F493440

General Info

Members Datasets Scaffolds Average Seq Length
1373 544 1276 444

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0000968|Ga0496123_0000968_38835_40331
Length 498
Sequence MWMRADARLVAALAGDHKPTMTETLVPQVETAPQKRLFIKTYGCQMNVYDSERMADVLRPLGYGVTDDVKAADFVILNTCHIREKAAEKIYSELGKLREMRDIRRETGGDLTIAVAGCVAQAEGEEIMRRQPAVDIVVGPQAYHQLPELLTRTARARGERIGADFAPDDKFDALPAARFTEGPTAFLTVQEGCDKFCTFCVVPYTRGAEWSRPMAAVLEEARQLTDRGVREVTLLGQNVNAYDGERPDGRKATLAELAYALAEIPGLDRIRYTTSHPNDMADELIAAHGDLDALMPYLHLPVQAGSDRILRAMNRKHGRQKYFDLIDRIRVARPDIAIAGDFIVGFPGETDREFEDTLDLVRRVNYAGAFAFAYSPRPGTPAAGMGKQVEPDVVKDRLHRLIALLTEQQTAFNAAQAGRTLNVLFDKPGRHGHRRQAIGRSPYLQSVHVDNADHLIGQIVPVEIIAGQQNSLSGRLIADGLNQPGPAGSAIAQAEKAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
5 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
6 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
7 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
8 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
9 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
10 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
11 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
12 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
13 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
14 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
15 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
16 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
17 2643221583 Caulobacter sp. Root655 Isolate Unclassified
18 2643221584 Caulobacter sp. Root656 Isolate Unclassified
19 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
20 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
21 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
22 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
23 2643221640 Caulobacter sp. Root342 Isolate Unclassified
24 2643221642 Caulobacter sp. Root343 Isolate Unclassified
25 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
26 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
27 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
28 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
29 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
30 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
31 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
32 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
33 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
34 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
35 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
36 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
37 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
38 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
39 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
40 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
41 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
42 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
43 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
44 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
45 2818991435 Caulobacter henricii 536 Isolate Unclassified
46 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
47 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
48 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
49 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
50 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
51 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
52 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
53 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
54 2849560528 Caulobacter zeae 410 Isolate Unclassified
55 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
56 2851153111 Caulobacter radicis 736 Isolate Unclassified
57 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
58 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
59 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
60 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
61 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
62 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
63 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
64 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
65 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
66 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
67 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
68 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
69 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
70 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
71 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
72 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
73 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
74 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
75 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
76 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
77 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
78 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
79 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
80 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
81 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
82 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
83 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
84 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
85 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
86 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
87 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
88 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
89 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
90 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
91 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
92 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
93 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
94 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
95 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
96 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
97 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
98 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
99 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
100 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
101 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
102 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
103 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
104 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
105 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
106 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
107 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
108 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
109 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
110 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
111 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
112 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
113 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
114 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
115 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
116 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
117 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
118 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
119 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
120 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
121 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
122 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
123 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
124 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
125 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
126 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
127 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
128 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
129 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
130 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
131 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
132 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
133 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
134 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
137 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
138 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
139 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
140 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
143 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
144 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
145 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
146 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
147 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
148 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
149 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
150 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
151 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
152 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
153 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
154 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
166 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
167 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
168 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
169 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
170 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
171 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
172 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
173 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
174 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
175 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
176 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
177 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
178 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
179 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
180 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
181 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
182 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
183 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
184 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
185 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
206 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
207 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
208 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
209 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
210 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
211 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
212 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
213 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
214 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
215 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
216 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
217 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
218 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
219 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
220 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
229 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
231 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
234 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
284 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
285 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
289 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
290 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
291 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
292 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
293 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
294 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
295 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
296 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
297 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
298 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
299 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
300 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
301 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
302 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
303 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
306 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
307 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
310 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
311 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
312 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
313 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
314 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
315 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
316 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
317 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
318 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
319 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
320 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
321 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
322 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
327 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
328 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
329 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
330 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
333 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
334 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
335 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
336 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
337 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
339 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
340 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
341 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
342 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
343 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
344 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
345 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
346 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
347 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
348 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
349 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
352 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
353 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
356 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
361 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
364 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
367 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
368 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
376 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
377 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
378 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
379 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
380 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
384 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
385 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
386 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
387 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
392 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
399 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
403 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
404 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
405 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
418 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
419 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
420 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
424 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
425 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
426 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
439 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
440 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
441 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
442 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
443 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
458 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
459 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
460 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
461 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
462 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
463 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
464 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
465 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
466 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
467 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
468 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
469 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
470 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
471 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
472 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
473 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
477 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
478 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
479 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
480 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
481 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
482 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
483 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
487 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
488 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
489 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
490 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
491 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
492 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
493 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
494 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
495 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
496 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
497 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
498 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
499 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
500 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
501 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
502 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
503 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
504 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
505 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
506 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
507 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
508 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
509 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
510 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
511 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
512 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
513 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
514 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
515 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
516 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
517 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
518 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
519 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
520 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
521 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
522 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
523 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
526 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
527 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
528 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
529 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
530 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
535 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
536 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
537 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
538 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
539 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
540 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
541 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
542 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
543 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
544 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 0
Isolates 7.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 16.1
