F493440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1373 | 544 | 1276 | 444 |
Family's Representative Sequence
| Representative Sequence | 3300048926|Ga0496123_0000968|Ga0496123_0000968_38835_40331 |
| Length | 498 |
| Sequence | MWMRADARLVAALAGDHKPTMTETLVPQVETAPQKRLFIKTYGCQMNVYDSERMADVLRPLGYGVTDDVKAADFVILNTCHIREKAAEKIYSELGKLREMRDIRRETGGDLTIAVAGCVAQAEGEEIMRRQPAVDIVVGPQAYHQLPELLTRTARARGERIGADFAPDDKFDALPAARFTEGPTAFLTVQEGCDKFCTFCVVPYTRGAEWSRPMAAVLEEARQLTDRGVREVTLLGQNVNAYDGERPDGRKATLAELAYALAEIPGLDRIRYTTSHPNDMADELIAAHGDLDALMPYLHLPVQAGSDRILRAMNRKHGRQKYFDLIDRIRVARPDIAIAGDFIVGFPGETDREFEDTLDLVRRVNYAGAFAFAYSPRPGTPAAGMGKQVEPDVVKDRLHRLIALLTEQQTAFNAAQAGRTLNVLFDKPGRHGHRRQAIGRSPYLQSVHVDNADHLIGQIVPVEIIAGQQNSLSGRLIADGLNQPGPAGSAIAQAEKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 5 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 6 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 7 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 8 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 9 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 10 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 11 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 12 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 13 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 14 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 15 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 16 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 17 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 18 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 19 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 20 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 21 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 22 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 23 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 24 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 25 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 26 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 27 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 28 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 29 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 30 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 31 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 32 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 33 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 34 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 35 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 36 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 37 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 38 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 39 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 40 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 41 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 42 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 43 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 44 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 45 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 46 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 47 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 48 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 49 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 50 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 51 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 52 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 53 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 54 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 55 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 56 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 57 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 58 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 59 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 60 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 61 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 62 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 63 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 64 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 65 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 66 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 67 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 68 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 69 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 70 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 71 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 72 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 73 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 74 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 75 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 76 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 77 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 78 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 79 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 80 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 81 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 82 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 83 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 84 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 85 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 86 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 87 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 88 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 89 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 90 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 91 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 92 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 93 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 94 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 95 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 96 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 97 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 98 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 99 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 100 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 101 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 102 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 103 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 104 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 105 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 106 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 107 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 108 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 110 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 111 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 112 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 113 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 114 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 115 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 116 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 117 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 118 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 127 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 145 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 146 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 148 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 150 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 158 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 160 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 161 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 162 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 163 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 164 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 165 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 166 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 167 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 168 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 169 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 170 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 171 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 172 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 173 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 174 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 175 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 176 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 177 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 178 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 179 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 180 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 181 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 182 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 183 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 184 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 185 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 186 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 201 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 213 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 214 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 216 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 217 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 219 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 220 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 230 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 285 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 289 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 290 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 292 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 293 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 294 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 295 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 296 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 297 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 298 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 299 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 300 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 301 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 302 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 303 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 306 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 307 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 308 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 309 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 310 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 311 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 312 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 313 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 314 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 315 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 316 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 317 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 318 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 319 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 320 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 322 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 325 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 327 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 328 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 329 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 330 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 331 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 332 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 333 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 334 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 335 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 336 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 337 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 338 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 339 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 341 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 342 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 343 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 344 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 345 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 346 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 347 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 348 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 349 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 350 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 351 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 352 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 353 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 354 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 355 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 356 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 357 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 358 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 359 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 360 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 361 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 416 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 417 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 418 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 419 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 422 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 423 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 426 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 434 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 435 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 436 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 437 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 438 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 440 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 441 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 442 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 443 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 467 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 468 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 469 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 470 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 471 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 472 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 473 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 474 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 479 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 480 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 481 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 482 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 483 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 484 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 488 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 490 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 491 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 492 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 493 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 494 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 495 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 499 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 500 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 501 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 502 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 504 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 505 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 506 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 507 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 509 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 510 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 512 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 513 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 514 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 515 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 516 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 517 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 519 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 522 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 524 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 528 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 529 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 533 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 536 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 537 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 539 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 541 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 542 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 543 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 544 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.94 |