Nodule 0.07
Rhizoplane 3.5
Rhizosphere 69.12
Stem 0
Stem Tuber 0.07
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1584582 2162886007 Bacteria 10355
2 JGI24741J21665_1000993 3300001915 Bacteria 8532
3 JGI24741J21665_1003085 3300001915 Bacteria 4096
4 JGI24752J21851_1005100 3300001976 Bacteria 1718
5 JGI24740J21852_10004068 3300001979 Bacteria 6327
6 JGI24739J22299_10004442 3300001989 Bacteria 5376
7 JGI24737J22298_10000247 3300001990 Bacteria 17946
8 JGI24737J22298_10003963 3300001990 Bacteria 5185
9 JGI24735J21928_10002583 3300002067 Bacteria 6263
10 JGI24751J29686_10000118 3300002459 Bacteria 41570
11 JGI25150J39212_1000177 3300002774 Bacteria 35741
12 JGI25159J45721_1003172 3300002987 Bacteria 5903
13 JGI25151J46595_10000335 3300003187 Bacteria 50415
14 JGI25151J46595_10029424 3300003187 Bacteria 2175
15 JGI25165J46597_1000208 3300003214 Bacteria 84386
16 JGI25153J46596_10000152 3300003215 Bacteria 70039
17 JGI25153J46596_10000153 3300003215 Bacteria 69588
18 Ga0055542_1000132 3300003762 Bacteria 96749
19 Ga0055529_1000088 3300003763 Bacteria 139031
20 Ga0055537_1002000 3300003773 Bacteria 7251
21 Ga0055537_1003620 3300003773 Bacteria 4692
22 Ga0055524_1000172 3300003775 Bacteria 73986
23 Ga0055536_1000781 3300003781 Bacteria 21243
24 Ga0055536_1005313 3300003781 Bacteria 6332
25 Ga0055536_1010902 3300003781 Bacteria 3547
26 Ga0055536_1017767 3300003781 Bacteria 2312
27 Ga0055530_10000465 3300003791 Bacteria 35593
28 Ga0055530_10000586 3300003791 Bacteria 31506
29 Ga0055530_10001358 3300003791 Bacteria 18146
30 Ga0055530_10012502 3300003791 Bacteria 2955
31 Ga0055540_1002368 3300003792 Bacteria 10076
32 Ga0055531_10001005 3300003794 Bacteria 22405
33 Ga0055531_10003722 3300003794 Bacteria 9587
34 Ga0055531_10005543 3300003794 Bacteria 7367
35 Ga0055531_10007465 3300003794 Bacteria 5960
36 Ga0065165_1000345 3300005262 Bacteria 76072
37 Ga0065165_1000941 3300005262 Bacteria 37145
38 Ga0065165_1016452 3300005262 Bacteria 2768
39 Ga0065704_10000204 3300005289 Bacteria 211587
40 Ga0065704_10125067 3300005289 Bacteria 1709
41 Ga0065707_10081814 3300005295 Bacteria 36963
42 Ga0070658_10000086 3300005327 Bacteria 86563
43 Ga0070658_10001217 3300005327 Bacteria 22089
44 Ga0070658_10002923 3300005327 Bacteria 14159
45 Ga0070658_10012645 3300005327 Bacteria 6770
46 Ga0070658_10015022 3300005327 Bacteria 6198
47 Ga0070658_10032050 3300005327 Bacteria 4225
48 Ga0070658_10056113 3300005327 Bacteria 3201
49 Ga0070658_10101106 3300005327 Bacteria 2383
50 Ga0070676_10110783 3300005328 Bacteria 1709
51 Ga0070683_100059652 3300005329 Bacteria 3545
52 Ga0070670_100000004 3300005331 Bacteria 392110
53 Ga0070670_100007458 3300005331 Bacteria 9289
54 Ga0070670_100030976 3300005331 Bacteria 4607
55 Ga0070670_100071668 3300005331 Bacteria 2975
56 Ga0070670_100162912 3300005331 Bacteria 1933
57 Ga0070677_10000283 3300005333 Bacteria 17774
58 Ga0070677_10019501 3300005333 Bacteria 2457
59 Ga0070666_10000408 3300005335 Bacteria 26751
60 Ga0070666_10011967 3300005335 Bacteria 5461
61 Ga0070680_100000705 3300005336 Bacteria 23175
62 Ga0070680_100026681 3300005336 Bacteria 4619
63 Ga0070680_100147050 3300005336 Bacteria 1977
64 Ga0070682_100006966 3300005337 Bacteria 6358
65 Ga0070682_100046621 3300005337 Bacteria 2691
66 Ga0068868_100000021 3300005338 Bacteria 89090
67 Ga0068868_100001497 3300005338 Bacteria 16125
68 Ga0070660_100000197 3300005339 Bacteria 40265
69 Ga0070660_100004476 3300005339 Bacteria 9659
70 Ga0070691_10001596 3300005341 Bacteria 9801
71 Ga0070691_10006308 3300005341 Bacteria 5420
72 Ga0070691_10007427 3300005341 Bacteria 5021
73 Ga0070691_10018081 3300005341 Bacteria 3246
74 Ga0070661_100004099 3300005344 Bacteria 10045
75 Ga0070661_100006006 3300005344 Bacteria 8359
76 Ga0070661_100023224 3300005344 Bacteria 4444
77 Ga0070661_100105134 3300005344 Bacteria 2104
78 Ga0070668_100000120 3300005347 Bacteria 48270
79 Ga0070668_100000618 3300005347 Bacteria 23868
80 Ga0070668_100002111 3300005347 Bacteria 14547
81 Ga0070668_100009939 3300005347 Bacteria 7048
82 Ga0070668_100013147 3300005347 Bacteria 6171
83 Ga0070668_100028298 3300005347 Bacteria 4255
84 Ga0070668_100058973 3300005347 Bacteria 2971
85 Ga0070669_100000109 3300005353 Bacteria 80041
86 Ga0070669_100000620 3300005353 Bacteria 26234
87 Ga0070669_100003318 3300005353 Bacteria 11566
88 Ga0070669_100044858 3300005353 Bacteria 3221
89 Ga0070669_100072327 3300005353 Bacteria 2553
90 Ga0070669_100086365 3300005353 Bacteria 2344
91 Ga0070671_100000020 3300005355 Bacteria 127483
92 Ga0070671_100000062 3300005355 Bacteria 73417
93 Ga0070671_100004972 3300005355 Bacteria 10584
94 Ga0070671_100009247 3300005355 Bacteria 7917
95 Ga0070671_100068538 3300005355 Bacteria 2959
96 Ga0070671_100104541 3300005355 Bacteria 2376
97 Ga0070671_100203484 3300005355 Bacteria 1679
98 Ga0070674_100039375 3300005356 Bacteria 3191
99 Ga0070674_100070701 3300005356 Bacteria 2466
100 Ga0070674_100140603 3300005356 Bacteria 1811
101 Ga0070659_100000027 3300005366 Bacteria 143469
102 Ga0070659_100001161 3300005366 Bacteria 19244
103 Ga0070659_100006138 3300005366 Bacteria 8674
104 Ga0070659_100022474 3300005366 Bacteria 4816
105 Ga0070659_100027632 3300005366 Bacteria 4374
106 Ga0070659_100075209 3300005366 Bacteria 2692
107 Ga0070659_100226012 3300005366 Bacteria 1546
108 Ga0070667_100000067 3300005367 Bacteria 133023
109 Ga0070667_100000175 3300005367 Bacteria 79433
110 Ga0070667_100001088 3300005367 Bacteria 24888
111 Ga0070667_100004571 3300005367 Bacteria 11626
112 Ga0070667_100005409 3300005367 Bacteria 10666
113 Ga0070667_100006391 3300005367 Bacteria 9793
114 Ga0070667_100103915 3300005367 Bacteria 2456
115 Ga0070703_10004937 3300005406 Bacteria 3722
116 Ga0070714_100000769 3300005435 Bacteria 22715
117 Ga0070705_100001889 3300005440 Bacteria 10771
118 Ga0070700_100008602 3300005441 Bacteria 5561
119 Ga0070694_100107816 3300005444 Bacteria 1980
120 Ga0070663_100009949 3300005455 Bacteria 5911
121 Ga0070663_100014296 3300005455 Bacteria 5092
122 Ga0070663_100015593 3300005455 Bacteria 4911
123 Ga0070663_100106107 3300005455 Bacteria 2104
124 Ga0070678_100001098 3300005456 Bacteria 14179
125 Ga0070662_100010012 3300005457 Bacteria 6208
126 Ga0070662_100010097 3300005457 Bacteria 6185
127 Ga0070662_100014743 3300005457 Bacteria 5223
128 Ga0070662_100036012 3300005457 Bacteria 3498
129 Ga0070662_100088175 3300005457 Bacteria 2325
130 Ga0070681_10017384 3300005458 Bacteria 7187
131 Ga0070681_10019769 3300005458 Bacteria 6744
132 Ga0070681_10053345 3300005458 Bacteria 4029
133 Ga0068867_100069552 3300005459 Bacteria 2629
134 Ga0070699_100015869 3300005518 Bacteria 6466
135 Ga0070679_100002011 3300005530 Bacteria 18247
136 Ga0070679_100028982 3300005530 Bacteria 5461
137 Ga0070679_100043339 3300005530 Bacteria 4482
138 Ga0070679_100110214 3300005530 Bacteria 2739
139 Ga0070697_100047807 3300005536 Bacteria 3469
140 Ga0068853_100007497 3300005539 Bacteria 8732
141 Ga0068853_100018732 3300005539 Bacteria 5734
142 Ga0068853_100025509 3300005539 Bacteria 4961
143 Ga0068853_100154613 3300005539 Bacteria 2066
144 Ga0068853_100161110 3300005539 Bacteria 2025
145 Ga0070672_100124643 3300005543 Bacteria 2112
146 Ga0070672_100125677 3300005543 Bacteria 2103
147 Ga0070686_100000152 3300005544 Bacteria 47696
148 Ga0070695_100008458 3300005545 Bacteria 6105
149 Ga0070696_100000340 3300005546 Bacteria 28341
150 Ga0070696_100081819 3300005546 Bacteria 2288
151 Ga0070693_100008209 3300005547 Bacteria 5134
152 Ga0070693_100092286 3300005547 Bacteria 1828
153 Ga0070665_100000115 3300005548 Bacteria 151164
154 Ga0070665_100000198 3300005548 Bacteria 105999
155 Ga0070665_100000878 3300005548 Bacteria 38691
156 Ga0070665_100002021 3300005548 Bacteria 22808
157 Ga0070665_100025272 3300005548 Bacteria 5984
158 Ga0070665_100032162 3300005548 Bacteria 5280
159 Ga0070665_100039869 3300005548 Bacteria 4722
160 Ga0070665_100143749 3300005548 Bacteria 2389
161 Ga0070704_100002065 3300005549 Bacteria 11148
162 Ga0068855_100002675 3300005563 Bacteria 21961
163 Ga0068855_100009847 3300005563 Bacteria 11528
164 Ga0068855_100014465 3300005563 Bacteria 9502
165 Ga0068855_100020437 3300005563 Bacteria 7940
166 Ga0068855_100036162 3300005563 Bacteria 5880
167 Ga0068855_100042440 3300005563 Bacteria 5389
168 Ga0068855_100060501 3300005563 Bacteria 4429
169 Ga0068855_100066161 3300005563 Bacteria 4214
170 Ga0068855_100138126 3300005563 Bacteria 2780
171 Ga0070664_100000464 3300005564 Bacteria 30816
172 Ga0070664_100018223 3300005564 Bacteria 5762
173 Ga0070664_100021127 3300005564 Bacteria 5362
174 Ga0070664_100250907 3300005564 Bacteria 1591
175 Ga0068857_100016189 3300005577 Bacteria 6531
176 Ga0068857_100053945 3300005577 Bacteria 3566
177 Ga0068854_100002421 3300005578 Bacteria 11519
178 Ga0068856_100017510 3300005614 Bacteria 6942
179 Ga0068852_100000142 3300005616 Bacteria 48221
180 Ga0068852_100000824 3300005616 Bacteria 20475
181 Ga0068859_100000452 3300005617 Bacteria 40834
182 Ga0068859_100001068 3300005617 Bacteria 28047
183 Ga0068859_100006366 3300005617 Bacteria 11975
184 Ga0068859_100032062 3300005617 Bacteria 5278
185 Ga0068859_100034727 3300005617 Bacteria 5060
186 Ga0068859_100087061 3300005617 Bacteria 3171
187 Ga0068864_100000058 3300005618 Bacteria 125688
188 Ga0068864_100000082 3300005618 Bacteria 101182
189 Ga0068864_100000928 3300005618 Bacteria 24614
190 Ga0068864_100007684 3300005618 Bacteria 8882
191 Ga0068864_100054564 3300005618 Bacteria 3449
192 Ga0068864_100077377 3300005618 Bacteria 2909
193 Ga0068864_100254682 3300005618 Bacteria 1631
194 Ga0068861_100001980 3300005719 Bacteria 13225
195 Ga0068863_100000038 3300005841 Bacteria 161477
196 Ga0068863_100000175 3300005841 Bacteria 67772
197 Ga0068863_100000597 3300005841 Bacteria 36664
198 Ga0068863_100004185 3300005841 Bacteria 14245
199 Ga0068863_100010685 3300005841 Bacteria 8915
200 Ga0068863_100011189 3300005841 Bacteria 8694
201 Ga0068863_100041278 3300005841 Bacteria 4386
202 Ga0068863_100131813 3300005841 Bacteria 2386
203 Ga0068858_100000006 3300005842 Bacteria 256011
204 Ga0068858_100000137 3300005842 Bacteria 77050
205 Ga0068858_100001141 3300005842 Bacteria 27483
206 Ga0068858_100008659 3300005842 Bacteria 9770
207 Ga0068858_100031945 3300005842 Bacteria 4891
208 Ga0068858_100054189 3300005842 Bacteria 3708
209 Ga0068858_100131951 3300005842 Bacteria 2343
210 Ga0068858_100195628 3300005842 Bacteria 1911
211 Ga0068860_100000077 3300005843 Bacteria 171297
212 Ga0068860_100002654 3300005843 Bacteria 18612
213 Ga0068860_100002711 3300005843 Bacteria 18421
214 Ga0068860_100008925 3300005843 Bacteria 9990
215 Ga0068860_100013711 3300005843 Bacteria 7948
216 Ga0068860_100014606 3300005843 Bacteria 7684
217 Ga0068860_100019195 3300005843 Bacteria 6636
218 Ga0068860_100021477 3300005843 Bacteria 6250
219 Ga0068860_100024619 3300005843 Bacteria 5813
220 Ga0068860_100041470 3300005843 Bacteria 4396
221 Ga0068860_100082779 3300005843 Bacteria 3052
222 Ga0068862_100000183 3300005844 Bacteria 68758
223 Ga0068862_100001800 3300005844 Bacteria 19399
224 Ga0068862_100013372 3300005844 Bacteria 6791
225 Ga0068862_100014327 3300005844 Bacteria 6577
226 Ga0068862_100015404 3300005844 Bacteria 6351
227 Ga0068862_100031339 3300005844 Bacteria 4487
228 Ga0068862_100048727 3300005844 Bacteria 3618
229 Ga0068862_100120438 3300005844 Bacteria 2312
230 Ga0081455_10000041 3300005937 Bacteria 134032
231 Ga0081455_10000100 3300005937 Bacteria 95033
232 Ga0081540_1000091 3300005983 Bacteria 94664
233 Ga0081540_1002750 3300005983 Bacteria 14293
234 Ga0081540_1045461 3300005983 Bacteria 2229
235 Ga0081539_10024820 3300005985 Bacteria 3877
236 Ga0075368_10000517 3300006042 Bacteria 11528
237 Ga0075368_10007027 3300006042 Bacteria 3962
238 Ga0075368_10011642 3300006042 Bacteria 3203
239 Ga0075368_10015568 3300006042 Bacteria 2824
240 Ga0075363_100006499 3300006048 Bacteria 5317
241 Ga0075363_100061646 3300006048 Bacteria 2022
242 Ga0075363_100072464 3300006048 Bacteria 1873
243 Ga0075364_10001169 3300006051 Bacteria 14073
244 Ga0075364_10008317 3300006051 Bacteria 6195
245 Ga0075364_10017758 3300006051 Bacteria 4448
246 Ga0075432_10022132 3300006058 Bacteria 2173
247 Ga0070712_100167572 3300006175 Bacteria 1702
248 Ga0075362_10000119 3300006177 Bacteria 22052
249 Ga0075362_10027389 3300006177 Bacteria 2440
250 Ga0075362_10030269 3300006177 Bacteria 2337
251 Ga0075367_10002637 3300006178 Bacteria 8251
252 Ga0075367_10012363 3300006178 Bacteria 4549
253 Ga0075367_10017716 3300006178 Bacteria 3915
254 Ga0075367_10019406 3300006178 Bacteria 3768
255 Ga0075369_10001089 3300006186 Bacteria 9105
256 Ga0075369_10010903 3300006186 Bacteria 3562
257 Ga0075366_10000014 3300006195 Bacteria 66940
258 Ga0075366_10015605 3300006195 Bacteria 4358
259 Ga0075366_10022279 3300006195 Bacteria 3684
260 Ga0075366_10034698 3300006195 Bacteria 2972
261 Ga0075370_10000141 3300006353 Bacteria 24359
262 Ga0075370_10002146 3300006353 Bacteria 9020
263 Ga0075431_100001098 3300006847 Bacteria 24239
264 Ga0075431_100002734 3300006847 Bacteria 17104
265 Ga0075431_100006959 3300006847 Bacteria 11248
266 Ga0075429_100038809 3300006880 Bacteria 4146
267 Ga0068865_100000389 3300006881 Bacteria 24391
268 Ga0097620_100000452 3300006931 Bacteria 40834
269 Ga0097620_100001068 3300006931 Bacteria 28047
270 Ga0097620_100006366 3300006931 Bacteria 11975
271 Ga0097620_100032062 3300006931 Bacteria 5278
272 Ga0097620_100034728 3300006931 Bacteria 5060
273 Ga0097620_100087064 3300006931 Bacteria 3171
274 Ga0105251_10018337 3300009011 Bacteria 3724
275 Ga0105250_10007702 3300009092 Bacteria 4616
276 Ga0105240_10003577 3300009093 Bacteria 24115
277 Ga0105240_10004776 3300009093 Bacteria 20437
278 Ga0105240_10031721 3300009093 Bacteria 6847
279 Ga0105240_10089281 3300009093 Bacteria 3770
280 Ga0105240_10113959 3300009093 Bacteria 3266
281 Ga0105240_10122781 3300009093 Bacteria 3125
282 Ga0105240_10201908 3300009093 Bacteria 2329
283 Ga0111539_10033514 3300009094 Bacteria 6236
284 Ga0105245_10016411 3300009098 Bacteria 6459
285 Ga0105245_10028937 3300009098 Bacteria 4891
286 Ga0105245_10084495 3300009098 Bacteria 2908
287 Ga0114129_10053884 3300009147 Bacteria 5641
288 Ga0105243_10000091 3300009148 Bacteria 102081
289 Ga0105243_10017595 3300009148 Bacteria 5405
290 Ga0105243_10029432 3300009148 Bacteria 4223
291 Ga0105241_10003044 3300009174 Bacteria 12509
292 Ga0105248_10000170 3300009177 Bacteria 75642
293 Ga0105248_10000400 3300009177 Bacteria 50262
294 Ga0105248_10004550 3300009177 Bacteria 15348
295 Ga0105248_10006314 3300009177 Bacteria 13004
296 Ga0105248_10012717 3300009177 Bacteria 9286
297 Ga0105248_10036168 3300009177 Bacteria 5523
298 Ga0105248_10039321 3300009177 Bacteria 5297
299 Ga0105248_10055686 3300009177 Bacteria 4437
300 Ga0105248_10087489 3300009177 Bacteria 3506
301 Ga0105237_10056680 3300009545 Bacteria 3921
302 Ga0105237_10087184 3300009545 Bacteria 3111
303 Ga0105237_10190630 3300009545 Bacteria 2050
304 Ga0105238_10017709 3300009551 Bacteria 7243
305 Ga0105238_10035809 3300009551 Bacteria 5045
306 Ga0105238_10227325 3300009551 Bacteria 1842
307 Ga0105238_10264668 3300009551 Bacteria 1699
308 Ga0105249_10000438 3300009553 Bacteria 39201
309 Ga0105249_10001111 3300009553 Bacteria 23909
310 Ga0105249_10025304 3300009553 Bacteria 5341
311 Ga0105246_10000589 3300011119 Bacteria 20145
312 Ga0105246_10009669 3300011119 Bacteria 5943
313 Ga0157326_1003496 3300012513 Bacteria 1650
314 Ga0157373_10001577 3300013100 Bacteria 17397
315 Ga0157373_10001686 3300013100 Bacteria 16857
316 Ga0157373_10002751 3300013100 Bacteria 13318
317 Ga0157373_10096330 3300013100 Bacteria 2083
318 Ga0157371_10000048 3300013102 Bacteria 184015
319 Ga0157371_10006522 3300013102 Bacteria 9603
320 Ga0157371_10023869 3300013102 Bacteria 4469
321 Ga0157371_10024127 3300013102 Bacteria 4443
322 Ga0157370_10000760 3300013104 Bacteria 40285
323 Ga0157370_10019472 3300013104 Bacteria 6807
324 Ga0157370_10190102 3300013104 Bacteria 1906
325 Ga0157369_10013459 3300013105 Bacteria 9246
326 Ga0157369_10071265 3300013105 Bacteria 3731
327 Ga0157369_10103340 3300013105 Bacteria 3035
328 Ga0157378_10112497 3300013297 Bacteria 2497
329 Ga0163162_10012113 3300013306 Bacteria 8416
330 Ga0163162_10022236 3300013306 Bacteria 6250
331 Ga0163162_10117051 3300013306 Bacteria 2766
332 Ga0157372_10069250 3300013307 Bacteria 3968
333 Ga0157372_10228772 3300013307 Bacteria 2156
334 Ga0157372_10251746 3300013307 Bacteria 2050
335 Ga0163163_10011090 3300014325 Bacteria 8157
336 Ga0157380_10000062 3300014326 Bacteria 61714
337 Ga0157380_10006274 3300014326 Bacteria 8346
338 Ga0157380_10051725 3300014326 Bacteria 3250
339 Ga0157380_10082902 3300014326 Bacteria 2626
340 Ga0157379_10005111 3300014968 Bacteria 11250
341 Ga0157379_10011135 3300014968 Bacteria 7840
342 Ga0157379_10022602 3300014968 Bacteria 5571
343 Ga0157376_10275782 3300014969 Bacteria 1581
344 Ga0183365_10001 3300015684 Bacteria 2090444
345 Ga0183363_1001 3300015690 Bacteria 611534
346 Ga0163161_10037310 3300017792 Bacteria 3484
347 Ga0213876_10000145 3300021384 Bacteria 76883
348 Ga0213876_10000522 3300021384 Bacteria 29437
349 Ga0213876_10000537 3300021384 Bacteria 28569
350 Ga0213876_10088540 3300021384 Bacteria 1639
351 Ga0213875_10000101 3300021388 Bacteria 96957
352 Ga0207425_1000019 3300025245 Bacteria 399942
353 Ga0209646_1004657 3300025246 Bacteria 2474
354 Ga0209026_1002551 3300025250 Bacteria 6729
355 Ga0209026_1009856 3300025250 Bacteria 1834
356 Ga0209148_1000017 3300025254 Bacteria 787064
357 Ga0209233_1000186 3300025261 Bacteria 133572
358 Ga0209565_1000007 3300025263 Bacteria 784361
359 Ga0209565_1000089 3300025263 Bacteria 150511
360 Ga0209565_1000172 3300025263 Bacteria 84264
361 Ga0209455_1000005 3300025272 Bacteria 1416756
362 Ga0209673_1000796 3300025273 Bacteria 42005
363 Ga0209130_1000616 3300025284 Bacteria 34066
364 Ga0209675_1000384 3300025291 Bacteria 36771
365 Ga0209676_1000140 3300025292 Bacteria 176735
366 Ga0209676_1000257 3300025292 Bacteria 112662
367 Ga0209676_1000316 3300025292 Bacteria 94380
368 Ga0209676_1000421 3300025292 Bacteria 74706
369 Ga0209676_1000693 3300025292 Bacteria 47361
370 Ga0209676_1001736 3300025292 Bacteria 18672
371 Ga0209025_1000179 3300025294 Bacteria 157965
372 Ga0209025_1000304 3300025294 Bacteria 109508
373 Ga0209564_1002843 3300025295 Bacteria 12745
374 Ga0209564_1007077 3300025295 Bacteria 5873
375 Ga0209564_1009726 3300025295 Bacteria 4527
376 Ga0209758_1000019 3300025297 Bacteria 743682
377 Ga0209758_1000035 3300025297 Bacteria 448190
378 Ga0209758_1002605 3300025297 Bacteria 18041
379 Ga0209758_1005251 3300025297 Bacteria 10137
380 Ga0209050_1000001 3300025298 Bacteria 3563507
381 Ga0209050_1000010 3300025298 Bacteria 980454
382 Ga0209050_1000053 3300025298 Bacteria 349521
383 Ga0209050_1000112 3300025298 Bacteria 210320
384 Ga0209050_1000254 3300025298 Bacteria 114395
385 Ga0209050_1000604 3300025298 Bacteria 57101
386 Ga0209050_1001180 3300025298 Bacteria 30808
387 Ga0209050_1006747 3300025298 Bacteria 6698
388 Ga0209050_1010143 3300025298 Bacteria 4688
389 Ga0209050_1017409 3300025298 Bacteria 2868
390 Ga0209256_1000008 3300025299 Bacteria 975723
391 Ga0207426_1000191 3300025302 Bacteria 151850
392 Ga0207426_1013452 3300025302 Bacteria 3032
393 Ga0209051_1000309 3300025303 Bacteria 76449
394 Ga0209051_1007732 3300025303 Bacteria 5826
395 Ga0209257_1000027 3300025304 Bacteria 703541
396 Ga0209257_1000192 3300025304 Bacteria 151851
397 Ga0209257_1000289 3300025304 Bacteria 110882
398 Ga0209257_1000600 3300025304 Bacteria 59824
399 Ga0209257_1000630 3300025304 Bacteria 56658
400 Ga0209257_1000877 3300025304 Bacteria 42562
401 Ga0209257_1001191 3300025304 Bacteria 32721
402 Ga0209257_1001221 3300025304 Bacteria 32172
403 Ga0209257_1001776 3300025304 Bacteria 23847
404 Ga0209257_1001845 3300025304 Bacteria 23059
405 Ga0209257_1003844 3300025304 Bacteria 12300
406 Ga0209257_1005979 3300025304 Bacteria 8159
407 Ga0207697_10000375 3300025315 Bacteria 25016
408 Ga0207653_10006282 3300025885 Bacteria 3706
409 Ga0207682_10000506 3300025893 Bacteria 17914
410 Ga0207682_10014983 3300025893 Bacteria 3019
411 Ga0207710_10005667 3300025900 Bacteria 5374
412 Ga0207680_10002355 3300025903 Bacteria 8788
413 Ga0207647_10052545 3300025904 Bacteria 2515
414 Ga0207705_10000002 3300025909 Bacteria 2046852
415 Ga0207705_10000058 3300025909 Bacteria 155967
416 Ga0207705_10000621 3300025909 Bacteria 29636
417 Ga0207705_10000665 3300025909 Bacteria 28572
418 Ga0207705_10003453 3300025909 Bacteria 12024
419 Ga0207654_10001839 3300025911 Bacteria 11000
420 Ga0207707_10005208 3300025912 Bacteria 11395
421 Ga0207695_10002758 3300025913 Bacteria 25593
422 Ga0207695_10003649 3300025913 Bacteria 21496
423 Ga0207695_10011589 3300025913 Bacteria 10662
424 Ga0207695_10011899 3300025913 Bacteria 10484
425 Ga0207695_10024402 3300025913 Bacteria 6807
426 Ga0207695_10027405 3300025913 Bacteria 6345
427 Ga0207695_10032586 3300025913 Bacteria 5700
428 Ga0207695_10036878 3300025913 Bacteria 5280
429 Ga0207695_10077943 3300025913 Bacteria 3364
430 Ga0207671_10004168 3300025914 Bacteria 13975
431 Ga0207671_10013737 3300025914 Bacteria 6430
432 Ga0207671_10028484 3300025914 Bacteria 4173
433 Ga0207671_10040107 3300025914 Bacteria 3466
434 Ga0207671_10078027 3300025914 Bacteria 2480
435 Ga0207660_10015333 3300025917 Bacteria 5055
436 Ga0207660_10034110 3300025917 Bacteria 3525
437 Ga0207657_10001791 3300025919 Bacteria 23171
438 Ga0207657_10002881 3300025919 Bacteria 18486
439 Ga0207657_10003546 3300025919 Bacteria 16677
440 Ga0207657_10004751 3300025919 Bacteria 14343
441 Ga0207657_10027824 3300025919 Bacteria 5171
442 Ga0207657_10033675 3300025919 Bacteria 4615
443 Ga0207657_10041820 3300025919 Bacteria 4049
444 Ga0207657_10081160 3300025919 Bacteria 2725
445 Ga0207649_10006776 3300025920 Bacteria 6223
446 Ga0207649_10138089 3300025920 Bacteria 1664
447 Ga0207652_10001178 3300025921 Bacteria 23512
448 Ga0207652_10003184 3300025921 Bacteria 13638
449 Ga0207652_10004969 3300025921 Bacteria 10765
450 Ga0207652_10097333 3300025921 Bacteria 2593
451 Ga0207681_10000042 3300025923 Bacteria 137167
452 Ga0207681_10000558 3300025923 Bacteria 25541
453 Ga0207681_10009243 3300025923 Bacteria 6022
454 Ga0207681_10012409 3300025923 Bacteria 5258
455 Ga0207681_10028244 3300025923 Bacteria 3633
456 Ga0207681_10096745 3300025923 Bacteria 2120
457 Ga0207694_10004292 3300025924 Bacteria 11153
458 Ga0207694_10054264 3300025924 Bacteria 3109
459 Ga0207694_10149972 3300025924 Bacteria 1878
460 Ga0207650_10000118 3300025925 Bacteria 104112
461 Ga0207650_10030302 3300025925 Bacteria 3896
462 Ga0207650_10054091 3300025925 Bacteria 2976
463 Ga0207650_10058633 3300025925 Bacteria 2867
464 Ga0207687_10014749 3300025927 Bacteria 5117
465 Ga0207687_10017758 3300025927 Bacteria 4690
466 Ga0207687_10153690 3300025927 Bacteria 1758
467 Ga0207664_10001066 3300025929 Bacteria 18289
468 Ga0207644_10000005 3300025931 Bacteria 441948
469 Ga0207644_10000034 3300025931 Bacteria 132239
470 Ga0207644_10000328 3300025931 Bacteria 30816
471 Ga0207644_10002034 3300025931 Bacteria 13085
472 Ga0207644_10043243 3300025931 Bacteria 3196
473 Ga0207644_10072594 3300025931 Bacteria 2521
474 Ga0207644_10107790 3300025931 Bacteria 2102
475 Ga0207644_10120201 3300025931 Bacteria 1999
476 Ga0207690_10000142 3300025932 Bacteria 57187
477 Ga0207690_10000161 3300025932 Bacteria 52622
478 Ga0207690_10003702 3300025932 Bacteria 9098
479 Ga0207706_10004879 3300025933 Bacteria 12546
480 Ga0207706_10010885 3300025933 Bacteria 8299
481 Ga0207706_10011982 3300025933 Bacteria 7899
482 Ga0207706_10027411 3300025933 Bacteria 5093
483 Ga0207706_10039609 3300025933 Bacteria 4178
484 Ga0207709_10000018 3300025935 Bacteria 431545
485 Ga0207669_10000055 3300025937 Bacteria 56749
486 Ga0207669_10000311 3300025937 Bacteria 22231
487 Ga0207669_10028512 3300025937 Bacteria 3073
488 Ga0207704_10001695 3300025938 Bacteria 9871
489 Ga0207691_10099108 3300025940 Bacteria 2602
490 Ga0207691_10104930 3300025940 Bacteria 2518
491 Ga0207711_10000374 3300025941 Bacteria 47567
492 Ga0207711_10001625 3300025941 Bacteria 20737
493 Ga0207711_10012677 3300025941 Bacteria 7003
494 Ga0207711_10020668 3300025941 Bacteria 5493
495 Ga0207711_10024234 3300025941 Bacteria 5079
496 Ga0207711_10031965 3300025941 Bacteria 4447
497 Ga0207711_10046761 3300025941 Bacteria 3698
498 Ga0207711_10063192 3300025941 Bacteria 3195
499 Ga0207661_10073728 3300025944 Bacteria 2797
500 Ga0207679_10002863 3300025945 Bacteria 10700
501 Ga0207679_10031822 3300025945 Bacteria 3696
502 Ga0207679_10053471 3300025945 Bacteria 2968
503 Ga0207667_10000004 3300025949 Bacteria 737718
504 Ga0207667_10002049 3300025949 Bacteria 25269
505 Ga0207667_10012946 3300025949 Bacteria 9578
506 Ga0207667_10018370 3300025949 Bacteria 7843
507 Ga0207667_10030277 3300025949 Bacteria 5857
508 Ga0207667_10030986 3300025949 Bacteria 5779
509 Ga0207667_10042335 3300025949 Bacteria 4841
510 Ga0207667_10047053 3300025949 Bacteria 4567
511 Ga0207667_10151577 3300025949 Bacteria 2386
512 Ga0207667_10273244 3300025949 Bacteria 1727
513 Ga0207712_10002229 3300025961 Bacteria 12612
514 Ga0207712_10022800 3300025961 Bacteria 4126
515 Ga0207668_10000004 3300025972 Bacteria 201204
516 Ga0207668_10000464 3300025972 Bacteria 25530
517 Ga0207668_10000668 3300025972 Bacteria 21067
518 Ga0207668_10002103 3300025972 Bacteria 11616
519 Ga0207668_10004014 3300025972 Bacteria 8669
520 Ga0207668_10021931 3300025972 Bacteria 4079
521 Ga0207640_10006960 3300025981 Bacteria 6221
522 Ga0207658_10000089 3300025986 Bacteria 100308
523 Ga0207658_10000229 3300025986 Bacteria 58984
524 Ga0207658_10001929 3300025986 Bacteria 15483
525 Ga0207658_10006621 3300025986 Bacteria 7892
526 Ga0207658_10029009 3300025986 Bacteria 3902
527 Ga0207677_10000036 3300026023 Bacteria 115815
528 Ga0207677_10003316 3300026023 Bacteria 8519
529 Ga0207703_10000027 3300026035 Bacteria 209608
530 Ga0207703_10000330 3300026035 Bacteria 51662
531 Ga0207703_10008806 3300026035 Bacteria 7958
532 Ga0207703_10016909 3300026035 Bacteria 5690
533 Ga0207639_10004425 3300026041 Bacteria 9482
534 Ga0207639_10005317 3300026041 Bacteria 8695
535 Ga0207639_10011991 3300026041 Bacteria 6030
536 Ga0207639_10040179 3300026041 Bacteria 3490
537 Ga0207639_10047490 3300026041 Bacteria 3245
538 Ga0207639_10139878 3300026041 Bacteria 2015
539 Ga0207639_10183816 3300026041 Bacteria 1780
540 Ga0207639_10191144 3300026041 Bacteria 1749
541 Ga0207678_10000503 3300026067 Bacteria 35476
542 Ga0207678_10009031 3300026067 Bacteria 8775
543 Ga0207678_10019581 3300026067 Bacteria 5949
544 Ga0207678_10066353 3300026067 Bacteria 3099
545 Ga0207678_10131918 3300026067 Bacteria 2132
546 Ga0207708_10000470 3300026075 Bacteria 31135
547 Ga0207702_10014676 3300026078 Bacteria 6501
548 Ga0207702_10188046 3300026078 Bacteria 1906
549 Ga0207641_10000003 3300026088 Bacteria 496984
550 Ga0207641_10000060 3300026088 Bacteria 161514
551 Ga0207641_10000243 3300026088 Bacteria 70600
552 Ga0207641_10001900 3300026088 Bacteria 20061
553 Ga0207641_10005156 3300026088 Bacteria 11180
554 Ga0207641_10005247 3300026088 Bacteria 11076
555 Ga0207641_10011979 3300026088 Bacteria 7114
556 Ga0207641_10021125 3300026088 Bacteria 5350
557 Ga0207641_10047698 3300026088 Bacteria 3613
558 Ga0207641_10061514 3300026088 Bacteria 3202
559 Ga0207676_10000068 3300026095 Bacteria 104705
560 Ga0207676_10000087 3300026095 Bacteria 85293
561 Ga0207676_10003035 3300026095 Bacteria 11983
562 Ga0207676_10003136 3300026095 Bacteria 11798
563 Ga0207676_10026183 3300026095 Bacteria 4336
564 Ga0207676_10045603 3300026095 Bacteria 3388
565 Ga0207676_10045609 3300026095 Bacteria 3388
566 Ga0207676_10283934 3300026095 Bacteria 1504
567 Ga0207674_10002013 3300026116 Bacteria 25816
568 Ga0207674_10015660 3300026116 Bacteria 8325
569 Ga0207674_10032601 3300026116 Bacteria 5463
570 Ga0207674_10038271 3300026116 Bacteria 4981
571 Ga0207675_100000225 3300026118 Bacteria 53168
572 Ga0207675_100000666 3300026118 Bacteria 33780
573 Ga0207675_100069432 3300026118 Bacteria 3293
574 Ga0207675_100186138 3300026118 Bacteria 1990
575 Ga0207683_10007580 3300026121 Bacteria 9297
576 Ga0207698_10000005 3300026142 Bacteria 295687
577 Ga0207698_10011829 3300026142 Bacteria 5680
578 Ga0207698_10014031 3300026142 Bacteria 5309
579 Ga0209813_10000130 3300027866 Bacteria 27121
580 Ga0209813_10003413 3300027866 Bacteria 3717
581 Ga0207428_10061903 3300027907 Bacteria 2961
582 Ga0207428_10187210 3300027907 Bacteria 1561
583 Ga0268266_10000003 3300028379 Bacteria 1701703
584 Ga0268266_10000015 3300028379 Bacteria 630629
585 Ga0268266_10000800 3300028379 Bacteria 41757
586 Ga0268266_10001045 3300028379 Bacteria 34723
587 Ga0268266_10017802 3300028379 Bacteria 6056
588 Ga0268266_10019517 3300028379 Bacteria 5776
589 Ga0268266_10027675 3300028379 Bacteria 4820
590 Ga0268266_10046135 3300028379 Bacteria 3731
591 Ga0268265_10000043 3300028380 Bacteria 186081
592 Ga0268265_10000500 3300028380 Bacteria 40586
593 Ga0268265_10001504 3300028380 Bacteria 19451
594 Ga0268265_10030171 3300028380 Bacteria 3901
595 Ga0268265_10080763 3300028380 Bacteria 2565
596 Ga0268265_10181559 3300028380 Bacteria 1808
597 Ga0268264_10000032 3300028381 Bacteria 408337
598 Ga0268264_10000154 3300028381 Bacteria 156992
599 Ga0268264_10000253 3300028381 Bacteria 98587
600 Ga0268264_10003985 3300028381 Bacteria 12642
601 Ga0268264_10008542 3300028381 Bacteria 8513
602 Ga0268264_10009741 3300028381 Bacteria 7955
603 Ga0268264_10014571 3300028381 Bacteria 6458
604 Ga0268264_10040418 3300028381 Bacteria 3854
605 Ga0268264_10078942 3300028381 Bacteria 2807
606 Ga0268264_10083068 3300028381 Bacteria 2743
607 Ga0307517_10004144 3300028786 Bacteria 22364
608 Ga0307517_10016334 3300028786 Bacteria 9764
609 Ga0307517_10073535 3300028786 Bacteria 3028
610 Ga0307515_10040761 3300028794 Bacteria 7330
611 Ga0265338_10036951 3300028800 Bacteria 4660
612 Ga0265338_10107234 3300028800 Bacteria 2259
613 Ga0265325_10000888 3300031241 Bacteria 21577
614 Ga0265327_10000110 3300031251 Bacteria 181251
615 Ga0265327_10001598 3300031251 Bacteria 27550
616 Ga0265327_10005240 3300031251 Bacteria 10933
617 Ga0265316_10082109 3300031344 Bacteria 2470
618 Ga0307513_10000100 3300031456 Bacteria 125183
619 Ga0307513_10000649 3300031456 Bacteria 50063
620 Ga0307513_10004370 3300031456 Bacteria 18876
621 Ga0307513_10005039 3300031456 Bacteria 17496
622 Ga0307513_10015216 3300031456 Bacteria 9338
623 Ga0307513_10083368 3300031456 Bacteria 3288
624 Ga0307509_10165295 3300031507 Bacteria 2103
625 Ga0307408_100080500 3300031548 Bacteria 2433
626 Ga0307408_100245674 3300031548 Bacteria 1473
627 Ga0265313_10000395 3300031595 Bacteria 46824
628 Ga0307508_10012843 3300031616 Bacteria 7658
629 Ga0316579_10012348 3300031691 Bacteria 3653
630 Ga0265314_10002588 3300031711 Bacteria 18308
631 Ga0265314_10006363 3300031711 Bacteria 10475
632 Ga0265342_10043807 3300031712 Bacteria 2699
633 Ga0265342_10047984 3300031712 Bacteria 2561
634 Ga0316576_10107633 3300031727 Bacteria 2088
635 Ga0307405_10011232 3300031731 Bacteria 4682
636 Ga0307405_10014620 3300031731 Bacteria 4227
637 Ga0307405_10099603 3300031731 Bacteria 1945
638 Ga0307413_10000417 3300031824 Bacteria 13739
639 Ga0307413_10001468 3300031824 Bacteria 8960
640 Ga0307413_10005709 3300031824 Bacteria 5590
641 Ga0307413_10010862 3300031824 Bacteria 4442
642 Ga0307413_10014827 3300031824 Bacteria 3974
643 Ga0307413_10024791 3300031824 Bacteria 3276
644 Ga0307413_10029026 3300031824 Bacteria 3089
645 Ga0307413_10061166 3300031824 Bacteria 2322
646 Ga0307413_10111020 3300031824 Bacteria 1835
647 Ga0307413_10158372 3300031824 Bacteria 1587
648 Ga0307410_10003610 3300031852 Bacteria 7797
649 Ga0307410_10015739 3300031852 Bacteria 4494
650 Ga0307410_10016374 3300031852 Bacteria 4421
651 Ga0307410_10046002 3300031852 Bacteria 2909
652 Ga0307406_10020684 3300031901 Bacteria 3880
653 Ga0307407_10009898 3300031903 Bacteria 4465
654 Ga0307407_10061256 3300031903 Bacteria 2199
655 Ga0307412_10000805 3300031911 Bacteria 18045
656 Ga0307412_10010159 3300031911 Bacteria 5415
657 Ga0307412_10014753 3300031911 Bacteria 4616
658 Ga0307412_10046590 3300031911 Bacteria 2841
659 Ga0307412_10066101 3300031911 Bacteria 2450
660 Ga0307409_100001714 3300031995 Bacteria 11055
661 Ga0307409_100012813 3300031995 Bacteria 5361
662 Ga0307409_100091403 3300031995 Bacteria 2494
663 Ga0307409_100109153 3300031995 Bacteria 2316
664 Ga0307416_100015498 3300032002 Bacteria 5268
665 Ga0307416_100090531 3300032002 Bacteria 2624
666 Ga0307416_100103041 3300032002 Bacteria 2490
667 Ga0307414_10001083 3300032004 Bacteria 13923
668 Ga0307414_10003221 3300032004 Bacteria 8690
669 Ga0307414_10003727 3300032004 Bacteria 8178
670 Ga0307414_10007076 3300032004 Bacteria 6293
671 Ga0307414_10023772 3300032004 Bacteria 3894
672 Ga0307414_10027888 3300032004 Bacteria 3655
673 Ga0307414_10039436 3300032004 Bacteria 3181
674 Ga0307414_10044478 3300032004 Bacteria 3033
675 Ga0307414_10049975 3300032004 Bacteria 2894
676 Ga0307414_10080986 3300032004 Bacteria 2376
677 Ga0307414_10081483 3300032004 Bacteria 2370
678 Ga0307414_10088170 3300032004 Bacteria 2295
679 Ga0307414_10235506 3300032004 Bacteria 1512
680 Ga0307411_10018355 3300032005 Bacteria 4010
681 Ga0307411_10023473 3300032005 Bacteria 3654
682 Ga0307411_10063057 3300032005 Bacteria 2475
683 Ga0307411_10074867 3300032005 Bacteria 2309
684 Ga0307415_100001725 3300032126 Bacteria 10640
685 Ga0307415_100003090 3300032126 Bacteria 8410
686 Ga0307415_100007649 3300032126 Bacteria 5927
687 Ga0307415_100043012 3300032126 Bacteria 3010
688 Ga0307415_100092189 3300032126 Bacteria 2196
689 Ga0316583_10001134 3300032133 Bacteria 8699
690 Ga0307510_10008609 3300033180 Bacteria 12160
691 Ga0307510_10080123 3300033180 Bacteria 3177
692 Ga0373944_0010848 3300035089 Bacteria 2490
693 Ga0373939_0006034 3300035114 Bacteria 2907
694 Ga0373939_0020890 3300035114 Bacteria 1785
695 Ga0373941_0002377 3300035115 Bacteria 4133
696 Ga0373941_0012176 3300035115 Bacteria 2242
697 Ga0373943_0022108 3300035170 Bacteria 2943
698 Ga0373961_0006445 3300035241 Bacteria 2818
699 Ga0373962_0029430 3300035242 Bacteria 1497
700 Ga0373931_0000951 3300035691 Bacteria 12183
701 Ga0373927_0035366 3300035695 Bacteria 3248
702 Ga0373927_0050106 3300035695 Bacteria 2700
703 Ga0373937_0071228 3300036401 Bacteria 3206
704 Ga0373937_0098781 3300036401 Bacteria 2708
705 Ga0373937_0146980 3300036401 Bacteria 2207
706 Ga0373925_0000199 3300037068 Bacteria 65400
707 Ga0373925_0171687 3300037068 Bacteria 1712
708 Ga0395899_0001948 3300037312 Bacteria 16981
709 Ga0395899_0002554 3300037312 Bacteria 14732
710 Ga0395899_0028367 3300037312 Bacteria 4216
711 Ga0395900_0000002 3300037418 Bacteria 671103
712 Ga0395900_0000213 3300037418 Bacteria 91272
713 Ga0395900_0001825 3300037418 Bacteria 24311
714 Ga0395900_0006995 3300037418 Bacteria 11687
715 Ga0395900_0060542 3300037418 Bacteria 3896
716 Ga0395900_0166042 3300037418 Bacteria 2249
717 Ga0395900_0175542 3300037418 Bacteria 2179
718 Ga0395898_0000582 3300037466 Bacteria 67856
719 Ga0395898_0014210 3300037466 Bacteria 8187
720 Ga0395898_0030411 3300037466 Bacteria 5403
721 Ga0395898_0035284 3300037466 Bacteria 4975
722 Ga0395898_0064204 3300037466 Bacteria 3561
723 Ga0395898_0084365 3300037466 Bacteria 3062
724 Ga0395905_0000108 3300037471 Bacteria 138234
725 Ga0395905_0000128 3300037471 Bacteria 124305
726 Ga0395905_0001759 3300037471 Bacteria 25247
727 Ga0395905_0005732 3300037471 Bacteria 12628
728 Ga0395905_0014029 3300037471 Bacteria 7661
729 Ga0395905_0015723 3300037471 Bacteria 7189
730 Ga0395905_0023486 3300037471 Bacteria 5825
731 Ga0395905_0044731 3300037471 Bacteria 4154
732 Ga0395905_0146097 3300037471 Bacteria 2225
733 Ga0395905_0175172 3300037471 Bacteria 2014
734 Ga0436364_0188471 3300037853 Bacteria 43213
735 Ga0436364_0209780 3300037853 Bacteria 2293
736 Ga0436364_0582923 3300037853 Bacteria 2147
737 Ga0395901_0000021 3300038443 Bacteria 307734
738 Ga0395901_0011351 3300038443 Bacteria 9027
739 Ga0395901_0013736 3300038443 Bacteria 8230
740 Ga0395901_0050884 3300038443 Bacteria 4305
741 Ga0395901_0055064 3300038443 Bacteria 4135
742 Ga0395901_0076776 3300038443 Bacteria 3486
743 Ga0237819_02124 3300038705 Bacteria 4269
744 Ga0400483_046084 3300039062 Bacteria 1797
745 Ga0400483_059080 3300039062 Bacteria 3538
746 Ga0400483_099733 3300039062 Bacteria 3339
747 Ga0400483_125071 3300039062 Bacteria 5691
748 Ga0436365_0257402 3300039437 Bacteria 164674
749 Ga0436365_0298223 3300039437 Bacteria 74249
750 Ga0436365_0350825 3300039437 Bacteria 3173
751 Ga0436365_0616457 3300039437 Bacteria 20937
752 Ga0436365_0938205 3300039437 Bacteria 2760
753 Ga0436365_1145611 3300039437 Bacteria 2873
754 Ga0436365_1326958 3300039437 Bacteria 40452
755 Ga0436365_1574866 3300039437 Bacteria 3675
756 Ga0436361_1131750 3300039447 Bacteria 2569
757 Ga0436363_0707542 3300039450 Bacteria 6129
758 Ga0439461_0000264 3300041410 Bacteria 7521
759 Ga0439465_0000472 3300041413 Bacteria 11922
760 Ga0451795_0707270 3300041456 Bacteria 1591
761 Ga0439431_0000300 3300041997 Bacteria 10190
762 Ga0439431_0010999 3300041997 Bacteria 2062
763 Ga0439442_002932 3300042002 Bacteria 3362
764 Ga0439432_002280 3300042006 Bacteria 7227
765 Ga0439452_018759 3300042010 Bacteria 1839
766 Ga0439462_0001923 3300042015 Bacteria 4733
767 Ga0450904_000400 3300042139 Bacteria 8947
768 Ga0450905_003894 3300042142 Bacteria 1965
769 Ga0450907_000900 3300042146 Bacteria 7088
770 Ga0439458_0000074 3300042157 Bacteria 18402
771 Ga0439434_0000095 3300042435 Bacteria 22345
772 Ga0451577_0060900 3300042876 Bacteria 3365
773 Ga0466969_0000486 3300044656 Bacteria 21764
774 Ga0466966_0064193 3300044684 Bacteria 2312
775 Ga0466961_0013782 3300044693 Bacteria 5181
776 Ga0466963_0110203 3300044694 Bacteria 1889
777 Ga0466964_0068646 3300044706 Bacteria 1493
778 Ga0466971_0002611 3300044719 Bacteria 7623
779 Ga0466968_0043813 3300044735 Bacteria 1895
780 Ga0466957_0001487 3300044842 Bacteria 12287
781 Ga0466959_0000155 3300045049 Bacteria 44848
782 Ga0451576_0000023 3300045051 Bacteria 477965
783 Ga0466958_0011945 3300045836 Bacteria 4906
784 Ga0466967_0055997 3300045976 Bacteria 3475
785 Ga0466967_0088996 3300045976 Bacteria 2803
786 Ga0495627_000230 3300046453 Bacteria 59380
787 Ga0495627_000954 3300046453 Bacteria 19825
788 Ga0495590_0000763 3300046457 Bacteria 14638
789 Ga0495638_0000613 3300046460 Bacteria 39830
790 Ga0495638_0001571 3300046460 Bacteria 20485
791 Ga0495638_0006650 3300046460 Bacteria 8391
792 Ga0495638_0028107 3300046460 Bacteria 3634
793 Ga0495650_0000468 3300046471 Bacteria 62149
794 Ga0495650_0000926 3300046471 Bacteria 34330
795 Ga0495650_0004694 3300046471 Bacteria 9223
796 Ga0495594_0048015 3300046499 Bacteria 2345
797 Ga0495596_0000314 3300046500 Bacteria 31893
798 Ga0495596_0001189 3300046500 Bacteria 15223
799 Ga0495607_0023019 3300046501 Bacteria 3905
800 Ga0495583_0000003 3300046506 Bacteria 709273
801 Ga0495583_0006990 3300046506 Bacteria 7227
802 Ga0495583_0019104 3300046506 Bacteria 3586
803 Ga0495606_0000809 3300046507 Bacteria 47581
804 Ga0495606_0001283 3300046507 Bacteria 34807
805 Ga0495606_0011422 3300046507 Bacteria 7243
806 Ga0495606_0012552 3300046507 Bacteria 6784
807 Ga0495606_0102542 3300046507 Bacteria 1739
808 Ga0495610_0000031 3300046512 Bacteria 254606
809 Ga0495610_0000816 3300046512 Bacteria 29254
810 Ga0495610_0002416 3300046512 Bacteria 15729
811 Ga0495610_0002953 3300046512 Bacteria 13709
812 Ga0495610_0005936 3300046512 Bacteria 8552
813 Ga0495610_0010540 3300046512 Bacteria 5732
814 Ga0495610_0013934 3300046512 Bacteria 4751
815 Ga0495616_0000030 3300046513 Bacteria 132950
816 Ga0495616_0000405 3300046513 Bacteria 33255
817 Ga0495620_0018404 3300046515 Bacteria 3460
818 Ga0495631_0008844 3300046518 Bacteria 5055
819 Ga0495632_0001835 3300046519 Bacteria 17118
820 Ga0495632_0003925 3300046519 Bacteria 10328
821 Ga0495632_0046621 3300046519 Bacteria 2153
822 Ga0495632_0049216 3300046519 Bacteria 2084
823 Ga0495637_0019611 3300046520 Bacteria 3123
824 Ga0495643_0000014 3300046522 Bacteria 314632
825 Ga0495643_0000159 3300046522 Bacteria 108642
826 Ga0495643_0002054 3300046522 Bacteria 16700
827 Ga0495643_0008243 3300046522 Bacteria 6618
828 Ga0495643_0009120 3300046522 Bacteria 6207
829 Ga0495643_0026530 3300046522 Bacteria 3269
830 Ga0495648_0000107 3300046524 Bacteria 104376
831 Ga0495648_0000152 3300046524 Bacteria 82900
832 Ga0495648_0023970 3300046524 Bacteria 4167
833 Ga0495642_0002008 3300046528 Bacteria 8487
834 Ga0495642_0029966 3300046528 Bacteria 2175
835 Ga0495654_0000199 3300046530 Bacteria 58450
836 Ga0495654_0001219 3300046530 Bacteria 18236
837 Ga0495654_0043994 3300046530 Bacteria 2211
838 Ga0495654_0082554 3300046530 Bacteria 1504
839 Ga0495587_0075380 3300046536 Bacteria 1959
840 Ga0495598_0015637 3300046537 Bacteria 1920
841 Ga0495609_0002848 3300046538 Bacteria 10345
842 Ga0495609_0016617 3300046538 Bacteria 3427
843 Ga0495609_0019732 3300046538 Bacteria 3117
844 Ga0495597_0001614 3300046542 Bacteria 15825
845 Ga0495622_0002247 3300046557 Bacteria 9402
846 Ga0495622_0070321 3300046557 Bacteria 1615
847 Ga0495633_0000400 3300046558 Bacteria 45378
848 Ga0495668_0000002 3300046616 Bacteria 763179
849 Ga0495668_0000389 3300046616 Bacteria 57953