| Metatranscriptomes | 0 |
| Isolates | 7.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 16.1 |
| Nodule | 0.07 |
| Rhizoplane | 3.5 |
| Rhizosphere | 69.12 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 10.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1584582 | 2162886007 | Bacteria | 10355 |
| 2 | JGI24741J21665_1000993 | 3300001915 | Bacteria | 8532 |
| 3 | JGI24741J21665_1003085 | 3300001915 | Bacteria | 4096 |
| 4 | JGI24752J21851_1005100 | 3300001976 | Bacteria | 1718 |
| 5 | JGI24740J21852_10004068 | 3300001979 | Bacteria | 6327 |
| 6 | JGI24739J22299_10004442 | 3300001989 | Bacteria | 5376 |
| 7 | JGI24737J22298_10000247 | 3300001990 | Bacteria | 17946 |
| 8 | JGI24737J22298_10003963 | 3300001990 | Bacteria | 5185 |
| 9 | JGI24735J21928_10002583 | 3300002067 | Bacteria | 6263 |
| 10 | JGI24751J29686_10000118 | 3300002459 | Bacteria | 41570 |
| 11 | JGI25150J39212_1000177 | 3300002774 | Bacteria | 35741 |
| 12 | JGI25159J45721_1003172 | 3300002987 | Bacteria | 5903 |
| 13 | JGI25151J46595_10000335 | 3300003187 | Bacteria | 50415 |
| 14 | JGI25151J46595_10029424 | 3300003187 | Bacteria | 2175 |
| 15 | JGI25165J46597_1000208 | 3300003214 | Bacteria | 84386 |
| 16 | JGI25153J46596_10000152 | 3300003215 | Bacteria | 70039 |
| 17 | JGI25153J46596_10000153 | 3300003215 | Bacteria | 69588 |
| 18 | Ga0055542_1000132 | 3300003762 | Bacteria | 96749 |
| 19 | Ga0055529_1000088 | 3300003763 | Bacteria | 139031 |
| 20 | Ga0055537_1002000 | 3300003773 | Bacteria | 7251 |
| 21 | Ga0055537_1003620 | 3300003773 | Bacteria | 4692 |
| 22 | Ga0055524_1000172 | 3300003775 | Bacteria | 73986 |
| 23 | Ga0055536_1000781 | 3300003781 | Bacteria | 21243 |
| 24 | Ga0055536_1005313 | 3300003781 | Bacteria | 6332 |
| 25 | Ga0055536_1010902 | 3300003781 | Bacteria | 3547 |
| 26 | Ga0055536_1017767 | 3300003781 | Bacteria | 2312 |
| 27 | Ga0055530_10000465 | 3300003791 | Bacteria | 35593 |
| 28 | Ga0055530_10000586 | 3300003791 | Bacteria | 31506 |
| 29 | Ga0055530_10001358 | 3300003791 | Bacteria | 18146 |
| 30 | Ga0055530_10012502 | 3300003791 | Bacteria | 2955 |
| 31 | Ga0055540_1002368 | 3300003792 | Bacteria | 10076 |
| 32 | Ga0055531_10001005 | 3300003794 | Bacteria | 22405 |
| 33 | Ga0055531_10003722 | 3300003794 | Bacteria | 9587 |
| 34 | Ga0055531_10005543 | 3300003794 | Bacteria | 7367 |
| 35 | Ga0055531_10007465 | 3300003794 | Bacteria | 5960 |
| 36 | Ga0065165_1000345 | 3300005262 | Bacteria | 76072 |
| 37 | Ga0065165_1000941 | 3300005262 | Bacteria | 37145 |
| 38 | Ga0065165_1016452 | 3300005262 | Bacteria | 2768 |
| 39 | Ga0065704_10000204 | 3300005289 | Bacteria | 211587 |
| 40 | Ga0065704_10125067 | 3300005289 | Bacteria | 1709 |
| 41 | Ga0065707_10081814 | 3300005295 | Bacteria | 36963 |
| 42 | Ga0070658_10000086 | 3300005327 | Bacteria | 86563 |
| 43 | Ga0070658_10001217 | 3300005327 | Bacteria | 22089 |
| 44 | Ga0070658_10002923 | 3300005327 | Bacteria | 14159 |
| 45 | Ga0070658_10012645 | 3300005327 | Bacteria | 6770 |
| 46 | Ga0070658_10015022 | 3300005327 | Bacteria | 6198 |
| 47 | Ga0070658_10032050 | 3300005327 | Bacteria | 4225 |
| 48 | Ga0070658_10056113 | 3300005327 | Bacteria | 3201 |
| 49 | Ga0070658_10101106 | 3300005327 | Bacteria | 2383 |
| 50 | Ga0070676_10110783 | 3300005328 | Bacteria | 1709 |
| 51 | Ga0070683_100059652 | 3300005329 | Bacteria | 3545 |
| 52 | Ga0070670_100000004 | 3300005331 | Bacteria | 392110 |
| 53 | Ga0070670_100007458 | 3300005331 | Bacteria | 9289 |
| 54 | Ga0070670_100030976 | 3300005331 | Bacteria | 4607 |
| 55 | Ga0070670_100071668 | 3300005331 | Bacteria | 2975 |
| 56 | Ga0070670_100162912 | 3300005331 | Bacteria | 1933 |
| 57 | Ga0070677_10000283 | 3300005333 | Bacteria | 17774 |
| 58 | Ga0070677_10019501 | 3300005333 | Bacteria | 2457 |
| 59 | Ga0070666_10000408 | 3300005335 | Bacteria | 26751 |
| 60 | Ga0070666_10011967 | 3300005335 | Bacteria | 5461 |
| 61 | Ga0070680_100000705 | 3300005336 | Bacteria | 23175 |
| 62 | Ga0070680_100026681 | 3300005336 | Bacteria | 4619 |
| 63 | Ga0070680_100147050 | 3300005336 | Bacteria | 1977 |
| 64 | Ga0070682_100006966 | 3300005337 | Bacteria | 6358 |
| 65 | Ga0070682_100046621 | 3300005337 | Bacteria | 2691 |
| 66 | Ga0068868_100000021 | 3300005338 | Bacteria | 89090 |
| 67 | Ga0068868_100001497 | 3300005338 | Bacteria | 16125 |
| 68 | Ga0070660_100000197 | 3300005339 | Bacteria | 40265 |
| 69 | Ga0070660_100004476 | 3300005339 | Bacteria | 9659 |
| 70 | Ga0070691_10001596 | 3300005341 | Bacteria | 9801 |
| 71 | Ga0070691_10006308 | 3300005341 | Bacteria | 5420 |
| 72 | Ga0070691_10007427 | 3300005341 | Bacteria | 5021 |
| 73 | Ga0070691_10018081 | 3300005341 | Bacteria | 3246 |
| 74 | Ga0070661_100004099 | 3300005344 | Bacteria | 10045 |
| 75 | Ga0070661_100006006 | 3300005344 | Bacteria | 8359 |
| 76 | Ga0070661_100023224 | 3300005344 | Bacteria | 4444 |
| 77 | Ga0070661_100105134 | 3300005344 | Bacteria | 2104 |
| 78 | Ga0070668_100000120 | 3300005347 | Bacteria | 48270 |
| 79 | Ga0070668_100000618 | 3300005347 | Bacteria | 23868 |
| 80 | Ga0070668_100002111 | 3300005347 | Bacteria | 14547 |
| 81 | Ga0070668_100009939 | 3300005347 | Bacteria | 7048 |
| 82 | Ga0070668_100013147 | 3300005347 | Bacteria | 6171 |
| 83 | Ga0070668_100028298 | 3300005347 | Bacteria | 4255 |
| 84 | Ga0070668_100058973 | 3300005347 | Bacteria | 2971 |
| 85 | Ga0070669_100000109 | 3300005353 | Bacteria | 80041 |
| 86 | Ga0070669_100000620 | 3300005353 | Bacteria | 26234 |
| 87 | Ga0070669_100003318 | 3300005353 | Bacteria | 11566 |
| 88 | Ga0070669_100044858 | 3300005353 | Bacteria | 3221 |
| 89 | Ga0070669_100072327 | 3300005353 | Bacteria | 2553 |
| 90 | Ga0070669_100086365 | 3300005353 | Bacteria | 2344 |
| 91 | Ga0070671_100000020 | 3300005355 | Bacteria | 127483 |
| 92 | Ga0070671_100000062 | 3300005355 | Bacteria | 73417 |
| 93 | Ga0070671_100004972 | 3300005355 | Bacteria | 10584 |
| 94 | Ga0070671_100009247 | 3300005355 | Bacteria | 7917 |
| 95 | Ga0070671_100068538 | 3300005355 | Bacteria | 2959 |
| 96 | Ga0070671_100104541 | 3300005355 | Bacteria | 2376 |
| 97 | Ga0070671_100203484 | 3300005355 | Bacteria | 1679 |
| 98 | Ga0070674_100039375 | 3300005356 | Bacteria | 3191 |
| 99 | Ga0070674_100070701 | 3300005356 | Bacteria | 2466 |
| 100 | Ga0070674_100140603 | 3300005356 | Bacteria | 1811 |
| 101 | Ga0070659_100000027 | 3300005366 | Bacteria | 143469 |
| 102 | Ga0070659_100001161 | 3300005366 | Bacteria | 19244 |
| 103 | Ga0070659_100006138 | 3300005366 | Bacteria | 8674 |
| 104 | Ga0070659_100022474 | 3300005366 | Bacteria | 4816 |
| 105 | Ga0070659_100027632 | 3300005366 | Bacteria | 4374 |
| 106 | Ga0070659_100075209 | 3300005366 | Bacteria | 2692 |
| 107 | Ga0070659_100226012 | 3300005366 | Bacteria | 1546 |
| 108 | Ga0070667_100000067 | 3300005367 | Bacteria | 133023 |
| 109 | Ga0070667_100000175 | 3300005367 | Bacteria | 79433 |
| 110 | Ga0070667_100001088 | 3300005367 | Bacteria | 24888 |
| 111 | Ga0070667_100004571 | 3300005367 | Bacteria | 11626 |
| 112 | Ga0070667_100005409 | 3300005367 | Bacteria | 10666 |
| 113 | Ga0070667_100006391 | 3300005367 | Bacteria | 9793 |
| 114 | Ga0070667_100103915 | 3300005367 | Bacteria | 2456 |
| 115 | Ga0070703_10004937 | 3300005406 | Bacteria | 3722 |
| 116 | Ga0070714_100000769 | 3300005435 | Bacteria | 22715 |
| 117 | Ga0070705_100001889 | 3300005440 | Bacteria | 10771 |
| 118 | Ga0070700_100008602 | 3300005441 | Bacteria | 5561 |
| 119 | Ga0070694_100107816 | 3300005444 | Bacteria | 1980 |
| 120 | Ga0070663_100009949 | 3300005455 | Bacteria | 5911 |
| 121 | Ga0070663_100014296 | 3300005455 | Bacteria | 5092 |
| 122 | Ga0070663_100015593 | 3300005455 | Bacteria | 4911 |
| 123 | Ga0070663_100106107 | 3300005455 | Bacteria | 2104 |
| 124 | Ga0070678_100001098 | 3300005456 | Bacteria | 14179 |
| 125 | Ga0070662_100010012 | 3300005457 | Bacteria | 6208 |
| 126 | Ga0070662_100010097 | 3300005457 | Bacteria | 6185 |
| 127 | Ga0070662_100014743 | 3300005457 | Bacteria | 5223 |
| 128 | Ga0070662_100036012 | 3300005457 | Bacteria | 3498 |
| 129 | Ga0070662_100088175 | 3300005457 | Bacteria | 2325 |
| 130 | Ga0070681_10017384 | 3300005458 | Bacteria | 7187 |
| 131 | Ga0070681_10019769 | 3300005458 | Bacteria | 6744 |
| 132 | Ga0070681_10053345 | 3300005458 | Bacteria | 4029 |
| 133 | Ga0068867_100069552 | 3300005459 | Bacteria | 2629 |
| 134 | Ga0070699_100015869 | 3300005518 | Bacteria | 6466 |
| 135 | Ga0070679_100002011 | 3300005530 | Bacteria | 18247 |
| 136 | Ga0070679_100028982 | 3300005530 | Bacteria | 5461 |
| 137 | Ga0070679_100043339 | 3300005530 | Bacteria | 4482 |
| 138 | Ga0070679_100110214 | 3300005530 | Bacteria | 2739 |
| 139 | Ga0070697_100047807 | 3300005536 | Bacteria | 3469 |
| 140 | Ga0068853_100007497 | 3300005539 | Bacteria | 8732 |
| 141 | Ga0068853_100018732 | 3300005539 | Bacteria | 5734 |
| 142 | Ga0068853_100025509 | 3300005539 | Bacteria | 4961 |
| 143 | Ga0068853_100154613 | 3300005539 | Bacteria | 2066 |
| 144 | Ga0068853_100161110 | 3300005539 | Bacteria | 2025 |
| 145 | Ga0070672_100124643 | 3300005543 | Bacteria | 2112 |
| 146 | Ga0070672_100125677 | 3300005543 | Bacteria | 2103 |
| 147 | Ga0070686_100000152 | 3300005544 | Bacteria | 47696 |
| 148 | Ga0070695_100008458 | 3300005545 | Bacteria | 6105 |
| 149 | Ga0070696_100000340 | 3300005546 | Bacteria | 28341 |
| 150 | Ga0070696_100081819 | 3300005546 | Bacteria | 2288 |
| 151 | Ga0070693_100008209 | 3300005547 | Bacteria | 5134 |
| 152 | Ga0070693_100092286 | 3300005547 | Bacteria | 1828 |
| 153 | Ga0070665_100000115 | 3300005548 | Bacteria | 151164 |
| 154 | Ga0070665_100000198 | 3300005548 | Bacteria | 105999 |
| 155 | Ga0070665_100000878 | 3300005548 | Bacteria | 38691 |
| 156 | Ga0070665_100002021 | 3300005548 | Bacteria | 22808 |
| 157 | Ga0070665_100025272 | 3300005548 | Bacteria | 5984 |
| 158 | Ga0070665_100032162 | 3300005548 | Bacteria | 5280 |
| 159 | Ga0070665_100039869 | 3300005548 | Bacteria | 4722 |
| 160 | Ga0070665_100143749 | 3300005548 | Bacteria | 2389 |
| 161 | Ga0070704_100002065 | 3300005549 | Bacteria | 11148 |
| 162 | Ga0068855_100002675 | 3300005563 | Bacteria | 21961 |
| 163 | Ga0068855_100009847 | 3300005563 | Bacteria | 11528 |
| 164 | Ga0068855_100014465 | 3300005563 | Bacteria | 9502 |
| 165 | Ga0068855_100020437 | 3300005563 | Bacteria | 7940 |
| 166 | Ga0068855_100036162 | 3300005563 | Bacteria | 5880 |
| 167 | Ga0068855_100042440 | 3300005563 | Bacteria | 5389 |
| 168 | Ga0068855_100060501 | 3300005563 | Bacteria | 4429 |
| 169 | Ga0068855_100066161 | 3300005563 | Bacteria | 4214 |
| 170 | Ga0068855_100138126 | 3300005563 | Bacteria | 2780 |
| 171 | Ga0070664_100000464 | 3300005564 | Bacteria | 30816 |
| 172 | Ga0070664_100018223 | 3300005564 | Bacteria | 5762 |
| 173 | Ga0070664_100021127 | 3300005564 | Bacteria | 5362 |
| 174 | Ga0070664_100250907 | 3300005564 | Bacteria | 1591 |
| 175 | Ga0068857_100016189 | 3300005577 | Bacteria | 6531 |
| 176 | Ga0068857_100053945 | 3300005577 | Bacteria | 3566 |
| 177 | Ga0068854_100002421 | 3300005578 | Bacteria | 11519 |
| 178 | Ga0068856_100017510 | 3300005614 | Bacteria | 6942 |
| 179 | Ga0068852_100000142 | 3300005616 | Bacteria | 48221 |
| 180 | Ga0068852_100000824 | 3300005616 | Bacteria | 20475 |
| 181 | Ga0068859_100000452 | 3300005617 | Bacteria | 40834 |
| 182 | Ga0068859_100001068 | 3300005617 | Bacteria | 28047 |
| 183 | Ga0068859_100006366 | 3300005617 | Bacteria | 11975 |
| 184 | Ga0068859_100032062 | 3300005617 | Bacteria | 5278 |
| 185 | Ga0068859_100034727 | 3300005617 | Bacteria | 5060 |
| 186 | Ga0068859_100087061 | 3300005617 | Bacteria | 3171 |
| 187 | Ga0068864_100000058 | 3300005618 | Bacteria | 125688 |
| 188 | Ga0068864_100000082 | 3300005618 | Bacteria | 101182 |
| 189 | Ga0068864_100000928 | 3300005618 | Bacteria | 24614 |
| 190 | Ga0068864_100007684 | 3300005618 | Bacteria | 8882 |
| 191 | Ga0068864_100054564 | 3300005618 | Bacteria | 3449 |
| 192 | Ga0068864_100077377 | 3300005618 | Bacteria | 2909 |
| 193 | Ga0068864_100254682 | 3300005618 | Bacteria | 1631 |
| 194 | Ga0068861_100001980 | 3300005719 | Bacteria | 13225 |
| 195 | Ga0068863_100000038 | 3300005841 | Bacteria | 161477 |
| 196 | Ga0068863_100000175 | 3300005841 | Bacteria | 67772 |
| 197 | Ga0068863_100000597 | 3300005841 | Bacteria | 36664 |
| 198 | Ga0068863_100004185 | 3300005841 | Bacteria | 14245 |
| 199 | Ga0068863_100010685 | 3300005841 | Bacteria | 8915 |
| 200 | Ga0068863_100011189 | 3300005841 | Bacteria | 8694 |
| 201 | Ga0068863_100041278 | 3300005841 | Bacteria | 4386 |
| 202 | Ga0068863_100131813 | 3300005841 | Bacteria | 2386 |
| 203 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 204 | Ga0068858_100000137 | 3300005842 | Bacteria | 77050 |
| 205 | Ga0068858_100001141 | 3300005842 | Bacteria | 27483 |
| 206 | Ga0068858_100008659 | 3300005842 | Bacteria | 9770 |
| 207 | Ga0068858_100031945 | 3300005842 | Bacteria | 4891 |
| 208 | Ga0068858_100054189 | 3300005842 | Bacteria | 3708 |
| 209 | Ga0068858_100131951 | 3300005842 | Bacteria | 2343 |
| 210 | Ga0068858_100195628 | 3300005842 | Bacteria | 1911 |
| 211 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 212 | Ga0068860_100002654 | 3300005843 | Bacteria | 18612 |
| 213 | Ga0068860_100002711 | 3300005843 | Bacteria | 18421 |
| 214 | Ga0068860_100008925 | 3300005843 | Bacteria | 9990 |
| 215 | Ga0068860_100013711 | 3300005843 | Bacteria | 7948 |
| 216 | Ga0068860_100014606 | 3300005843 | Bacteria | 7684 |
| 217 | Ga0068860_100019195 | 3300005843 | Bacteria | 6636 |
| 218 | Ga0068860_100021477 | 3300005843 | Bacteria | 6250 |
| 219 | Ga0068860_100024619 | 3300005843 | Bacteria | 5813 |
| 220 | Ga0068860_100041470 | 3300005843 | Bacteria | 4396 |
| 221 | Ga0068860_100082779 | 3300005843 | Bacteria | 3052 |
| 222 | Ga0068862_100000183 | 3300005844 | Bacteria | 68758 |
| 223 | Ga0068862_100001800 | 3300005844 | Bacteria | 19399 |