850 Ga0495668_0002423 3300046616 Bacteria 15386
851 Ga0495668_0003831 3300046616 Bacteria 11013
852 Ga0495668_0009041 3300046616 Bacteria 6151
853 Ga0495668_0020864 3300046616 Bacteria 3762
854 Ga0495668_0032711 3300046616 Bacteria 2924
855 Ga0495668_0035138 3300046616 Bacteria 2809
856 Ga0495668_0041587 3300046616 Bacteria 2560
857 Ga0495611_0002954 3300046648 Bacteria 7579
858 Ga0495611_0011861 3300046648 Bacteria 3699
859 Ga0495625_0000339 3300046660 Bacteria 71474
860 Ga0495625_0000707 3300046660 Bacteria 47153
861 Ga0495625_0001440 3300046660 Bacteria 28945
862 Ga0495625_0004355 3300046660 Bacteria 13450
863 Ga0495625_0004577 3300046660 Bacteria 13007
864 Ga0495625_0013497 3300046660 Bacteria 6561
865 Ga0495625_0047436 3300046660 Bacteria 3097
866 Ga0495669_0000007 3300046684 Bacteria 180797
867 Ga0495669_0000318 3300046684 Bacteria 26632
868 Ga0495669_0000433 3300046684 Bacteria 19902
869 Ga0495669_0018193 3300046684 Bacteria 3019
870 Ga0495669_0027912 3300046684 Bacteria 2469
871 Ga0495669_0040720 3300046684 Bacteria 2061
872 Ga0495613_0001950 3300046689 Bacteria 15659
873 Ga0495670_0000006 3300046691 Bacteria 255322
874 Ga0495671_0000058 3300046692 Bacteria 113487
875 Ga0495671_0064432 3300046692 Bacteria 1804
876 Ga0495649_0000118 3300046694 Bacteria 69833
877 Ga0495649_0076182 3300046694 Bacteria 1796
878 Ga0495649_0085326 3300046694 Bacteria 1685
879 Ga0495589_0003192 3300046794 Bacteria 8951
880 Ga0495589_0006097 3300046794 Bacteria 6371
881 Ga0495600_0001465 3300046809 Bacteria 13091
882 Ga0495660_0014662 3300046810 Bacteria 4533
883 Ga0495636_0045637 3300047318 Bacteria 1827
884 Ga0495672_0007833 3300047320 Bacteria 7977
885 Ga0495672_0025937 3300047320 Bacteria 3746
886 Ga0495680_0108286 3300047322 Bacteria 2063
887 Ga0495683_0034867 3300047323 Bacteria 2558
888 Ga0495687_010981 3300047443 Bacteria 4909
889 Ga0495687_050161 3300047443 Bacteria 1780
890 Ga0495677_0001848 3300047445 Bacteria 8464
891 Ga0495677_0021725 3300047445 Bacteria 2326
892 Ga0495673_0000370 3300047469 Bacteria 54131
893 Ga0495673_0001884 3300047469 Bacteria 15741
894 Ga0495681_0000211 3300047470 Bacteria 48554
895 Ga0495681_0007535 3300047470 Bacteria 6935
896 Ga0495681_0030101 3300047470 Bacteria 2769
897 Ga0495686_0000074 3300047472 Bacteria 208094
898 Ga0495686_0000650 3300047472 Bacteria 47482
899 Ga0495686_0001170 3300047472 Bacteria 30668
900 Ga0495686_0003469 3300047472 Bacteria 13649
901 Ga0495686_0006442 3300047472 Bacteria 8987
902 Ga0495686_0016140 3300047472 Bacteria 5074
903 Ga0495686_0016988 3300047472 Bacteria 4914
904 Ga0495686_0020655 3300047472 Bacteria 4390
905 Ga0495686_0040060 3300047472 Bacteria 2990
906 Ga0495602_0057744 3300048088 Bacteria 3402
907 Ga0495615_0000901 3300048090 Bacteria 4201
908 Ga0495615_0002799 3300048090 Bacteria 2840
909 Ga0495626_0000139 3300048091 Bacteria 92719
910 Ga0496100_0092837 3300048903 Bacteria 2064
911 Ga0496101_0056532 3300048904 Bacteria 2837
912 Ga0496102_0000049 3300048905 Bacteria 179480
913 Ga0496102_0000125 3300048905 Bacteria 109075
914 Ga0496102_0003298 3300048905 Bacteria 13683
915 Ga0496102_0036887 3300048905 Bacteria 4407
916 Ga0496102_0309549 3300048905 Bacteria 1488
917 Ga0496102_0320533 3300048905 Bacteria 1460
918 Ga0496103_0000037 3300048906 Bacteria 179474
919 Ga0496103_0000322 3300048906 Bacteria 43840
920 Ga0496103_0021698 3300048906 Bacteria 3864
921 Ga0496104_0000094 3300048907 Bacteria 86872
922 Ga0496104_0015178 3300048907 Bacteria 6973
923 Ga0496105_0000261 3300048908 Bacteria 35507
924 Ga0496105_0007066 3300048908 Bacteria 8654
925 Ga0496105_0034153 3300048908 Bacteria 4182
926 Ga0496105_0220751 3300048908 Bacteria 1543
927 Ga0496106_0001568 3300048909 Bacteria 17207
928 Ga0496106_0003336 3300048909 Bacteria 11965
929 Ga0496106_0005947 3300048909 Bacteria 9009
930 Ga0496106_0050742 3300048909 Bacteria 3127
931 Ga0496107_0000039 3300048910 Bacteria 77588
932 Ga0496107_0016977 3300048910 Bacteria 5118
933 Ga0496108_0025985 3300048911 Bacteria 4829
934 Ga0496109_0014912 3300048912 Bacteria 6764
935 Ga0496109_0053549 3300048912 Bacteria 3680
936 Ga0496109_0144902 3300048912 Bacteria 2222
937 Ga0496109_0146320 3300048912 Bacteria 2211
938 Ga0496109_0287190 3300048912 Bacteria 1551
939 Ga0496110_0000954 3300048913 Bacteria 20257
940 Ga0496110_0002141 3300048913 Bacteria 14760
941 Ga0496111_0011575 3300048914 Bacteria 5949
942 Ga0496112_0016768 3300048915 Bacteria 6870
943 Ga0496112_0068649 3300048915 Bacteria 3501
944 Ga0496112_0115553 3300048915 Bacteria 2654
945 Ga0496113_0000109 3300048916 Bacteria 35336
946 Ga0496113_0036227 3300048916 Bacteria 3613
947 Ga0496113_0056296 3300048916 Bacteria 2952
948 Ga0496114_0001428 3300048917 Bacteria 18118
949 Ga0496114_0065681 3300048917 Bacteria 3040
950 Ga0496115_0000142 3300048918 Bacteria 65915
951 Ga0496115_0000784 3300048918 Bacteria 23307
952 Ga0496115_0017296 3300048918 Bacteria 5509
953 Ga0496115_0019522 3300048918 Bacteria 5217
954 Ga0496115_0055841 3300048918 Bacteria 3173
955 Ga0496116_0000045 3300048919 Bacteria 324307
956 Ga0496116_0001001 3300048919 Bacteria 34554
957 Ga0496116_0029403 3300048919 Bacteria 3962
958 Ga0496116_0030724 3300048919 Bacteria 3855
959 Ga0496116_0169802 3300048919 Bacteria 1183
960 Ga0496117_0000115 3300048920 Bacteria 179488
961 Ga0496117_0001219 3300048920 Bacteria 38563
962 Ga0496117_0029261 3300048920 Bacteria 4249
963 Ga0496117_0070924 3300048920 Bacteria 2337
964 Ga0496118_0000086 3300048921 Bacteria 179488
965 Ga0496118_0000285 3300048921 Bacteria 88805
966 Ga0496118_0003370 3300048921 Bacteria 20186
967 Ga0496118_0014593 3300048921 Bacteria 7344
968 Ga0496118_0016614 3300048921 Bacteria 6744
969 Ga0496118_0023332 3300048921 Bacteria 5377
970 Ga0496118_0119716 3300048921 Bacteria 1720
971 Ga0496119_0016109 3300048922 Bacteria 5710
972 Ga0496120_0025661 3300048923 Bacteria 3654
973 Ga0496121_0000022 3300048924 Bacteria 472849
974 Ga0496121_0000042 3300048924 Bacteria 342304
975 Ga0496121_0000136 3300048924 Bacteria 165350
976 Ga0496121_0000671 3300048924 Bacteria 63867
977 Ga0496121_0001101 3300048924 Bacteria 47588
978 Ga0496121_0001923 3300048924 Bacteria 33167
979 Ga0496121_0002011 3300048924 Bacteria 32308
980 Ga0496121_0006291 3300048924 Bacteria 14844
981 Ga0496121_0014630 3300048924 Bacteria 8299
982 Ga0496121_0015763 3300048924 Bacteria 7874
983 Ga0496121_0190308 3300048924 Bacteria 1472
984 Ga0496122_0000216 3300048925 Bacteria 128675
985 Ga0496122_0003299 3300048925 Bacteria 21357
986 Ga0496122_0030555 3300048925 Bacteria 4511
987 Ga0496122_0083751 3300048925 Bacteria 2209
988 Ga0496123_0000233 3300048926 Bacteria 112582
989 Ga0496123_0000785 3300048926 Bacteria 51254
990 Ga0496123_0000968 3300048926 Bacteria 44375
991 Ga0496123_0002132 3300048926 Bacteria 25323
992 Ga0496123_0016451 3300048926 Bacteria 6005
993 Ga0496123_0016583 3300048926 Bacteria 5972
994 Ga0496123_0137042 3300048926 Bacteria 1345
995 Ga0496124_0000102 3300048927 Bacteria 179488
996 Ga0496124_0000320 3300048927 Bacteria 88704
997 Ga0496124_0000576 3300048927 Bacteria 61985
998 Ga0496124_0006449 3300048927 Bacteria 12776
999 Ga0496124_0009450 3300048927 Bacteria 10044
1000 Ga0496124_0025914 3300048927 Bacteria 5298
1001 Ga0496124_0102508 3300048927 Bacteria 2316
1002 Ga0496124_0110382 3300048927 Bacteria 2214
1003 Ga0496125_0001234 3300048928 Bacteria 38266
1004 Ga0496125_0001397 3300048928 Bacteria 35315
1005 Ga0496125_0008737 3300048928 Bacteria 10540
1006 Ga0496125_0015787 3300048928 Bacteria 7277
1007 Ga0496125_0019180 3300048928 Bacteria 6461
1008 Ga0496125_0026259 3300048928 Bacteria 5312
1009 Ga0496125_0096407 3300048928 Bacteria 2196
1010 Ga0496126_0000655 3300048929 Bacteria 64225
1011 Ga0496126_0001266 3300048929 Bacteria 40672
1012 Ga0496126_0005994 3300048929 Bacteria 13652
1013 Ga0496126_0015056 3300048929 Bacteria 7795
1014 Ga0496126_0022090 3300048929 Bacteria 6198
1015 Ga0496126_0143203 3300048929 Bacteria 2055
1016 Ga0495678_002387 3300049459 Bacteria 12852
1017 Ga0501290_000033 3300049513 Bacteria 18347
1018 Ga0501292_000026 3300049515 Bacteria 42153
1019 Ga0501294_000779 3300049517 Bacteria 3495
1020 Ga0501300_005984 3300049523 Bacteria 1791
1021 Ga0501031_0123192 3300049568 Bacteria 1693
1022 Ga0501031_0127692 3300049568 Bacteria 1661
1023 Ga0501032_0000341 3300049569 Bacteria 39021
1024 Ga0501032_0001548 3300049569 Bacteria 18326
1025 Ga0501033_0000287 3300049570 Bacteria 48448
1026 Ga0501033_0011462 3300049570 Bacteria 6784
1027 Ga0501033_0052342 3300049570 Bacteria 3026
1028 Ga0501033_0086258 3300049570 Bacteria 2298
1029 Ga0501033_0107904 3300049570 Bacteria 2028
1030 Ga0501033_0172764 3300049570 Bacteria 1552
1031 Ga0501034_0000135 3300049571 Bacteria 137151
1032 Ga0501034_0001020 3300049571 Bacteria 40131
1033 Ga0501034_0004898 3300049571 Bacteria 14758
1034 Ga0501034_0006655 3300049571 Bacteria 12394
1035 Ga0501034_0021280 3300049571 Bacteria 6613
1036 Ga0501034_0026896 3300049571 Bacteria 5853
1037 Ga0501034_0036856 3300049571 Bacteria 4952
1038 Ga0501034_0037070 3300049571 Bacteria 4937
1039 Ga0501034_0154648 3300049571 Bacteria 2268
1040 Ga0501034_0179597 3300049571 Bacteria 2082
1041 Ga0501036_0003057 3300049572 Bacteria 13338
1042 Ga0501036_0017342 3300049572 Bacteria 6018
1043 Ga0501036_0019184 3300049572 Bacteria 5737
1044 Ga0501036_0033991 3300049572 Bacteria 4312
1045 Ga0501037_0000987 3300049573 Bacteria 21089
1046 Ga0501037_0004940 3300049573 Bacteria 9700
1047 Ga0501037_0005708 3300049573 Bacteria 9083
1048 Ga0501037_0007076 3300049573 Bacteria 8196
1049 Ga0501037_0087637 3300049573 Bacteria 2253
1050 Ga0501037_0114808 3300049573 Bacteria 1938
1051 Ga0501037_0164605 3300049573 Bacteria 1580
1052 Ga0501038_0010812 3300049574 Bacteria 8341
1053 Ga0501038_0138952 3300049574 Bacteria 1989
1054 Ga0501039_0000180 3300049575 Bacteria 45008
1055 Ga0501040_0115576 3300049576 Bacteria 1879
1056 Ga0501040_0143425 3300049576 Bacteria 1683
1057 Ga0501042_0094542 3300049578 Bacteria 2147
1058 Ga0501043_0003691 3300049579 Bacteria 12574
1059 Ga0501043_0011753 3300049579 Bacteria 6856
1060 Ga0501043_0014517 3300049579 Bacteria 6167
1061 Ga0501043_0156785 3300049579 Bacteria 1780
1062 Ga0501043_0217987 3300049579 Bacteria 1477
1063 Ga0501046_0000567 3300049580 Bacteria 36589
1064 Ga0501046_0001979 3300049580 Bacteria 19466
1065 Ga0501046_0093688 3300049580 Bacteria 2309
1066 Ga0501047_0000435 3300049581 Bacteria 46511
1067 Ga0501047_0001118 3300049581 Bacteria 26623
1068 Ga0501047_0004654 3300049581 Bacteria 12909
1069 Ga0501047_0006070 3300049581 Bacteria 11353
1070 Ga0501047_0007181 3300049581 Bacteria 10470
1071 Ga0501047_0014549 3300049581 Bacteria 7485
1072 Ga0501047_0022842 3300049581 Bacteria 6005
1073 Ga0501047_0043193 3300049581 Bacteria 4354
1074 Ga0501047_0057512 3300049581 Bacteria 3760
1075 Ga0501047_0130014 3300049581 Bacteria 2399
1076 Ga0501047_0136714 3300049581 Bacteria 2331
1077 Ga0501047_0167660 3300049581 Bacteria 2066
1078 Ga0501047_0345461 3300049581 Bacteria 1325
1079 Ga0501048_0000615 3300049582 Bacteria 25398
1080 Ga0501067_0000123 3300049583 Bacteria 42381
1081 Ga0501067_0001900 3300049583 Bacteria 11486
1082 Ga0501067_0019712 3300049583 Bacteria 3734
1083 Ga0501068_0001282 3300049584 Bacteria 13343
1084 Ga0501069_0023377 3300049585 Bacteria 3370
1085 Ga0501070_0000111 3300049586 Bacteria 71786
1086 Ga0501070_0023959 3300049586 Bacteria 5116
1087 Ga0501072_0000844 3300049588 Bacteria 22545
1088 Ga0501073_0000002 3300049589 Bacteria 323865
1089 Ga0501073_0005548 3300049589 Bacteria 9436
1090 Ga0501073_0007445 3300049589 Bacteria 8136
1091 Ga0501073_0074964 3300049589 Bacteria 2355
1092 Ga0501075_0042396 3300049591 Bacteria 3412
1093 Ga0501075_0110505 3300049591 Bacteria 2090
1094 Ga0501075_0165309 3300049591 Bacteria 1688
1095 Ga0501076_0021665 3300049592 Bacteria 4932
1096 Ga0501077_0000002 3300049593 Bacteria 159855
1097 Ga0501222_000709 3300049662 Bacteria 4878
1098 Ga0501223_000012 3300049663 Bacteria 75953
1099 Ga0501223_009167 3300049663 Bacteria 2009
1100 Ga0501233_006677 3300049668 Bacteria 2175
1101 Ga0501242_002950 3300049674 Bacteria 1818
1102 Ga0501249_002241 3300049679 Bacteria 3925
1103 Ga0501249_005886 3300049679 Bacteria 2510
1104 Ga0501257_000040 3300049686 Bacteria 36614
1105 Ga0501257_003032 3300049686 Bacteria 3575
1106 Ga0501261_000055 3300049690 Bacteria 21300
1107 Ga0501225_0014233 3300049705 Bacteria 2223
1108 Ga0501079_0011214 3300049741 Bacteria 6837
1109 Ga0501079_0110693 3300049741 Bacteria 2134
1110 Ga0501079_0132494 3300049741 Bacteria 1940
1111 Ga0501080_0000014 3300049742 Bacteria 99739
1112 Ga0501080_0000199 3300049742 Bacteria 44057
1113 Ga0501080_0001583 3300049742 Bacteria 19292
1114 Ga0501080_0002278 3300049742 Bacteria 16703
1115 Ga0501080_0042676 3300049742 Bacteria 4223
1116 Ga0501081_0203208 3300049743 Bacteria 1437
1117 Ga0501083_0007263 3300049744 Bacteria 7865
1118 Ga0501241_006104 3300049758 Bacteria 2230
1119 Ga0501270_002356 3300049767 Bacteria 1930
1120 Ga0501279_000027 3300049775 Bacteria 40843
1121 Ga0501280_000543 3300049776 Bacteria 8844
1122 Ga0501280_001354 3300049776 Bacteria 4648
1123 Ga0501281_00070 3300049777 Bacteria 11809
1124 Ga0501283_001097 3300049779 Bacteria 3570
1125 Ga0501035_0000056 3300049822 Bacteria 137385
1126 Ga0501035_0002698 3300049822 Bacteria 17267
1127 Ga0501035_0006774 3300049822 Bacteria 10707
1128 Ga0501035_0011486 3300049822 Bacteria 8206
1129 Ga0501035_0133714 3300049822 Bacteria 2161
1130 Ga0501035_0247831 3300049822 Bacteria 1514
1131 Ga0501044_0000826 3300049823 Bacteria 37298
1132 Ga0501044_0001302 3300049823 Bacteria 29482
1133 Ga0501044_0006354 3300049823 Bacteria 13063
1134 Ga0501044_0013907 3300049823 Bacteria 8696
1135 Ga0501044_0018903 3300049823 Bacteria 7378
1136 Ga0501044_0019159 3300049823 Bacteria 7326
1137 Ga0501044_0038309 3300049823 Bacteria 5006
1138 Ga0501044_0059578 3300049823 Bacteria 3911
1139 Ga0501044_0090277 3300049823 Bacteria 3091
1140 Ga0501044_0093564 3300049823 Bacteria 3030
1141 Ga0501044_0100855 3300049823 Bacteria 2905
1142 Ga0501044_0152650 3300049823 Bacteria 2291
1143 Ga0501044_0198895 3300049823 Bacteria 1963
1144 Ga0501045_0030541 3300049824 Bacteria 3901
1145 nmdc:mga03683_1197_c1 3300050489 Bacteria 7649
1146 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
1147 nmdc:mga03683_3999_c1 3300050489 Bacteria 4830
1148 nmdc:mga03n38_26053_c1 3300050490 Bacteria 2411
1149 nmdc:mga03n38_38213_c1 3300050490 Bacteria 2075
1150 nmdc:mga00v17_481_c1 3300050491 Bacteria 22300
1151 nmdc:mga00v17_687_c1 3300050491 Bacteria 18636
1152 nmdc:mga0yw44_124867_c1 3300050492 Bacteria 1661
1153 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
1154 nmdc:mga0k408_87211_c1 3300050493 Bacteria 1833
1155 nmdc:mga06z11_4155_c1 3300050494 Bacteria 5663
1156 nmdc:mga06z11_9336_c1 3300050494 Bacteria 4130
1157 nmdc:mga06z11_99581_c1 3300050494 Bacteria 1592
1158 nmdc:mga04h51_1548_c1 3300050495 Bacteria 5344
1159 nmdc:mga04h51_269_c1 3300050495 Bacteria 13325
1160 nmdc:mga04h51_879_c1 3300050495 Bacteria 6916
1161 nmdc:mga07m45_132684_c1 3300050496 Bacteria 1441
1162 nmdc:mga07m45_1567_c1 3300050496 Bacteria 10524
1163 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
1164 nmdc:mga07m45_48438_c1 3300050496 Bacteria 2390
1165 nmdc:mga07m45_90_c1 3300050496 Bacteria 34935
1166 nmdc:mga0qj67_10678_c1 3300050509 Bacteria 6863
1167 nmdc:mga06r32_34521_c1 3300050510 Bacteria 4770
1168 nmdc:mga06r32_5383_c1 3300050510 Bacteria 11517
1169 nmdc:mga06r32_69356_c1 3300050510 Bacteria 3407
1170 nmdc:mga06r32_82853_c1 3300050510 Bacteria 3125
1171 nmdc:mga08y16_52472_c1 3300050511 Bacteria 4266
1172 nmdc:mga0sz30_5235_c1 3300050516 Bacteria 4746
1173 nmdc:mga0sz30_6928_c1 3300050516 Bacteria 4233
1174 Ga0500610_0000036 3300053079 Bacteria 46301
1175 Ga0500635_0000172 3300053080 Bacteria 33572
1176 Ga0500643_000226 3300053087 Bacteria 52820
1177 Ga0500643_000821 3300053087 Bacteria 20070
1178 Ga0500643_001378 3300053087 Bacteria 14073
1179 Ga0500643_003017 3300053087 Bacteria 8332
1180 Ga0500643_007637 3300053087 Bacteria 4332
1181 Ga0500643_013280 3300053087 Bacteria 2914
1182 Ga0500643_026815 3300053087 Bacteria 1798
1183 Ga0500644_0001179 3300053088 Bacteria 7482
1184 Ga0500647_0054774 3300053091 Bacteria 1919
1185 Ga0500651_0023648 3300053093 Bacteria 3848
1186 Ga0500566_0001038 3300053094 Bacteria 16065
1187 Ga0500641_0003987 3300053096 Bacteria 5218
1188 Ga0500641_0005963 3300053096 Bacteria 4315
1189 Ga0500641_0006677 3300053096 Bacteria 4099
1190 Ga0500556_0000044 3300053104 Bacteria 132744
1191 Ga0500556_0002605 3300053104 Bacteria 5671
1192 Ga0500556_0016379 3300053104 Bacteria 2304
1193 Ga0500562_000724 3300053108 Bacteria 7992
1194 Ga0500562_001461 3300053108 Bacteria 5832
1195 Ga0500562_003755 3300053108 Bacteria 3822
1196 Ga0500562_005344 3300053108 Bacteria 3226
1197 Ga0500569_004798 3300053109 Bacteria 2870
1198 Ga0500572_000052 3300053111 Bacteria 34966
1199 Ga0500592_000323 3300053116 Bacteria 8178
1200 Ga0500592_001827 3300053116 Bacteria 3431
1201 Ga0500592_002384 3300053116 Bacteria 3027
1202 Ga0500593_000280 3300053117 Bacteria 20786
1203 Ga0500594_0000117 3300053118 Bacteria 22333
1204 Ga0500594_0002743 3300053118 Bacteria 3835
1205 Ga0500595_000530 3300053119 Bacteria 23016
1206 Ga0500595_002453 3300053119 Bacteria 9198
1207 Ga0500595_006117 3300053119 Bacteria 5158
1208 Ga0500595_013172 3300053119 Bacteria 3173
1209 Ga0500607_000107 3300053121 Bacteria 64565
1210 Ga0500607_101417 3300053121 Bacteria 1428
1211 Ga0500608_000611 3300053122 Bacteria 13123
1212 Ga0500608_009357 3300053122 Bacteria 4158
1213 Ga0500618_000617 3300053125 Bacteria 21732
1214 Ga0500618_002790 3300053125 Bacteria 6329
1215 Ga0500618_004364 3300053125 Bacteria 4548
1216 Ga0500642_0000008 3300053130 Bacteria 293258
1217 Ga0500642_0022234 3300053130 Bacteria 2527
1218 Ga0500658_0000037 3300053134 Bacteria 84326
1219 Ga0500658_0000225 3300053134 Bacteria 27052
1220 Ga0500658_0036719 3300053134 Bacteria 1945
1221 Ga0500559_0000009 3300053136 Bacteria 174153
1222 Ga0500559_0000048 3300053136 Bacteria 93755
1223 Ga0500559_0001513 3300053136 Bacteria 13044
1224 Ga0500559_0005040 3300053136 Bacteria 6124
1225 Ga0500559_0015075 3300053136 Bacteria 3267
1226 Ga0500559_0018818 3300053136 Bacteria 2917
1227 Ga0500559_0035175 3300053136 Bacteria 2162
1228 Ga0500559_0061298 3300053136 Bacteria 1678
1229 Ga0500559_0079313 3300053136 Bacteria 1490
1230 Ga0500564_000254 3300053138 Bacteria 14954
1231 Ga0500568_0000005 3300053139 Bacteria 614296
1232 Ga0500568_0001920 3300053139 Bacteria 12747
1233 Ga0500568_0017483 3300053139 Bacteria 3165
1234 Ga0500573_0000093 3300053140 Bacteria 40260
1235 Ga0500604_0000087 3300053151 Bacteria 31301
1236 Ga0500604_0002430 3300053151 Bacteria 5082
1237 Ga0500604_0015267 3300053151 Bacteria 2102
1238 Ga0500616_0009567 3300053153 Bacteria 5886
1239 Ga0500616_0023122 3300053153 Bacteria 3464
1240 Ga0500616_0033237 3300053153 Bacteria 2815
1241 Ga0500619_008512 3300053154 Bacteria 2497
1242 Ga0500622_0000136 3300053156 Bacteria 78059
1243 Ga0500622_0001045 3300053156 Bacteria 23113
1244 Ga0500622_0011684 3300053156 Bacteria 4775
1245 Ga0500622_0021291 3300053156 Bacteria 3442
1246 Ga0500622_0036597 3300053156 Bacteria 2565
1247 Ga0500624_000130 3300053157 Bacteria 32645
1248 Ga0500624_002025 3300053157 Bacteria 2848
1249 Ga0500627_0000006 3300053158 Bacteria 165989
1250 Ga0500627_0000240 3300053158 Bacteria 15589
1251 Ga0500627_0012643 3300053158 Bacteria 3171
1252 Ga0500638_014057 3300053162 Bacteria 3642
1253 Ga0500636_0007932 3300053177 Bacteria 6140
1254 Ga0500636_0036753 3300053177 Bacteria 2898
1255 Ga0500637_0001181 3300053178 Bacteria 10867
1256 Ga0500645_000990 3300053730 Bacteria 16051
1257 Ga0500645_001524 3300053730 Bacteria 11599
1258 Ga0500645_002292 3300053730 Bacteria 8662
1259 Ga0500645_012044 3300053730 Bacteria 2804
1260 Ga0500645_017119 3300053730 Bacteria 2275
1261 Ga0500609_000937 3300053731 Bacteria 4367
1262 Ga0500552_002336 3300053733 Bacteria 1840
1263 Ga0500596_000319 3300053735 Bacteria 8589
1264 Ga0501084_0018673 3300054114 Bacteria 5773
1265 Ga0501084_0098876 3300054114 Bacteria 2450
1266 Ga0500661_002377 3300055283 Bacteria 3551
1267 Ga0501082_0007636 3300060353 Bacteria 9327
1268 Ga0501082_0019442 3300060353 Bacteria 5855
1269 Ga0501082_0020694 3300060353 Bacteria 5671
1270 Ga0501082_0087818 3300060353 Bacteria 2683
1271 Ga0466962_0000959 3300061719 Bacteria 13099
1272 Ga0466962_0005238 3300061719 Bacteria 6229
1273 Ga0530510_0004423 3300061734 Bacteria 9725
1274 Ga0530510_0006937 3300061734 Bacteria 7897
1275 Ga0530510_0062093 3300061734 Bacteria 2705
1276 Ga0530510_0180655 3300061734 Bacteria 1565