| 224 | Ga0068862_100013372 | 3300005844 | Bacteria | 6791 |
| 225 | Ga0068862_100014327 | 3300005844 | Bacteria | 6577 |
| 226 | Ga0068862_100015404 | 3300005844 | Bacteria | 6351 |
| 227 | Ga0068862_100031339 | 3300005844 | Bacteria | 4487 |
| 228 | Ga0068862_100048727 | 3300005844 | Bacteria | 3618 |
| 229 | Ga0068862_100120438 | 3300005844 | Bacteria | 2312 |
| 230 | Ga0081455_10000041 | 3300005937 | Bacteria | 134032 |
| 231 | Ga0081455_10000100 | 3300005937 | Bacteria | 95033 |
| 232 | Ga0081540_1000091 | 3300005983 | Bacteria | 94664 |
| 233 | Ga0081540_1002750 | 3300005983 | Bacteria | 14293 |
| 234 | Ga0081540_1045461 | 3300005983 | Bacteria | 2229 |
| 235 | Ga0081539_10024820 | 3300005985 | Bacteria | 3877 |
| 236 | Ga0075368_10000517 | 3300006042 | Bacteria | 11528 |
| 237 | Ga0075368_10007027 | 3300006042 | Bacteria | 3962 |
| 238 | Ga0075368_10011642 | 3300006042 | Bacteria | 3203 |
| 239 | Ga0075368_10015568 | 3300006042 | Bacteria | 2824 |
| 240 | Ga0075363_100006499 | 3300006048 | Bacteria | 5317 |
| 241 | Ga0075363_100061646 | 3300006048 | Bacteria | 2022 |
| 242 | Ga0075363_100072464 | 3300006048 | Bacteria | 1873 |
| 243 | Ga0075364_10001169 | 3300006051 | Bacteria | 14073 |
| 244 | Ga0075364_10008317 | 3300006051 | Bacteria | 6195 |
| 245 | Ga0075364_10017758 | 3300006051 | Bacteria | 4448 |
| 246 | Ga0075432_10022132 | 3300006058 | Bacteria | 2173 |
| 247 | Ga0070712_100167572 | 3300006175 | Bacteria | 1702 |
| 248 | Ga0075362_10000119 | 3300006177 | Bacteria | 22052 |
| 249 | Ga0075362_10027389 | 3300006177 | Bacteria | 2440 |
| 250 | Ga0075362_10030269 | 3300006177 | Bacteria | 2337 |
| 251 | Ga0075367_10002637 | 3300006178 | Bacteria | 8251 |
| 252 | Ga0075367_10012363 | 3300006178 | Bacteria | 4549 |
| 253 | Ga0075367_10017716 | 3300006178 | Bacteria | 3915 |
| 254 | Ga0075367_10019406 | 3300006178 | Bacteria | 3768 |
| 255 | Ga0075369_10001089 | 3300006186 | Bacteria | 9105 |
| 256 | Ga0075369_10010903 | 3300006186 | Bacteria | 3562 |
| 257 | Ga0075366_10000014 | 3300006195 | Bacteria | 66940 |
| 258 | Ga0075366_10015605 | 3300006195 | Bacteria | 4358 |
| 259 | Ga0075366_10022279 | 3300006195 | Bacteria | 3684 |
| 260 | Ga0075366_10034698 | 3300006195 | Bacteria | 2972 |
| 261 | Ga0075370_10000141 | 3300006353 | Bacteria | 24359 |
| 262 | Ga0075370_10002146 | 3300006353 | Bacteria | 9020 |
| 263 | Ga0075431_100001098 | 3300006847 | Bacteria | 24239 |
| 264 | Ga0075431_100002734 | 3300006847 | Bacteria | 17104 |
| 265 | Ga0075431_100006959 | 3300006847 | Bacteria | 11248 |
| 266 | Ga0075429_100038809 | 3300006880 | Bacteria | 4146 |
| 267 | Ga0068865_100000389 | 3300006881 | Bacteria | 24391 |
| 268 | Ga0097620_100000452 | 3300006931 | Bacteria | 40834 |
| 269 | Ga0097620_100001068 | 3300006931 | Bacteria | 28047 |
| 270 | Ga0097620_100006366 | 3300006931 | Bacteria | 11975 |
| 271 | Ga0097620_100032062 | 3300006931 | Bacteria | 5278 |
| 272 | Ga0097620_100034728 | 3300006931 | Bacteria | 5060 |
| 273 | Ga0097620_100087064 | 3300006931 | Bacteria | 3171 |
| 274 | Ga0105251_10018337 | 3300009011 | Bacteria | 3724 |
| 275 | Ga0105250_10007702 | 3300009092 | Bacteria | 4616 |
| 276 | Ga0105240_10003577 | 3300009093 | Bacteria | 24115 |
| 277 | Ga0105240_10004776 | 3300009093 | Bacteria | 20437 |
| 278 | Ga0105240_10031721 | 3300009093 | Bacteria | 6847 |
| 279 | Ga0105240_10089281 | 3300009093 | Bacteria | 3770 |
| 280 | Ga0105240_10113959 | 3300009093 | Bacteria | 3266 |
| 281 | Ga0105240_10122781 | 3300009093 | Bacteria | 3125 |
| 282 | Ga0105240_10201908 | 3300009093 | Bacteria | 2329 |
| 283 | Ga0111539_10033514 | 3300009094 | Bacteria | 6236 |
| 284 | Ga0105245_10016411 | 3300009098 | Bacteria | 6459 |
| 285 | Ga0105245_10028937 | 3300009098 | Bacteria | 4891 |
| 286 | Ga0105245_10084495 | 3300009098 | Bacteria | 2908 |
| 287 | Ga0114129_10053884 | 3300009147 | Bacteria | 5641 |
| 288 | Ga0105243_10000091 | 3300009148 | Bacteria | 102081 |
| 289 | Ga0105243_10017595 | 3300009148 | Bacteria | 5405 |
| 290 | Ga0105243_10029432 | 3300009148 | Bacteria | 4223 |
| 291 | Ga0105241_10003044 | 3300009174 | Bacteria | 12509 |
| 292 | Ga0105248_10000170 | 3300009177 | Bacteria | 75642 |
| 293 | Ga0105248_10000400 | 3300009177 | Bacteria | 50262 |
| 294 | Ga0105248_10004550 | 3300009177 | Bacteria | 15348 |
| 295 | Ga0105248_10006314 | 3300009177 | Bacteria | 13004 |
| 296 | Ga0105248_10012717 | 3300009177 | Bacteria | 9286 |
| 297 | Ga0105248_10036168 | 3300009177 | Bacteria | 5523 |
| 298 | Ga0105248_10039321 | 3300009177 | Bacteria | 5297 |
| 299 | Ga0105248_10055686 | 3300009177 | Bacteria | 4437 |
| 300 | Ga0105248_10087489 | 3300009177 | Bacteria | 3506 |
| 301 | Ga0105237_10056680 | 3300009545 | Bacteria | 3921 |
| 302 | Ga0105237_10087184 | 3300009545 | Bacteria | 3111 |
| 303 | Ga0105237_10190630 | 3300009545 | Bacteria | 2050 |
| 304 | Ga0105238_10017709 | 3300009551 | Bacteria | 7243 |
| 305 | Ga0105238_10035809 | 3300009551 | Bacteria | 5045 |
| 306 | Ga0105238_10227325 | 3300009551 | Bacteria | 1842 |
| 307 | Ga0105238_10264668 | 3300009551 | Bacteria | 1699 |
| 308 | Ga0105249_10000438 | 3300009553 | Bacteria | 39201 |
| 309 | Ga0105249_10001111 | 3300009553 | Bacteria | 23909 |
| 310 | Ga0105249_10025304 | 3300009553 | Bacteria | 5341 |
| 311 | Ga0105246_10000589 | 3300011119 | Bacteria | 20145 |
| 312 | Ga0105246_10009669 | 3300011119 | Bacteria | 5943 |
| 313 | Ga0157326_1003496 | 3300012513 | Bacteria | 1650 |
| 314 | Ga0157373_10001577 | 3300013100 | Bacteria | 17397 |
| 315 | Ga0157373_10001686 | 3300013100 | Bacteria | 16857 |
| 316 | Ga0157373_10002751 | 3300013100 | Bacteria | 13318 |
| 317 | Ga0157373_10096330 | 3300013100 | Bacteria | 2083 |
| 318 | Ga0157371_10000048 | 3300013102 | Bacteria | 184015 |
| 319 | Ga0157371_10006522 | 3300013102 | Bacteria | 9603 |
| 320 | Ga0157371_10023869 | 3300013102 | Bacteria | 4469 |
| 321 | Ga0157371_10024127 | 3300013102 | Bacteria | 4443 |
| 322 | Ga0157370_10000760 | 3300013104 | Bacteria | 40285 |
| 323 | Ga0157370_10019472 | 3300013104 | Bacteria | 6807 |
| 324 | Ga0157370_10190102 | 3300013104 | Bacteria | 1906 |
| 325 | Ga0157369_10013459 | 3300013105 | Bacteria | 9246 |
| 326 | Ga0157369_10071265 | 3300013105 | Bacteria | 3731 |
| 327 | Ga0157369_10103340 | 3300013105 | Bacteria | 3035 |
| 328 | Ga0157378_10112497 | 3300013297 | Bacteria | 2497 |
| 329 | Ga0163162_10012113 | 3300013306 | Bacteria | 8416 |
| 330 | Ga0163162_10022236 | 3300013306 | Bacteria | 6250 |
| 331 | Ga0163162_10117051 | 3300013306 | Bacteria | 2766 |
| 332 | Ga0157372_10069250 | 3300013307 | Bacteria | 3968 |
| 333 | Ga0157372_10228772 | 3300013307 | Bacteria | 2156 |
| 334 | Ga0157372_10251746 | 3300013307 | Bacteria | 2050 |
| 335 | Ga0163163_10011090 | 3300014325 | Bacteria | 8157 |
| 336 | Ga0157380_10000062 | 3300014326 | Bacteria | 61714 |
| 337 | Ga0157380_10006274 | 3300014326 | Bacteria | 8346 |
| 338 | Ga0157380_10051725 | 3300014326 | Bacteria | 3250 |
| 339 | Ga0157380_10082902 | 3300014326 | Bacteria | 2626 |
| 340 | Ga0157379_10005111 | 3300014968 | Bacteria | 11250 |
| 341 | Ga0157379_10011135 | 3300014968 | Bacteria | 7840 |
| 342 | Ga0157379_10022602 | 3300014968 | Bacteria | 5571 |
| 343 | Ga0157376_10275782 | 3300014969 | Bacteria | 1581 |
| 344 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 345 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 346 | Ga0163161_10037310 | 3300017792 | Bacteria | 3484 |
| 347 | Ga0213876_10000145 | 3300021384 | Bacteria | 76883 |
| 348 | Ga0213876_10000522 | 3300021384 | Bacteria | 29437 |
| 349 | Ga0213876_10000537 | 3300021384 | Bacteria | 28569 |
| 350 | Ga0213876_10088540 | 3300021384 | Bacteria | 1639 |
| 351 | Ga0213875_10000101 | 3300021388 | Bacteria | 96957 |
| 352 | Ga0207425_1000019 | 3300025245 | Bacteria | 399942 |
| 353 | Ga0209646_1004657 | 3300025246 | Bacteria | 2474 |
| 354 | Ga0209026_1002551 | 3300025250 | Bacteria | 6729 |
| 355 | Ga0209026_1009856 | 3300025250 | Bacteria | 1834 |
| 356 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 357 | Ga0209233_1000186 | 3300025261 | Bacteria | 133572 |
| 358 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 359 | Ga0209565_1000089 | 3300025263 | Bacteria | 150511 |
| 360 | Ga0209565_1000172 | 3300025263 | Bacteria | 84264 |
| 361 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 362 | Ga0209673_1000796 | 3300025273 | Bacteria | 42005 |
| 363 | Ga0209130_1000616 | 3300025284 | Bacteria | 34066 |
| 364 | Ga0209675_1000384 | 3300025291 | Bacteria | 36771 |
| 365 | Ga0209676_1000140 | 3300025292 | Bacteria | 176735 |
| 366 | Ga0209676_1000257 | 3300025292 | Bacteria | 112662 |
| 367 | Ga0209676_1000316 | 3300025292 | Bacteria | 94380 |
| 368 | Ga0209676_1000421 | 3300025292 | Bacteria | 74706 |
| 369 | Ga0209676_1000693 | 3300025292 | Bacteria | 47361 |
| 370 | Ga0209676_1001736 | 3300025292 | Bacteria | 18672 |
| 371 | Ga0209025_1000179 | 3300025294 | Bacteria | 157965 |
| 372 | Ga0209025_1000304 | 3300025294 | Bacteria | 109508 |
| 373 | Ga0209564_1002843 | 3300025295 | Bacteria | 12745 |
| 374 | Ga0209564_1007077 | 3300025295 | Bacteria | 5873 |
| 375 | Ga0209564_1009726 | 3300025295 | Bacteria | 4527 |
| 376 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 377 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 378 | Ga0209758_1002605 | 3300025297 | Bacteria | 18041 |
| 379 | Ga0209758_1005251 | 3300025297 | Bacteria | 10137 |
| 380 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 381 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 382 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 383 | Ga0209050_1000112 | 3300025298 | Bacteria | 210320 |
| 384 | Ga0209050_1000254 | 3300025298 | Bacteria | 114395 |
| 385 | Ga0209050_1000604 | 3300025298 | Bacteria | 57101 |
| 386 | Ga0209050_1001180 | 3300025298 | Bacteria | 30808 |
| 387 | Ga0209050_1006747 | 3300025298 | Bacteria | 6698 |
| 388 | Ga0209050_1010143 | 3300025298 | Bacteria | 4688 |
| 389 | Ga0209050_1017409 | 3300025298 | Bacteria | 2868 |
| 390 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 391 | Ga0207426_1000191 | 3300025302 | Bacteria | 151850 |
| 392 | Ga0207426_1013452 | 3300025302 | Bacteria | 3032 |
| 393 | Ga0209051_1000309 | 3300025303 | Bacteria | 76449 |
| 394 | Ga0209051_1007732 | 3300025303 | Bacteria | 5826 |
| 395 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 396 | Ga0209257_1000192 | 3300025304 | Bacteria | 151851 |
| 397 | Ga0209257_1000289 | 3300025304 | Bacteria | 110882 |
| 398 | Ga0209257_1000600 | 3300025304 | Bacteria | 59824 |
| 399 | Ga0209257_1000630 | 3300025304 | Bacteria | 56658 |
| 400 | Ga0209257_1000877 | 3300025304 | Bacteria | 42562 |
| 401 | Ga0209257_1001191 | 3300025304 | Bacteria | 32721 |
| 402 | Ga0209257_1001221 | 3300025304 | Bacteria | 32172 |
| 403 | Ga0209257_1001776 | 3300025304 | Bacteria | 23847 |
| 404 | Ga0209257_1001845 | 3300025304 | Bacteria | 23059 |
| 405 | Ga0209257_1003844 | 3300025304 | Bacteria | 12300 |
| 406 | Ga0209257_1005979 | 3300025304 | Bacteria | 8159 |
| 407 | Ga0207697_10000375 | 3300025315 | Bacteria | 25016 |
| 408 | Ga0207653_10006282 | 3300025885 | Bacteria | 3706 |
| 409 | Ga0207682_10000506 | 3300025893 | Bacteria | 17914 |
| 410 | Ga0207682_10014983 | 3300025893 | Bacteria | 3019 |
| 411 | Ga0207710_10005667 | 3300025900 | Bacteria | 5374 |
| 412 | Ga0207680_10002355 | 3300025903 | Bacteria | 8788 |
| 413 | Ga0207647_10052545 | 3300025904 | Bacteria | 2515 |
| 414 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 415 | Ga0207705_10000058 | 3300025909 | Bacteria | 155967 |
| 416 | Ga0207705_10000621 | 3300025909 | Bacteria | 29636 |
| 417 | Ga0207705_10000665 | 3300025909 | Bacteria | 28572 |
| 418 | Ga0207705_10003453 | 3300025909 | Bacteria | 12024 |
| 419 | Ga0207654_10001839 | 3300025911 | Bacteria | 11000 |
| 420 | Ga0207707_10005208 | 3300025912 | Bacteria | 11395 |
| 421 | Ga0207695_10002758 | 3300025913 | Bacteria | 25593 |
| 422 | Ga0207695_10003649 | 3300025913 | Bacteria | 21496 |
| 423 | Ga0207695_10011589 | 3300025913 | Bacteria | 10662 |
| 424 | Ga0207695_10011899 | 3300025913 | Bacteria | 10484 |
| 425 | Ga0207695_10024402 | 3300025913 | Bacteria | 6807 |
| 426 | Ga0207695_10027405 | 3300025913 | Bacteria | 6345 |
| 427 | Ga0207695_10032586 | 3300025913 | Bacteria | 5700 |
| 428 | Ga0207695_10036878 | 3300025913 | Bacteria | 5280 |
| 429 | Ga0207695_10077943 | 3300025913 | Bacteria | 3364 |
| 430 | Ga0207671_10004168 | 3300025914 | Bacteria | 13975 |
| 431 | Ga0207671_10013737 | 3300025914 | Bacteria | 6430 |
| 432 | Ga0207671_10028484 | 3300025914 | Bacteria | 4173 |
| 433 | Ga0207671_10040107 | 3300025914 | Bacteria | 3466 |
| 434 | Ga0207671_10078027 | 3300025914 | Bacteria | 2480 |
| 435 | Ga0207660_10015333 | 3300025917 | Bacteria | 5055 |
| 436 | Ga0207660_10034110 | 3300025917 | Bacteria | 3525 |
| 437 | Ga0207657_10001791 | 3300025919 | Bacteria | 23171 |
| 438 | Ga0207657_10002881 | 3300025919 | Bacteria | 18486 |
| 439 | Ga0207657_10003546 | 3300025919 | Bacteria | 16677 |
| 440 | Ga0207657_10004751 | 3300025919 | Bacteria | 14343 |
| 441 | Ga0207657_10027824 | 3300025919 | Bacteria | 5171 |
| 442 | Ga0207657_10033675 | 3300025919 | Bacteria | 4615 |
| 443 | Ga0207657_10041820 | 3300025919 | Bacteria | 4049 |
| 444 | Ga0207657_10081160 | 3300025919 | Bacteria | 2725 |
| 445 | Ga0207649_10006776 | 3300025920 | Bacteria | 6223 |
| 446 | Ga0207649_10138089 | 3300025920 | Bacteria | 1664 |
| 447 | Ga0207652_10001178 | 3300025921 | Bacteria | 23512 |
| 448 | Ga0207652_10003184 | 3300025921 | Bacteria | 13638 |
| 449 | Ga0207652_10004969 | 3300025921 | Bacteria | 10765 |
| 450 | Ga0207652_10097333 | 3300025921 | Bacteria | 2593 |
| 451 | Ga0207681_10000042 | 3300025923 | Bacteria | 137167 |
| 452 | Ga0207681_10000558 | 3300025923 | Bacteria | 25541 |
| 453 | Ga0207681_10009243 | 3300025923 | Bacteria | 6022 |
| 454 | Ga0207681_10012409 | 3300025923 | Bacteria | 5258 |
| 455 | Ga0207681_10028244 | 3300025923 | Bacteria | 3633 |
| 456 | Ga0207681_10096745 | 3300025923 | Bacteria | 2120 |
| 457 | Ga0207694_10004292 | 3300025924 | Bacteria | 11153 |
| 458 | Ga0207694_10054264 | 3300025924 | Bacteria | 3109 |
| 459 | Ga0207694_10149972 | 3300025924 | Bacteria | 1878 |
| 460 | Ga0207650_10000118 | 3300025925 | Bacteria | 104112 |
| 461 | Ga0207650_10030302 | 3300025925 | Bacteria | 3896 |
| 462 | Ga0207650_10054091 | 3300025925 | Bacteria | 2976 |
| 463 | Ga0207650_10058633 | 3300025925 | Bacteria | 2867 |
| 464 | Ga0207687_10014749 | 3300025927 | Bacteria | 5117 |
| 465 | Ga0207687_10017758 | 3300025927 | Bacteria | 4690 |
| 466 | Ga0207687_10153690 | 3300025927 | Bacteria | 1758 |
| 467 | Ga0207664_10001066 | 3300025929 | Bacteria | 18289 |
| 468 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 469 | Ga0207644_10000034 | 3300025931 | Bacteria | 132239 |
| 470 | Ga0207644_10000328 | 3300025931 | Bacteria | 30816 |
| 471 | Ga0207644_10002034 | 3300025931 | Bacteria | 13085 |
| 472 | Ga0207644_10043243 | 3300025931 | Bacteria | 3196 |
| 473 | Ga0207644_10072594 | 3300025931 | Bacteria | 2521 |
| 474 | Ga0207644_10107790 | 3300025931 | Bacteria | 2102 |
| 475 | Ga0207644_10120201 | 3300025931 | Bacteria | 1999 |
| 476 | Ga0207690_10000142 | 3300025932 | Bacteria | 57187 |
| 477 | Ga0207690_10000161 | 3300025932 | Bacteria | 52622 |
| 478 | Ga0207690_10003702 | 3300025932 | Bacteria | 9098 |
| 479 | Ga0207706_10004879 | 3300025933 | Bacteria | 12546 |
| 480 | Ga0207706_10010885 | 3300025933 | Bacteria | 8299 |
| 481 | Ga0207706_10011982 | 3300025933 | Bacteria | 7899 |
| 482 | Ga0207706_10027411 | 3300025933 | Bacteria | 5093 |
| 483 | Ga0207706_10039609 | 3300025933 | Bacteria | 4178 |
| 484 | Ga0207709_10000018 | 3300025935 | Bacteria | 431545 |
| 485 | Ga0207669_10000055 | 3300025937 | Bacteria | 56749 |
| 486 | Ga0207669_10000311 | 3300025937 | Bacteria | 22231 |
| 487 | Ga0207669_10028512 | 3300025937 | Bacteria | 3073 |
| 488 | Ga0207704_10001695 | 3300025938 | Bacteria | 9871 |
| 489 | Ga0207691_10099108 | 3300025940 | Bacteria | 2602 |
| 490 | Ga0207691_10104930 | 3300025940 | Bacteria | 2518 |
| 491 | Ga0207711_10000374 | 3300025941 | Bacteria | 47567 |
| 492 | Ga0207711_10001625 | 3300025941 | Bacteria | 20737 |
| 493 | Ga0207711_10012677 | 3300025941 | Bacteria | 7003 |
| 494 | Ga0207711_10020668 | 3300025941 | Bacteria | 5493 |
| 495 | Ga0207711_10024234 | 3300025941 | Bacteria | 5079 |
| 496 | Ga0207711_10031965 | 3300025941 | Bacteria | 4447 |
| 497 | Ga0207711_10046761 | 3300025941 | Bacteria | 3698 |
| 498 | Ga0207711_10063192 | 3300025941 | Bacteria | 3195 |
| 499 | Ga0207661_10073728 | 3300025944 | Bacteria | 2797 |
| 500 | Ga0207679_10002863 | 3300025945 | Bacteria | 10700 |
| 501 | Ga0207679_10031822 | 3300025945 | Bacteria | 3696 |
| 502 | Ga0207679_10053471 | 3300025945 | Bacteria | 2968 |
| 503 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 504 | Ga0207667_10002049 | 3300025949 | Bacteria | 25269 |
| 505 | Ga0207667_10012946 | 3300025949 | Bacteria | 9578 |
| 506 | Ga0207667_10018370 | 3300025949 | Bacteria | 7843 |
| 507 | Ga0207667_10030277 | 3300025949 | Bacteria | 5857 |
| 508 | Ga0207667_10030986 | 3300025949 | Bacteria | 5779 |
| 509 | Ga0207667_10042335 | 3300025949 | Bacteria | 4841 |
| 510 | Ga0207667_10047053 | 3300025949 | Bacteria | 4567 |
| 511 | Ga0207667_10151577 | 3300025949 | Bacteria | 2386 |
| 512 | Ga0207667_10273244 | 3300025949 | Bacteria | 1727 |
| 513 | Ga0207712_10002229 | 3300025961 | Bacteria | 12612 |
| 514 | Ga0207712_10022800 | 3300025961 | Bacteria | 4126 |
| 515 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 516 | Ga0207668_10000464 | 3300025972 | Bacteria | 25530 |
| 517 | Ga0207668_10000668 | 3300025972 | Bacteria | 21067 |
| 518 | Ga0207668_10002103 | 3300025972 | Bacteria | 11616 |
| 519 | Ga0207668_10004014 | 3300025972 | Bacteria | 8669 |
| 520 | Ga0207668_10021931 | 3300025972 | Bacteria | 4079 |
| 521 | Ga0207640_10006960 | 3300025981 | Bacteria | 6221 |
| 522 | Ga0207658_10000089 | 3300025986 | Bacteria | 100308 |
| 523 | Ga0207658_10000229 | 3300025986 | Bacteria | 58984 |
| 524 | Ga0207658_10001929 | 3300025986 | Bacteria | 15483 |
| 525 | Ga0207658_10006621 | 3300025986 | Bacteria | 7892 |
| 526 | Ga0207658_10029009 | 3300025986 | Bacteria | 3902 |
| 527 | Ga0207677_10000036 | 3300026023 | Bacteria | 115815 |
| 528 | Ga0207677_10003316 | 3300026023 | Bacteria | 8519 |
| 529 | Ga0207703_10000027 | 3300026035 | Bacteria | 209608 |
| 530 | Ga0207703_10000330 | 3300026035 | Bacteria | 51662 |
| 531 | Ga0207703_10008806 | 3300026035 | Bacteria | 7958 |
| 532 | Ga0207703_10016909 | 3300026035 | Bacteria | 5690 |
| 533 | Ga0207639_10004425 | 3300026041 | Bacteria | 9482 |
| 534 | Ga0207639_10005317 | 3300026041 | Bacteria | 8695 |
| 535 | Ga0207639_10011991 | 3300026041 | Bacteria | 6030 |
| 536 | Ga0207639_10040179 | 3300026041 | Bacteria | 3490 |
| 537 | Ga0207639_10047490 | 3300026041 | Bacteria | 3245 |
| 538 | Ga0207639_10139878 | 3300026041 | Bacteria | 2015 |
| 539 | Ga0207639_10183816 | 3300026041 | Bacteria | 1780 |
| 540 | Ga0207639_10191144 | 3300026041 | Bacteria | 1749 |
| 541 | Ga0207678_10000503 | 3300026067 | Bacteria | 35476 |
| 542 | Ga0207678_10009031 | 3300026067 | Bacteria | 8775 |
| 543 | Ga0207678_10019581 | 3300026067 | Bacteria | 5949 |
| 544 | Ga0207678_10066353 | 3300026067 | Bacteria | 3099 |
| 545 | Ga0207678_10131918 | 3300026067 | Bacteria | 2132 |
| 546 | Ga0207708_10000470 | 3300026075 | Bacteria | 31135 |
| 547 | Ga0207702_10014676 | 3300026078 | Bacteria | 6501 |
| 548 | Ga0207702_10188046 | 3300026078 | Bacteria | 1906 |
| 549 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 550 | Ga0207641_10000060 | 3300026088 | Bacteria | 161514 |
| 551 | Ga0207641_10000243 | 3300026088 | Bacteria | 70600 |
| 552 | Ga0207641_10001900 | 3300026088 | Bacteria | 20061 |
| 553 | Ga0207641_10005156 | 3300026088 | Bacteria | 11180 |
| 554 | Ga0207641_10005247 | 3300026088 | Bacteria | 11076 |
| 555 | Ga0207641_10011979 | 3300026088 | Bacteria | 7114 |
| 556 | Ga0207641_10021125 | 3300026088 | Bacteria | 5350 |
| 557 | Ga0207641_10047698 | 3300026088 | Bacteria | 3613 |
| 558 | Ga0207641_10061514 | 3300026088 | Bacteria | 3202 |
| 559 | Ga0207676_10000068 | 3300026095 | Bacteria | 104705 |
| 560 | Ga0207676_10000087 | 3300026095 | Bacteria | 85293 |
| 561 | Ga0207676_10003035 | 3300026095 | Bacteria | 11983 |
| 562 | Ga0207676_10003136 | 3300026095 | Bacteria | 11798 |
| 563 | Ga0207676_10026183 | 3300026095 | Bacteria | 4336 |
| 564 | Ga0207676_10045603 | 3300026095 | Bacteria | 3388 |
| 565 | Ga0207676_10045609 | 3300026095 | Bacteria | 3388 |
| 566 | Ga0207676_10283934 | 3300026095 | Bacteria | 1504 |
| 567 | Ga0207674_10002013 | 3300026116 | Bacteria | 25816 |
| 568 | Ga0207674_10015660 | 3300026116 | Bacteria | 8325 |
| 569 | Ga0207674_10032601 | 3300026116 | Bacteria | 5463 |
| 570 | Ga0207674_10038271 | 3300026116 | Bacteria | 4981 |
| 571 | Ga0207675_100000225 | 3300026118 | Bacteria | 53168 |
| 572 | Ga0207675_100000666 | 3300026118 | Bacteria | 33780 |
| 573 | Ga0207675_100069432 | 3300026118 | Bacteria | 3293 |
| 574 | Ga0207675_100186138 | 3300026118 | Bacteria | 1990 |
| 575 | Ga0207683_10007580 | 3300026121 | Bacteria | 9297 |
| 576 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 577 | Ga0207698_10011829 | 3300026142 | Bacteria | 5680 |
| 578 | Ga0207698_10014031 | 3300026142 | Bacteria | 5309 |
| 579 | Ga0209813_10000130 | 3300027866 | Bacteria | 27121 |
| 580 | Ga0209813_10003413 | 3300027866 | Bacteria | 3717 |
| 581 | Ga0207428_10061903 | 3300027907 | Bacteria | 2961 |
| 582 | Ga0207428_10187210 | 3300027907 | Bacteria | 1561 |
| 583 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 584 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 585 | Ga0268266_10000800 | 3300028379 | Bacteria | 41757 |
| 586 | Ga0268266_10001045 | 3300028379 | Bacteria | 34723 |
| 587 | Ga0268266_10017802 | 3300028379 | Bacteria | 6056 |
| 588 | Ga0268266_10019517 | 3300028379 | Bacteria | 5776 |
| 589 | Ga0268266_10027675 | 3300028379 | Bacteria | 4820 |
| 590 | Ga0268266_10046135 | 3300028379 | Bacteria | 3731 |
| 591 | Ga0268265_10000043 | 3300028380 | Bacteria | 186081 |
| 592 | Ga0268265_10000500 | 3300028380 | Bacteria | 40586 |
| 593 | Ga0268265_10001504 | 3300028380 | Bacteria | 19451 |
| 594 | Ga0268265_10030171 | 3300028380 | Bacteria | 3901 |
| 595 | Ga0268265_10080763 | 3300028380 | Bacteria | 2565 |
| 596 | Ga0268265_10181559 | 3300028380 | Bacteria | 1808 |
| 597 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 598 | Ga0268264_10000154 | 3300028381 | Bacteria | 156992 |
| 599 | Ga0268264_10000253 | 3300028381 | Bacteria | 98587 |
| 600 | Ga0268264_10003985 | 3300028381 | Bacteria | 12642 |
| 601 | Ga0268264_10008542 | 3300028381 | Bacteria | 8513 |
| 602 | Ga0268264_10009741 | 3300028381 | Bacteria | 7955 |
| 603 | Ga0268264_10014571 | 3300028381 | Bacteria | 6458 |
| 604 | Ga0268264_10040418 | 3300028381 | Bacteria | 3854 |
| 605 | Ga0268264_10078942 | 3300028381 | Bacteria | 2807 |
| 606 | Ga0268264_10083068 | 3300028381 | Bacteria | 2743 |
| 607 | Ga0307517_10004144 | 3300028786 | Bacteria | 22364 |
| 608 | Ga0307517_10016334 | 3300028786 | Bacteria | 9764 |
| 609 | Ga0307517_10073535 | 3300028786 | Bacteria | 3028 |
| 610 | Ga0307515_10040761 | 3300028794 | Bacteria | 7330 |
| 611 | Ga0265338_10036951 | 3300028800 | Bacteria | 4660 |
| 612 | Ga0265338_10107234 | 3300028800 | Bacteria | 2259 |
| 613 | Ga0265325_10000888 | 3300031241 | Bacteria | 21577 |
| 614 | Ga0265327_10000110 | 3300031251 | Bacteria | 181251 |
| 615 | Ga0265327_10001598 | 3300031251 | Bacteria | 27550 |
| 616 | Ga0265327_10005240 | 3300031251 | Bacteria | 10933 |
| 617 | Ga0265316_10082109 | 3300031344 | Bacteria | 2470 |
| 618 | Ga0307513_10000100 | 3300031456 | Bacteria | 125183 |
| 619 | Ga0307513_10000649 | 3300031456 | Bacteria | 50063 |
| 620 | Ga0307513_10004370 | 3300031456 | Bacteria | 18876 |
| 621 | Ga0307513_10005039 | 3300031456 | Bacteria | 17496 |
| 622 | Ga0307513_10015216 | 3300031456 | Bacteria | 9338 |
| 623 | Ga0307513_10083368 | 3300031456 | Bacteria | 3288 |
| 624 | Ga0307509_10165295 | 3300031507 | Bacteria | 2103 |
| 625 | Ga0307408_100080500 | 3300031548 | Bacteria | 2433 |
| 626 | Ga0307408_100245674 | 3300031548 | Bacteria | 1473 |
| 627 | Ga0265313_10000395 | 3300031595 | Bacteria | 46824 |
| 628 | Ga0307508_10012843 | 3300031616 | Bacteria | 7658 |
| 629 | Ga0316579_10012348 | 3300031691 | Bacteria | 3653 |
| 630 | Ga0265314_10002588 | 3300031711 | Bacteria | 18308 |
| 631 | Ga0265314_10006363 | 3300031711 | Bacteria | 10475 |
| 632 | Ga0265342_10043807 | 3300031712 | Bacteria | 2699 |
| 633 | Ga0265342_10047984 | 3300031712 | Bacteria | 2561 |
| 634 | Ga0316576_10107633 | 3300031727 | Bacteria | 2088 |
| 635 | Ga0307405_10011232 | 3300031731 | Bacteria | 4682 |
| 636 | Ga0307405_10014620 | 3300031731 | Bacteria | 4227 |
| 637 | Ga0307405_10099603 | 3300031731 | Bacteria | 1945 |
| 638 | Ga0307413_10000417 | 3300031824 | Bacteria | 13739 |
| 639 | Ga0307413_10001468 | 3300031824 | Bacteria | 8960 |
| 640 | Ga0307413_10005709 | 3300031824 | Bacteria | 5590 |
| 641 | Ga0307413_10010862 | 3300031824 | Bacteria | 4442 |
| 642 | Ga0307413_10014827 | 3300031824 | Bacteria | 3974 |
| 643 | Ga0307413_10024791 | 3300031824 | Bacteria | 3276 |
| 644 | Ga0307413_10029026 | 3300031824 | Bacteria | 3089 |
| 645 | Ga0307413_10061166 | 3300031824 | Bacteria | 2322 |
| 646 | Ga0307413_10111020 | 3300031824 | Bacteria | 1835 |
| 647 | Ga0307413_10158372 | 3300031824 | Bacteria | 1587 |
| 648 | Ga0307410_10003610 | 3300031852 | Bacteria | 7797 |
| 649 | Ga0307410_10015739 | 3300031852 | Bacteria | 4494 |
| 650 | Ga0307410_10016374 | 3300031852 | Bacteria | 4421 |
| 651 | Ga0307410_10046002 | 3300031852 | Bacteria | 2909 |
| 652 | Ga0307406_10020684 | 3300031901 | Bacteria | 3880 |
| 653 | Ga0307407_10009898 | 3300031903 | Bacteria | 4465 |
| 654 | Ga0307407_10061256 | 3300031903 | Bacteria | 2199 |
| 655 | Ga0307412_10000805 | 3300031911 | Bacteria | 18045 |
| 656 | Ga0307412_10010159 | 3300031911 | Bacteria | 5415 |
| 657 | Ga0307412_10014753 | 3300031911 | Bacteria | 4616 |
| 658 | Ga0307412_10046590 | 3300031911 | Bacteria | 2841 |
| 659 | Ga0307412_10066101 | 3300031911 | Bacteria | 2450 |
| 660 | Ga0307409_100001714 | 3300031995 | Bacteria | 11055 |
| 661 | Ga0307409_100012813 | 3300031995 | Bacteria | 5361 |
| 662 | Ga0307409_100091403 | 3300031995 | Bacteria | 2494 |
| 663 | Ga0307409_100109153 | 3300031995 | Bacteria | 2316 |
| 664 | Ga0307416_100015498 | 3300032002 | Bacteria | 5268 |
| 665 | Ga0307416_100090531 | 3300032002 | Bacteria | 2624 |
| 666 | Ga0307416_100103041 | 3300032002 | Bacteria | 2490 |
| 667 | Ga0307414_10001083 | 3300032004 | Bacteria | 13923 |
| 668 | Ga0307414_10003221 | 3300032004 | Bacteria | 8690 |
| 669 | Ga0307414_10003727 | 3300032004 | Bacteria | 8178 |
| 670 | Ga0307414_10007076 | 3300032004 | Bacteria | 6293 |
| 671 | Ga0307414_10023772 | 3300032004 | Bacteria | 3894 |
| 672 | Ga0307414_10027888 | 3300032004 | Bacteria | 3655 |
| 673 | Ga0307414_10039436 | 3300032004 | Bacteria | 3181 |
| 674 | Ga0307414_10044478 | 3300032004 | Bacteria | 3033 |
| 675 | Ga0307414_10049975 | 3300032004 | Bacteria | 2894 |
| 676 | Ga0307414_10080986 | 3300032004 | Bacteria | 2376 |
| 677 | Ga0307414_10081483 | 3300032004 | Bacteria | 2370 |
| 678 | Ga0307414_10088170 | 3300032004 | Bacteria | 2295 |
| 679 | Ga0307414_10235506 | 3300032004 | Bacteria | 1512 |
| 680 | Ga0307411_10018355 | 3300032005 | Bacteria | 4010 |
| 681 | Ga0307411_10023473 | 3300032005 | Bacteria | 3654 |
| 682 | Ga0307411_10063057 | 3300032005 | Bacteria | 2475 |
| 683 | Ga0307411_10074867 | 3300032005 | Bacteria | 2309 |
| 684 | Ga0307415_100001725 | 3300032126 | Bacteria | 10640 |
| 685 | Ga0307415_100003090 | 3300032126 | Bacteria | 8410 |
| 686 | Ga0307415_100007649 | 3300032126 | Bacteria | 5927 |
| 687 | Ga0307415_100043012 | 3300032126 | Bacteria | 3010 |
| 688 | Ga0307415_100092189 | 3300032126 | Bacteria | 2196 |
| 689 | Ga0316583_10001134 | 3300032133 | Bacteria | 8699 |
| 690 | Ga0307510_10008609 | 3300033180 | Bacteria | 12160 |
| 691 | Ga0307510_10080123 | 3300033180 | Bacteria | 3177 |
| 692 | Ga0373944_0010848 | 3300035089 | Bacteria | 2490 |
| 693 | Ga0373939_0006034 | 3300035114 | Bacteria | 2907 |
| 694 | Ga0373939_0020890 | 3300035114 | Bacteria | 1785 |
| 695 | Ga0373941_0002377 | 3300035115 | Bacteria | 4133 |
| 696 | Ga0373941_0012176 | 3300035115 | Bacteria | 2242 |
| 697 | Ga0373943_0022108 | 3300035170 | Bacteria | 2943 |
| 698 | Ga0373961_0006445 | 3300035241 | Bacteria | 2818 |
| 699 | Ga0373962_0029430 | 3300035242 | Bacteria | 1497 |
| 700 | Ga0373931_0000951 | 3300035691 | Bacteria | 12183 |
| 701 | Ga0373927_0035366 | 3300035695 | Bacteria | 3248 |
| 702 | Ga0373927_0050106 | 3300035695 | Bacteria | 2700 |
| 703 | Ga0373937_0071228 | 3300036401 | Bacteria | 3206 |
| 704 | Ga0373937_0098781 | 3300036401 | Bacteria | 2708 |
| 705 | Ga0373937_0146980 | 3300036401 | Bacteria | 2207 |
| 706 | Ga0373925_0000199 | 3300037068 | Bacteria | 65400 |
| 707 | Ga0373925_0171687 | 3300037068 | Bacteria | 1712 |
| 708 | Ga0395899_0001948 | 3300037312 | Bacteria | 16981 |
| 709 | Ga0395899_0002554 | 3300037312 | Bacteria | 14732 |
| 710 | Ga0395899_0028367 | 3300037312 | Bacteria | 4216 |
| 711 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 712 | Ga0395900_0000213 | 3300037418 | Bacteria | 91272 |
| 713 | Ga0395900_0001825 | 3300037418 | Bacteria | 24311 |
| 714 | Ga0395900_0006995 | 3300037418 | Bacteria | 11687 |
| 715 | Ga0395900_0060542 | 3300037418 | Bacteria | 3896 |
| 716 | Ga0395900_0166042 | 3300037418 | Bacteria | 2249 |
| 717 | Ga0395900_0175542 | 3300037418 | Bacteria | 2179 |
| 718 | Ga0395898_0000582 | 3300037466 | Bacteria | 67856 |
| 719 | Ga0395898_0014210 | 3300037466 | Bacteria | 8187 |
| 720 | Ga0395898_0030411 | 3300037466 | Bacteria | 5403 |
| 721 | Ga0395898_0035284 | 3300037466 | Bacteria | 4975 |
| 722 | Ga0395898_0064204 | 3300037466 | Bacteria | 3561 |
| 723 | Ga0395898_0084365 | 3300037466 | Bacteria | 3062 |
| 724 | Ga0395905_0000108 | 3300037471 | Bacteria | 138234 |
| 725 | Ga0395905_0000128 | 3300037471 | Bacteria | 124305 |
| 726 | Ga0395905_0001759 | 3300037471 | Bacteria | 25247 |
| 727 | Ga0395905_0005732 | 3300037471 | Bacteria | 12628 |
| 728 | Ga0395905_0014029 | 3300037471 | Bacteria | 7661 |
| 729 | Ga0395905_0015723 | 3300037471 | Bacteria | 7189 |
| 730 | Ga0395905_0023486 | 3300037471 | Bacteria | 5825 |
| 731 | Ga0395905_0044731 | 3300037471 | Bacteria | 4154 |
| 732 | Ga0395905_0146097 | 3300037471 | Bacteria | 2225 |
| 733 | Ga0395905_0175172 | 3300037471 | Bacteria | 2014 |
| 734 | Ga0436364_0188471 | 3300037853 | Bacteria | 43213 |
| 735 | Ga0436364_0209780 | 3300037853 | Bacteria | 2293 |
| 736 | Ga0436364_0582923 | 3300037853 | Bacteria | 2147 |
| 737 | Ga0395901_0000021 | 3300038443 | Bacteria | 307734 |
| 738 | Ga0395901_0011351 | 3300038443 | Bacteria | 9027 |
| 739 | Ga0395901_0013736 | 3300038443 | Bacteria | 8230 |
| 740 | Ga0395901_0050884 | 3300038443 | Bacteria | 4305 |