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0203208 Ga0501081_0203208_337_1422 355
2 3300048915 Ga0496112_0115553 Ga0496112_0115553_15_1124 357
3 3300049576 Ga0501040_0115576 Ga0501040_0115576_737_1828 357
4 3300049581 Ga0501047_0345461 Ga0501047_0345461_178_1272 360
5 3300048919 Ga0496116_0169802 Ga0496116_0169802_41_1147 366
6 3300049568 Ga0501031_0123192 Ga0501031_0123192_36_1154 366
7 3300046530 Ga0495654_0082554 Ga0495654_0082554_20_1174 372
8 3300044684 Ga0466966_0064193 Ga0466966_0064193_746_2059 380
9 3300044693 Ga0466961_0013782 Ga0466961_0013782_262_1575 380
10 3300044719 Ga0466971_0002611 Ga0466971_0002611_5830_7143 380
11 3300044842 Ga0466957_0001487 Ga0466957_0001487_745_2058 380
12 3300045049 Ga0466959_0000155 Ga0466959_0000155_15421_16734 380
13 3300045836 Ga0466958_0011945 Ga0466958_0011945_1024_2337 380
14 3300061719 Ga0466962_0000959 Ga0466962_0000959_5819_7132 380
15 3300015684 Ga0183365_10001 Ga0183365_10001479 388
16 3300049571 Ga0501034_0036856 Ga0501034_0036856_19_1368 389
17 3300014969 Ga0157376_10275782 Ga0157376_102757821 392
18 3300044656 Ga0466969_0000486 Ga0466969_0000486_3256_4626 393
19 3300042146 Ga0450907_000900 Ga0450907_000900_5802_7067 395
20 3300037471 Ga0395905_0023486 Ga0395905_0023486_3106_4521 396
21 3300049679 Ga0501249_002241 Ga0501249_002241_2434_3630 397
22 3300037471 Ga0395905_0146097 Ga0395905_0146097_978_2207 398
23 3300046537 Ga0495598_0015637 Ga0495598_0015637_706_1905 398
24 3300035695 Ga0373927_0035366 Ga0373927_0035366_16_1251 399
25 3300047320 Ga0495672_0025937 Ga0495672_0025937_2488_3729 400
26 3300049589 Ga0501073_0074964 Ga0501073_0074964_17_1291 401
27 3300048905 Ga0496102_0320533 Ga0496102_0320533_209_1450 402
28 3300053108 Ga0500562_005344 Ga0500562_005344_1972_3216 402
29 3300013105 Ga0157369_10103340 Ga0157369_101033403 403
30 3300046507 Ga0495606_0102542 Ga0495606_0102542_29_1318 403
31 3300046520 Ga0495637_0019611 Ga0495637_0019611_909_2198 403
32 3300048926 Ga0496123_0137042 Ga0496123_0137042_11_1246 410
33 3300037312 Ga0395899_0002554 Ga0395899_0002554_9132_10412 411
34 3300037418 Ga0395900_0000213 Ga0395900_0000213_22346_23626 411
35 3300037466 Ga0395898_0000582 Ga0395898_0000582_31205_32485 411
36 3300037471 Ga0395905_0001759 Ga0395905_0001759_5423_6703 411
37 3300046616 Ga0495668_0020864 Ga0495668_0020864_18_1307 411
38 3300046810 Ga0495660_0014662 Ga0495660_0014662_695_1975 411
39 3300061719 Ga0466962_0005238 Ga0466962_0005238_4981_6219 412
40 3300005336 Ga0070680_100026681 Ga0070680_1000266812 413
41 3300005337 Ga0070682_100006966 Ga0070682_1000069661 413
42 3300005341 Ga0070691_10007427 Ga0070691_100074271 413
43 3300005455 Ga0070663_100009949 Ga0070663_1000099497 413
44 3300005530 Ga0070679_100110214 Ga0070679_1001102142 413
45 3300005539 Ga0068853_100007497 Ga0068853_1000074978 413
46 3300005546 Ga0070696_100081819 Ga0070696_1000818191 413
47 3300005563 Ga0068855_100138126 Ga0068855_1001381262 413
48 3300005577 Ga0068857_100053945 Ga0068857_1000539454 413
49 3300005843 Ga0068860_100082779 Ga0068860_1000827792 413
50 3300025904 Ga0207647_10052545 Ga0207647_100525452 413
51 3300025914 Ga0207671_10040107 Ga0207671_100401072 413
52 3300026041 Ga0207639_10004425 Ga0207639_1000442510 413
53 3300026067 Ga0207678_10000503 Ga0207678_1000050314 413
54 3300032004 Ga0307414_10027888 Ga0307414_100278882 413
55 3300037471 Ga0395905_0175172 Ga0395905_0175172_755_1996 413
56 3300039447 Ga0436361_1131750 Ga0436361_1131750_11_1387 414
57 iso_pu_bacteria 2885429604 2885430518 414
58 3300046616 Ga0495668_0000002 Ga0495668_0000002_310231_311517 415
59 3300038443 Ga0395901_0076776 Ga0395901_0076776_219_1559 416
60 3300046519 Ga0495632_0046621 Ga0495632_0046621_844_2133 416
61 iso_pu_bacteria 2643221598 2643999684 416
62 3300006042 Ga0075368_10015568 Ga0075368_100155683 417
63 3300028800 Ga0265338_10036951 Ga0265338_100369513 417
64 3300031727 Ga0316576_10107633 Ga0316576_101076332 417
65 3300048090 Ga0495615_0002799 Ga0495615_0002799_13_1302 417
66 3300048924 Ga0496121_0190308 Ga0496121_0190308_157_1452 418
67 3300049579 Ga0501043_0217987 Ga0501043_0217987_181_1461 418
68 iso_pu_bacteria 2928100450 2928103752 418
69 3300044706 Ga0466964_0068646 Ga0466964_0068646_174_1475 419
70 3300046519 Ga0495632_0049216 Ga0495632_0049216_734_2035 419
71 3300046694 Ga0495649_0076182 Ga0495649_0076182_10_1272 419
72 3300053119 Ga0500595_006117 Ga0500595_006117_3854_5143 419
73 3300046616 Ga0495668_0041587 Ga0495668_0041587_618_1973 420
74 3300048905 Ga0496102_0036887 Ga0496102_0036887_63_1358 420
75 iso_pu_bacteria 2855020534 2855021639 420
76 iso_pu_bacteria 2899259804 2899260357 420
77 3300005327 Ga0070658_10056113 Ga0070658_100561132 421
78 3300005331 Ga0070670_100071668 Ga0070670_1000716682 421
79 3300005333 Ga0070677_10019501 Ga0070677_100195012 421
80 3300005344 Ga0070661_100004099 Ga0070661_1000040991 421
81 3300005353 Ga0070669_100086365 Ga0070669_1000863652 421
82 3300005356 Ga0070674_100070701 Ga0070674_1000707012 421
83 3300005366 Ga0070659_100022474 Ga0070659_1000224745 421
84 3300005543 Ga0070672_100125677 Ga0070672_1001256772 421
85 3300005548 Ga0070665_100143749 Ga0070665_1001437492 421
86 3300005564 Ga0070664_100021127 Ga0070664_1000211278 421
87 3300006042 Ga0075368_10007027 Ga0075368_100070271 421
88 3300006048 Ga0075363_100072464 Ga0075363_1000724642 421
89 3300006178 Ga0075367_10017716 Ga0075367_100177165 421
90 3300006847 Ga0075431_100001098 Ga0075431_10000109817 421
91 3300006880 Ga0075429_100038809 Ga0075429_1000388095 421
92 3300009177 Ga0105248_10012717 Ga0105248_1001271711 421
93 3300025923 Ga0207681_10096745 Ga0207681_100967451 421
94 3300025925 Ga0207650_10054091 Ga0207650_100540912 421
95 3300025931 Ga0207644_10107790 Ga0207644_101077902 421
96 3300025937 Ga0207669_10028512 Ga0207669_100285124 421
97 3300025940 Ga0207691_10104930 Ga0207691_101049302 421
98 3300025941 Ga0207711_10031965 Ga0207711_100319652 421
99 3300031731 Ga0307405_10014620 Ga0307405_100146204 421
100 3300037418 Ga0395900_0166042 Ga0395900_0166042_18_1283 421
101 3300048912 Ga0496109_0146320 Ga0496109_0146320_136_1452 421
102 3300048913 Ga0496110_0002141 Ga0496110_0002141_883_2199 421
103 3300048915 Ga0496112_0068649 Ga0496112_0068649_2170_3489 421
104 3300048917 Ga0496114_0065681 Ga0496114_0065681_1602_2918 421
105 3300050510 nmdc:mga06r32_34521_c1 nmdc:mga06r32_34521_c1_151_1443 421
106 3300006353 Ga0075370_10000141 Ga0075370_1000014110 422
107 3300009093 Ga0105240_10113959 Ga0105240_101139591 422
108 3300025913 Ga0207695_10077943 Ga0207695_100779434 422
109 3300037312 Ga0395899_0028367 Ga0395899_0028367_39_1310 422
110 3300050489 nmdc:mga03683_32_c1 nmdc:mga03683_32_c1_13277_14548 422
111 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_98531_99802 422
112 3300050494 nmdc:mga06z11_99581_c1 nmdc:mga06z11_99581_c1_292_1563 422
113 3300050516 nmdc:mga0sz30_5235_c1 nmdc:mga0sz30_5235_c1_1998_3269 422
114 iso_pu_bacteria 2852653556 2852657059 422
115 iso_pu_bacteria 2852680915 2852683750 422
116 iso_pu_bacteria 2880518877 2880519940 422
117 iso_pu_bacteria 2898795034 2898796644 422
118 iso_pu_bacteria 2899275550 2899279380 422
119 3300049569 Ga0501032_0000341 Ga0501032_0000341_22404_23753 423
120 3300049571 Ga0501034_0000135 Ga0501034_0000135_60067_61416 423
121 3300049572 Ga0501036_0003057 Ga0501036_0003057_9830_11179 423
122 3300049573 Ga0501037_0000987 Ga0501037_0000987_14498_15847 423
123 3300049575 Ga0501039_0000180 Ga0501039_0000180_36505_37854 423
124 3300049576 Ga0501040_0143425 Ga0501040_0143425_319_1668 423
125 3300049580 Ga0501046_0000567 Ga0501046_0000567_8380_9729 423
126 3300049581 Ga0501047_0000435 Ga0501047_0000435_16045_17394 423
127 3300049583 Ga0501067_0001900 Ga0501067_0001900_8174_9523 423
128 3300049586 Ga0501070_0023959 Ga0501070_0023959_1609_2958 423
129 3300049591 Ga0501075_0042396 Ga0501075_0042396_2081_3385 423
130 3300049742 Ga0501080_0000014 Ga0501080_0000014_75885_77234 423
131 3300049822 Ga0501035_0000056 Ga0501035_0000056_59904_61253 423
132 3300049823 Ga0501044_0018903 Ga0501044_0018903_4610_5959 423
133 3300050510 nmdc:mga06r32_82853_c1 nmdc:mga06r32_82853_c1_1295_2599 423
134 3300053117 Ga0500593_000280 Ga0500593_000280_10802_12136 423
135 3300060353 Ga0501082_0020694 Ga0501082_0020694_709_2058 423
136 3300061734 Ga0530510_0004423 Ga0530510_0004423_2218_3522 423
137 3300006847 Ga0075431_100006959 Ga0075431_1000069592 424
138 3300009148 Ga0105243_10017595 Ga0105243_100175954 424
139 3300009553 Ga0105249_10025304 Ga0105249_100253044 424
140 3300026118 Ga0207675_100069432 Ga0207675_1000694322 424
141 3300035242 Ga0373962_0029430 Ga0373962_0029430_155_1456 424
142 3300048906 Ga0496103_0021698 Ga0496103_0021698_1156_2457 424
143 3300048909 Ga0496106_0001568 Ga0496106_0001568_13887_15188 424
144 3300048912 Ga0496109_0287190 Ga0496109_0287190_208_1509 424
145 3300049571 Ga0501034_0021280 Ga0501034_0021280_84_1433 424
146 3300049580 Ga0501046_0001979 Ga0501046_0001979_17091_18440 424
147 3300049581 Ga0501047_0043193 Ga0501047_0043193_1341_2690 424
148 3300053088 Ga0500644_0001179 Ga0500644_0001179_271_1623 424
149 3300054114 Ga0501084_0098876 Ga0501084_0098876_771_2072 424
150 3300061734 Ga0530510_0180655 Ga0530510_0180655_104_1405 424
151 iso_pu_bacteria 2713897090 2715499662 424
152 iso_pu_bacteria 2854681122 2854684811 424
153 iso_pu_bacteria 3000405567 3000406982 424
154 3300005457 Ga0070662_100010012 Ga0070662_1000100129 425
155 3300005539 Ga0068853_100025509 Ga0068853_1000255097 425
156 3300006178 Ga0075367_10012363 Ga0075367_100123633 425
157 3300026041 Ga0207639_10011991 Ga0207639_100119917 425
158 3300039062 Ga0400483_099733 Ga0400483_099733_282_1589 425
159 3300047445 Ga0495677_0001848 Ga0495677_0001848_3873_5156 425
160 3300048929 Ga0496126_0143203 Ga0496126_0143203_512_1834 425
161 3300049580 Ga0501046_0093688 Ga0501046_0093688_987_2297 425
162 3300049741 Ga0501079_0132494 Ga0501079_0132494_13_1338 425
163 3300060353 Ga0501082_0019442 Ga0501082_0019442_4274_5623 425
164 iso_pu_bacteria 2919679072 2919679484 425
165 iso_pu_bacteria 8055878733 8055882311 425
166 3300003781 Ga0055536_1005313 Ga0055536_10053132 426
167 3300003781 Ga0055536_1010902 Ga0055536_10109022 426
168 3300003791 Ga0055530_10000465 Ga0055530_100004652 426
169 3300003794 Ga0055531_10001005 Ga0055531_100010052 426
170 3300005289 Ga0065704_10125067 Ga0065704_101250672 426
171 3300013100 Ga0157373_10001577 Ga0157373_1000157714 426
172 3300013100 Ga0157373_10001686 Ga0157373_1000168614 426
173 3300014326 Ga0157380_10000062 Ga0157380_1000006249 426
174 3300025920 Ga0207649_10138089 Ga0207649_101380892 426
175 3300027907 Ga0207428_10187210 Ga0207428_101872101 426
176 3300031824 Ga0307413_10024791 Ga0307413_100247912 426
177 3300031911 Ga0307412_10010159 Ga0307412_100101598 426
178 3300032126 Ga0307415_100007649 Ga0307415_1000076492 426
179 3300044735 Ga0466968_0043813 Ga0466968_0043813_24_1316 426
180 3300046513 Ga0495616_0000030 Ga0495616_0000030_99249_100535 426
181 3300046530 Ga0495654_0001219 Ga0495654_0001219_8126_9421 426
182 3300046616 Ga0495668_0002423 Ga0495668_0002423_7711_9006 426
183 3300046794 Ga0495589_0006097 Ga0495589_0006097_4757_6052 426
184 3300047469 Ga0495673_0000370 Ga0495673_0000370_5840_7192 426
185 3300048908 Ga0496105_0034153 Ga0496105_0034153_1475_2785 426
186 3300048921 Ga0496118_0014593 Ga0496118_0014593_334_1626 426
187 3300049679 Ga0501249_005886 Ga0501249_005886_1181_2461 426
188 3300050496 nmdc:mga07m45_132684_c1 nmdc:mga07m45_132684_c1_93_1373 426
189 3300053087 Ga0500643_000226 Ga0500643_000226_7048_8334 426
190 3300053136 Ga0500559_0018818 Ga0500559_0018818_1456_2742 426
191 3300053138 Ga0500564_000254 Ga0500564_000254_99_1451 426
192 3300053151 Ga0500604_0002430 Ga0500604_0002430_3114_4400 426
193 3300053156 Ga0500622_0000136 Ga0500622_0000136_35355_36635 426
194 3300053158 Ga0500627_0000240 Ga0500627_0000240_5522_6817 426
195 3300055283 Ga0500661_002377 Ga0500661_002377_660_1946 426
196 iso_pu_bacteria 8057132660 8057134550 426
197 3300005333 Ga0070677_10000283 Ga0070677_100002838 427
198 3300009148 Ga0105243_10029432 Ga0105243_100294322 427
199 3300009545 Ga0105237_10087184 Ga0105237_100871842 427
200 3300011119 Ga0105246_10009669 Ga0105246_100096697 427
201 3300025893 Ga0207682_10000506 Ga0207682_1000050616 427
202 3300039062 Ga0400483_059080 Ga0400483_059080_1472_2785 427
203 3300042139 Ga0450904_000400 Ga0450904_000400_144_1472 427
204 3300047472 Ga0495686_0000074 Ga0495686_0000074_168804_170168 427
205 3300048903 Ga0496100_0092837 Ga0496100_0092837_209_1558 427
206 3300048908 Ga0496105_0220751 Ga0496105_0220751_154_1503 427
207 3300048909 Ga0496106_0005947 Ga0496106_0005947_4491_5840 427
208 3300048910 Ga0496107_0016977 Ga0496107_0016977_641_1990 427
209 3300048918 Ga0496115_0019522 Ga0496115_0019522_3099_4448 427
210 3300049571 Ga0501034_0001020 Ga0501034_0001020_25802_27118 427
211 iso_pu_bacteria 2840878972 2840881314 427
212 iso_pu_bacteria 2879163058 2879163308 427
213 3300005344 Ga0070661_100105134 Ga0070661_1001051342 428
214 3300048918 Ga0496115_0055841 Ga0496115_0055841_1162_2640 428
215 iso_pu_bacteria 2738543020 2739289529 428
216 iso_pu_bacteria 2738543021 2739294841 428
217 iso_pu_bacteria 2834578030 2834580476 428
218 3300021384 Ga0213876_10000537 Ga0213876_100005373 429
219 3300039437 Ga0436365_0257402 Ga0436365_0257402_148144_149460 429
220 3300049570 Ga0501033_0000287 Ga0501033_0000287_32310_33686 429
221 3300049571 Ga0501034_0037070 Ga0501034_0037070_1399_2772 429
222 3300049572 Ga0501036_0017342 Ga0501036_0017342_1671_3047 429
223 3300049573 Ga0501037_0007076 Ga0501037_0007076_3849_5225 429
224 3300049579 Ga0501043_0003691 Ga0501043_0003691_10703_12079 429
225 3300049822 Ga0501035_0006774 Ga0501035_0006774_5657_7033 429
226 3300049823 Ga0501044_0006354 Ga0501044_0006354_2468_3844 429
227 iso_pu_bacteria 2599185359 2600227395 429
228 iso_pu_bacteria 2842805378 2842809957 429
229 iso_pu_bacteria 2928526807 2928529966 429
230 iso_pu_bacteria 2928968154 2928970613 429
231 3300017792 Ga0163161_10037310 Ga0163161_100373102 430
232 3300039062 Ga0400483_046084 Ga0400483_046084_209_1531 430
233 3300039062 Ga0400483_125071 Ga0400483_125071_2704_4026 430
234 3300046522 Ga0495643_0000159 Ga0495643_0000159_58904_60259 430
235 3300046691 Ga0495670_0000006 Ga0495670_0000006_81604_82908 430
236 3300046694 Ga0495649_0085326 Ga0495649_0085326_317_1672 430
237 3300048090 Ga0495615_0000901 Ga0495615_0000901_218_1510 430
238 3300048925 Ga0496122_0083751 Ga0496122_0083751_143_1435 430
239 3300048926 Ga0496123_0002132 Ga0496123_0002132_4792_6084 430
240 3300049570 Ga0501033_0052342 Ga0501033_0052342_1019_2377 430
241 3300049574 Ga0501038_0138952 Ga0501038_0138952_174_1532 430
242 3300049581 Ga0501047_0022842 Ga0501047_0022842_3806_5164 430
243 3300049822 Ga0501035_0011486 Ga0501035_0011486_2197_3555 430
244 3300049823 Ga0501044_0090277 Ga0501044_0090277_1163_2521 430
245 3300053136 Ga0500559_0079313 Ga0500559_0079313_19_1314 430
246 iso_pu_bacteria 2599185354 2600202372 430
247 iso_pu_bacteria 2751185897 2753766017 430
248 iso_pu_bacteria 2896429255 2896429726 430
249 iso_pu_bacteria 3000017691 3000020137 430
250 3300013104 Ga0157370_10000760 Ga0157370_1000076026 431
251 3300021384 Ga0213876_10000145 Ga0213876_1000014546 431
252 3300028800 Ga0265338_10107234 Ga0265338_101072342 431
253 3300039437 Ga0436365_1326958 Ga0436365_1326958_9253_10638 431
254 3300046507 Ga0495606_0001283 Ga0495606_0001283_19183_20550 431
255 3300046522 Ga0495643_0002054 Ga0495643_0002054_5877_7244 431
256 3300048924 Ga0496121_0002011 Ga0496121_0002011_9469_10779 431
257 3300049591 Ga0501075_0165309 Ga0501075_0165309_66_1388 431
258 3300049824 Ga0501045_0030541 Ga0501045_0030541_809_2131 431
259 iso_pu_bacteria 2510917020 2511120943 431
260 iso_pu_bacteria 2582581279 2585149828 431
261 iso_pu_bacteria 2582581280 2585151264 431
262 iso_pu_bacteria 2582581293 2585197133 431
263 iso_pu_bacteria 2585428106 2587919946 431
264 iso_pu_bacteria 2643221545 2643747680 431
265 iso_pu_bacteria 2643221552 2643780885 431
266 iso_pu_bacteria 2643221583 2643926789 431
267 iso_pu_bacteria 2643221584 2643929619 431
268 iso_pu_bacteria 2643221622 2644125446 431
269 iso_pu_bacteria 2643221640 2644223421 431
270 iso_pu_bacteria 2643221642 2644237163 431
271 iso_pu_bacteria 2643221666 2644367030 431
272 iso_pu_bacteria 2643221691 2644506937 431
273 iso_pu_bacteria 2791355048 2792460768 431
274 iso_pu_bacteria 2818991435 2819540192 431
275 iso_pu_bacteria 2818991454 2819647090 431
276 iso_pu_bacteria 2830075706 2830076593 431
277 iso_pu_bacteria 2843744320 2843745573 431
278 iso_pu_bacteria 2849560528 2849561188 431
279 iso_pu_bacteria 2849573788 2849576169 431
280 iso_pu_bacteria 2851153111 2851157223 431
281 iso_pu_bacteria 2857504554 2857505795 431
282 iso_pu_bacteria 2884960567 2884965485 431
283 iso_pu_bacteria 2898329390 2898332882 431
284 iso_pu_bacteria 2928027323 2928028431 431
285 iso_pu_bacteria 2928531327 2928532088 431
286 iso_pu_bacteria 2984555340 2984555992 431
287 iso_pu_bacteria 2984564862 2984565902 431
288 iso_pu_bacteria 2993356040 2993356911 431
289 3300005327 Ga0070658_10000086 Ga0070658_1000008626 432
290 3300005347 Ga0070668_100009939 Ga0070668_1000099398 432
291 3300005353 Ga0070669_100044858 Ga0070669_1000448584 432
292 3300005367 Ga0070667_100103915 Ga0070667_1001039153 432
293 3300005458 Ga0070681_10017384 Ga0070681_100173845 432
294 3300005563 Ga0068855_100066161 Ga0068855_1000661616 432
295 3300005617 Ga0068859_100034727 Ga0068859_1000347274 432
296 3300005841 Ga0068863_100041278 Ga0068863_1000412782 432
297 3300005843 Ga0068860_100014606 Ga0068860_1000146065 432
298 3300005844 Ga0068862_100048727 Ga0068862_1000487273 432
299 3300006195 Ga0075366_10034698 Ga0075366_100346984 432
300 3300006931 Ga0097620_100034728 Ga0097620_1000347285 432
301 3300009093 Ga0105240_10201908 Ga0105240_102019082 432
302 3300025909 Ga0207705_10000002 Ga0207705_1000000268 432
303 3300025913 Ga0207695_10011589 Ga0207695_100115898 432
304 3300025913 Ga0207695_10036878 Ga0207695_100368783 432
305 3300025923 Ga0207681_10028244 Ga0207681_100282443 432
306 3300025931 Ga0207644_10072594 Ga0207644_100725943 432
307 3300025949 Ga0207667_10042335 Ga0207667_100423356 432
308 3300025949 Ga0207667_10047053 Ga0207667_100470536 432
309 3300025986 Ga0207658_10029009 Ga0207658_100290093 432
310 3300026095 Ga0207676_10045609 Ga0207676_100456094 432
311 3300028381 Ga0268264_10008542 Ga0268264_100085424 432
312 3300031251 Ga0265327_10001598 Ga0265327_1000159824 432
313 3300031824 Ga0307413_10061166 Ga0307413_100611662 432
314 3300031903 Ga0307407_10061256 Ga0307407_100612562 432
315 3300032126 Ga0307415_100003090 Ga0307415_1000030907 432
316 3300032126 Ga0307415_100092189 Ga0307415_1000921892 432
317 3300035089 Ga0373944_0010848 Ga0373944_0010848_902_2245 432
318 3300037853 Ga0436364_0209780 Ga0436364_0209780_489_1802 432
319 3300039437 Ga0436365_0350825 Ga0436365_0350825_764_2098 432
320 3300049581 Ga0501047_0136714 Ga0501047_0136714_706_2049 432
321 3300049686 Ga0501257_003032 Ga0501257_003032_721_2061 432
322 3300049823 Ga0501044_0198895 Ga0501044_0198895_399_1742 432
323 iso_pu_bacteria 2990265787 2990268716 432
324 iso_pu_bacteria 2993693658 2993694577 432
325 3300001915 JGI24741J21665_1000993 JGI24741J21665_10009931 433
326 3300001990 JGI24737J22298_10003963 JGI24737J22298_100039634 433
327 3300003215 JGI25153J46596_10000152 JGI25153J46596_1000015266 433
328 3300003762 Ga0055542_1000132 Ga0055542_100013275 433
329 3300003763 Ga0055529_1000088 Ga0055529_100008885 433
330 3300003791 Ga0055530_10012502 Ga0055530_100125023 433
331 3300003794 Ga0055531_10003722 Ga0055531_1000372211 433
332 3300005327 Ga0070658_10001217 Ga0070658_1000121711 433
333 3300005328 Ga0070676_10110783 Ga0070676_101107832 433
334 3300005336 Ga0070680_100147050 Ga0070680_1001470502 433
335 3300005344 Ga0070661_100006006 Ga0070661_1000060067 433
336 3300005347 Ga0070668_100000120 Ga0070668_10000012038 433
337 3300005347 Ga0070668_100000618 Ga0070668_1000006187 433
338 3300005347 Ga0070668_100058973 Ga0070668_1000589733 433
339 3300005353 Ga0070669_100003318 Ga0070669_1000033185 433
340 3300005355 Ga0070671_100004972 Ga0070671_1000049723 433
341 3300005356 Ga0070674_100039375 Ga0070674_1000393753 433
342 3300005356 Ga0070674_100140603 Ga0070674_1001406032 433
343 3300005367 Ga0070667_100004571 Ga0070667_1000045717 433
344 3300005367 Ga0070667_100006391 Ga0070667_1000063914 433
345 3300005441 Ga0070700_100008602 Ga0070700_1000086025 433
346 3300005456 Ga0070678_100001098 Ga0070678_1000010983 433
347 3300005539 Ga0068853_100018732 Ga0068853_1000187325 433
348 3300005539 Ga0068853_100161110 Ga0068853_1001611101 433
349 3300005543 Ga0070672_100124643 Ga0070672_1001246432 433
350 3300005548 Ga0070665_100000115 Ga0070665_1000001156 433
351 3300005548 Ga0070665_100000198 Ga0070665_10000019887 433
352 3300005548 Ga0070665_100039869 Ga0070665_1000398692 433
353 3300005564 Ga0070664_100018223 Ga0070664_1000182232 433
354 3300005617 Ga0068859_100001068 Ga0068859_10000106810 433
355 3300005617 Ga0068859_100087061 Ga0068859_1000870613 433
356 3300005618 Ga0068864_100000058 Ga0068864_10000005821 433
357 3300005618 Ga0068864_100254682 Ga0068864_1002546822 433
358 3300005841 Ga0068863_100000175 Ga0068863_10000017517 433
359 3300005841 Ga0068863_100010685 Ga0068863_1000106854 433
360 3300005842 Ga0068858_100000006 Ga0068858_100000006158 433
361 3300005842 Ga0068858_100008659 Ga0068858_1000086594 433
362 3300005843 Ga0068860_100002711 Ga0068860_10000271113 433
363 3300005844 Ga0068862_100013372 Ga0068862_10001337210 433
364 3300005844 Ga0068862_100014327 Ga0068862_1000143277 433
365 3300006195 Ga0075366_10022279 Ga0075366_100222794 433
366 3300006931 Ga0097620_100001068 Ga0097620_10000106819 433
367 3300006931 Ga0097620_100087064 Ga0097620_1000870643 433
368 3300009092 Ga0105250_10007702 Ga0105250_100077023 433
369 3300009093 Ga0105240_10089281 Ga0105240_100892812 433
370 3300009147 Ga0114129_10053884 Ga0114129_100538844 433
371 3300009148 Ga0105243_10000091 Ga0105243_1000009183 433
372 3300009174 Ga0105241_10003044 Ga0105241_100030443 433
373 3300009177 Ga0105248_10000400 Ga0105248_1000040017 433
374 3300009545 Ga0105237_10190630 Ga0105237_101906302 433
375 3300009551 Ga0105238_10264668 Ga0105238_102646682 433
376 3300012513 Ga0157326_1003496 Ga0157326_10034962 433
377 3300013100 Ga0157373_10096330 Ga0157373_100963302 433
378 3300013102 Ga0157371_10000048 Ga0157371_10000048101 433
379 3300013104 Ga0157370_10190102 Ga0157370_101901021 433
380 3300013105 Ga0157369_10013459 Ga0157369_100134598 433
381 3300013297 Ga0157378_10112497 Ga0157378_101124972 433
382 3300013306 Ga0163162_10022236 Ga0163162_100222367 433
383 3300013307 Ga0157372_10228772 Ga0157372_102287723 433
384 3300013307 Ga0157372_10251746 Ga0157372_102517462 433
385 3300014325 Ga0163163_10011090 Ga0163163_100110906 433
386 3300014326 Ga0157380_10006274 Ga0157380_100062745 433
387 3300014968 Ga0157379_10011135 Ga0157379_100111356 433
388 3300014968 Ga0157379_10022602 Ga0157379_100226024 433
389 3300025246 Ga0209646_1004657 Ga0209646_10046572 433
390 3300025250 Ga0209026_1009856 Ga0209026_10098561 433
391 3300025254 Ga0209148_1000017 Ga0209148_100001781 433
392 3300025272 Ga0209455_1000005 Ga0209455_100000581 433
393 3300025292 Ga0209676_1000257 Ga0209676_100025795 433
394 3300025297 Ga0209758_1000035 Ga0209758_100003567 433
395 3300025298 Ga0209050_1001180 Ga0209050_100118020 433
396 3300025304 Ga0209257_1001221 Ga0209257_100122119 433
397 3300025909 Ga0207705_10000665 Ga0207705_1000066532 433
398 3300025911 Ga0207654_10001839 Ga0207654_100018396 433
399 3300025913 Ga0207695_10024402 Ga0207695_100244026 433
400 3300025914 Ga0207671_10013737 Ga0207671_100137377 433
401 3300025914 Ga0207671_10028484 Ga0207671_100284844 433
402 3300025914 Ga0207671_10078027 Ga0207671_100780272 433
403 3300025917 Ga0207660_10034110 Ga0207660_100341105 433
404 3300025919 Ga0207657_10081160 Ga0207657_100811602 433
405 3300025920 Ga0207649_10006776 Ga0207649_100067764 433
406 3300025923 Ga0207681_10012409 Ga0207681_100124093 433
407 3300025924 Ga0207694_10004292 Ga0207694_1000429216 433
408 3300025924 Ga0207694_10149972 Ga0207694_101499722 433
409 3300025925 Ga0207650_10030302 Ga0207650_100303025 433
410 3300025931 Ga0207644_10000328 Ga0207644_1000032814 433
411 3300025935 Ga0207709_10000018 Ga0207709_10000018173 433
412 3300025937 Ga0207669_10000055 Ga0207669_1000005565 433
413 3300025937 Ga0207669_10000311 Ga0207669_1000031119 433
414 3300025940 Ga0207691_10099108 Ga0207691_100991082 433
415 3300025941 Ga0207711_10001625 Ga0207711_1000162515 433
416 3300025941 Ga0207711_10012677 Ga0207711_100126773 433
417 3300025941 Ga0207711_10020668 Ga0207711_100206685 433
418 3300025949 Ga0207667_10000004 Ga0207667_1000000474 433
419 3300025972 Ga0207668_10000004 Ga0207668_1000000439 433
420 3300025972 Ga0207668_10004014 Ga0207668_100040147 433
421 3300026035 Ga0207703_10000027 Ga0207703_1000002784 433
422 3300026041 Ga0207639_10005317 Ga0207639_100053177 433
423 3300026041 Ga0207639_10040179 Ga0207639_100401794 433
424 3300026041 Ga0207639_10191144 Ga0207639_101911441 433
425 3300026075 Ga0207708_10000470 Ga0207708_1000047033 433
426 3300026078 Ga0207702_10188046 Ga0207702_101880462 433
427 3300026088 Ga0207641_10000003 Ga0207641_10000003289 433
428 3300026088 Ga0207641_10005247 Ga0207641_100052477 433
429 3300026095 Ga0207676_10000087 Ga0207676_1000008744 433
430 3300026095 Ga0207676_10283934 Ga0207676_102839341 433
431 3300026116 Ga0207674_10015660 Ga0207674_100156609 433
432 3300026118 Ga0207675_100186138 Ga0207675_1001861382 433
433 3300026121 Ga0207683_10007580 Ga0207683_100075807 433
434 3300026142 Ga0207698_10011829 Ga0207698_100118291 433
435 3300028379 Ga0268266_10000015 Ga0268266_10000015455 433
436 3300028379 Ga0268266_10000800 Ga0268266_1000080024 433
437 3300028379 Ga0268266_10017802 Ga0268266_100178022 433
438 3300028380 Ga0268265_10030171 Ga0268265_100301713 433
439 3300028380 Ga0268265_10181559 Ga0268265_101815592 433
440 3300031251 Ga0265327_10005240 Ga0265327_1000524016 433
441 3300031456 Ga0307513_10005039 Ga0307513_100050393 433
442 3300031548 Ga0307408_100080500 Ga0307408_1000805001 433
443 3300031731 Ga0307405_10099603 Ga0307405_100996032 433
444 3300031824 Ga0307413_10001468 Ga0307413_100014689 433
445 3300031824 Ga0307413_10005709 Ga0307413_100057092 433
446 3300031824 Ga0307413_10010862 Ga0307413_100108622 433
447 3300031824 Ga0307413_10111020 Ga0307413_101110202 433
448 3300031824 Ga0307413_10158372 Ga0307413_101583722 433
449 3300031852 Ga0307410_10003610 Ga0307410_100036108 433
450 3300031852 Ga0307410_10016374 Ga0307410_100163744 433
451 3300031852 Ga0307410_10046002 Ga0307410_100460024 433
452 3300031911 Ga0307412_10000805 Ga0307412_1000080510 433
453 3300031911 Ga0307412_10046590 Ga0307412_100465902 433
454 3300031995 Ga0307409_100001714 Ga0307409_1000017144 433
455 3300032002 Ga0307416_100090531 Ga0307416_1000905313 433
456 3300032002 Ga0307416_100103041 Ga0307416_1001030412 433
457 3300032004 Ga0307414_10003727 Ga0307414_100037276 433
458 3300032004 Ga0307414_10023772 Ga0307414_100237722 433
459 3300032004 Ga0307414_10080986 Ga0307414_100809862 433
460 3300032004 Ga0307414_10088170 Ga0307414_100881702 433
461 3300032005 Ga0307411_10018355 Ga0307411_100183552 433
462 3300032005 Ga0307411_10023473 Ga0307411_100234732 433
463 3300032005 Ga0307411_10063057 Ga0307411_100630572 433
464 3300032005 Ga0307411_10074867 Ga0307411_100748672 433
465 3300037068 Ga0373925_0171687 Ga0373925_0171687_115_1455 433
466 3300037418 Ga0395900_0001825 Ga0395900_0001825_11621_12949 433
467 3300037418 Ga0395900_0175542 Ga0395900_0175542_630_1976 433
468 3300037466 Ga0395898_0084365 Ga0395898_0084365_1580_2926 433
469 3300037471 Ga0395905_0000128 Ga0395905_0000128_85494_86822 433
470 3300037471 Ga0395905_0005732 Ga0395905_0005732_3575_4879 433
471 3300037471 Ga0395905_0015723 Ga0395905_0015723_2675_4021 433
472 3300038443 Ga0395901_0055064 Ga0395901_0055064_412_1740 433
473 3300041410 Ga0439461_0000264 Ga0439461_0000264_6104_7417 433
474 3300041413 Ga0439465_0000472 Ga0439465_0000472_4954_6267 433
475 3300041997 Ga0439431_0000300 Ga0439431_0000300_6169_7482 433
476 3300042002 Ga0439442_002932 Ga0439442_002932_228_1541 433
477 3300042006 Ga0439432_002280 Ga0439432_002280_3538_4851 433
478 3300042010 Ga0439452_018759 Ga0439452_018759_222_1535 433
479 3300042015 Ga0439462_0001923 Ga0439462_0001923_1138_2451 433
480 3300042435 Ga0439434_0000095 Ga0439434_0000095_16148_17461 433
481 3300046499 Ga0495594_0048015 Ga0495594_0048015_686_2053 433
482 3300046507 Ga0495606_0000809 Ga0495606_0000809_23730_25043 433
483 3300046507 Ga0495606_0011422 Ga0495606_0011422_1813_3126 433
484 3300046522 Ga0495643_0009120 Ga0495643_0009120_3060_4373 433
485 3300046524 Ga0495648_0000152 Ga0495648_0000152_13282_14595 433
486 3300046648 Ga0495611_0002954 Ga0495611_0002954_2518_3831 433
487 3300046648 Ga0495611_0011861 Ga0495611_0011861_1864_3219 433
488 3300046660 Ga0495625_0001440 Ga0495625_0001440_25968_27281 433
489 3300046684 Ga0495669_0000433 Ga0495669_0000433_17169_18482 433
490 3300046684 Ga0495669_0040720 Ga0495669_0040720_136_1440 433
491 3300047443 Ga0495687_010981 Ga0495687_010981_1085_2398 433
492 3300047470 Ga0495681_0007535 Ga0495681_0007535_3586_4899 433
493 3300047472 Ga0495686_0000650 Ga0495686_0000650_16878_18191 433
494 3300048905 Ga0496102_0000125 Ga0496102_0000125_26667_27980 433
495 3300048906 Ga0496103_0000322 Ga0496103_0000322_26680_27993 433
496 3300048907 Ga0496104_0015178 Ga0496104_0015178_2308_3621 433
497 3300048908 Ga0496105_0000261 Ga0496105_0000261_15376_16689 433
498 3300048914 Ga0496111_0011575 Ga0496111_0011575_2988_4301 433
499 3300048916 Ga0496113_0056296 Ga0496113_0056296_1148_2461 433
500 3300048917 Ga0496114_0001428 Ga0496114_0001428_4274_5587 433
501 3300048918 Ga0496115_0000142 Ga0496115_0000142_36248_37561 433
502 3300048919 Ga0496116_0029403 Ga0496116_0029403_1314_2627 433
503 3300048920 Ga0496117_0001219 Ga0496117_0001219_1040_2353 433
504 3300048921 Ga0496118_0000285 Ga0496118_0000285_51163_52476 433
505 3300048923 Ga0496120_0025661 Ga0496120_0025661_1270_2583 433
506 3300048924 Ga0496121_0001101 Ga0496121_0001101_43859_45172 433
507 3300048926 Ga0496123_0016451 Ga0496123_0016451_1422_2732 433
508 3300048926 Ga0496123_0016583 Ga0496123_0016583_4652_5962 433
509 3300048927 Ga0496124_0000320 Ga0496124_0000320_51146_52459 433
510 3300048927 Ga0496124_0006449 Ga0496124_0006449_6653_7963 433
511 3300048927 Ga0496124_0025914 Ga0496124_0025914_1303_2613 433
512 3300048928 Ga0496125_0001234 Ga0496125_0001234_35573_36886 433
513 3300048929 Ga0496126_0000655 Ga0496126_0000655_36243_37556 433
514 3300048929 Ga0496126_0005994 Ga0496126_0005994_1020_2366 433
515 3300049581 Ga0501047_0006070 Ga0501047_0006070_2739_4097 433
516 3300049585 Ga0501069_0023377 Ga0501069_0023377_1044_2351 433
517 3300049588 Ga0501072_0000844 Ga0501072_0000844_14734_16092 433
518 3300049589 Ga0501073_0007445 Ga0501073_0007445_6297_7655 433
519 3300049674 Ga0501242_002950 Ga0501242_002950_353_1657 433
520 3300049705 Ga0501225_0014233 Ga0501225_0014233_828_2132 433
521 3300049741 Ga0501079_0110693 Ga0501079_0110693_298_1656 433
522 3300049767 Ga0501270_002356 Ga0501270_002356_496_1800 433
523 3300050510 nmdc:mga06r32_69356_c1 nmdc:mga06r32_69356_c1_192_1613 433
524 3300053079 Ga0500610_0000036 Ga0500610_0000036_16118_17431 433
525 3300053087 Ga0500643_007637 Ga0500643_007637_1493_2848 433
526 3300053087 Ga0500643_026815 Ga0500643_026815_427_1782 433
527 3300053096 Ga0500641_0003987 Ga0500641_0003987_3222_4577 433
528 3300053096 Ga0500641_0006677 Ga0500641_0006677_1750_3054 433
529 3300053104 Ga0500556_0002605 Ga0500556_0002605_4204_5559 433
530 3300053104 Ga0500556_0016379 Ga0500556_0016379_295_1650 433
531 3300053108 Ga0500562_000724 Ga0500562_000724_1560_2915 433
532 3300053136 Ga0500559_0000048 Ga0500559_0000048_71747_73186 433
533 3300053156 Ga0500622_0011684 Ga0500622_0011684_169_1524 433
534 3300053156 Ga0500622_0036597 Ga0500622_0036597_939_2315 433
535 3300053730 Ga0500645_001524 Ga0500645_001524_1772_3127 433
536 3300053735 Ga0500596_000319 Ga0500596_000319_3304_4617 433
537 3300003773 Ga0055537_1003620 Ga0055537_10036204 434
538 3300003775 Ga0055524_1000172 Ga0055524_100017272 434
539 3300003791 Ga0055530_10001358 Ga0055530_100013583 434
540 3300003794 Ga0055531_10007465 Ga0055531_100074652 434
541 3300005262 Ga0065165_1000345 Ga0065165_100034512 434
542 3300005355 Ga0070671_100104541 Ga0070671_1001045412 434
543 3300005355 Ga0070671_100203484 Ga0070671_1002034841 434
544 3300005457 Ga0070662_100014743 Ga0070662_1000147435 434
545 3300005459 Ga0068867_100069552 Ga0068867_1000695522 434
546 3300005564 Ga0070664_100250907 Ga0070664_1002509071 434
547 3300009093 Ga0105240_10003577 Ga0105240_1000357711 434
548 3300013306 Ga0163162_10117051 Ga0163162_101170513 434
549 3300025263 Ga0209565_1000007 Ga0209565_1000007452 434
550 3300025263 Ga0209565_1000172 Ga0209565_10001724 434
551 3300025273 Ga0209673_1000796 Ga0209673_100079633 434
552 3300025292 Ga0209676_1000316 Ga0209676_10003167 434
553 3300025295 Ga0209564_1002843 Ga0209564_10028437 434
554 3300025297 Ga0209758_1002605 Ga0209758_10026059 434
555 3300025298 Ga0209050_1000010 Ga0209050_1000010717 434
556 3300025298 Ga0209050_1000604 Ga0209050_10006047 434
557 3300025299 Ga0209256_1000008 Ga0209256_1000008294 434
558 3300025303 Ga0209051_1007732 Ga0209051_10077325 434
559 3300025304 Ga0209257_1000027 Ga0209257_1000027359 434
560 3300025304 Ga0209257_1000192 Ga0209257_1000192136 434
561 3300025304 Ga0209257_1001191 Ga0209257_10011919 434
562 3300025304 Ga0209257_1005979 Ga0209257_10059795 434
563 3300025913 Ga0207695_10002758 Ga0207695_1000275829 434
564 3300025931 Ga0207644_10043243 Ga0207644_100432432 434
565 3300025933 Ga0207706_10039609 Ga0207706_100396095 434
566 3300026088 Ga0207641_10061514 Ga0207641_100615141 434
567 3300026095 Ga0207676_10003035 Ga0207676_100030353 434
568 3300026118 Ga0207675_100000666 Ga0207675_10000066635 434
569 3300028794 Ga0307515_10040761 Ga0307515_100407612 434
570 3300031456 Ga0307513_10000649 Ga0307513_1000064911 434
571 3300031456 Ga0307513_10083368 Ga0307513_100833683 434
572 3300033180 Ga0307510_10008609 Ga0307510_100086099 434
573 3300035170 Ga0373943_0022108 Ga0373943_0022108_740_2086 434
574 3300037068 Ga0373925_0000199 Ga0373925_0000199_10909_12255 434
575 3300037418 Ga0395900_0060542 Ga0395900_0060542_1092_2480 434
576 3300037471 Ga0395905_0044731 Ga0395905_0044731_261_1649 434
577 3300038443 Ga0395901_0013736 Ga0395901_0013736_6089_7477 434
578 3300038443 Ga0395901_0050884 Ga0395901_0050884_2686_4029 434
579 3300041997 Ga0439431_0010999 Ga0439431_0010999_105_1418 434
580 3300046453 Ga0495627_000954 Ga0495627_000954_3116_4468 434
581 3300046457 Ga0495590_0000763 Ga0495590_0000763_3742_5094 434
582 3300046460 Ga0495638_0001571 Ga0495638_0001571_10002_11354 434
583 3300046460 Ga0495638_0006650 Ga0495638_0006650_5049_6401 434
584 3300046460 Ga0495638_0028107 Ga0495638_0028107_281_1633 434
585 3300046471 Ga0495650_0000468 Ga0495650_0000468_42483_43835 434
586 3300046506 Ga0495583_0000003 Ga0495583_0000003_450095_451447 434
587 3300046506 Ga0495583_0006990 Ga0495583_0006990_1334_2644 434
588 3300046507 Ga0495606_0012552 Ga0495606_0012552_2891_4243 434
589 3300046512 Ga0495610_0000816 Ga0495610_0000816_9498_10850 434
590 3300046512 Ga0495610_0002953 Ga0495610_0002953_5662_7014 434
591 3300046512 Ga0495610_0005936 Ga0495610_0005936_7048_8400 434
592 3300046513 Ga0495616_0000405 Ga0495616_0000405_18978_20330 434
593 3300046515 Ga0495620_0018404 Ga0495620_0018404_2074_3426 434
594 3300046518 Ga0495631_0008844 Ga0495631_0008844_2887_4239 434
595 3300046519 Ga0495632_0003925 Ga0495632_0003925_1381_2733 434
596 3300046524 Ga0495648_0000107 Ga0495648_0000107_102378_103730 434
597 3300046528 Ga0495642_0002008 Ga0495642_0002008_1924_3285 434
598 3300046530 Ga0495654_0000199 Ga0495654_0000199_20232_21584 434
599 3300046538 Ga0495609_0019732 Ga0495609_0019732_1660_3012 434
600 3300046616 Ga0495668_0000389 Ga0495668_0000389_5286_6638 434
601 3300046616 Ga0495668_0035138 Ga0495668_0035138_1343_2695 434
602 3300046660 Ga0495625_0000707 Ga0495625_0000707_40757_42109 434
603 3300046660 Ga0495625_0004355 Ga0495625_0004355_8410_9762 434
604 3300046660 Ga0495625_0004577 Ga0495625_0004577_7670_9022 434
605 3300046794 Ga0495589_0003192 Ga0495589_0003192_1701_3053 434
606 3300047318 Ga0495636_0045637 Ga0495636_0045637_75_1436 434
607 3300047320 Ga0495672_0007833 Ga0495672_0007833_5905_7257 434
608 3300047323 Ga0495683_0034867 Ga0495683_0034867_941_2293 434
609 3300047469 Ga0495673_0001884 Ga0495673_0001884_10150_11502 434
610 3300047472 Ga0495686_0001170 Ga0495686_0001170_5036_6388 434
611 3300047472 Ga0495686_0006442 Ga0495686_0006442_436_1788 434
612 3300047472 Ga0495686_0016140 Ga0495686_0016140_870_2222 434
613 3300047472 Ga0495686_0020655 Ga0495686_0020655_2788_4113 434
614 3300048905 Ga0496102_0003298 Ga0496102_0003298_10546_11907 434
615 3300048909 Ga0496106_0050742 Ga0496106_0050742_12_1364 434
616 3300048910 Ga0496107_0000039 Ga0496107_0000039_65266_66618 434
617 3300048912 Ga0496109_0053549 Ga0496109_0053549_956_2317 434
618 3300048924 Ga0496121_0006291 Ga0496121_0006291_8015_9367 434
619 3300049459 Ga0495678_002387 Ga0495678_002387_841_2193 434
620 3300049569 Ga0501032_0001548 Ga0501032_0001548_3986_5362 434
621 3300049572 Ga0501036_0033991 Ga0501036_0033991_2894_4270 434
622 3300049573 Ga0501037_0004940 Ga0501037_0004940_2438_3814 434
623 3300049579 Ga0501043_0014517 Ga0501043_0014517_4738_6114 434
624 3300049583 Ga0501067_0000123 Ga0501067_0000123_23507_24883 434
625 3300049584 Ga0501068_0001282 Ga0501068_0001282_9853_11229 434
626 3300049589 Ga0501073_0000002 Ga0501073_0000002_102057_103433 434
627 3300049593 Ga0501077_0000002 Ga0501077_0000002_153405_154781 434
628 3300049742 Ga0501080_0000199 Ga0501080_0000199_13388_14764 434
629 3300050516 nmdc:mga0sz30_6928_c1 nmdc:mga0sz30_6928_c1_16_1368 434
630 3300053087 Ga0500643_003017 Ga0500643_003017_5620_6930 434
631 3300053091 Ga0500647_0054774 Ga0500647_0054774_14_1354 434
632 3300053111 Ga0500572_000052 Ga0500572_000052_22919_24259 434
633 3300053118 Ga0500594_0000117 Ga0500594_0000117_11338_12690 434
634 3300053119 Ga0500595_002453 Ga0500595_002453_5267_6667 434
635 3300053122 Ga0500608_000611 Ga0500608_000611_11756_13108 434
636 3300053125 Ga0500618_000617 Ga0500618_000617_11924_13276 434
637 3300053134 Ga0500658_0036719 Ga0500658_0036719_68_1381 434
638 3300053136 Ga0500559_0000009 Ga0500559_0000009_161507_162859 434
639 3300053136 Ga0500559_0005040 Ga0500559_0005040_4650_6002 434
640 3300053136 Ga0500559_0035175 Ga0500559_0035175_42_1352 434
641 3300053139 Ga0500568_0017483 Ga0500568_0017483_838_2151 434
642 3300053153 Ga0500616_0033237 Ga0500616_0033237_331_1683 434
643 3300053156 Ga0500622_0001045 Ga0500622_0001045_11455_12807 434
644 3300053156 Ga0500622_0021291 Ga0500622_0021291_2037_3389 434
645 3300053158 Ga0500627_0012643 Ga0500627_0012643_489_1841 434
646 3300053730 Ga0500645_000990 Ga0500645_000990_12867_14219 434
647 3300053730 Ga0500645_012044 Ga0500645_012044_616_1926 434
648 3300053731 Ga0500609_000937 Ga0500609_000937_101_1453 434
649 3300053733 Ga0500552_002336 Ga0500552_002336_187_1527 434
650 iso_pu_bacteria 2946787523 2946789212 434
651 3300001915 JGI24741J21665_1003085 JGI24741J21665_10030855 435
652 3300001979 JGI24740J21852_10004068 JGI24740J21852_100040687 435
653 3300001989 JGI24739J22299_10004442 JGI24739J22299_100044427 435
654 3300001990 JGI24737J22298_10000247 JGI24737J22298_100002477 435
655 3300002067 JGI24735J21928_10002583 JGI24735J21928_100025838 435
656 3300003773 Ga0055537_1002000 Ga0055537_10020005 435
657 3300003791 Ga0055530_10000586 Ga0055530_1000058612 435
658 3300003794 Ga0055531_10005543 Ga0055531_100055438 435
659 3300005262 Ga0065165_1000941 Ga0065165_100094110 435
660 3300005262 Ga0065165_1016452 Ga0065165_10164524 435
661 3300005327 Ga0070658_10012645 Ga0070658_1001264510 435
662 3300005327 Ga0070658_10015022 Ga0070658_100150222 435
663 3300005329 Ga0070683_100059652 Ga0070683_1000596522 435
664 3300005337 Ga0070682_100046621 Ga0070682_1000466213 435
665 3300005338 Ga0068868_100001497 Ga0068868_1000014978 435
666 3300005344 Ga0070661_100023224 Ga0070661_1000232242 435
667 3300005366 Ga0070659_100001161 Ga0070659_10000116111 435
668 3300005366 Ga0070659_100006138 Ga0070659_1000061387 435
669 3300005366 Ga0070659_100027632 Ga0070659_1000276322 435
670 3300005455 Ga0070663_100014296 Ga0070663_1000142967 435
671 3300005457 Ga0070662_100088175 Ga0070662_1000881752 435
672 3300005547 Ga0070693_100008209 Ga0070693_1000082097 435
673 3300005548 Ga0070665_100002021 Ga0070665_10000202113 435
674 3300005563 Ga0068855_100009847 Ga0068855_10000984714 435
675 3300005564 Ga0070664_100000464 Ga0070664_10000046423 435
676 3300005617 Ga0068859_100032062 Ga0068859_1000320625 435
677 3300005844 Ga0068862_100120438 Ga0068862_1001204382 435
678 3300005983 Ga0081540_1002750 Ga0081540_10027508 435
679 3300006881 Ga0068865_100000389 Ga0068865_10000038914 435
680 3300006931 Ga0097620_100032062 Ga0097620_1000320624 435
681 3300009098 Ga0105245_10084495 Ga0105245_100844952 435
682 3300009177 Ga0105248_10000170 Ga0105248_1000017076 435
683 3300009177 Ga0105248_10055686 Ga0105248_100556866 435
684 3300013102 Ga0157371_10023869 Ga0157371_100238694 435
685 3300013307 Ga0157372_10069250 Ga0157372_100692505 435
686 3300025250 Ga0209026_1002551 Ga0209026_10025518 435
687 3300025263 Ga0209565_1000089 Ga0209565_10000899 435
688 3300025295 Ga0209564_1009726 Ga0209564_10097264 435
689 3300025298 Ga0209050_1000053 Ga0209050_1000053242 435
690 3300025298 Ga0209050_1010143 Ga0209050_10101434 435
691 3300025302 Ga0207426_1013452 Ga0207426_10134523 435
692 3300025304 Ga0209257_1000289 Ga0209257_100028933 435
693 3300025304 Ga0209257_1003844 Ga0209257_100384410 435
694 3300025909 Ga0207705_10003453 Ga0207705_1000345312 435
695 3300025919 Ga0207657_10004751 Ga0207657_100047512 435
696 3300025919 Ga0207657_10027824 Ga0207657_100278242 435
697 3300025919 Ga0207657_10041820 Ga0207657_100418202 435
698 3300025921 Ga0207652_10004969 Ga0207652_100049699 435
699 3300025927 Ga0207687_10014749 Ga0207687_100147497 435
700 3300025932 Ga0207690_10000142 Ga0207690_1000014211 435
701 3300025938 Ga0207704_10001695 Ga0207704_100016953 435
702 3300025941 Ga0207711_10000374 Ga0207711_1000037416 435
703 3300025941 Ga0207711_10046761 Ga0207711_100467615 435
704 3300025945 Ga0207679_10002863 Ga0207679_100028635 435
705 3300025949 Ga0207667_10018370 Ga0207667_100183707 435
706 3300026023 Ga0207677_10003316 Ga0207677_100033162 435
707 3300026041 Ga0207639_10139878 Ga0207639_101398782 435