| 741 | Ga0395901_0055064 | 3300038443 | Bacteria | 4135 |
| 742 | Ga0395901_0076776 | 3300038443 | Bacteria | 3486 |
| 743 | Ga0237819_02124 | 3300038705 | Bacteria | 4269 |
| 744 | Ga0400483_046084 | 3300039062 | Bacteria | 1797 |
| 745 | Ga0400483_059080 | 3300039062 | Bacteria | 3538 |
| 746 | Ga0400483_099733 | 3300039062 | Bacteria | 3339 |
| 747 | Ga0400483_125071 | 3300039062 | Bacteria | 5691 |
| 748 | Ga0436365_0257402 | 3300039437 | Bacteria | 164674 |
| 749 | Ga0436365_0298223 | 3300039437 | Bacteria | 74249 |
| 750 | Ga0436365_0350825 | 3300039437 | Bacteria | 3173 |
| 751 | Ga0436365_0616457 | 3300039437 | Bacteria | 20937 |
| 752 | Ga0436365_0938205 | 3300039437 | Bacteria | 2760 |
| 753 | Ga0436365_1145611 | 3300039437 | Bacteria | 2873 |
| 754 | Ga0436365_1326958 | 3300039437 | Bacteria | 40452 |
| 755 | Ga0436365_1574866 | 3300039437 | Bacteria | 3675 |
| 756 | Ga0436361_1131750 | 3300039447 | Bacteria | 2569 |
| 757 | Ga0436363_0707542 | 3300039450 | Bacteria | 6129 |
| 758 | Ga0439461_0000264 | 3300041410 | Bacteria | 7521 |
| 759 | Ga0439465_0000472 | 3300041413 | Bacteria | 11922 |
| 760 | Ga0451795_0707270 | 3300041456 | Bacteria | 1591 |
| 761 | Ga0439431_0000300 | 3300041997 | Bacteria | 10190 |
| 762 | Ga0439431_0010999 | 3300041997 | Bacteria | 2062 |
| 763 | Ga0439442_002932 | 3300042002 | Bacteria | 3362 |
| 764 | Ga0439432_002280 | 3300042006 | Bacteria | 7227 |
| 765 | Ga0439452_018759 | 3300042010 | Bacteria | 1839 |
| 766 | Ga0439462_0001923 | 3300042015 | Bacteria | 4733 |
| 767 | Ga0450904_000400 | 3300042139 | Bacteria | 8947 |
| 768 | Ga0450905_003894 | 3300042142 | Bacteria | 1965 |
| 769 | Ga0450907_000900 | 3300042146 | Bacteria | 7088 |
| 770 | Ga0439458_0000074 | 3300042157 | Bacteria | 18402 |
| 771 | Ga0439434_0000095 | 3300042435 | Bacteria | 22345 |
| 772 | Ga0451577_0060900 | 3300042876 | Bacteria | 3365 |
| 773 | Ga0466969_0000486 | 3300044656 | Bacteria | 21764 |
| 774 | Ga0466966_0064193 | 3300044684 | Bacteria | 2312 |
| 775 | Ga0466961_0013782 | 3300044693 | Bacteria | 5181 |
| 776 | Ga0466963_0110203 | 3300044694 | Bacteria | 1889 |
| 777 | Ga0466964_0068646 | 3300044706 | Bacteria | 1493 |
| 778 | Ga0466971_0002611 | 3300044719 | Bacteria | 7623 |
| 779 | Ga0466968_0043813 | 3300044735 | Bacteria | 1895 |
| 780 | Ga0466957_0001487 | 3300044842 | Bacteria | 12287 |
| 781 | Ga0466959_0000155 | 3300045049 | Bacteria | 44848 |
| 782 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 783 | Ga0466958_0011945 | 3300045836 | Bacteria | 4906 |
| 784 | Ga0466967_0055997 | 3300045976 | Bacteria | 3475 |
| 785 | Ga0466967_0088996 | 3300045976 | Bacteria | 2803 |
| 786 | Ga0495627_000230 | 3300046453 | Bacteria | 59380 |
| 787 | Ga0495627_000954 | 3300046453 | Bacteria | 19825 |
| 788 | Ga0495590_0000763 | 3300046457 | Bacteria | 14638 |
| 789 | Ga0495638_0000613 | 3300046460 | Bacteria | 39830 |
| 790 | Ga0495638_0001571 | 3300046460 | Bacteria | 20485 |
| 791 | Ga0495638_0006650 | 3300046460 | Bacteria | 8391 |
| 792 | Ga0495638_0028107 | 3300046460 | Bacteria | 3634 |
| 793 | Ga0495650_0000468 | 3300046471 | Bacteria | 62149 |
| 794 | Ga0495650_0000926 | 3300046471 | Bacteria | 34330 |
| 795 | Ga0495650_0004694 | 3300046471 | Bacteria | 9223 |
| 796 | Ga0495594_0048015 | 3300046499 | Bacteria | 2345 |
| 797 | Ga0495596_0000314 | 3300046500 | Bacteria | 31893 |
| 798 | Ga0495596_0001189 | 3300046500 | Bacteria | 15223 |
| 799 | Ga0495607_0023019 | 3300046501 | Bacteria | 3905 |
| 800 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 801 | Ga0495583_0006990 | 3300046506 | Bacteria | 7227 |
| 802 | Ga0495583_0019104 | 3300046506 | Bacteria | 3586 |
| 803 | Ga0495606_0000809 | 3300046507 | Bacteria | 47581 |
| 804 | Ga0495606_0001283 | 3300046507 | Bacteria | 34807 |
| 805 | Ga0495606_0011422 | 3300046507 | Bacteria | 7243 |
| 806 | Ga0495606_0012552 | 3300046507 | Bacteria | 6784 |
| 807 | Ga0495606_0102542 | 3300046507 | Bacteria | 1739 |
| 808 | Ga0495610_0000031 | 3300046512 | Bacteria | 254606 |
| 809 | Ga0495610_0000816 | 3300046512 | Bacteria | 29254 |
| 810 | Ga0495610_0002416 | 3300046512 | Bacteria | 15729 |
| 811 | Ga0495610_0002953 | 3300046512 | Bacteria | 13709 |
| 812 | Ga0495610_0005936 | 3300046512 | Bacteria | 8552 |
| 813 | Ga0495610_0010540 | 3300046512 | Bacteria | 5732 |
| 814 | Ga0495610_0013934 | 3300046512 | Bacteria | 4751 |
| 815 | Ga0495616_0000030 | 3300046513 | Bacteria | 132950 |
| 816 | Ga0495616_0000405 | 3300046513 | Bacteria | 33255 |
| 817 | Ga0495620_0018404 | 3300046515 | Bacteria | 3460 |
| 818 | Ga0495631_0008844 | 3300046518 | Bacteria | 5055 |
| 819 | Ga0495632_0001835 | 3300046519 | Bacteria | 17118 |
| 820 | Ga0495632_0003925 | 3300046519 | Bacteria | 10328 |
| 821 | Ga0495632_0046621 | 3300046519 | Bacteria | 2153 |
| 822 | Ga0495632_0049216 | 3300046519 | Bacteria | 2084 |
| 823 | Ga0495637_0019611 | 3300046520 | Bacteria | 3123 |
| 824 | Ga0495643_0000014 | 3300046522 | Bacteria | 314632 |
| 825 | Ga0495643_0000159 | 3300046522 | Bacteria | 108642 |
| 826 | Ga0495643_0002054 | 3300046522 | Bacteria | 16700 |
| 827 | Ga0495643_0008243 | 3300046522 | Bacteria | 6618 |
| 828 | Ga0495643_0009120 | 3300046522 | Bacteria | 6207 |
| 829 | Ga0495643_0026530 | 3300046522 | Bacteria | 3269 |
| 830 | Ga0495648_0000107 | 3300046524 | Bacteria | 104376 |
| 831 | Ga0495648_0000152 | 3300046524 | Bacteria | 82900 |
| 832 | Ga0495648_0023970 | 3300046524 | Bacteria | 4167 |
| 833 | Ga0495642_0002008 | 3300046528 | Bacteria | 8487 |
| 834 | Ga0495642_0029966 | 3300046528 | Bacteria | 2175 |
| 835 | Ga0495654_0000199 | 3300046530 | Bacteria | 58450 |
| 836 | Ga0495654_0001219 | 3300046530 | Bacteria | 18236 |
| 837 | Ga0495654_0043994 | 3300046530 | Bacteria | 2211 |
| 838 | Ga0495654_0082554 | 3300046530 | Bacteria | 1504 |
| 839 | Ga0495587_0075380 | 3300046536 | Bacteria | 1959 |
| 840 | Ga0495598_0015637 | 3300046537 | Bacteria | 1920 |
| 841 | Ga0495609_0002848 | 3300046538 | Bacteria | 10345 |
| 842 | Ga0495609_0016617 | 3300046538 | Bacteria | 3427 |
| 843 | Ga0495609_0019732 | 3300046538 | Bacteria | 3117 |
| 844 | Ga0495597_0001614 | 3300046542 | Bacteria | 15825 |
| 845 | Ga0495622_0002247 | 3300046557 | Bacteria | 9402 |
| 846 | Ga0495622_0070321 | 3300046557 | Bacteria | 1615 |
| 847 | Ga0495633_0000400 | 3300046558 | Bacteria | 45378 |
| 848 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 849 | Ga0495668_0000389 | 3300046616 | Bacteria | 57953 |
| 850 | Ga0495668_0002423 | 3300046616 | Bacteria | 15386 |
| 851 | Ga0495668_0003831 | 3300046616 | Bacteria | 11013 |
| 852 | Ga0495668_0009041 | 3300046616 | Bacteria | 6151 |
| 853 | Ga0495668_0020864 | 3300046616 | Bacteria | 3762 |
| 854 | Ga0495668_0032711 | 3300046616 | Bacteria | 2924 |
| 855 | Ga0495668_0035138 | 3300046616 | Bacteria | 2809 |
| 856 | Ga0495668_0041587 | 3300046616 | Bacteria | 2560 |
| 857 | Ga0495611_0002954 | 3300046648 | Bacteria | 7579 |
| 858 | Ga0495611_0011861 | 3300046648 | Bacteria | 3699 |
| 859 | Ga0495625_0000339 | 3300046660 | Bacteria | 71474 |
| 860 | Ga0495625_0000707 | 3300046660 | Bacteria | 47153 |
| 861 | Ga0495625_0001440 | 3300046660 | Bacteria | 28945 |
| 862 | Ga0495625_0004355 | 3300046660 | Bacteria | 13450 |
| 863 | Ga0495625_0004577 | 3300046660 | Bacteria | 13007 |
| 864 | Ga0495625_0013497 | 3300046660 | Bacteria | 6561 |
| 865 | Ga0495625_0047436 | 3300046660 | Bacteria | 3097 |
| 866 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 867 | Ga0495669_0000318 | 3300046684 | Bacteria | 26632 |
| 868 | Ga0495669_0000433 | 3300046684 | Bacteria | 19902 |
| 869 | Ga0495669_0018193 | 3300046684 | Bacteria | 3019 |
| 870 | Ga0495669_0027912 | 3300046684 | Bacteria | 2469 |
| 871 | Ga0495669_0040720 | 3300046684 | Bacteria | 2061 |
| 872 | Ga0495613_0001950 | 3300046689 | Bacteria | 15659 |
| 873 | Ga0495670_0000006 | 3300046691 | Bacteria | 255322 |
| 874 | Ga0495671_0000058 | 3300046692 | Bacteria | 113487 |
| 875 | Ga0495671_0064432 | 3300046692 | Bacteria | 1804 |
| 876 | Ga0495649_0000118 | 3300046694 | Bacteria | 69833 |
| 877 | Ga0495649_0076182 | 3300046694 | Bacteria | 1796 |
| 878 | Ga0495649_0085326 | 3300046694 | Bacteria | 1685 |
| 879 | Ga0495589_0003192 | 3300046794 | Bacteria | 8951 |
| 880 | Ga0495589_0006097 | 3300046794 | Bacteria | 6371 |
| 881 | Ga0495600_0001465 | 3300046809 | Bacteria | 13091 |
| 882 | Ga0495660_0014662 | 3300046810 | Bacteria | 4533 |
| 883 | Ga0495636_0045637 | 3300047318 | Bacteria | 1827 |
| 884 | Ga0495672_0007833 | 3300047320 | Bacteria | 7977 |
| 885 | Ga0495672_0025937 | 3300047320 | Bacteria | 3746 |
| 886 | Ga0495680_0108286 | 3300047322 | Bacteria | 2063 |
| 887 | Ga0495683_0034867 | 3300047323 | Bacteria | 2558 |
| 888 | Ga0495687_010981 | 3300047443 | Bacteria | 4909 |
| 889 | Ga0495687_050161 | 3300047443 | Bacteria | 1780 |
| 890 | Ga0495677_0001848 | 3300047445 | Bacteria | 8464 |
| 891 | Ga0495677_0021725 | 3300047445 | Bacteria | 2326 |
| 892 | Ga0495673_0000370 | 3300047469 | Bacteria | 54131 |
| 893 | Ga0495673_0001884 | 3300047469 | Bacteria | 15741 |
| 894 | Ga0495681_0000211 | 3300047470 | Bacteria | 48554 |
| 895 | Ga0495681_0007535 | 3300047470 | Bacteria | 6935 |
| 896 | Ga0495681_0030101 | 3300047470 | Bacteria | 2769 |
| 897 | Ga0495686_0000074 | 3300047472 | Bacteria | 208094 |
| 898 | Ga0495686_0000650 | 3300047472 | Bacteria | 47482 |
| 899 | Ga0495686_0001170 | 3300047472 | Bacteria | 30668 |
| 900 | Ga0495686_0003469 | 3300047472 | Bacteria | 13649 |
| 901 | Ga0495686_0006442 | 3300047472 | Bacteria | 8987 |
| 902 | Ga0495686_0016140 | 3300047472 | Bacteria | 5074 |
| 903 | Ga0495686_0016988 | 3300047472 | Bacteria | 4914 |
| 904 | Ga0495686_0020655 | 3300047472 | Bacteria | 4390 |
| 905 | Ga0495686_0040060 | 3300047472 | Bacteria | 2990 |
| 906 | Ga0495602_0057744 | 3300048088 | Bacteria | 3402 |
| 907 | Ga0495615_0000901 | 3300048090 | Bacteria | 4201 |
| 908 | Ga0495615_0002799 | 3300048090 | Bacteria | 2840 |
| 909 | Ga0495626_0000139 | 3300048091 | Bacteria | 92719 |
| 910 | Ga0496100_0092837 | 3300048903 | Bacteria | 2064 |
| 911 | Ga0496101_0056532 | 3300048904 | Bacteria | 2837 |
| 912 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 913 | Ga0496102_0000125 | 3300048905 | Bacteria | 109075 |
| 914 | Ga0496102_0003298 | 3300048905 | Bacteria | 13683 |
| 915 | Ga0496102_0036887 | 3300048905 | Bacteria | 4407 |
| 916 | Ga0496102_0309549 | 3300048905 | Bacteria | 1488 |
| 917 | Ga0496102_0320533 | 3300048905 | Bacteria | 1460 |
| 918 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 919 | Ga0496103_0000322 | 3300048906 | Bacteria | 43840 |
| 920 | Ga0496103_0021698 | 3300048906 | Bacteria | 3864 |
| 921 | Ga0496104_0000094 | 3300048907 | Bacteria | 86872 |
| 922 | Ga0496104_0015178 | 3300048907 | Bacteria | 6973 |
| 923 | Ga0496105_0000261 | 3300048908 | Bacteria | 35507 |
| 924 | Ga0496105_0007066 | 3300048908 | Bacteria | 8654 |
| 925 | Ga0496105_0034153 | 3300048908 | Bacteria | 4182 |
| 926 | Ga0496105_0220751 | 3300048908 | Bacteria | 1543 |
| 927 | Ga0496106_0001568 | 3300048909 | Bacteria | 17207 |
| 928 | Ga0496106_0003336 | 3300048909 | Bacteria | 11965 |
| 929 | Ga0496106_0005947 | 3300048909 | Bacteria | 9009 |
| 930 | Ga0496106_0050742 | 3300048909 | Bacteria | 3127 |
| 931 | Ga0496107_0000039 | 3300048910 | Bacteria | 77588 |
| 932 | Ga0496107_0016977 | 3300048910 | Bacteria | 5118 |
| 933 | Ga0496108_0025985 | 3300048911 | Bacteria | 4829 |
| 934 | Ga0496109_0014912 | 3300048912 | Bacteria | 6764 |
| 935 | Ga0496109_0053549 | 3300048912 | Bacteria | 3680 |
| 936 | Ga0496109_0144902 | 3300048912 | Bacteria | 2222 |
| 937 | Ga0496109_0146320 | 3300048912 | Bacteria | 2211 |
| 938 | Ga0496109_0287190 | 3300048912 | Bacteria | 1551 |
| 939 | Ga0496110_0000954 | 3300048913 | Bacteria | 20257 |
| 940 | Ga0496110_0002141 | 3300048913 | Bacteria | 14760 |
| 941 | Ga0496111_0011575 | 3300048914 | Bacteria | 5949 |
| 942 | Ga0496112_0016768 | 3300048915 | Bacteria | 6870 |
| 943 | Ga0496112_0068649 | 3300048915 | Bacteria | 3501 |
| 944 | Ga0496112_0115553 | 3300048915 | Bacteria | 2654 |
| 945 | Ga0496113_0000109 | 3300048916 | Bacteria | 35336 |
| 946 | Ga0496113_0036227 | 3300048916 | Bacteria | 3613 |
| 947 | Ga0496113_0056296 | 3300048916 | Bacteria | 2952 |
| 948 | Ga0496114_0001428 | 3300048917 | Bacteria | 18118 |
| 949 | Ga0496114_0065681 | 3300048917 | Bacteria | 3040 |
| 950 | Ga0496115_0000142 | 3300048918 | Bacteria | 65915 |
| 951 | Ga0496115_0000784 | 3300048918 | Bacteria | 23307 |
| 952 | Ga0496115_0017296 | 3300048918 | Bacteria | 5509 |
| 953 | Ga0496115_0019522 | 3300048918 | Bacteria | 5217 |
| 954 | Ga0496115_0055841 | 3300048918 | Bacteria | 3173 |
| 955 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 956 | Ga0496116_0001001 | 3300048919 | Bacteria | 34554 |
| 957 | Ga0496116_0029403 | 3300048919 | Bacteria | 3962 |
| 958 | Ga0496116_0030724 | 3300048919 | Bacteria | 3855 |
| 959 | Ga0496116_0169802 | 3300048919 | Bacteria | 1183 |
| 960 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 961 | Ga0496117_0001219 | 3300048920 | Bacteria | 38563 |
| 962 | Ga0496117_0029261 | 3300048920 | Bacteria | 4249 |
| 963 | Ga0496117_0070924 | 3300048920 | Bacteria | 2337 |
| 964 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 965 | Ga0496118_0000285 | 3300048921 | Bacteria | 88805 |
| 966 | Ga0496118_0003370 | 3300048921 | Bacteria | 20186 |
| 967 | Ga0496118_0014593 | 3300048921 | Bacteria | 7344 |
| 968 | Ga0496118_0016614 | 3300048921 | Bacteria | 6744 |
| 969 | Ga0496118_0023332 | 3300048921 | Bacteria | 5377 |
| 970 | Ga0496118_0119716 | 3300048921 | Bacteria | 1720 |
| 971 | Ga0496119_0016109 | 3300048922 | Bacteria | 5710 |
| 972 | Ga0496120_0025661 | 3300048923 | Bacteria | 3654 |
| 973 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 974 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 975 | Ga0496121_0000136 | 3300048924 | Bacteria | 165350 |
| 976 | Ga0496121_0000671 | 3300048924 | Bacteria | 63867 |
| 977 | Ga0496121_0001101 | 3300048924 | Bacteria | 47588 |
| 978 | Ga0496121_0001923 | 3300048924 | Bacteria | 33167 |
| 979 | Ga0496121_0002011 | 3300048924 | Bacteria | 32308 |
| 980 | Ga0496121_0006291 | 3300048924 | Bacteria | 14844 |
| 981 | Ga0496121_0014630 | 3300048924 | Bacteria | 8299 |
| 982 | Ga0496121_0015763 | 3300048924 | Bacteria | 7874 |
| 983 | Ga0496121_0190308 | 3300048924 | Bacteria | 1472 |
| 984 | Ga0496122_0000216 | 3300048925 | Bacteria | 128675 |
| 985 | Ga0496122_0003299 | 3300048925 | Bacteria | 21357 |
| 986 | Ga0496122_0030555 | 3300048925 | Bacteria | 4511 |
| 987 | Ga0496122_0083751 | 3300048925 | Bacteria | 2209 |
| 988 | Ga0496123_0000233 | 3300048926 | Bacteria | 112582 |
| 989 | Ga0496123_0000785 | 3300048926 | Bacteria | 51254 |
| 990 | Ga0496123_0000968 | 3300048926 | Bacteria | 44375 |
| 991 | Ga0496123_0002132 | 3300048926 | Bacteria | 25323 |
| 992 | Ga0496123_0016451 | 3300048926 | Bacteria | 6005 |
| 993 | Ga0496123_0016583 | 3300048926 | Bacteria | 5972 |
| 994 | Ga0496123_0137042 | 3300048926 | Bacteria | 1345 |
| 995 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 996 | Ga0496124_0000320 | 3300048927 | Bacteria | 88704 |
| 997 | Ga0496124_0000576 | 3300048927 | Bacteria | 61985 |
| 998 | Ga0496124_0006449 | 3300048927 | Bacteria | 12776 |
| 999 | Ga0496124_0009450 | 3300048927 | Bacteria | 10044 |
| 1000 | Ga0496124_0025914 | 3300048927 | Bacteria | 5298 |
| 1001 | Ga0496124_0102508 | 3300048927 | Bacteria | 2316 |
| 1002 | Ga0496124_0110382 | 3300048927 | Bacteria | 2214 |
| 1003 | Ga0496125_0001234 | 3300048928 | Bacteria | 38266 |
| 1004 | Ga0496125_0001397 | 3300048928 | Bacteria | 35315 |
| 1005 | Ga0496125_0008737 | 3300048928 | Bacteria | 10540 |
| 1006 | Ga0496125_0015787 | 3300048928 | Bacteria | 7277 |
| 1007 | Ga0496125_0019180 | 3300048928 | Bacteria | 6461 |
| 1008 | Ga0496125_0026259 | 3300048928 | Bacteria | 5312 |
| 1009 | Ga0496125_0096407 | 3300048928 | Bacteria | 2196 |
| 1010 | Ga0496126_0000655 | 3300048929 | Bacteria | 64225 |
| 1011 | Ga0496126_0001266 | 3300048929 | Bacteria | 40672 |
| 1012 | Ga0496126_0005994 | 3300048929 | Bacteria | 13652 |
| 1013 | Ga0496126_0015056 | 3300048929 | Bacteria | 7795 |
| 1014 | Ga0496126_0022090 | 3300048929 | Bacteria | 6198 |
| 1015 | Ga0496126_0143203 | 3300048929 | Bacteria | 2055 |
| 1016 | Ga0495678_002387 | 3300049459 | Bacteria | 12852 |
| 1017 | Ga0501290_000033 | 3300049513 | Bacteria | 18347 |
| 1018 | Ga0501292_000026 | 3300049515 | Bacteria | 42153 |
| 1019 | Ga0501294_000779 | 3300049517 | Bacteria | 3495 |
| 1020 | Ga0501300_005984 | 3300049523 | Bacteria | 1791 |
| 1021 | Ga0501031_0123192 | 3300049568 | Bacteria | 1693 |
| 1022 | Ga0501031_0127692 | 3300049568 | Bacteria | 1661 |
| 1023 | Ga0501032_0000341 | 3300049569 | Bacteria | 39021 |
| 1024 | Ga0501032_0001548 | 3300049569 | Bacteria | 18326 |
| 1025 | Ga0501033_0000287 | 3300049570 | Bacteria | 48448 |
| 1026 | Ga0501033_0011462 | 3300049570 | Bacteria | 6784 |
| 1027 | Ga0501033_0052342 | 3300049570 | Bacteria | 3026 |
| 1028 | Ga0501033_0086258 | 3300049570 | Bacteria | 2298 |
| 1029 | Ga0501033_0107904 | 3300049570 | Bacteria | 2028 |
| 1030 | Ga0501033_0172764 | 3300049570 | Bacteria | 1552 |
| 1031 | Ga0501034_0000135 | 3300049571 | Bacteria | 137151 |
| 1032 | Ga0501034_0001020 | 3300049571 | Bacteria | 40131 |
| 1033 | Ga0501034_0004898 | 3300049571 | Bacteria | 14758 |
| 1034 | Ga0501034_0006655 | 3300049571 | Bacteria | 12394 |
| 1035 | Ga0501034_0021280 | 3300049571 | Bacteria | 6613 |
| 1036 | Ga0501034_0026896 | 3300049571 | Bacteria | 5853 |
| 1037 | Ga0501034_0036856 | 3300049571 | Bacteria | 4952 |
| 1038 | Ga0501034_0037070 | 3300049571 | Bacteria | 4937 |
| 1039 | Ga0501034_0154648 | 3300049571 | Bacteria | 2268 |
| 1040 | Ga0501034_0179597 | 3300049571 | Bacteria | 2082 |
| 1041 | Ga0501036_0003057 | 3300049572 | Bacteria | 13338 |
| 1042 | Ga0501036_0017342 | 3300049572 | Bacteria | 6018 |
| 1043 | Ga0501036_0019184 | 3300049572 | Bacteria | 5737 |
| 1044 | Ga0501036_0033991 | 3300049572 | Bacteria | 4312 |
| 1045 | Ga0501037_0000987 | 3300049573 | Bacteria | 21089 |
| 1046 | Ga0501037_0004940 | 3300049573 | Bacteria | 9700 |
| 1047 | Ga0501037_0005708 | 3300049573 | Bacteria | 9083 |
| 1048 | Ga0501037_0007076 | 3300049573 | Bacteria | 8196 |
| 1049 | Ga0501037_0087637 | 3300049573 | Bacteria | 2253 |
| 1050 | Ga0501037_0114808 | 3300049573 | Bacteria | 1938 |
| 1051 | Ga0501037_0164605 | 3300049573 | Bacteria | 1580 |
| 1052 | Ga0501038_0010812 | 3300049574 | Bacteria | 8341 |
| 1053 | Ga0501038_0138952 | 3300049574 | Bacteria | 1989 |
| 1054 | Ga0501039_0000180 | 3300049575 | Bacteria | 45008 |
| 1055 | Ga0501040_0115576 | 3300049576 | Bacteria | 1879 |
| 1056 | Ga0501040_0143425 | 3300049576 | Bacteria | 1683 |
| 1057 | Ga0501042_0094542 | 3300049578 | Bacteria | 2147 |
| 1058 | Ga0501043_0003691 | 3300049579 | Bacteria | 12574 |
| 1059 | Ga0501043_0011753 | 3300049579 | Bacteria | 6856 |
| 1060 | Ga0501043_0014517 | 3300049579 | Bacteria | 6167 |
| 1061 | Ga0501043_0156785 | 3300049579 | Bacteria | 1780 |
| 1062 | Ga0501043_0217987 | 3300049579 | Bacteria | 1477 |
| 1063 | Ga0501046_0000567 | 3300049580 | Bacteria | 36589 |
| 1064 | Ga0501046_0001979 | 3300049580 | Bacteria | 19466 |
| 1065 | Ga0501046_0093688 | 3300049580 | Bacteria | 2309 |
| 1066 | Ga0501047_0000435 | 3300049581 | Bacteria | 46511 |
| 1067 | Ga0501047_0001118 | 3300049581 | Bacteria | 26623 |
| 1068 | Ga0501047_0004654 | 3300049581 | Bacteria | 12909 |
| 1069 | Ga0501047_0006070 | 3300049581 | Bacteria | 11353 |
| 1070 | Ga0501047_0007181 | 3300049581 | Bacteria | 10470 |
| 1071 | Ga0501047_0014549 | 3300049581 | Bacteria | 7485 |
| 1072 | Ga0501047_0022842 | 3300049581 | Bacteria | 6005 |
| 1073 | Ga0501047_0043193 | 3300049581 | Bacteria | 4354 |
| 1074 | Ga0501047_0057512 | 3300049581 | Bacteria | 3760 |
| 1075 | Ga0501047_0130014 | 3300049581 | Bacteria | 2399 |
| 1076 | Ga0501047_0136714 | 3300049581 | Bacteria | 2331 |
| 1077 | Ga0501047_0167660 | 3300049581 | Bacteria | 2066 |
| 1078 | Ga0501047_0345461 | 3300049581 | Bacteria | 1325 |
| 1079 | Ga0501048_0000615 | 3300049582 | Bacteria | 25398 |
| 1080 | Ga0501067_0000123 | 3300049583 | Bacteria | 42381 |
| 1081 | Ga0501067_0001900 | 3300049583 | Bacteria | 11486 |
| 1082 | Ga0501067_0019712 | 3300049583 | Bacteria | 3734 |
| 1083 | Ga0501068_0001282 | 3300049584 | Bacteria | 13343 |
| 1084 | Ga0501069_0023377 | 3300049585 | Bacteria | 3370 |
| 1085 | Ga0501070_0000111 | 3300049586 | Bacteria | 71786 |
| 1086 | Ga0501070_0023959 | 3300049586 | Bacteria | 5116 |
| 1087 | Ga0501072_0000844 | 3300049588 | Bacteria | 22545 |
| 1088 | Ga0501073_0000002 | 3300049589 | Bacteria | 323865 |
| 1089 | Ga0501073_0005548 | 3300049589 | Bacteria | 9436 |
| 1090 | Ga0501073_0007445 | 3300049589 | Bacteria | 8136 |
| 1091 | Ga0501073_0074964 | 3300049589 | Bacteria | 2355 |
| 1092 | Ga0501075_0042396 | 3300049591 | Bacteria | 3412 |
| 1093 | Ga0501075_0110505 | 3300049591 | Bacteria | 2090 |
| 1094 | Ga0501075_0165309 | 3300049591 | Bacteria | 1688 |
| 1095 | Ga0501076_0021665 | 3300049592 | Bacteria | 4932 |
| 1096 | Ga0501077_0000002 | 3300049593 | Bacteria | 159855 |
| 1097 | Ga0501222_000709 | 3300049662 | Bacteria | 4878 |
| 1098 | Ga0501223_000012 | 3300049663 | Bacteria | 75953 |
| 1099 | Ga0501223_009167 | 3300049663 | Bacteria | 2009 |
| 1100 | Ga0501233_006677 | 3300049668 | Bacteria | 2175 |
| 1101 | Ga0501242_002950 | 3300049674 | Bacteria | 1818 |
| 1102 | Ga0501249_002241 | 3300049679 | Bacteria | 3925 |
| 1103 | Ga0501249_005886 | 3300049679 | Bacteria | 2510 |
| 1104 | Ga0501257_000040 | 3300049686 | Bacteria | 36614 |
| 1105 | Ga0501257_003032 | 3300049686 | Bacteria | 3575 |
| 1106 | Ga0501261_000055 | 3300049690 | Bacteria | 21300 |
| 1107 | Ga0501225_0014233 | 3300049705 | Bacteria | 2223 |
| 1108 | Ga0501079_0011214 | 3300049741 | Bacteria | 6837 |
| 1109 | Ga0501079_0110693 | 3300049741 | Bacteria | 2134 |
| 1110 | Ga0501079_0132494 | 3300049741 | Bacteria | 1940 |
| 1111 | Ga0501080_0000014 | 3300049742 | Bacteria | 99739 |
| 1112 | Ga0501080_0000199 | 3300049742 | Bacteria | 44057 |
| 1113 | Ga0501080_0001583 | 3300049742 | Bacteria | 19292 |
| 1114 | Ga0501080_0002278 | 3300049742 | Bacteria | 16703 |
| 1115 | Ga0501080_0042676 | 3300049742 | Bacteria | 4223 |
| 1116 | Ga0501081_0203208 | 3300049743 | Bacteria | 1437 |
| 1117 | Ga0501083_0007263 | 3300049744 | Bacteria | 7865 |
| 1118 | Ga0501241_006104 | 3300049758 | Bacteria | 2230 |
| 1119 | Ga0501270_002356 | 3300049767 | Bacteria | 1930 |
| 1120 | Ga0501279_000027 | 3300049775 | Bacteria | 40843 |
| 1121 | Ga0501280_000543 | 3300049776 | Bacteria | 8844 |
| 1122 | Ga0501280_001354 | 3300049776 | Bacteria | 4648 |
| 1123 | Ga0501281_00070 | 3300049777 | Bacteria | 11809 |
| 1124 | Ga0501283_001097 | 3300049779 | Bacteria | 3570 |
| 1125 | Ga0501035_0000056 | 3300049822 | Bacteria | 137385 |
| 1126 | Ga0501035_0002698 | 3300049822 | Bacteria | 17267 |
| 1127 | Ga0501035_0006774 | 3300049822 | Bacteria | 10707 |
| 1128 | Ga0501035_0011486 | 3300049822 | Bacteria | 8206 |
| 1129 | Ga0501035_0133714 | 3300049822 | Bacteria | 2161 |
| 1130 | Ga0501035_0247831 | 3300049822 | Bacteria | 1514 |
| 1131 | Ga0501044_0000826 | 3300049823 | Bacteria | 37298 |
| 1132 | Ga0501044_0001302 | 3300049823 | Bacteria | 29482 |
| 1133 | Ga0501044_0006354 | 3300049823 | Bacteria | 13063 |
| 1134 | Ga0501044_0013907 | 3300049823 | Bacteria | 8696 |
| 1135 | Ga0501044_0018903 | 3300049823 | Bacteria | 7378 |
| 1136 | Ga0501044_0019159 | 3300049823 | Bacteria | 7326 |
| 1137 | Ga0501044_0038309 | 3300049823 | Bacteria | 5006 |
| 1138 | Ga0501044_0059578 | 3300049823 | Bacteria | 3911 |
| 1139 | Ga0501044_0090277 | 3300049823 | Bacteria | 3091 |
| 1140 | Ga0501044_0093564 | 3300049823 | Bacteria | 3030 |
| 1141 | Ga0501044_0100855 | 3300049823 | Bacteria | 2905 |
| 1142 | Ga0501044_0152650 | 3300049823 | Bacteria | 2291 |
| 1143 | Ga0501044_0198895 | 3300049823 | Bacteria | 1963 |
| 1144 | Ga0501045_0030541 | 3300049824 | Bacteria | 3901 |
| 1145 | nmdc:mga03683_1197_c1 | 3300050489 | Bacteria | 7649 |
| 1146 | nmdc:mga03683_32_c1 | 3300050489 | Bacteria | 68182 |
| 1147 | nmdc:mga03683_3999_c1 | 3300050489 | Bacteria | 4830 |
| 1148 | nmdc:mga03n38_26053_c1 | 3300050490 | Bacteria | 2411 |
| 1149 | nmdc:mga03n38_38213_c1 | 3300050490 | Bacteria | 2075 |
| 1150 | nmdc:mga00v17_481_c1 | 3300050491 | Bacteria | 22300 |
| 1151 | nmdc:mga00v17_687_c1 | 3300050491 | Bacteria | 18636 |
| 1152 | nmdc:mga0yw44_124867_c1 | 3300050492 | Bacteria | 1661 |
| 1153 | nmdc:mga0k408_7_c1 | 3300050493 | Bacteria | 164270 |
| 1154 | nmdc:mga0k408_87211_c1 | 3300050493 | Bacteria | 1833 |
| 1155 | nmdc:mga06z11_4155_c1 | 3300050494 | Bacteria | 5663 |
| 1156 | nmdc:mga06z11_9336_c1 | 3300050494 | Bacteria | 4130 |
| 1157 | nmdc:mga06z11_99581_c1 | 3300050494 | Bacteria | 1592 |
| 1158 | nmdc:mga04h51_1548_c1 | 3300050495 | Bacteria | 5344 |
| 1159 | nmdc:mga04h51_269_c1 | 3300050495 | Bacteria | 13325 |
| 1160 | nmdc:mga04h51_879_c1 | 3300050495 | Bacteria | 6916 |
| 1161 | nmdc:mga07m45_132684_c1 | 3300050496 | Bacteria | 1441 |
| 1162 | nmdc:mga07m45_1567_c1 | 3300050496 | Bacteria | 10524 |
| 1163 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 1164 | nmdc:mga07m45_48438_c1 | 3300050496 | Bacteria | 2390 |
| 1165 | nmdc:mga07m45_90_c1 | 3300050496 | Bacteria | 34935 |
| 1166 | nmdc:mga0qj67_10678_c1 | 3300050509 | Bacteria | 6863 |
| 1167 | nmdc:mga06r32_34521_c1 | 3300050510 | Bacteria | 4770 |
| 1168 | nmdc:mga06r32_5383_c1 | 3300050510 | Bacteria | 11517 |
| 1169 | nmdc:mga06r32_69356_c1 | 3300050510 | Bacteria | 3407 |
| 1170 | nmdc:mga06r32_82853_c1 | 3300050510 | Bacteria | 3125 |
| 1171 | nmdc:mga08y16_52472_c1 | 3300050511 | Bacteria | 4266 |
| 1172 | nmdc:mga0sz30_5235_c1 | 3300050516 | Bacteria | 4746 |
| 1173 | nmdc:mga0sz30_6928_c1 | 3300050516 | Bacteria | 4233 |
| 1174 | Ga0500610_0000036 | 3300053079 | Bacteria | 46301 |
| 1175 | Ga0500635_0000172 | 3300053080 | Bacteria | 33572 |
| 1176 | Ga0500643_000226 | 3300053087 | Bacteria | 52820 |
| 1177 | Ga0500643_000821 | 3300053087 | Bacteria | 20070 |
| 1178 | Ga0500643_001378 | 3300053087 | Bacteria | 14073 |
| 1179 | Ga0500643_003017 | 3300053087 | Bacteria | 8332 |
| 1180 | Ga0500643_007637 | 3300053087 | Bacteria | 4332 |
| 1181 | Ga0500643_013280 | 3300053087 | Bacteria | 2914 |
| 1182 | Ga0500643_026815 | 3300053087 | Bacteria | 1798 |
| 1183 | Ga0500644_0001179 | 3300053088 | Bacteria | 7482 |
| 1184 | Ga0500647_0054774 | 3300053091 | Bacteria | 1919 |
| 1185 | Ga0500651_0023648 | 3300053093 | Bacteria | 3848 |
| 1186 | Ga0500566_0001038 | 3300053094 | Bacteria | 16065 |
| 1187 | Ga0500641_0003987 | 3300053096 | Bacteria | 5218 |
| 1188 | Ga0500641_0005963 | 3300053096 | Bacteria | 4315 |
| 1189 | Ga0500641_0006677 | 3300053096 | Bacteria | 4099 |
| 1190 | Ga0500556_0000044 | 3300053104 | Bacteria | 132744 |
| 1191 | Ga0500556_0002605 | 3300053104 | Bacteria | 5671 |
| 1192 | Ga0500556_0016379 | 3300053104 | Bacteria | 2304 |
| 1193 | Ga0500562_000724 | 3300053108 | Bacteria | 7992 |
| 1194 | Ga0500562_001461 | 3300053108 | Bacteria | 5832 |
| 1195 | Ga0500562_003755 | 3300053108 | Bacteria | 3822 |
| 1196 | Ga0500562_005344 | 3300053108 | Bacteria | 3226 |
| 1197 | Ga0500569_004798 | 3300053109 | Bacteria | 2870 |
| 1198 | Ga0500572_000052 | 3300053111 | Bacteria | 34966 |
| 1199 | Ga0500592_000323 | 3300053116 | Bacteria | 8178 |
| 1200 | Ga0500592_001827 | 3300053116 | Bacteria | 3431 |
| 1201 | Ga0500592_002384 | 3300053116 | Bacteria | 3027 |
| 1202 | Ga0500593_000280 | 3300053117 | Bacteria | 20786 |
| 1203 | Ga0500594_0000117 | 3300053118 | Bacteria | 22333 |
| 1204 | Ga0500594_0002743 | 3300053118 | Bacteria | 3835 |
| 1205 | Ga0500595_000530 | 3300053119 | Bacteria | 23016 |
| 1206 | Ga0500595_002453 | 3300053119 | Bacteria | 9198 |
| 1207 | Ga0500595_006117 | 3300053119 | Bacteria | 5158 |
| 1208 | Ga0500595_013172 | 3300053119 | Bacteria | 3173 |
| 1209 | Ga0500607_000107 | 3300053121 | Bacteria | 64565 |
| 1210 | Ga0500607_101417 | 3300053121 | Bacteria | 1428 |
| 1211 | Ga0500608_000611 | 3300053122 | Bacteria | 13123 |
| 1212 | Ga0500608_009357 | 3300053122 | Bacteria | 4158 |
| 1213 | Ga0500618_000617 | 3300053125 | Bacteria | 21732 |
| 1214 | Ga0500618_002790 | 3300053125 | Bacteria | 6329 |
| 1215 | Ga0500618_004364 | 3300053125 | Bacteria | 4548 |
| 1216 | Ga0500642_0000008 | 3300053130 | Bacteria | 293258 |
| 1217 | Ga0500642_0022234 | 3300053130 | Bacteria | 2527 |
| 1218 | Ga0500658_0000037 | 3300053134 | Bacteria | 84326 |
| 1219 | Ga0500658_0000225 | 3300053134 | Bacteria | 27052 |
| 1220 | Ga0500658_0036719 | 3300053134 | Bacteria | 1945 |
| 1221 | Ga0500559_0000009 | 3300053136 | Bacteria | 174153 |
| 1222 | Ga0500559_0000048 | 3300053136 | Bacteria | 93755 |
| 1223 | Ga0500559_0001513 | 3300053136 | Bacteria | 13044 |
| 1224 | Ga0500559_0005040 | 3300053136 | Bacteria | 6124 |
| 1225 | Ga0500559_0015075 | 3300053136 | Bacteria | 3267 |
| 1226 | Ga0500559_0018818 | 3300053136 | Bacteria | 2917 |
| 1227 | Ga0500559_0035175 | 3300053136 | Bacteria | 2162 |
| 1228 | Ga0500559_0061298 | 3300053136 | Bacteria | 1678 |
| 1229 | Ga0500559_0079313 | 3300053136 | Bacteria | 1490 |
| 1230 | Ga0500564_000254 | 3300053138 | Bacteria | 14954 |
| 1231 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 1232 | Ga0500568_0001920 | 3300053139 | Bacteria | 12747 |
| 1233 | Ga0500568_0017483 | 3300053139 | Bacteria | 3165 |
| 1234 | Ga0500573_0000093 | 3300053140 | Bacteria | 40260 |
| 1235 | Ga0500604_0000087 | 3300053151 | Bacteria | 31301 |
| 1236 | Ga0500604_0002430 | 3300053151 | Bacteria | 5082 |
| 1237 | Ga0500604_0015267 | 3300053151 | Bacteria | 2102 |
| 1238 | Ga0500616_0009567 | 3300053153 | Bacteria | 5886 |
| 1239 | Ga0500616_0023122 | 3300053153 | Bacteria | 3464 |
| 1240 | Ga0500616_0033237 | 3300053153 | Bacteria | 2815 |
| 1241 | Ga0500619_008512 | 3300053154 | Bacteria | 2497 |
| 1242 | Ga0500622_0000136 | 3300053156 | Bacteria | 78059 |
| 1243 | Ga0500622_0001045 | 3300053156 | Bacteria | 23113 |
| 1244 | Ga0500622_0011684 | 3300053156 | Bacteria | 4775 |
| 1245 | Ga0500622_0021291 | 3300053156 | Bacteria | 3442 |
| 1246 | Ga0500622_0036597 | 3300053156 | Bacteria | 2565 |
| 1247 | Ga0500624_000130 | 3300053157 | Bacteria | 32645 |
| 1248 | Ga0500624_002025 | 3300053157 | Bacteria | 2848 |
| 1249 | Ga0500627_0000006 | 3300053158 | Bacteria | 165989 |
| 1250 | Ga0500627_0000240 | 3300053158 | Bacteria | 15589 |
| 1251 | Ga0500627_0012643 | 3300053158 | Bacteria | 3171 |
| 1252 | Ga0500638_014057 | 3300053162 | Bacteria | 3642 |
| 1253 | Ga0500636_0007932 | 3300053177 | Bacteria | 6140 |
| 1254 | Ga0500636_0036753 | 3300053177 | Bacteria | 2898 |
| 1255 | Ga0500637_0001181 | 3300053178 | Bacteria | 10867 |
| 1256 | Ga0500645_000990 | 3300053730 | Bacteria | 16051 |
| 1257 | Ga0500645_001524 | 3300053730 | Bacteria | 11599 |
| 1258 | Ga0500645_002292 | 3300053730 | Bacteria | 8662 |
| 1259 | Ga0500645_012044 | 3300053730 | Bacteria | 2804 |