708 3300026041 Ga0207639_10183816 Ga0207639_101838162 435
709 3300026067 Ga0207678_10009031 Ga0207678_100090312 435
710 3300026067 Ga0207678_10131918 Ga0207678_101319181 435
711 3300026095 Ga0207676_10045603 Ga0207676_100456032 435
712 3300028379 Ga0268266_10000003 Ga0268266_100000031323 435
713 3300028381 Ga0268264_10078942 Ga0268264_100789423 435
714 3300028786 Ga0307517_10073535 Ga0307517_100735353 435
715 3300031711 Ga0265314_10006363 Ga0265314_100063639 435
716 3300033180 Ga0307510_10080123 Ga0307510_100801234 435
717 3300037312 Ga0395899_0001948 Ga0395899_0001948_10303_11610 435
718 3300037418 Ga0395900_0006995 Ga0395900_0006995_5671_6978 435
719 3300037466 Ga0395898_0014210 Ga0395898_0014210_5040_6347 435
720 3300037466 Ga0395898_0030411 Ga0395898_0030411_684_1991 435
721 3300037466 Ga0395898_0064204 Ga0395898_0064204_1066_2415 435
722 3300038443 Ga0395901_0011351 Ga0395901_0011351_5880_7187 435
723 3300042157 Ga0439458_0000074 Ga0439458_0000074_2108_3415 435
724 3300044694 Ga0466963_0110203 Ga0466963_0110203_508_1815 435
725 3300045976 Ga0466967_0055997 Ga0466967_0055997_1922_3229 435
726 3300045976 Ga0466967_0088996 Ga0466967_0088996_996_2303 435
727 3300046616 Ga0495668_0009041 Ga0495668_0009041_414_1721 435
728 3300046684 Ga0495669_0000007 Ga0495669_0000007_105434_106780 435
729 3300046684 Ga0495669_0000318 Ga0495669_0000318_18123_19469 435
730 3300046684 Ga0495669_0027912 Ga0495669_0027912_702_2009 435
731 3300047445 Ga0495677_0021725 Ga0495677_0021725_118_1425 435
732 3300048907 Ga0496104_0000094 Ga0496104_0000094_60898_62262 435
733 3300048908 Ga0496105_0007066 Ga0496105_0007066_7176_8540 435
734 3300048911 Ga0496108_0025985 Ga0496108_0025985_441_1805 435
735 3300048912 Ga0496109_0014912 Ga0496109_0014912_1690_3054 435
736 3300048912 Ga0496109_0144902 Ga0496109_0144902_39_1346 435
737 3300048913 Ga0496110_0000954 Ga0496110_0000954_11509_12873 435
738 3300048915 Ga0496112_0016768 Ga0496112_0016768_724_2073 435
739 3300048916 Ga0496113_0000109 Ga0496113_0000109_32574_33938 435
740 3300048918 Ga0496115_0000784 Ga0496115_0000784_4397_5746 435
741 3300049570 Ga0501033_0011462 Ga0501033_0011462_4390_5748 435
742 3300049571 Ga0501034_0004898 Ga0501034_0004898_6397_7755 435
743 3300049573 Ga0501037_0114808 Ga0501037_0114808_55_1413 435
744 3300049581 Ga0501047_0004654 Ga0501047_0004654_2312_3655 435
745 3300049581 Ga0501047_0130014 Ga0501047_0130014_764_2113 435
746 3300049582 Ga0501048_0000615 Ga0501048_0000615_16297_17646 435
747 3300049583 Ga0501067_0019712 Ga0501067_0019712_380_1729 435
748 3300049758 Ga0501241_006104 Ga0501241_006104_876_2204 435
749 3300049823 Ga0501044_0059578 Ga0501044_0059578_1462_2820 435
750 3300050492 nmdc:mga0yw44_124867_c1 nmdc:mga0yw44_124867_c1_59_1396 435
751 3300050494 nmdc:mga06z11_9336_c1 nmdc:mga06z11_9336_c1_2489_3826 435
752 3300053094 Ga0500566_0001038 Ga0500566_0001038_4538_5866 435
753 3300053096 Ga0500641_0005963 Ga0500641_0005963_2863_4206 435
754 3300053108 Ga0500562_003755 Ga0500562_003755_2162_3523 435
755 3300053134 Ga0500658_0000037 Ga0500658_0000037_51557_52864 435
756 3300053153 Ga0500616_0009567 Ga0500616_0009567_708_2048 435
757 3300002774 JGI25150J39212_1000177 JGI25150J39212_100017736 436
758 3300003187 JGI25151J46595_10029424 JGI25151J46595_100294241 436
759 3300003215 JGI25153J46596_10000153 JGI25153J46596_1000015352 436
760 3300005327 Ga0070658_10101106 Ga0070658_101011061 436
761 3300005331 Ga0070670_100162912 Ga0070670_1001629122 436
762 3300005338 Ga0068868_100000021 Ga0068868_10000002175 436
763 3300005339 Ga0070660_100004476 Ga0070660_1000044769 436
764 3300005341 Ga0070691_10001596 Ga0070691_100015965 436
765 3300005341 Ga0070691_10018081 Ga0070691_100180812 436
766 3300005366 Ga0070659_100000027 Ga0070659_100000027100 436
767 3300005366 Ga0070659_100226012 Ga0070659_1002260121 436
768 3300005435 Ga0070714_100000769 Ga0070714_10000076921 436
769 3300005458 Ga0070681_10019769 Ga0070681_100197693 436
770 3300005458 Ga0070681_10053345 Ga0070681_100533452 436
771 3300005530 Ga0070679_100043339 Ga0070679_1000433392 436
772 3300005539 Ga0068853_100154613 Ga0068853_1001546132 436
773 3300005563 Ga0068855_100042440 Ga0068855_1000424406 436
774 3300005563 Ga0068855_100060501 Ga0068855_1000605012 436
775 3300005937 Ga0081455_10000100 Ga0081455_1000010078 436
776 3300005983 Ga0081540_1045461 Ga0081540_10454612 436
777 3300005985 Ga0081539_10024820 Ga0081539_100248203 436
778 3300009093 Ga0105240_10031721 Ga0105240_100317212 436
779 3300009093 Ga0105240_10122781 Ga0105240_101227814 436
780 3300009545 Ga0105237_10056680 Ga0105237_100566804 436
781 3300009551 Ga0105238_10227325 Ga0105238_102273252 436
782 3300013104 Ga0157370_10019472 Ga0157370_100194726 436
783 3300025245 Ga0207425_1000019 Ga0207425_1000019323 436
784 3300025294 Ga0209025_1000304 Ga0209025_100030442 436
785 3300025297 Ga0209758_1000019 Ga0209758_1000019264 436
786 3300025298 Ga0209050_1017409 Ga0209050_10174092 436
787 3300025304 Ga0209257_1001845 Ga0209257_10018453 436
788 3300025893 Ga0207682_10014983 Ga0207682_100149832 436
789 3300025909 Ga0207705_10000058 Ga0207705_10000058153 436
790 3300025912 Ga0207707_10005208 Ga0207707_100052089 436
791 3300025913 Ga0207695_10011899 Ga0207695_1001189911 436
792 3300025913 Ga0207695_10027405 Ga0207695_100274055 436
793 3300025913 Ga0207695_10032586 Ga0207695_100325865 436
794 3300025919 Ga0207657_10002881 Ga0207657_100028819 436
795 3300025919 Ga0207657_10003546 Ga0207657_100035469 436
796 3300025919 Ga0207657_10033675 Ga0207657_100336752 436
797 3300025921 Ga0207652_10001178 Ga0207652_1000117813 436
798 3300025923 Ga0207681_10009243 Ga0207681_100092437 436
799 3300025925 Ga0207650_10058633 Ga0207650_100586334 436
800 3300025929 Ga0207664_10001066 Ga0207664_1000106617 436
801 3300025931 Ga0207644_10120201 Ga0207644_101202012 436
802 3300025932 Ga0207690_10000161 Ga0207690_1000016127 436
803 3300025933 Ga0207706_10004879 Ga0207706_100048797 436
804 3300025945 Ga0207679_10053471 Ga0207679_100534712 436
805 3300025949 Ga0207667_10273244 Ga0207667_102732442 436
806 3300026023 Ga0207677_10000036 Ga0207677_1000003663 436
807 3300026041 Ga0207639_10047490 Ga0207639_100474902 436
808 3300031251 Ga0265327_10000110 Ga0265327_1000011051 436
809 3300031344 Ga0265316_10082109 Ga0265316_100821093 436
810 3300031456 Ga0307513_10000100 Ga0307513_1000010048 436
811 3300031712 Ga0265342_10043807 Ga0265342_100438073 436
812 3300031824 Ga0307413_10000417 Ga0307413_1000041714 436
813 3300031903 Ga0307407_10009898 Ga0307407_100098983 436
814 3300031911 Ga0307412_10066101 Ga0307412_100661012 436
815 3300031995 Ga0307409_100012813 Ga0307409_1000128135 436
816 3300032002 Ga0307416_100015498 Ga0307416_1000154982 436
817 3300032126 Ga0307415_100001725 Ga0307415_1000017255 436
818 3300032126 Ga0307415_100043012 Ga0307415_1000430122 436
819 3300035695 Ga0373927_0050106 Ga0373927_0050106_1116_2474 436
820 3300036401 Ga0373937_0071228 Ga0373937_0071228_1707_3059 436
821 3300036401 Ga0373937_0098781 Ga0373937_0098781_798_2156 436
822 3300036401 Ga0373937_0146980 Ga0373937_0146980_143_1495 436
823 3300037418 Ga0395900_0000002 Ga0395900_0000002_219868_221229 436
824 3300037466 Ga0395898_0035284 Ga0395898_0035284_2001_3371 436
825 3300037471 Ga0395905_0014029 Ga0395905_0014029_430_1791 436
826 3300038443 Ga0395901_0000021 Ga0395901_0000021_73665_75026 436
827 3300046536 Ga0495587_0075380 Ga0495587_0075380_259_1581 436
828 3300046684 Ga0495669_0018193 Ga0495669_0018193_1603_2916 436
829 3300046689 Ga0495613_0001950 Ga0495613_0001950_7109_8455 436
830 3300047322 Ga0495680_0108286 Ga0495680_0108286_407_1759 436
831 3300048927 Ga0496124_0000576 Ga0496124_0000576_49526_50881 436
832 3300049573 Ga0501037_0087637 Ga0501037_0087637_419_1774 436
833 3300049579 Ga0501043_0011753 Ga0501043_0011753_4216_5571 436
834 3300049581 Ga0501047_0167660 Ga0501047_0167660_176_1531 436
835 3300049586 Ga0501070_0000111 Ga0501070_0000111_22345_23700 436
836 3300049742 Ga0501080_0002278 Ga0501080_0002278_12746_14101 436
837 3300049822 Ga0501035_0002698 Ga0501035_0002698_5448_6803 436
838 3300049822 Ga0501035_0247831 Ga0501035_0247831_98_1450 436
839 3300049823 Ga0501044_0001302 Ga0501044_0001302_24058_25413 436
840 3300049823 Ga0501044_0038309 Ga0501044_0038309_1714_3069 436
841 3300053136 Ga0500559_0061298 Ga0500559_0061298_254_1615 436
842 3300053151 Ga0500604_0000087 Ga0500604_0000087_73_1401 436
843 3300061734 Ga0530510_0062093 Ga0530510_0062093_662_2008 436
844 iso_pu_bacteria 2738541275 2738711597 436
845 iso_pu_bacteria 2738541301 2738850022 436
846 iso_pu_bacteria 2738541304 2738865751 436
847 iso_pu_bacteria 2738543022 2739298269 436
848 iso_pu_bacteria 2738543033 2739359947 436
849 iso_pu_bacteria 2928959182 2928961680 436
850 3300002987 JGI25159J45721_1003172 JGI25159J45721_10031722 437
851 3300003187 JGI25151J46595_10000335 JGI25151J46595_1000033525 437
852 3300003214 JGI25165J46597_1000208 JGI25165J46597_100020884 437
853 3300005530 Ga0070679_100028982 Ga0070679_1000289822 437
854 3300005618 Ga0068864_100000928 Ga0068864_10000092822 437
855 3300005842 Ga0068858_100000137 Ga0068858_10000013770 437
856 3300006042 Ga0075368_10000517 Ga0075368_100005177 437
857 3300006051 Ga0075364_10017758 Ga0075364_100177582 437
858 3300006178 Ga0075367_10002637 Ga0075367_100026374 437
859 3300006186 Ga0075369_10010903 Ga0075369_100109034 437
860 3300009177 Ga0105248_10039321 Ga0105248_100393215 437
861 3300015690 Ga0183363_1001 Ga0183363_1001399 437
862 3300021384 Ga0213876_10000522 Ga0213876_1000052230 437
863 3300021388 Ga0213875_10000101 Ga0213875_1000010194 437
864 3300025261 Ga0209233_1000186 Ga0209233_100018654 437
865 3300025284 Ga0209130_1000616 Ga0209130_100061628 437
866 3300025297 Ga0209758_1005251 Ga0209758_10052517 437
867 3300025302 Ga0207426_1000191 Ga0207426_1000191135 437
868 3300025941 Ga0207711_10063192 Ga0207711_100631923 437
869 3300026035 Ga0207703_10000330 Ga0207703_1000033011 437
870 3300026095 Ga0207676_10003136 Ga0207676_1000313610 437
871 3300027866 Ga0209813_10000130 Ga0209813_1000013023 437
872 3300028786 Ga0307517_10016334 Ga0307517_100163341 437
873 3300031241 Ga0265325_10000888 Ga0265325_1000088814 437
874 3300031456 Ga0307513_10015216 Ga0307513_100152164 437
875 3300031507 Ga0307509_10165295 Ga0307509_101652952 437
876 3300031595 Ga0265313_10000395 Ga0265313_1000039531 437
877 3300031616 Ga0307508_10012843 Ga0307508_100128435 437
878 3300031711 Ga0265314_10002588 Ga0265314_100025882 437
879 3300031712 Ga0265342_10047984 Ga0265342_100479842 437
880 3300037853 Ga0436364_0188471 Ga0436364_0188471_41733_43058 437
881 3300039437 Ga0436365_0298223 Ga0436365_0298223_45988_47346 437
882 3300042876 Ga0451577_0060900 Ga0451577_0060900_510_1952 437
883 3300046506 Ga0495583_0019104 Ga0495583_0019104_1286_2611 437
884 3300046512 Ga0495610_0013934 Ga0495610_0013934_280_1683 437
885 3300046524 Ga0495648_0023970 Ga0495648_0023970_81_1412 437
886 3300046538 Ga0495609_0016617 Ga0495609_0016617_147_1499 437
887 3300046542 Ga0495597_0001614 Ga0495597_0001614_636_1988 437
888 3300046557 Ga0495622_0002247 Ga0495622_0002247_5260_6612 437
889 3300046809 Ga0495600_0001465 Ga0495600_0001465_5393_6718 437
890 3300047443 Ga0495687_050161 Ga0495687_050161_222_1574 437
891 3300048088 Ga0495602_0057744 Ga0495602_0057744_420_1772 437
892 3300048921 Ga0496118_0003370 Ga0496118_0003370_18049_19401 437
893 3300048924 Ga0496121_0000042 Ga0496121_0000042_88340_89692 437
894 3300049570 Ga0501033_0172764 Ga0501033_0172764_56_1399 437
895 3300049573 Ga0501037_0005708 Ga0501037_0005708_1817_3181 437
896 3300049578 Ga0501042_0094542 Ga0501042_0094542_160_1509 437
897 3300049591 Ga0501075_0110505 Ga0501075_0110505_356_1705 437
898 3300049592 Ga0501076_0021665 Ga0501076_0021665_3436_4785 437
899 3300049741 Ga0501079_0011214 Ga0501079_0011214_5354_6703 437
900 3300049742 Ga0501080_0042676 Ga0501080_0042676_186_1535 437
901 3300049823 Ga0501044_0100855 Ga0501044_0100855_355_1719 437
902 3300050489 nmdc:mga03683_1197_c1 nmdc:mga03683_1197_c1_2226_3560 437
903 3300050490 nmdc:mga03n38_26053_c1 nmdc:mga03n38_26053_c1_355_1689 437
904 3300050495 nmdc:mga04h51_269_c1 nmdc:mga04h51_269_c1_7149_8483 437
905 3300050496 nmdc:mga07m45_90_c1 nmdc:mga07m45_90_c1_4628_5962 437
906 3300053080 Ga0500635_0000172 Ga0500635_0000172_23684_25036 437
907 3300053109 Ga0500569_004798 Ga0500569_004798_198_1550 437
908 3300053119 Ga0500595_000530 Ga0500595_000530_20675_22000 437
909 3300053122 Ga0500608_009357 Ga0500608_009357_242_1594 437
910 3300053130 Ga0500642_0022234 Ga0500642_0022234_23_1375 437
911 3300053136 Ga0500559_0015075 Ga0500559_0015075_949_2301 437
912 3300053139 Ga0500568_0000005 Ga0500568_0000005_244234_245613 437
913 3300053140 Ga0500573_0000093 Ga0500573_0000093_19830_21152 437
914 3300053154 Ga0500619_008512 Ga0500619_008512_1054_2379 437
915 3300053157 Ga0500624_002025 Ga0500624_002025_1416_2768 437
916 3300053162 Ga0500638_014057 Ga0500638_014057_1668_3020 437
917 3300053177 Ga0500636_0036753 Ga0500636_0036753_212_1564 437
918 3300053178 Ga0500637_0001181 Ga0500637_0001181_8896_10248 437
919 3300054114 Ga0501084_0018673 Ga0501084_0018673_1413_2762 437
920 3300060353 Ga0501082_0087818 Ga0501082_0087818_774_2123 437
921 3300061734 Ga0530510_0006937 Ga0530510_0006937_2612_3961 437
922 iso_pu_bacteria 2582581305 2585260335 437
923 iso_pu_bacteria 3000865235 3000867721 437
924 3300003792 Ga0055540_1002368 Ga0055540_10023684 438
925 3300005331 Ga0070670_100000004 Ga0070670_100000004182 438
926 3300005341 Ga0070691_10006308 Ga0070691_100063087 438
927 3300005347 Ga0070668_100002111 Ga0070668_1000021115 438
928 3300005367 Ga0070667_100000067 Ga0070667_10000006798 438
929 3300005367 Ga0070667_100000175 Ga0070667_10000017540 438
930 3300005406 Ga0070703_10004937 Ga0070703_100049373 438
931 3300005440 Ga0070705_100001889 Ga0070705_1000018893 438
932 3300005444 Ga0070694_100107816 Ga0070694_1001078161 438
933 3300005455 Ga0070663_100015593 Ga0070663_1000155932 438
934 3300005518 Ga0070699_100015869 Ga0070699_1000158693 438
935 3300005536 Ga0070697_100047807 Ga0070697_1000478072 438
936 3300005545 Ga0070695_100008458 Ga0070695_1000084583 438
937 3300005546 Ga0070696_100000340 Ga0070696_1000003403 438
938 3300005547 Ga0070693_100092286 Ga0070693_1000922861 438
939 3300005548 Ga0070665_100032162 Ga0070665_1000321624 438
940 3300005549 Ga0070704_100002065 Ga0070704_10000206512 438
941 3300005577 Ga0068857_100016189 Ga0068857_1000161893 438
942 3300005617 Ga0068859_100006366 Ga0068859_10000636612 438
943 3300005618 Ga0068864_100000082 Ga0068864_10000008249 438
944 3300005618 Ga0068864_100077377 Ga0068864_1000773773 438
945 3300005841 Ga0068863_100000038 Ga0068863_10000003896 438
946 3300005841 Ga0068863_100000597 Ga0068863_10000059711 438
947 3300005842 Ga0068858_100031945 Ga0068858_1000319454 438
948 3300005843 Ga0068860_100000077 Ga0068860_100000077182 438
949 3300005843 Ga0068860_100013711 Ga0068860_1000137113 438
950 3300005843 Ga0068860_100019195 Ga0068860_1000191957 438
951 3300005844 Ga0068862_100000183 Ga0068862_10000018361 438
952 3300005844 Ga0068862_100001800 Ga0068862_1000018003 438
953 3300005937 Ga0081455_10000041 Ga0081455_10000041101 438
954 3300005983 Ga0081540_1000091 Ga0081540_100009136 438
955 3300006042 Ga0075368_10011642 Ga0075368_100116425 438
956 3300006048 Ga0075363_100006499 Ga0075363_1000064993 438
957 3300006048 Ga0075363_100061646 Ga0075363_1000616462 438
958 3300006051 Ga0075364_10008317 Ga0075364_100083177 438
959 3300006058 Ga0075432_10022132 Ga0075432_100221322 438
960 3300006178 Ga0075367_10019406 Ga0075367_100194064 438
961 3300006195 Ga0075366_10015605 Ga0075366_100156052 438
962 3300006931 Ga0097620_100006366 Ga0097620_1000063663 438
963 3300009094 Ga0111539_10033514 Ga0111539_100335142 438
964 3300009098 Ga0105245_10016411 Ga0105245_100164117 438
965 3300009177 Ga0105248_10087489 Ga0105248_100874893 438
966 3300009553 Ga0105249_10000438 Ga0105249_100004387 438
967 3300025295 Ga0209564_1007077 Ga0209564_10070772 438
968 3300025298 Ga0209050_1000001 Ga0209050_10000011329 438
969 3300025303 Ga0209051_1000309 Ga0209051_100030940 438
970 3300025304 Ga0209257_1001776 Ga0209257_10017763 438
971 3300025885 Ga0207653_10006282 Ga0207653_100062822 438
972 3300025917 Ga0207660_10015333 Ga0207660_100153333 438
973 3300025925 Ga0207650_10000118 Ga0207650_1000011891 438
974 3300025927 Ga0207687_10017758 Ga0207687_100177586 438
975 3300025927 Ga0207687_10153690 Ga0207687_101536902 438
976 3300025944 Ga0207661_10073728 Ga0207661_100737282 438
977 3300025961 Ga0207712_10022800 Ga0207712_100228004 438
978 3300025972 Ga0207668_10000464 Ga0207668_1000046426 438
979 3300025972 Ga0207668_10002103 Ga0207668_100021032 438
980 3300025986 Ga0207658_10000089 Ga0207658_1000008935 438
981 3300025986 Ga0207658_10000229 Ga0207658_100002295 438
982 3300026035 Ga0207703_10008806 Ga0207703_100088064 438
983 3300026067 Ga0207678_10019581 Ga0207678_100195813 438
984 3300026088 Ga0207641_10000060 Ga0207641_1000006065 438
985 3300026088 Ga0207641_10001900 Ga0207641_1000190010 438
986 3300026088 Ga0207641_10047698 Ga0207641_100476982 438
987 3300026095 Ga0207676_10000068 Ga0207676_1000006832 438
988 3300026116 Ga0207674_10002013 Ga0207674_100020133 438
989 3300027866 Ga0209813_10003413 Ga0209813_100034133 438
990 3300027907 Ga0207428_10061903 Ga0207428_100619032 438
991 3300028379 Ga0268266_10019517 Ga0268266_100195174 438
992 3300028380 Ga0268265_10000500 Ga0268265_100005009 438
993 3300028380 Ga0268265_10001504 Ga0268265_1000150421 438
994 3300028381 Ga0268264_10000032 Ga0268264_10000032233 438
995 3300028381 Ga0268264_10009741 Ga0268264_100097416 438
996 3300028381 Ga0268264_10040418 Ga0268264_100404185 438
997 3300031824 Ga0307413_10014827 Ga0307413_100148272 438
998 3300035114 Ga0373939_0006034 Ga0373939_0006034_481_1863 438
999 3300035114 Ga0373939_0020890 Ga0373939_0020890_63_1445 438
1000 3300035115 Ga0373941_0002377 Ga0373941_0002377_1216_2598 438
1001 3300035115 Ga0373941_0012176 Ga0373941_0012176_722_2104 438
1002 3300035241 Ga0373961_0006445 Ga0373961_0006445_309_1691 438
1003 3300035691 Ga0373931_0000951 Ga0373931_0000951_9824_11206 438
1004 3300038705 Ga0237819_02124 Ga0237819_02124_789_2120 438
1005 3300039437 Ga0436365_0938205 Ga0436365_0938205_121_1437 438
1006 3300039437 Ga0436365_1145611 Ga0436365_1145611_574_1929 438
1007 3300041456 Ga0451795_0707270 Ga0451795_0707270_74_1399 438
1008 3300046460 Ga0495638_0000613 Ga0495638_0000613_24319_25641 438
1009 3300046471 Ga0495650_0004694 Ga0495650_0004694_4632_5966 438
1010 3300046528 Ga0495642_0029966 Ga0495642_0029966_824_2140 438
1011 3300046660 Ga0495625_0013497 Ga0495625_0013497_1553_2875 438
1012 3300046660 Ga0495625_0047436 Ga0495625_0047436_526_1848 438
1013 3300047472 Ga0495686_0016988 Ga0495686_0016988_277_1599 438
1014 3300047472 Ga0495686_0040060 Ga0495686_0040060_1511_2902 438
1015 3300048918 Ga0496115_0017296 Ga0496115_0017296_4101_5447 438
1016 3300048924 Ga0496121_0000022 Ga0496121_0000022_47653_48984 438
1017 3300048924 Ga0496121_0015763 Ga0496121_0015763_598_1920 438
1018 3300048928 Ga0496125_0096407 Ga0496125_0096407_246_1616 438
1019 3300049513 Ga0501290_000033 Ga0501290_000033_15412_16731 438
1020 3300049515 Ga0501292_000026 Ga0501292_000026_18774_20093 438
1021 3300049517 Ga0501294_000779 Ga0501294_000779_245_1564 438
1022 3300049523 Ga0501300_005984 Ga0501300_005984_110_1429 438
1023 3300049571 Ga0501034_0026896 Ga0501034_0026896_2934_4349 438
1024 3300049581 Ga0501047_0007181 Ga0501047_0007181_6901_8316 438
1025 3300049589 Ga0501073_0005548 Ga0501073_0005548_5163_6578 438
1026 3300049662 Ga0501222_000709 Ga0501222_000709_522_1841 438
1027 3300049663 Ga0501223_009167 Ga0501223_009167_172_1491 438
1028 3300049668 Ga0501233_006677 Ga0501233_006677_370_1689 438
1029 3300049690 Ga0501261_000055 Ga0501261_000055_16090_17409 438
1030 3300049742 Ga0501080_0001583 Ga0501080_0001583_17079_18494 438
1031 3300049744 Ga0501083_0007263 Ga0501083_0007263_4051_5466 438
1032 3300049775 Ga0501279_000027 Ga0501279_000027_510_1829 438
1033 3300049776 Ga0501280_000543 Ga0501280_000543_1080_2399 438
1034 3300049777 Ga0501281_00070 Ga0501281_00070_6396_7715 438
1035 3300049779 Ga0501283_001097 Ga0501283_001097_434_1753 438
1036 3300049822 Ga0501035_0133714 Ga0501035_0133714_38_1453 438
1037 3300049823 Ga0501044_0019159 Ga0501044_0019159_4246_5661 438
1038 3300050490 nmdc:mga03n38_38213_c1 nmdc:mga03n38_38213_c1_308_1684 438
1039 3300050491 nmdc:mga00v17_481_c1 nmdc:mga00v17_481_c1_10772_12127 438
1040 3300050493 nmdc:mga0k408_87211_c1 nmdc:mga0k408_87211_c1_212_1567 438
1041 3300050494 nmdc:mga06z11_4155_c1 nmdc:mga06z11_4155_c1_902_2257 438
1042 3300050495 nmdc:mga04h51_1548_c1 nmdc:mga04h51_1548_c1_1289_2644 438
1043 3300050495 nmdc:mga04h51_879_c1 nmdc:mga04h51_879_c1_3491_4867 438
1044 3300050511 nmdc:mga08y16_52472_c1 nmdc:mga08y16_52472_c1_1207_2589 438
1045 3300053134 Ga0500658_0000225 Ga0500658_0000225_24464_25786 438
1046 3300060353 Ga0501082_0007636 Ga0501082_0007636_1924_3339 438
1047 iso_pu_bacteria 2523231067 2523466790 438
1048 iso_pu_bacteria 2738543031 2739351006 438
1049 iso_pu_bacteria 2739367756 2739792758 438
1050 iso_pu_bacteria 2844533157 2844537473 438
1051 3300005544 Ga0070686_100000152 Ga0070686_10000015223 439
1052 3300009098 Ga0105245_10028937 Ga0105245_100289377 439
1053 3300021384 Ga0213876_10088540 Ga0213876_100885402 439
1054 3300028786 Ga0307517_10004144 Ga0307517_100041443 439