| 1260 | Ga0500645_017119 | 3300053730 | Bacteria | 2275 |
| 1261 | Ga0500609_000937 | 3300053731 | Bacteria | 4367 |
| 1262 | Ga0500552_002336 | 3300053733 | Bacteria | 1840 |
| 1263 | Ga0500596_000319 | 3300053735 | Bacteria | 8589 |
| 1264 | Ga0501084_0018673 | 3300054114 | Bacteria | 5773 |
| 1265 | Ga0501084_0098876 | 3300054114 | Bacteria | 2450 |
| 1266 | Ga0500661_002377 | 3300055283 | Bacteria | 3551 |
| 1267 | Ga0501082_0007636 | 3300060353 | Bacteria | 9327 |
| 1268 | Ga0501082_0019442 | 3300060353 | Bacteria | 5855 |
| 1269 | Ga0501082_0020694 | 3300060353 | Bacteria | 5671 |
| 1270 | Ga0501082_0087818 | 3300060353 | Bacteria | 2683 |
| 1271 | Ga0466962_0000959 | 3300061719 | Bacteria | 13099 |
| 1272 | Ga0466962_0005238 | 3300061719 | Bacteria | 6229 |
| 1273 | Ga0530510_0004423 | 3300061734 | Bacteria | 9725 |
| 1274 | Ga0530510_0006937 | 3300061734 | Bacteria | 7897 |
| 1275 | Ga0530510_0062093 | 3300061734 | Bacteria | 2705 |
| 1276 | Ga0530510_0180655 | 3300061734 | Bacteria | 1565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0203208 | Ga0501081_0203208_337_1422 | 355 |
| 2 | 3300048915 | Ga0496112_0115553 | Ga0496112_0115553_15_1124 | 357 |
| 3 | 3300049576 | Ga0501040_0115576 | Ga0501040_0115576_737_1828 | 357 |
| 4 | 3300049581 | Ga0501047_0345461 | Ga0501047_0345461_178_1272 | 360 |
| 5 | 3300048919 | Ga0496116_0169802 | Ga0496116_0169802_41_1147 | 366 |
| 6 | 3300049568 | Ga0501031_0123192 | Ga0501031_0123192_36_1154 | 366 |
| 7 | 3300046530 | Ga0495654_0082554 | Ga0495654_0082554_20_1174 | 372 |
| 8 | 3300044684 | Ga0466966_0064193 | Ga0466966_0064193_746_2059 | 380 |
| 9 | 3300044693 | Ga0466961_0013782 | Ga0466961_0013782_262_1575 | 380 |
| 10 | 3300044719 | Ga0466971_0002611 | Ga0466971_0002611_5830_7143 | 380 |
| 11 | 3300044842 | Ga0466957_0001487 | Ga0466957_0001487_745_2058 | 380 |
| 12 | 3300045049 | Ga0466959_0000155 | Ga0466959_0000155_15421_16734 | 380 |
| 13 | 3300045836 | Ga0466958_0011945 | Ga0466958_0011945_1024_2337 | 380 |
| 14 | 3300061719 | Ga0466962_0000959 | Ga0466962_0000959_5819_7132 | 380 |
| 15 | 3300015684 | Ga0183365_10001 | Ga0183365_10001479 | 388 |
| 16 | 3300049571 | Ga0501034_0036856 | Ga0501034_0036856_19_1368 | 389 |
| 17 | 3300014969 | Ga0157376_10275782 | Ga0157376_102757821 | 392 |
| 18 | 3300044656 | Ga0466969_0000486 | Ga0466969_0000486_3256_4626 | 393 |
| 19 | 3300042146 | Ga0450907_000900 | Ga0450907_000900_5802_7067 | 395 |
| 20 | 3300037471 | Ga0395905_0023486 | Ga0395905_0023486_3106_4521 | 396 |
| 21 | 3300049679 | Ga0501249_002241 | Ga0501249_002241_2434_3630 | 397 |
| 22 | 3300037471 | Ga0395905_0146097 | Ga0395905_0146097_978_2207 | 398 |
| 23 | 3300046537 | Ga0495598_0015637 | Ga0495598_0015637_706_1905 | 398 |
| 24 | 3300035695 | Ga0373927_0035366 | Ga0373927_0035366_16_1251 | 399 |
| 25 | 3300047320 | Ga0495672_0025937 | Ga0495672_0025937_2488_3729 | 400 |
| 26 | 3300049589 | Ga0501073_0074964 | Ga0501073_0074964_17_1291 | 401 |
| 27 | 3300048905 | Ga0496102_0320533 | Ga0496102_0320533_209_1450 | 402 |
| 28 | 3300053108 | Ga0500562_005344 | Ga0500562_005344_1972_3216 | 402 |
| 29 | 3300013105 | Ga0157369_10103340 | Ga0157369_101033403 | 403 |
| 30 | 3300046507 | Ga0495606_0102542 | Ga0495606_0102542_29_1318 | 403 |
| 31 | 3300046520 | Ga0495637_0019611 | Ga0495637_0019611_909_2198 | 403 |
| 32 | 3300048926 | Ga0496123_0137042 | Ga0496123_0137042_11_1246 | 410 |
| 33 | 3300037312 | Ga0395899_0002554 | Ga0395899_0002554_9132_10412 | 411 |
| 34 | 3300037418 | Ga0395900_0000213 | Ga0395900_0000213_22346_23626 | 411 |
| 35 | 3300037466 | Ga0395898_0000582 | Ga0395898_0000582_31205_32485 | 411 |
| 36 | 3300037471 | Ga0395905_0001759 | Ga0395905_0001759_5423_6703 | 411 |
| 37 | 3300046616 | Ga0495668_0020864 | Ga0495668_0020864_18_1307 | 411 |
| 38 | 3300046810 | Ga0495660_0014662 | Ga0495660_0014662_695_1975 | 411 |
| 39 | 3300061719 | Ga0466962_0005238 | Ga0466962_0005238_4981_6219 | 412 |
| 40 | 3300005336 | Ga0070680_100026681 | Ga0070680_1000266812 | 413 |
| 41 | 3300005337 | Ga0070682_100006966 | Ga0070682_1000069661 | 413 |
| 42 | 3300005341 | Ga0070691_10007427 | Ga0070691_100074271 | 413 |
| 43 | 3300005455 | Ga0070663_100009949 | Ga0070663_1000099497 | 413 |
| 44 | 3300005530 | Ga0070679_100110214 | Ga0070679_1001102142 | 413 |
| 45 | 3300005539 | Ga0068853_100007497 | Ga0068853_1000074978 | 413 |
| 46 | 3300005546 | Ga0070696_100081819 | Ga0070696_1000818191 | 413 |
| 47 | 3300005563 | Ga0068855_100138126 | Ga0068855_1001381262 | 413 |
| 48 | 3300005577 | Ga0068857_100053945 | Ga0068857_1000539454 | 413 |
| 49 | 3300005843 | Ga0068860_100082779 | Ga0068860_1000827792 | 413 |
| 50 | 3300025904 | Ga0207647_10052545 | Ga0207647_100525452 | 413 |
| 51 | 3300025914 | Ga0207671_10040107 | Ga0207671_100401072 | 413 |
| 52 | 3300026041 | Ga0207639_10004425 | Ga0207639_1000442510 | 413 |
| 53 | 3300026067 | Ga0207678_10000503 | Ga0207678_1000050314 | 413 |
| 54 | 3300032004 | Ga0307414_10027888 | Ga0307414_100278882 | 413 |
| 55 | 3300037471 | Ga0395905_0175172 | Ga0395905_0175172_755_1996 | 413 |
| 56 | 3300039447 | Ga0436361_1131750 | Ga0436361_1131750_11_1387 | 414 |
| 57 | iso_pu_bacteria | 2885429604 | 2885430518 | 414 |
| 58 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_310231_311517 | 415 |
| 59 | 3300038443 | Ga0395901_0076776 | Ga0395901_0076776_219_1559 | 416 |
| 60 | 3300046519 | Ga0495632_0046621 | Ga0495632_0046621_844_2133 | 416 |
| 61 | iso_pu_bacteria | 2643221598 | 2643999684 | 416 |
| 62 | 3300006042 | Ga0075368_10015568 | Ga0075368_100155683 | 417 |
| 63 | 3300028800 | Ga0265338_10036951 | Ga0265338_100369513 | 417 |
| 64 | 3300031727 | Ga0316576_10107633 | Ga0316576_101076332 | 417 |
| 65 | 3300048090 | Ga0495615_0002799 | Ga0495615_0002799_13_1302 | 417 |
| 66 | 3300048924 | Ga0496121_0190308 | Ga0496121_0190308_157_1452 | 418 |
| 67 | 3300049579 | Ga0501043_0217987 | Ga0501043_0217987_181_1461 | 418 |
| 68 | iso_pu_bacteria | 2928100450 | 2928103752 | 418 |
| 69 | 3300044706 | Ga0466964_0068646 | Ga0466964_0068646_174_1475 | 419 |
| 70 | 3300046519 | Ga0495632_0049216 | Ga0495632_0049216_734_2035 | 419 |
| 71 | 3300046694 | Ga0495649_0076182 | Ga0495649_0076182_10_1272 | 419 |
| 72 | 3300053119 | Ga0500595_006117 | Ga0500595_006117_3854_5143 | 419 |
| 73 | 3300046616 | Ga0495668_0041587 | Ga0495668_0041587_618_1973 | 420 |
| 74 | 3300048905 | Ga0496102_0036887 | Ga0496102_0036887_63_1358 | 420 |
| 75 | iso_pu_bacteria | 2855020534 | 2855021639 | 420 |
| 76 | iso_pu_bacteria | 2899259804 | 2899260357 | 420 |
| 77 | 3300005327 | Ga0070658_10056113 | Ga0070658_100561132 | 421 |
| 78 | 3300005331 | Ga0070670_100071668 | Ga0070670_1000716682 | 421 |
| 79 | 3300005333 | Ga0070677_10019501 | Ga0070677_100195012 | 421 |
| 80 | 3300005344 | Ga0070661_100004099 | Ga0070661_1000040991 | 421 |
| 81 | 3300005353 | Ga0070669_100086365 | Ga0070669_1000863652 | 421 |
| 82 | 3300005356 | Ga0070674_100070701 | Ga0070674_1000707012 | 421 |
| 83 | 3300005366 | Ga0070659_100022474 | Ga0070659_1000224745 | 421 |
| 84 | 3300005543 | Ga0070672_100125677 | Ga0070672_1001256772 | 421 |
| 85 | 3300005548 | Ga0070665_100143749 | Ga0070665_1001437492 | 421 |
| 86 | 3300005564 | Ga0070664_100021127 | Ga0070664_1000211278 | 421 |
| 87 | 3300006042 | Ga0075368_10007027 | Ga0075368_100070271 | 421 |
| 88 | 3300006048 | Ga0075363_100072464 | Ga0075363_1000724642 | 421 |
| 89 | 3300006178 | Ga0075367_10017716 | Ga0075367_100177165 | 421 |
| 90 | 3300006847 | Ga0075431_100001098 | Ga0075431_10000109817 | 421 |
| 91 | 3300006880 | Ga0075429_100038809 | Ga0075429_1000388095 | 421 |
| 92 | 3300009177 | Ga0105248_10012717 | Ga0105248_1001271711 | 421 |
| 93 | 3300025923 | Ga0207681_10096745 | Ga0207681_100967451 | 421 |
| 94 | 3300025925 | Ga0207650_10054091 | Ga0207650_100540912 | 421 |
| 95 | 3300025931 | Ga0207644_10107790 | Ga0207644_101077902 | 421 |
| 96 | 3300025937 | Ga0207669_10028512 | Ga0207669_100285124 | 421 |
| 97 | 3300025940 | Ga0207691_10104930 | Ga0207691_101049302 | 421 |
| 98 | 3300025941 | Ga0207711_10031965 | Ga0207711_100319652 | 421 |
| 99 | 3300031731 | Ga0307405_10014620 | Ga0307405_100146204 | 421 |
| 100 | 3300037418 | Ga0395900_0166042 | Ga0395900_0166042_18_1283 | 421 |
| 101 | 3300048912 | Ga0496109_0146320 | Ga0496109_0146320_136_1452 | 421 |
| 102 | 3300048913 | Ga0496110_0002141 | Ga0496110_0002141_883_2199 | 421 |
| 103 | 3300048915 | Ga0496112_0068649 | Ga0496112_0068649_2170_3489 | 421 |
| 104 | 3300048917 | Ga0496114_0065681 | Ga0496114_0065681_1602_2918 | 421 |
| 105 | 3300050510 | nmdc:mga06r32_34521_c1 | nmdc:mga06r32_34521_c1_151_1443 | 421 |
| 106 | 3300006353 | Ga0075370_10000141 | Ga0075370_1000014110 | 422 |
| 107 | 3300009093 | Ga0105240_10113959 | Ga0105240_101139591 | 422 |
| 108 | 3300025913 | Ga0207695_10077943 | Ga0207695_100779434 | 422 |
| 109 | 3300037312 | Ga0395899_0028367 | Ga0395899_0028367_39_1310 | 422 |
| 110 | 3300050489 | nmdc:mga03683_32_c1 | nmdc:mga03683_32_c1_13277_14548 | 422 |
| 111 | 3300050493 | nmdc:mga0k408_7_c1 | nmdc:mga0k408_7_c1_98531_99802 | 422 |
| 112 | 3300050494 | nmdc:mga06z11_99581_c1 | nmdc:mga06z11_99581_c1_292_1563 | 422 |
| 113 | 3300050516 | nmdc:mga0sz30_5235_c1 | nmdc:mga0sz30_5235_c1_1998_3269 | 422 |
| 114 | iso_pu_bacteria | 2852653556 | 2852657059 | 422 |
| 115 | iso_pu_bacteria | 2852680915 | 2852683750 | 422 |
| 116 | iso_pu_bacteria | 2880518877 | 2880519940 | 422 |
| 117 | iso_pu_bacteria | 2898795034 | 2898796644 | 422 |
| 118 | iso_pu_bacteria | 2899275550 | 2899279380 | 422 |
| 119 | 3300049569 | Ga0501032_0000341 | Ga0501032_0000341_22404_23753 | 423 |
| 120 | 3300049571 | Ga0501034_0000135 | Ga0501034_0000135_60067_61416 | 423 |
| 121 | 3300049572 | Ga0501036_0003057 | Ga0501036_0003057_9830_11179 | 423 |
| 122 | 3300049573 | Ga0501037_0000987 | Ga0501037_0000987_14498_15847 | 423 |
| 123 | 3300049575 | Ga0501039_0000180 | Ga0501039_0000180_36505_37854 | 423 |
| 124 | 3300049576 | Ga0501040_0143425 | Ga0501040_0143425_319_1668 | 423 |
| 125 | 3300049580 | Ga0501046_0000567 | Ga0501046_0000567_8380_9729 | 423 |
| 126 | 3300049581 | Ga0501047_0000435 | Ga0501047_0000435_16045_17394 | 423 |
| 127 | 3300049583 | Ga0501067_0001900 | Ga0501067_0001900_8174_9523 | 423 |
| 128 | 3300049586 | Ga0501070_0023959 | Ga0501070_0023959_1609_2958 | 423 |
| 129 | 3300049591 | Ga0501075_0042396 | Ga0501075_0042396_2081_3385 | 423 |
| 130 | 3300049742 | Ga0501080_0000014 | Ga0501080_0000014_75885_77234 | 423 |
| 131 | 3300049822 | Ga0501035_0000056 | Ga0501035_0000056_59904_61253 | 423 |
| 132 | 3300049823 | Ga0501044_0018903 | Ga0501044_0018903_4610_5959 | 423 |
| 133 | 3300050510 | nmdc:mga06r32_82853_c1 | nmdc:mga06r32_82853_c1_1295_2599 | 423 |
| 134 | 3300053117 | Ga0500593_000280 | Ga0500593_000280_10802_12136 | 423 |
| 135 | 3300060353 | Ga0501082_0020694 | Ga0501082_0020694_709_2058 | 423 |
| 136 | 3300061734 | Ga0530510_0004423 | Ga0530510_0004423_2218_3522 | 423 |
| 137 | 3300006847 | Ga0075431_100006959 | Ga0075431_1000069592 | 424 |
| 138 | 3300009148 | Ga0105243_10017595 | Ga0105243_100175954 | 424 |
| 139 | 3300009553 | Ga0105249_10025304 | Ga0105249_100253044 | 424 |
| 140 | 3300026118 | Ga0207675_100069432 | Ga0207675_1000694322 | 424 |
| 141 | 3300035242 | Ga0373962_0029430 | Ga0373962_0029430_155_1456 | 424 |
| 142 | 3300048906 | Ga0496103_0021698 | Ga0496103_0021698_1156_2457 | 424 |
| 143 | 3300048909 | Ga0496106_0001568 | Ga0496106_0001568_13887_15188 | 424 |
| 144 | 3300048912 | Ga0496109_0287190 | Ga0496109_0287190_208_1509 | 424 |
| 145 | 3300049571 | Ga0501034_0021280 | Ga0501034_0021280_84_1433 | 424 |
| 146 | 3300049580 | Ga0501046_0001979 | Ga0501046_0001979_17091_18440 | 424 |
| 147 | 3300049581 | Ga0501047_0043193 | Ga0501047_0043193_1341_2690 | 424 |
| 148 | 3300053088 | Ga0500644_0001179 | Ga0500644_0001179_271_1623 | 424 |
| 149 | 3300054114 | Ga0501084_0098876 | Ga0501084_0098876_771_2072 | 424 |
| 150 | 3300061734 | Ga0530510_0180655 | Ga0530510_0180655_104_1405 | 424 |
| 151 | iso_pu_bacteria | 2713897090 | 2715499662 | 424 |
| 152 | iso_pu_bacteria | 2854681122 | 2854684811 | 424 |
| 153 | iso_pu_bacteria | 3000405567 | 3000406982 | 424 |
| 154 | 3300005457 | Ga0070662_100010012 | Ga0070662_1000100129 | 425 |
| 155 | 3300005539 | Ga0068853_100025509 | Ga0068853_1000255097 | 425 |
| 156 | 3300006178 | Ga0075367_10012363 | Ga0075367_100123633 | 425 |
| 157 | 3300026041 | Ga0207639_10011991 | Ga0207639_100119917 | 425 |
| 158 | 3300039062 | Ga0400483_099733 | Ga0400483_099733_282_1589 | 425 |
| 159 | 3300047445 | Ga0495677_0001848 | Ga0495677_0001848_3873_5156 | 425 |
| 160 | 3300048929 | Ga0496126_0143203 | Ga0496126_0143203_512_1834 | 425 |
| 161 | 3300049580 | Ga0501046_0093688 | Ga0501046_0093688_987_2297 | 425 |
| 162 | 3300049741 | Ga0501079_0132494 | Ga0501079_0132494_13_1338 | 425 |
| 163 | 3300060353 | Ga0501082_0019442 | Ga0501082_0019442_4274_5623 | 425 |
| 164 | iso_pu_bacteria | 2919679072 | 2919679484 | 425 |
| 165 | iso_pu_bacteria | 8055878733 | 8055882311 | 425 |
| 166 | 3300003781 | Ga0055536_1005313 | Ga0055536_10053132 | 426 |
| 167 | 3300003781 | Ga0055536_1010902 | Ga0055536_10109022 | 426 |
| 168 | 3300003791 | Ga0055530_10000465 | Ga0055530_100004652 | 426 |
| 169 | 3300003794 | Ga0055531_10001005 | Ga0055531_100010052 | 426 |
| 170 | 3300005289 | Ga0065704_10125067 | Ga0065704_101250672 | 426 |
| 171 | 3300013100 | Ga0157373_10001577 | Ga0157373_1000157714 | 426 |
| 172 | 3300013100 | Ga0157373_10001686 | Ga0157373_1000168614 | 426 |
| 173 | 3300014326 | Ga0157380_10000062 | Ga0157380_1000006249 | 426 |
| 174 | 3300025920 | Ga0207649_10138089 | Ga0207649_101380892 | 426 |
| 175 | 3300027907 | Ga0207428_10187210 | Ga0207428_101872101 | 426 |
| 176 | 3300031824 | Ga0307413_10024791 | Ga0307413_100247912 | 426 |
| 177 | 3300031911 | Ga0307412_10010159 | Ga0307412_100101598 | 426 |
| 178 | 3300032126 | Ga0307415_100007649 | Ga0307415_1000076492 | 426 |
| 179 | 3300044735 | Ga0466968_0043813 | Ga0466968_0043813_24_1316 | 426 |
| 180 | 3300046513 | Ga0495616_0000030 | Ga0495616_0000030_99249_100535 | 426 |
| 181 | 3300046530 | Ga0495654_0001219 | Ga0495654_0001219_8126_9421 | 426 |
| 182 | 3300046616 | Ga0495668_0002423 | Ga0495668_0002423_7711_9006 | 426 |
| 183 | 3300046794 | Ga0495589_0006097 | Ga0495589_0006097_4757_6052 | 426 |
| 184 | 3300047469 | Ga0495673_0000370 | Ga0495673_0000370_5840_7192 | 426 |
| 185 | 3300048908 | Ga0496105_0034153 | Ga0496105_0034153_1475_2785 | 426 |
| 186 | 3300048921 | Ga0496118_0014593 | Ga0496118_0014593_334_1626 | 426 |
| 187 | 3300049679 | Ga0501249_005886 | Ga0501249_005886_1181_2461 | 426 |
| 188 | 3300050496 | nmdc:mga07m45_132684_c1 | nmdc:mga07m45_132684_c1_93_1373 | 426 |
| 189 | 3300053087 | Ga0500643_000226 | Ga0500643_000226_7048_8334 | 426 |
| 190 | 3300053136 | Ga0500559_0018818 | Ga0500559_0018818_1456_2742 | 426 |
| 191 | 3300053138 | Ga0500564_000254 | Ga0500564_000254_99_1451 | 426 |
| 192 | 3300053151 | Ga0500604_0002430 | Ga0500604_0002430_3114_4400 | 426 |
| 193 | 3300053156 | Ga0500622_0000136 | Ga0500622_0000136_35355_36635 | 426 |
| 194 | 3300053158 | Ga0500627_0000240 | Ga0500627_0000240_5522_6817 | 426 |
| 195 | 3300055283 | Ga0500661_002377 | Ga0500661_002377_660_1946 | 426 |
| 196 | iso_pu_bacteria | 8057132660 | 8057134550 | 426 |
| 197 | 3300005333 | Ga0070677_10000283 | Ga0070677_100002838 | 427 |
| 198 | 3300009148 | Ga0105243_10029432 | Ga0105243_100294322 | 427 |
| 199 | 3300009545 | Ga0105237_10087184 | Ga0105237_100871842 | 427 |
| 200 | 3300011119 | Ga0105246_10009669 | Ga0105246_100096697 | 427 |