1055 3300031456 Ga0307513_10004370 Ga0307513_100043704 439
1056 3300039437 Ga0436365_0616457 Ga0436365_0616457_9063_10382 439
1057 3300039437 Ga0436365_1574866 Ga0436365_1574866_1822_3207 439
1058 3300042142 Ga0450905_003894 Ga0450905_003894_463_1797 439
1059 3300049570 Ga0501033_0107904 Ga0501033_0107904_498_1877 439
1060 3300049823 Ga0501044_0013907 Ga0501044_0013907_1182_2612 439
1061 3300053125 Ga0500618_002790 Ga0500618_002790_3342_4676 439
1062 iso_pu_bacteria 2643221560 2643821161 439
1063 iso_pu_bacteria 2643221563 2643832720 439
1064 iso_pu_bacteria 2643221606 2644045836 439
1065 iso_pu_bacteria 2643221608 2644053485 439
1066 iso_pu_bacteria 2643221671 2644393413 439
1067 iso_pu_bacteria 2941485952 2941488108 439
1068 3300005336 Ga0070680_100000705 Ga0070680_10000070516 440
1069 3300005339 Ga0070660_100000197 Ga0070660_10000019726 440
1070 3300005347 Ga0070668_100028298 Ga0070668_1000282983 440
1071 3300005366 Ga0070659_100075209 Ga0070659_1000752092 440
1072 3300005563 Ga0068855_100020437 Ga0068855_1000204372 440
1073 3300006177 Ga0075362_10000119 Ga0075362_1000011915 440
1074 3300006186 Ga0075369_10001089 Ga0075369_100010899 440
1075 3300006195 Ga0075366_10000014 Ga0075366_1000001441 440
1076 3300025919 Ga0207657_10001791 Ga0207657_1000179118 440
1077 3300025932 Ga0207690_10003702 Ga0207690_1000370211 440
1078 3300025949 Ga0207667_10002049 Ga0207667_100020498 440
1079 3300025972 Ga0207668_10021931 Ga0207668_100219313 440
1080 3300037471 Ga0395905_0000108 Ga0395905_0000108_40342_41709 440
1081 3300047472 Ga0495686_0003469 Ga0495686_0003469_6406_7773 440
1082 3300048922 Ga0496119_0016109 Ga0496119_0016109_3014_4366 440
1083 3300049571 Ga0501034_0154648 Ga0501034_0154648_881_2203 440
1084 3300049581 Ga0501047_0014549 Ga0501047_0014549_136_1569 440
1085 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_100701_102080 440
1086 3300053087 Ga0500643_001378 Ga0500643_001378_10313_11707 440
1087 3300053093 Ga0500651_0023648 Ga0500651_0023648_720_2207 440
1088 iso_pu_bacteria 2643221574 2643882176 440
1089 iso_pu_bacteria 2643221699 2644547802 440
1090 iso_pu_bacteria 2808606401 2809061877 440
1091 iso_pu_bacteria 2808606404 2809077841 440
1092 iso_pu_bacteria 2808606405 2809082451 440
1093 iso_pu_bacteria 2818991438 2819551350 440
1094 iso_pu_bacteria 2919709256 2919711128 440
1095 iso_pu_bacteria 2928972540 2928973439 440
1096 iso_pu_bacteria 2977240413 2977240583 440
1097 3300005563 Ga0068855_100002675 Ga0068855_10000267513 441
1098 3300006847 Ga0075431_100002734 Ga0075431_10000273412 441
1099 3300009177 Ga0105248_10006314 Ga0105248_1000631410 441
1100 3300011119 Ga0105246_10000589 Ga0105246_100005891 441
1101 3300013100 Ga0157373_10002751 Ga0157373_100027512 441
1102 3300014326 Ga0157380_10051725 Ga0157380_100517253 441
1103 3300025933 Ga0207706_10010885 Ga0207706_100108854 441
1104 3300025949 Ga0207667_10012946 Ga0207667_1001294611 441
1105 3300032004 Ga0307414_10039436 Ga0307414_100394363 441
1106 3300032133 Ga0316583_10001134 Ga0316583_100011343 441
1107 3300037853 Ga0436364_0582923 Ga0436364_0582923_363_1751 441
1108 3300039450 Ga0436363_0707542 Ga0436363_0707542_265_1653 441
1109 3300046522 Ga0495643_0026530 Ga0495643_0026530_1233_2573 441
1110 3300046616 Ga0495668_0032711 Ga0495668_0032711_830_2170 441
1111 3300046694 Ga0495649_0000118 Ga0495649_0000118_35018_36439 441
1112 3300048927 Ga0496124_0102508 Ga0496124_0102508_778_2190 441
1113 3300048928 Ga0496125_0019180 Ga0496125_0019180_3309_4649 441
1114 3300049568 Ga0501031_0127692 Ga0501031_0127692_55_1392 441
1115 3300049570 Ga0501033_0086258 Ga0501033_0086258_124_1461 441
1116 3300049572 Ga0501036_0019184 Ga0501036_0019184_4231_5568 441
1117 3300049574 Ga0501038_0010812 Ga0501038_0010812_1432_2769 441
1118 3300049581 Ga0501047_0057512 Ga0501047_0057512_1962_3299 441
1119 3300049823 Ga0501044_0093564 Ga0501044_0093564_1454_2791 441
1120 3300050509 nmdc:mga0qj67_10678_c1 nmdc:mga0qj67_10678_c1_1256_2581 441
1121 3300050510 nmdc:mga06r32_5383_c1 nmdc:mga06r32_5383_c1_3775_5106 441
1122 3300053116 Ga0500592_002384 Ga0500592_002384_505_1845 441
1123 3300053125 Ga0500618_004364 Ga0500618_004364_694_2034 441
1124 3300053177 Ga0500636_0007932 Ga0500636_0007932_267_1682 441
1125 iso_pu_bacteria 2643221663 2644351344 441
1126 iso_pu_bacteria 2643221699 2644549109 441
1127 iso_pu_bacteria 2882806704 2882807298 441
1128 iso_pu_bacteria 2896184354 2896185306 441
1129 iso_pu_bacteria 2896253425 2896255696 441
1130 3300005367 Ga0070667_100005409 Ga0070667_1000054098 442
1131 3300005548 Ga0070665_100025272 Ga0070665_1000252726 442
1132 3300005563 Ga0068855_100014465 Ga0068855_1000144653 442
1133 3300005563 Ga0068855_100036162 Ga0068855_1000361625 442
1134 3300005616 Ga0068852_100000142 Ga0068852_10000014232 442
1135 3300005618 Ga0068864_100054564 Ga0068864_1000545642 442
1136 3300005841 Ga0068863_100004185 Ga0068863_10000418510 442
1137 3300005843 Ga0068860_100008925 Ga0068860_1000089254 442
1138 3300009011 Ga0105251_10018337 Ga0105251_100183372 442
1139 3300013102 Ga0157371_10006522 Ga0157371_100065224 442
1140 3300013105 Ga0157369_10071265 Ga0157369_100712654 442
1141 3300025294 Ga0209025_1000179 Ga0209025_1000179121 442
1142 3300025949 Ga0207667_10030277 Ga0207667_100302776 442
1143 3300025949 Ga0207667_10030986 Ga0207667_100309863 442
1144 3300026088 Ga0207641_10005156 Ga0207641_100051569 442
1145 3300026116 Ga0207674_10032601 Ga0207674_100326018 442
1146 3300028379 Ga0268266_10027675 Ga0268266_100276752 442
1147 3300028381 Ga0268264_10000253 Ga0268264_10000253116 442
1148 3300031911 Ga0307412_10014753 Ga0307412_100147533 442
1149 3300032004 Ga0307414_10003221 Ga0307414_100032219 442
1150 3300048919 Ga0496116_0030724 Ga0496116_0030724_2022_3440 442
1151 3300048928 Ga0496125_0001397 Ga0496125_0001397_19224_20642 442
1152 3300049571 Ga0501034_0006655 Ga0501034_0006655_716_2062 442
1153 3300049686 Ga0501257_000040 Ga0501257_000040_2814_4145 442
1154 3300049776 Ga0501280_001354 Ga0501280_001354_2140_3471 442
1155 3300003781 Ga0055536_1017767 Ga0055536_10177671 443
1156 3300005295 Ga0065707_10081814 Ga0065707_100818148 443
1157 3300005327 Ga0070658_10002923 Ga0070658_1000292311 443
1158 3300005327 Ga0070658_10032050 Ga0070658_100320504 443
1159 3300005353 Ga0070669_100072327 Ga0070669_1000723273 443
1160 3300005455 Ga0070663_100106107 Ga0070663_1001061072 443
1161 3300005457 Ga0070662_100010097 Ga0070662_1000100978 443
1162 3300005457 Ga0070662_100036012 Ga0070662_1000360122 443
1163 3300005530 Ga0070679_100002011 Ga0070679_1000020113 443
1164 3300005578 Ga0068854_100002421 Ga0068854_1000024218 443
1165 3300005614 Ga0068856_100017510 Ga0068856_1000175103 443
1166 3300005616 Ga0068852_100000824 Ga0068852_10000082421 443
1167 3300005618 Ga0068864_100007684 Ga0068864_1000076846 443
1168 3300005842 Ga0068858_100131951 Ga0068858_1001319511 443
1169 3300006177 Ga0075362_10027389 Ga0075362_100273892 443
1170 3300009093 Ga0105240_10004776 Ga0105240_1000477614 443
1171 3300009551 Ga0105238_10017709 Ga0105238_100177098 443
1172 3300009551 Ga0105238_10035809 Ga0105238_100358093 443
1173 3300025291 Ga0209675_1000384 Ga0209675_10003842 443
1174 3300025292 Ga0209676_1000421 Ga0209676_100042127 443
1175 3300025292 Ga0209676_1000693 Ga0209676_100069321 443
1176 3300025292 Ga0209676_1001736 Ga0209676_100173614 443
1177 3300025298 Ga0209050_1000112 Ga0209050_100011234 443
1178 3300025298 Ga0209050_1006747 Ga0209050_10067473 443
1179 3300025304 Ga0209257_1000600 Ga0209257_100060028 443
1180 3300025304 Ga0209257_1000877 Ga0209257_100087718 443
1181 3300025909 Ga0207705_10000621 Ga0207705_100006213 443
1182 3300025913 Ga0207695_10003649 Ga0207695_1000364919 443
1183 3300025921 Ga0207652_10003184 Ga0207652_1000318416 443
1184 3300025921 Ga0207652_10097333 Ga0207652_100973332 443
1185 3300025924 Ga0207694_10054264 Ga0207694_100542642 443
1186 3300025933 Ga0207706_10011982 Ga0207706_100119825 443
1187 3300025933 Ga0207706_10027411 Ga0207706_100274113 443
1188 3300025945 Ga0207679_10031822 Ga0207679_100318224 443
1189 3300025949 Ga0207667_10151577 Ga0207667_101515772 443
1190 3300025981 Ga0207640_10006960 Ga0207640_100069606 443
1191 3300026067 Ga0207678_10066353 Ga0207678_100663533 443
1192 3300026078 Ga0207702_10014676 Ga0207702_100146767 443
1193 3300026088 Ga0207641_10000243 Ga0207641_1000024332 443
1194 3300026095 Ga0207676_10026183 Ga0207676_100261832 443
1195 3300026116 Ga0207674_10038271 Ga0207674_100382712 443
1196 3300026142 Ga0207698_10000005 Ga0207698_10000005267 443
1197 3300026142 Ga0207698_10014031 Ga0207698_100140312 443
1198 3300031548 Ga0307408_100245674 Ga0307408_1002456741 443
1199 3300031731 Ga0307405_10011232 Ga0307405_100112322 443
1200 3300031824 Ga0307413_10029026 Ga0307413_100290263 443
1201 3300031852 Ga0307410_10015739 Ga0307410_100157392 443
1202 3300031995 Ga0307409_100109153 Ga0307409_1001091532 443
1203 3300032004 Ga0307414_10001083 Ga0307414_1000108317 443
1204 3300032004 Ga0307414_10007076 Ga0307414_100070764 443
1205 3300032004 Ga0307414_10044478 Ga0307414_100444783 443
1206 3300032004 Ga0307414_10235506 Ga0307414_102355062 443
1207 3300046512 Ga0495610_0010540 Ga0495610_0010540_603_2009 443
1208 3300046522 Ga0495643_0000014 Ga0495643_0000014_55609_56967 443
1209 3300046558 Ga0495633_0000400 Ga0495633_0000400_11633_13090 443
1210 3300046616 Ga0495668_0003831 Ga0495668_0003831_7878_9224 443
1211 3300046660 Ga0495625_0000339 Ga0495625_0000339_16442_17824 443
1212 3300046692 Ga0495671_0000058 Ga0495671_0000058_55609_56967 443
1213 3300047470 Ga0495681_0030101 Ga0495681_0030101_73_1431 443
1214 3300048905 Ga0496102_0000049 Ga0496102_0000049_77884_79227 443
1215 3300048906 Ga0496103_0000037 Ga0496103_0000037_100248_101591 443
1216 3300048919 Ga0496116_0001001 Ga0496116_0001001_29017_30360 443
1217 3300048920 Ga0496117_0000115 Ga0496117_0000115_77884_79227 443
1218 3300048920 Ga0496117_0029261 Ga0496117_0029261_2612_3961 443
1219 3300048921 Ga0496118_0000086 Ga0496118_0000086_100262_101605 443
1220 3300048921 Ga0496118_0023332 Ga0496118_0023332_3859_5208 443
1221 3300048925 Ga0496122_0003299 Ga0496122_0003299_2959_4395 443
1222 3300048926 Ga0496123_0000968 Ga0496123_0000968_38835_40331 443
1223 3300048927 Ga0496124_0000102 Ga0496124_0000102_100262_101605 443
1224 3300048928 Ga0496125_0026259 Ga0496125_0026259_1742_3085 443
1225 3300049571 Ga0501034_0179597 Ga0501034_0179597_609_2027 443
1226 3300049579 Ga0501043_0156785 Ga0501043_0156785_372_1721 443
1227 3300049581 Ga0501047_0001118 Ga0501047_0001118_25212_26561 443
1228 3300049663 Ga0501223_000012 Ga0501223_000012_27647_28996 443
1229 3300053087 Ga0500643_013280 Ga0500643_013280_1139_2482 443
1230 3300053104 Ga0500556_0000044 Ga0500556_0000044_15186_16529 443
1231 3300053108 Ga0500562_001461 Ga0500562_001461_1794_3143 443
1232 3300053116 Ga0500592_000323 Ga0500592_000323_206_1552 443
1233 3300053116 Ga0500592_001827 Ga0500592_001827_898_2235 443
1234 3300053130 Ga0500642_0000008 Ga0500642_0000008_225493_226836 443
1235 3300053139 Ga0500568_0001920 Ga0500568_0001920_4297_5634 443
1236 3300053157 Ga0500624_000130 Ga0500624_000130_4065_5414 443
1237 3300053158 Ga0500627_0000006 Ga0500627_0000006_147668_149005 443
1238 3300053730 Ga0500645_002292 Ga0500645_002292_3515_4858 443
1239 3300001976 JGI24752J21851_1005100 JGI24752J21851_10051002 444
1240 3300002459 JGI24751J29686_10000118 JGI24751J29686_1000011821 444
1241 3300003781 Ga0055536_1000781 Ga0055536_100078116 444
1242 3300005331 Ga0070670_100007458 Ga0070670_1000074589 444
1243 3300005331 Ga0070670_100030976 Ga0070670_1000309762 444
1244 3300005335 Ga0070666_10000408 Ga0070666_1000040812 444
1245 3300005347 Ga0070668_100013147 Ga0070668_1000131473 444
1246 3300005353 Ga0070669_100000109 Ga0070669_10000010942 444
1247 3300005355 Ga0070671_100000020 Ga0070671_10000002042 444
1248 3300005355 Ga0070671_100009247 Ga0070671_1000092472 444
1249 3300005355 Ga0070671_100068538 Ga0070671_1000685382 444
1250 3300005367 Ga0070667_100001088 Ga0070667_10000108818 444
1251 3300005548 Ga0070665_100000878 Ga0070665_10000087832 444
1252 3300005617 Ga0068859_100000452 Ga0068859_1000004526 444
1253 3300005719 Ga0068861_100001980 Ga0068861_10000198012 444
1254 3300005841 Ga0068863_100011189 Ga0068863_1000111899 444
1255 3300005841 Ga0068863_100131813 Ga0068863_1001318132 444
1256 3300005842 Ga0068858_100001141 Ga0068858_1000011418 444
1257 3300005842 Ga0068858_100195628 Ga0068858_1001956282 444
1258 3300005843 Ga0068860_100002654 Ga0068860_1000026548 444
1259 3300005843 Ga0068860_100021477 Ga0068860_1000214772 444
1260 3300005843 Ga0068860_100041470 Ga0068860_1000414702 444
1261 3300005844 Ga0068862_100015404 Ga0068862_1000154042 444
1262 3300005844 Ga0068862_100031339 Ga0068862_1000313392 444
1263 3300006051 Ga0075364_10001169 Ga0075364_100011696 444
1264 3300006175 Ga0070712_100167572 Ga0070712_1001675722 444
1265 3300006177 Ga0075362_10030269 Ga0075362_100302692 444
1266 3300006353 Ga0075370_10002146 Ga0075370_100021465 444
1267 3300006931 Ga0097620_100000452 Ga0097620_1000004526 444
1268 3300009177 Ga0105248_10004550 Ga0105248_1000455014 444
1269 3300009553 Ga0105249_10001111 Ga0105249_1000111120 444
1270 3300013306 Ga0163162_10012113 Ga0163162_100121139 444
1271 3300014326 Ga0157380_10082902 Ga0157380_100829022 444
1272 3300014968 Ga0157379_10005111 Ga0157379_1000511111 444
1273 3300025292 Ga0209676_1000140 Ga0209676_100014094 444
1274 3300025298 Ga0209050_1000254 Ga0209050_100025491 444
1275 3300025304 Ga0209257_1000630 Ga0209257_10006306 444
1276 3300025315 Ga0207697_10000375 Ga0207697_100003758 444
1277 3300025900 Ga0207710_10005667 Ga0207710_100056673 444
1278 3300025903 Ga0207680_10002355 Ga0207680_100023559 444
1279 3300025914 Ga0207671_10004168 Ga0207671_100041686 444
1280 3300025923 Ga0207681_10000042 Ga0207681_10000042129 444
1281 3300025931 Ga0207644_10000034 Ga0207644_1000003442 444
1282 3300025931 Ga0207644_10002034 Ga0207644_100020347 444
1283 3300025941 Ga0207711_10024234 Ga0207711_100242344 444
1284 3300025961 Ga0207712_10002229 Ga0207712_100022297 444
1285 3300025972 Ga0207668_10000668 Ga0207668_1000066820 444
1286 3300025986 Ga0207658_10001929 Ga0207658_1000192910 444
1287 3300025986 Ga0207658_10006621 Ga0207658_100066214 444
1288 3300026035 Ga0207703_10016909 Ga0207703_100169092 444
1289 3300026088 Ga0207641_10011979 Ga0207641_100119794 444
1290 3300026088 Ga0207641_10021125 Ga0207641_100211256 444
1291 3300026118 Ga0207675_100000225 Ga0207675_10000022519 444
1292 3300028379 Ga0268266_10001045 Ga0268266_1000104529 444
1293 3300028379 Ga0268266_10046135 Ga0268266_100461352 444
1294 3300028380 Ga0268265_10000043 Ga0268265_1000004376 444
1295 3300028380 Ga0268265_10080763 Ga0268265_100807632 444
1296 3300028381 Ga0268264_10000154 Ga0268264_1000015434 444
1297 3300028381 Ga0268264_10003985 Ga0268264_1000398510 444
1298 3300028381 Ga0268264_10083068 Ga0268264_100830682 444
1299 3300031691 Ga0316579_10012348 Ga0316579_100123484 444
1300 3300031901 Ga0307406_10020684 Ga0307406_100206844 444
1301 3300031995 Ga0307409_100091403 Ga0307409_1000914033 444
1302 3300032004 Ga0307414_10049975 Ga0307414_100499753 444
1303 3300032004 Ga0307414_10081483 Ga0307414_100814832 444
1304 3300046453 Ga0495627_000230 Ga0495627_000230_8496_9830 444
1305 3300046471 Ga0495650_0000926 Ga0495650_0000926_27195_28529 444
1306 3300046500 Ga0495596_0000314 Ga0495596_0000314_5677_7026 444
1307 3300046500 Ga0495596_0001189 Ga0495596_0001189_11899_13233 444
1308 3300046501 Ga0495607_0023019 Ga0495607_0023019_1822_3156 444
1309 3300046512 Ga0495610_0000031 Ga0495610_0000031_116094_117428 444
1310 3300046512 Ga0495610_0002416 Ga0495610_0002416_2923_4272 444
1311 3300046519 Ga0495632_0001835 Ga0495632_0001835_9815_11149 444
1312 3300046522 Ga0495643_0008243 Ga0495643_0008243_1787_3121 444
1313 3300046530 Ga0495654_0043994 Ga0495654_0043994_81_1442 444
1314 3300046538 Ga0495609_0002848 Ga0495609_0002848_1071_2405 444
1315 3300046557 Ga0495622_0070321 Ga0495622_0070321_194_1555 444
1316 3300046692 Ga0495671_0064432 Ga0495671_0064432_175_1536 444
1317 3300047470 Ga0495681_0000211 Ga0495681_0000211_20077_21411 444
1318 3300048091 Ga0495626_0000139 Ga0495626_0000139_23518_24867 444
1319 3300048904 Ga0496101_0056532 Ga0496101_0056532_310_1644 444
1320 3300048919 Ga0496116_0000045 Ga0496116_0000045_232631_233965 444
1321 3300048920 Ga0496117_0070924 Ga0496117_0070924_386_1720 444
1322 3300048921 Ga0496118_0016614 Ga0496118_0016614_5223_6602 444
1323 3300048921 Ga0496118_0119716 Ga0496118_0119716_50_1414 444
1324 3300048924 Ga0496121_0000136 Ga0496121_0000136_39018_40397 444
1325 3300048924 Ga0496121_0000671 Ga0496121_0000671_8556_9920 444
1326 3300048924 Ga0496121_0001923 Ga0496121_0001923_25719_27053 444
1327 3300048924 Ga0496121_0014630 Ga0496121_0014630_1900_3234 444
1328 3300048925 Ga0496122_0000216 Ga0496122_0000216_97739_99097 444
1329 3300048925 Ga0496122_0030555 Ga0496122_0030555_30_1364 444
1330 3300048926 Ga0496123_0000233 Ga0496123_0000233_97797_99155 444
1331 3300048926 Ga0496123_0000785 Ga0496123_0000785_26474_27808 444
1332 3300048927 Ga0496124_0009450 Ga0496124_0009450_344_1678 444
1333 3300048927 Ga0496124_0110382 Ga0496124_0110382_81_1415 444
1334 3300048928 Ga0496125_0008737 Ga0496125_0008737_3813_5147 444
1335 3300048928 Ga0496125_0015787 Ga0496125_0015787_1091_2437 444
1336 3300048929 Ga0496126_0001266 Ga0496126_0001266_34760_36094 444
1337 3300048929 Ga0496126_0015056 Ga0496126_0015056_951_2315 444
1338 3300048929 Ga0496126_0022090 Ga0496126_0022090_4484_5842 444
1339 3300049823 Ga0501044_0000826 Ga0501044_0000826_16340_17674 444
1340 3300050489 nmdc:mga03683_3999_c1 nmdc:mga03683_3999_c1_1782_3116 444
1341 3300050491 nmdc:mga00v17_687_c1 nmdc:mga00v17_687_c1_13071_14405 444
1342 3300050496 nmdc:mga07m45_1567_c1 nmdc:mga07m45_1567_c1_5148_6485 444
1343 3300050496 nmdc:mga07m45_48438_c1 nmdc:mga07m45_48438_c1_786_2132 444
1344 3300053087 Ga0500643_000821 Ga0500643_000821_13337_14689 444
1345 3300053118 Ga0500594_0002743 Ga0500594_0002743_168_1529 444
1346 3300053119 Ga0500595_013172 Ga0500595_013172_310_1647 444
1347 3300053121 Ga0500607_000107 Ga0500607_000107_10625_12040 444
1348 3300053121 Ga0500607_101417 Ga0500607_101417_69_1418 444
1349 3300053136 Ga0500559_0001513 Ga0500559_0001513_10121_11536 444
1350 3300053151 Ga0500604_0015267 Ga0500604_0015267_16_1362 444
1351 3300053730 Ga0500645_017119 Ga0500645_017119_676_2022 444
1352 iso_pu_bacteria 2510917021 2511130846 444
1353 iso_pu_bacteria 2919138771 2919141343 444
1354 iso_pu_bacteria 8054302542 8054307400 444
1355 3300005335 Ga0070666_10011967 Ga0070666_100119672 445
1356 3300005353 Ga0070669_100000620 Ga0070669_10000062018 445
1357 3300005355 Ga0070671_100000062 Ga0070671_10000006270 445
1358 3300005842 Ga0068858_100054189 Ga0068858_1000541892 445
1359 3300009177 Ga0105248_10036168 Ga0105248_100361686 445
1360 3300013102 Ga0157371_10024127 Ga0157371_100241271 445
1361 3300025923 Ga0207681_10000558 Ga0207681_1000055817 445
1362 3300025931 Ga0207644_10000005 Ga0207644_1000000595 445
1363 3300045051 Ga0451576_0000023 Ga0451576_0000023_433669_435057 445
1364 3300048905 Ga0496102_0309549 Ga0496102_0309549_111_1451 445
1365 3300048916 Ga0496113_0036227 Ga0496113_0036227_440_1780 445
1366 3300049573 Ga0501037_0164605 Ga0501037_0164605_118_1461 445
1367 3300049823 Ga0501044_0152650 Ga0501044_0152650_895_2238 445
1368 2162886007 SwRhRL2b_contig_1584582 SwRhRL2b_0526.00004000 448
1369 3300005289 Ga0065704_10000204 Ga0065704_10000204210 448
1370 3300005843 Ga0068860_100024619 Ga0068860_1000246192 448
1371 3300028381 Ga0268264_10014571 Ga0268264_100145713 448
1372 3300048909 Ga0496106_0003336 Ga0496106_0003336_3227_4612 448
1373 3300053153 Ga0500616_0023122 Ga0500616_0023122_1666_3024 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00919

UPF0004

Uncharacterized protein family UPF0004

36

139

0.94

PF01938

TRAM

TRAM domain

414

477

0.93

PF04055

Radical_SAM

Radical SAM superfamily

187

361

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.943 7 443
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.9419 6 444
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9306 7 443
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.9296 6 444
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9029 151 443
ID Description Score Start End Superfamily
af_A0A0R0IRV7_127_250_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9826 264 371 3.30.750.200
af_P0AEI1_145_378_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9781 150 381 3.80.30.20
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9713 268 384 3.30.750.200
af_P0AEI1_145_378_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9658 150 381 3.80.30.20
af_F1LV76_14_128_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9656 266 376 3.30.750.200
ID Description Score Start End GO Terms
AF-A0A2M7XLY8-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9873 276 374 GO:0005829
GO:0035597
GO:0051539
AF-A0A2N3DJZ1-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.98 8 319 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2E8LX22-F1-model_v4 deleted 0.9797 1 322
AF-A0A3R9WW79-F1-model_v4 deleted 0.9772 358 448
AF-A0A7V3SUC0-F1-model_v4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (EC 2.8.4.3) 0.9757 258 443 GO:0005829
GO:0035597
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
92.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map