| 201 | 3300025893 | Ga0207682_10000506 | Ga0207682_1000050616 | 427 |
| 202 | 3300039062 | Ga0400483_059080 | Ga0400483_059080_1472_2785 | 427 |
| 203 | 3300042139 | Ga0450904_000400 | Ga0450904_000400_144_1472 | 427 |
| 204 | 3300047472 | Ga0495686_0000074 | Ga0495686_0000074_168804_170168 | 427 |
| 205 | 3300048903 | Ga0496100_0092837 | Ga0496100_0092837_209_1558 | 427 |
| 206 | 3300048908 | Ga0496105_0220751 | Ga0496105_0220751_154_1503 | 427 |
| 207 | 3300048909 | Ga0496106_0005947 | Ga0496106_0005947_4491_5840 | 427 |
| 208 | 3300048910 | Ga0496107_0016977 | Ga0496107_0016977_641_1990 | 427 |
| 209 | 3300048918 | Ga0496115_0019522 | Ga0496115_0019522_3099_4448 | 427 |
| 210 | 3300049571 | Ga0501034_0001020 | Ga0501034_0001020_25802_27118 | 427 |
| 211 | iso_pu_bacteria | 2840878972 | 2840881314 | 427 |
| 212 | iso_pu_bacteria | 2879163058 | 2879163308 | 427 |
| 213 | 3300005344 | Ga0070661_100105134 | Ga0070661_1001051342 | 428 |
| 214 | 3300048918 | Ga0496115_0055841 | Ga0496115_0055841_1162_2640 | 428 |
| 215 | iso_pu_bacteria | 2738543020 | 2739289529 | 428 |
| 216 | iso_pu_bacteria | 2738543021 | 2739294841 | 428 |
| 217 | iso_pu_bacteria | 2834578030 | 2834580476 | 428 |
| 218 | 3300021384 | Ga0213876_10000537 | Ga0213876_100005373 | 429 |
| 219 | 3300039437 | Ga0436365_0257402 | Ga0436365_0257402_148144_149460 | 429 |
| 220 | 3300049570 | Ga0501033_0000287 | Ga0501033_0000287_32310_33686 | 429 |
| 221 | 3300049571 | Ga0501034_0037070 | Ga0501034_0037070_1399_2772 | 429 |
| 222 | 3300049572 | Ga0501036_0017342 | Ga0501036_0017342_1671_3047 | 429 |
| 223 | 3300049573 | Ga0501037_0007076 | Ga0501037_0007076_3849_5225 | 429 |
| 224 | 3300049579 | Ga0501043_0003691 | Ga0501043_0003691_10703_12079 | 429 |
| 225 | 3300049822 | Ga0501035_0006774 | Ga0501035_0006774_5657_7033 | 429 |
| 226 | 3300049823 | Ga0501044_0006354 | Ga0501044_0006354_2468_3844 | 429 |
| 227 | iso_pu_bacteria | 2599185359 | 2600227395 | 429 |
| 228 | iso_pu_bacteria | 2842805378 | 2842809957 | 429 |
| 229 | iso_pu_bacteria | 2928526807 | 2928529966 | 429 |
| 230 | iso_pu_bacteria | 2928968154 | 2928970613 | 429 |
| 231 | 3300017792 | Ga0163161_10037310 | Ga0163161_100373102 | 430 |
| 232 | 3300039062 | Ga0400483_046084 | Ga0400483_046084_209_1531 | 430 |
| 233 | 3300039062 | Ga0400483_125071 | Ga0400483_125071_2704_4026 | 430 |
| 234 | 3300046522 | Ga0495643_0000159 | Ga0495643_0000159_58904_60259 | 430 |
| 235 | 3300046691 | Ga0495670_0000006 | Ga0495670_0000006_81604_82908 | 430 |
| 236 | 3300046694 | Ga0495649_0085326 | Ga0495649_0085326_317_1672 | 430 |
| 237 | 3300048090 | Ga0495615_0000901 | Ga0495615_0000901_218_1510 | 430 |
| 238 | 3300048925 | Ga0496122_0083751 | Ga0496122_0083751_143_1435 | 430 |
| 239 | 3300048926 | Ga0496123_0002132 | Ga0496123_0002132_4792_6084 | 430 |
| 240 | 3300049570 | Ga0501033_0052342 | Ga0501033_0052342_1019_2377 | 430 |
| 241 | 3300049574 | Ga0501038_0138952 | Ga0501038_0138952_174_1532 | 430 |
| 242 | 3300049581 | Ga0501047_0022842 | Ga0501047_0022842_3806_5164 | 430 |
| 243 | 3300049822 | Ga0501035_0011486 | Ga0501035_0011486_2197_3555 | 430 |
| 244 | 3300049823 | Ga0501044_0090277 | Ga0501044_0090277_1163_2521 | 430 |
| 245 | 3300053136 | Ga0500559_0079313 | Ga0500559_0079313_19_1314 | 430 |
| 246 | iso_pu_bacteria | 2599185354 | 2600202372 | 430 |
| 247 | iso_pu_bacteria | 2751185897 | 2753766017 | 430 |
| 248 | iso_pu_bacteria | 2896429255 | 2896429726 | 430 |
| 249 | iso_pu_bacteria | 3000017691 | 3000020137 | 430 |
| 250 | 3300013104 | Ga0157370_10000760 | Ga0157370_1000076026 | 431 |
| 251 | 3300021384 | Ga0213876_10000145 | Ga0213876_1000014546 | 431 |
| 252 | 3300028800 | Ga0265338_10107234 | Ga0265338_101072342 | 431 |
| 253 | 3300039437 | Ga0436365_1326958 | Ga0436365_1326958_9253_10638 | 431 |
| 254 | 3300046507 | Ga0495606_0001283 | Ga0495606_0001283_19183_20550 | 431 |
| 255 | 3300046522 | Ga0495643_0002054 | Ga0495643_0002054_5877_7244 | 431 |
| 256 | 3300048924 | Ga0496121_0002011 | Ga0496121_0002011_9469_10779 | 431 |
| 257 | 3300049591 | Ga0501075_0165309 | Ga0501075_0165309_66_1388 | 431 |
| 258 | 3300049824 | Ga0501045_0030541 | Ga0501045_0030541_809_2131 | 431 |
| 259 | iso_pu_bacteria | 2510917020 | 2511120943 | 431 |
| 260 | iso_pu_bacteria | 2582581279 | 2585149828 | 431 |
| 261 | iso_pu_bacteria | 2582581280 | 2585151264 | 431 |
| 262 | iso_pu_bacteria | 2582581293 | 2585197133 | 431 |
| 263 | iso_pu_bacteria | 2585428106 | 2587919946 | 431 |
| 264 | iso_pu_bacteria | 2643221545 | 2643747680 | 431 |
| 265 | iso_pu_bacteria | 2643221552 | 2643780885 | 431 |
| 266 | iso_pu_bacteria | 2643221583 | 2643926789 | 431 |
| 267 | iso_pu_bacteria | 2643221584 | 2643929619 | 431 |
| 268 | iso_pu_bacteria | 2643221622 | 2644125446 | 431 |
| 269 | iso_pu_bacteria | 2643221640 | 2644223421 | 431 |
| 270 | iso_pu_bacteria | 2643221642 | 2644237163 | 431 |
| 271 | iso_pu_bacteria | 2643221666 | 2644367030 | 431 |
| 272 | iso_pu_bacteria | 2643221691 | 2644506937 | 431 |
| 273 | iso_pu_bacteria | 2791355048 | 2792460768 | 431 |
| 274 | iso_pu_bacteria | 2818991435 | 2819540192 | 431 |
| 275 | iso_pu_bacteria | 2818991454 | 2819647090 | 431 |
| 276 | iso_pu_bacteria | 2830075706 | 2830076593 | 431 |
| 277 | iso_pu_bacteria | 2843744320 | 2843745573 | 431 |
| 278 | iso_pu_bacteria | 2849560528 | 2849561188 | 431 |
| 279 | iso_pu_bacteria | 2849573788 | 2849576169 | 431 |
| 280 | iso_pu_bacteria | 2851153111 | 2851157223 | 431 |
| 281 | iso_pu_bacteria | 2857504554 | 2857505795 | 431 |
| 282 | iso_pu_bacteria | 2884960567 | 2884965485 | 431 |
| 283 | iso_pu_bacteria | 2898329390 | 2898332882 | 431 |
| 284 | iso_pu_bacteria | 2928027323 | 2928028431 | 431 |
| 285 | iso_pu_bacteria | 2928531327 | 2928532088 | 431 |
| 286 | iso_pu_bacteria | 2984555340 | 2984555992 | 431 |
| 287 | iso_pu_bacteria | 2984564862 | 2984565902 | 431 |
| 288 | iso_pu_bacteria | 2993356040 | 2993356911 | 431 |
| 289 | 3300005327 | Ga0070658_10000086 | Ga0070658_1000008626 | 432 |
| 290 | 3300005347 | Ga0070668_100009939 | Ga0070668_1000099398 | 432 |
| 291 | 3300005353 | Ga0070669_100044858 | Ga0070669_1000448584 | 432 |
| 292 | 3300005367 | Ga0070667_100103915 | Ga0070667_1001039153 | 432 |
| 293 | 3300005458 | Ga0070681_10017384 | Ga0070681_100173845 | 432 |
| 294 | 3300005563 | Ga0068855_100066161 | Ga0068855_1000661616 | 432 |
| 295 | 3300005617 | Ga0068859_100034727 | Ga0068859_1000347274 | 432 |
| 296 | 3300005841 | Ga0068863_100041278 | Ga0068863_1000412782 | 432 |
| 297 | 3300005843 | Ga0068860_100014606 | Ga0068860_1000146065 | 432 |
| 298 | 3300005844 | Ga0068862_100048727 | Ga0068862_1000487273 | 432 |
| 299 | 3300006195 | Ga0075366_10034698 | Ga0075366_100346984 | 432 |
| 300 | 3300006931 | Ga0097620_100034728 | Ga0097620_1000347285 | 432 |
| 301 | 3300009093 | Ga0105240_10201908 | Ga0105240_102019082 | 432 |
| 302 | 3300025909 | Ga0207705_10000002 | Ga0207705_1000000268 | 432 |
| 303 | 3300025913 | Ga0207695_10011589 | Ga0207695_100115898 | 432 |
| 304 | 3300025913 | Ga0207695_10036878 | Ga0207695_100368783 | 432 |
| 305 | 3300025923 | Ga0207681_10028244 | Ga0207681_100282443 | 432 |
| 306 | 3300025931 | Ga0207644_10072594 | Ga0207644_100725943 | 432 |
| 307 | 3300025949 | Ga0207667_10042335 | Ga0207667_100423356 | 432 |
| 308 | 3300025949 | Ga0207667_10047053 | Ga0207667_100470536 | 432 |
| 309 | 3300025986 | Ga0207658_10029009 | Ga0207658_100290093 | 432 |
| 310 | 3300026095 | Ga0207676_10045609 | Ga0207676_100456094 | 432 |
| 311 | 3300028381 | Ga0268264_10008542 | Ga0268264_100085424 | 432 |
| 312 | 3300031251 | Ga0265327_10001598 | Ga0265327_1000159824 | 432 |
| 313 | 3300031824 | Ga0307413_10061166 | Ga0307413_100611662 | 432 |
| 314 | 3300031903 | Ga0307407_10061256 | Ga0307407_100612562 | 432 |
| 315 | 3300032126 | Ga0307415_100003090 | Ga0307415_1000030907 | 432 |
| 316 | 3300032126 | Ga0307415_100092189 | Ga0307415_1000921892 | 432 |
| 317 | 3300035089 | Ga0373944_0010848 | Ga0373944_0010848_902_2245 | 432 |
| 318 | 3300037853 | Ga0436364_0209780 | Ga0436364_0209780_489_1802 | 432 |
| 319 | 3300039437 | Ga0436365_0350825 | Ga0436365_0350825_764_2098 | 432 |
| 320 | 3300049581 | Ga0501047_0136714 | Ga0501047_0136714_706_2049 | 432 |
| 321 | 3300049686 | Ga0501257_003032 | Ga0501257_003032_721_2061 | 432 |
| 322 | 3300049823 | Ga0501044_0198895 | Ga0501044_0198895_399_1742 | 432 |
| 323 | iso_pu_bacteria | 2990265787 | 2990268716 | 432 |
| 324 | iso_pu_bacteria | 2993693658 | 2993694577 | 432 |
| 325 | 3300001915 | JGI24741J21665_1000993 | JGI24741J21665_10009931 | 433 |
| 326 | 3300001990 | JGI24737J22298_10003963 | JGI24737J22298_100039634 | 433 |
| 327 | 3300003215 | JGI25153J46596_10000152 | JGI25153J46596_1000015266 | 433 |
| 328 | 3300003762 | Ga0055542_1000132 | Ga0055542_100013275 | 433 |
| 329 | 3300003763 | Ga0055529_1000088 | Ga0055529_100008885 | 433 |
| 330 | 3300003791 | Ga0055530_10012502 | Ga0055530_100125023 | 433 |
| 331 | 3300003794 | Ga0055531_10003722 | Ga0055531_1000372211 | 433 |
| 332 | 3300005327 | Ga0070658_10001217 | Ga0070658_1000121711 | 433 |
| 333 | 3300005328 | Ga0070676_10110783 | Ga0070676_101107832 | 433 |
| 334 | 3300005336 | Ga0070680_100147050 | Ga0070680_1001470502 | 433 |
| 335 | 3300005344 | Ga0070661_100006006 | Ga0070661_1000060067 | 433 |
| 336 | 3300005347 | Ga0070668_100000120 | Ga0070668_10000012038 | 433 |
| 337 | 3300005347 | Ga0070668_100000618 | Ga0070668_1000006187 | 433 |
| 338 | 3300005347 | Ga0070668_100058973 | Ga0070668_1000589733 | 433 |
| 339 | 3300005353 | Ga0070669_100003318 | Ga0070669_1000033185 | 433 |
| 340 | 3300005355 | Ga0070671_100004972 | Ga0070671_1000049723 | 433 |
| 341 | 3300005356 | Ga0070674_100039375 | Ga0070674_1000393753 | 433 |
| 342 | 3300005356 | Ga0070674_100140603 | Ga0070674_1001406032 | 433 |
| 343 | 3300005367 | Ga0070667_100004571 | Ga0070667_1000045717 | 433 |
| 344 | 3300005367 | Ga0070667_100006391 | Ga0070667_1000063914 | 433 |
| 345 | 3300005441 | Ga0070700_100008602 | Ga0070700_1000086025 | 433 |
| 346 | 3300005456 | Ga0070678_100001098 | Ga0070678_1000010983 | 433 |
| 347 | 3300005539 | Ga0068853_100018732 | Ga0068853_1000187325 | 433 |
| 348 | 3300005539 | Ga0068853_100161110 | Ga0068853_1001611101 | 433 |
| 349 | 3300005543 | Ga0070672_100124643 | Ga0070672_1001246432 | 433 |
| 350 | 3300005548 | Ga0070665_100000115 | Ga0070665_1000001156 | 433 |
| 351 | 3300005548 | Ga0070665_100000198 | Ga0070665_10000019887 | 433 |
| 352 | 3300005548 | Ga0070665_100039869 | Ga0070665_1000398692 | 433 |
| 353 | 3300005564 | Ga0070664_100018223 | Ga0070664_1000182232 | 433 |
| 354 | 3300005617 | Ga0068859_100001068 | Ga0068859_10000106810 | 433 |
| 355 | 3300005617 | Ga0068859_100087061 | Ga0068859_1000870613 | 433 |
| 356 | 3300005618 | Ga0068864_100000058 | Ga0068864_10000005821 | 433 |
| 357 | 3300005618 | Ga0068864_100254682 | Ga0068864_1002546822 | 433 |
| 358 | 3300005841 | Ga0068863_100000175 | Ga0068863_10000017517 | 433 |
| 359 | 3300005841 | Ga0068863_100010685 | Ga0068863_1000106854 | 433 |
| 360 | 3300005842 | Ga0068858_100000006 | Ga0068858_100000006158 | 433 |
| 361 | 3300005842 | Ga0068858_100008659 | Ga0068858_1000086594 | 433 |
| 362 | 3300005843 | Ga0068860_100002711 | Ga0068860_10000271113 | 433 |
| 363 | 3300005844 | Ga0068862_100013372 | Ga0068862_10001337210 | 433 |
| 364 | 3300005844 | Ga0068862_100014327 | Ga0068862_1000143277 | 433 |
| 365 | 3300006195 | Ga0075366_10022279 | Ga0075366_100222794 | 433 |
| 366 | 3300006931 | Ga0097620_100001068 | Ga0097620_10000106819 | 433 |
| 367 | 3300006931 | Ga0097620_100087064 | Ga0097620_1000870643 | 433 |
| 368 | 3300009092 | Ga0105250_10007702 | Ga0105250_100077023 | 433 |
| 369 | 3300009093 | Ga0105240_10089281 | Ga0105240_100892812 | 433 |
| 370 | 3300009147 | Ga0114129_10053884 | Ga0114129_100538844 | 433 |
| 371 | 3300009148 | Ga0105243_10000091 | Ga0105243_1000009183 | 433 |
| 372 | 3300009174 | Ga0105241_10003044 | Ga0105241_100030443 | 433 |
| 373 | 3300009177 | Ga0105248_10000400 | Ga0105248_1000040017 | 433 |
| 374 | 3300009545 | Ga0105237_10190630 | Ga0105237_101906302 | 433 |
| 375 | 3300009551 | Ga0105238_10264668 | Ga0105238_102646682 | 433 |
| 376 | 3300012513 | Ga0157326_1003496 | Ga0157326_10034962 | 433 |
| 377 | 3300013100 | Ga0157373_10096330 | Ga0157373_100963302 | 433 |
| 378 | 3300013102 | Ga0157371_10000048 | Ga0157371_10000048101 | 433 |
| 379 | 3300013104 | Ga0157370_10190102 | Ga0157370_101901021 | 433 |
| 380 | 3300013105 | Ga0157369_10013459 | Ga0157369_100134598 | 433 |
| 381 | 3300013297 | Ga0157378_10112497 | Ga0157378_101124972 | 433 |
| 382 | 3300013306 | Ga0163162_10022236 | Ga0163162_100222367 | 433 |
| 383 | 3300013307 | Ga0157372_10228772 | Ga0157372_102287723 | 433 |
| 384 | 3300013307 | Ga0157372_10251746 | Ga0157372_102517462 | 433 |
| 385 | 3300014325 | Ga0163163_10011090 | Ga0163163_100110906 | 433 |
| 386 | 3300014326 | Ga0157380_10006274 | Ga0157380_100062745 | 433 |
| 387 | 3300014968 | Ga0157379_10011135 | Ga0157379_100111356 | 433 |
| 388 | 3300014968 | Ga0157379_10022602 | Ga0157379_100226024 | 433 |
| 389 | 3300025246 | Ga0209646_1004657 | Ga0209646_10046572 | 433 |
| 390 | 3300025250 | Ga0209026_1009856 | Ga0209026_10098561 | 433 |
| 391 | 3300025254 | Ga0209148_1000017 | Ga0209148_100001781 | 433 |
| 392 | 3300025272 | Ga0209455_1000005 | Ga0209455_100000581 | 433 |
| 393 | 3300025292 | Ga0209676_1000257 | Ga0209676_100025795 | 433 |
| 394 | 3300025297 | Ga0209758_1000035 | Ga0209758_100003567 | 433 |
| 395 | 3300025298 | Ga0209050_1001180 | Ga0209050_100118020 | 433 |
| 396 | 3300025304 | Ga0209257_1001221 | Ga0209257_100122119 | 433 |
| 397 | 3300025909 | Ga0207705_10000665 | Ga0207705_1000066532 | 433 |
| 398 | 3300025911 | Ga0207654_10001839 | Ga0207654_100018396 | 433 |
| 399 | 3300025913 | Ga0207695_10024402 | Ga0207695_100244026 | 433 |
| 400 | 3300025914 | Ga0207671_10013737 | Ga0207671_100137377 | 433 |
| 401 | 3300025914 | Ga0207671_10028484 | Ga0207671_100284844 | 433 |
| 402 | 3300025914 | Ga0207671_10078027 | Ga0207671_100780272 | 433 |
| 403 | 3300025917 | Ga0207660_10034110 | Ga0207660_100341105 | 433 |
| 404 | 3300025919 | Ga0207657_10081160 | Ga0207657_100811602 | 433 |
| 405 | 3300025920 | Ga0207649_10006776 | Ga0207649_100067764 | 433 |
| 406 | 3300025923 | Ga0207681_10012409 | Ga0207681_100124093 | 433 |
| 407 | 3300025924 | Ga0207694_10004292 | Ga0207694_1000429216 | 433 |
| 408 | 3300025924 | Ga0207694_10149972 | Ga0207694_101499722 | 433 |
| 409 | 3300025925 | Ga0207650_10030302 | Ga0207650_100303025 | 433 |
| 410 | 3300025931 | Ga0207644_10000328 | Ga0207644_1000032814 | 433 |
| 411 | 3300025935 | Ga0207709_10000018 | Ga0207709_10000018173 | 433 |
| 412 | 3300025937 | Ga0207669_10000055 | Ga0207669_1000005565 | 433 |
| 413 | 3300025937 | Ga0207669_10000311 | Ga0207669_1000031119 | 433 |
| 414 | 3300025940 | Ga0207691_10099108 | Ga0207691_100991082 | 433 |
| 415 | 3300025941 | Ga0207711_10001625 | Ga0207711_1000162515 | 433 |
| 416 | 3300025941 | Ga0207711_10012677 | Ga0207711_100126773 | 433 |
| 417 | 3300025941 | Ga0207711_10020668 | Ga0207711_100206685 | 433 |
| 418 | 3300025949 | Ga0207667_10000004 | Ga0207667_1000000474 | 433 |
| 419 | 3300025972 | Ga0207668_10000004 | Ga0207668_1000000439 | 433 |
| 420 | 3300025972 | Ga0207668_10004014 | Ga0207668_100040147 | 433 |
| 421 | 3300026035 | Ga0207703_10000027 | Ga0207703_1000002784 | 433 |
| 422 | 3300026041 | Ga0207639_10005317 | Ga0207639_100053177 | 433 |
| 423 | 3300026041 | Ga0207639_10040179 | Ga0207639_100401794 | 433 |
| 424 | 3300026041 | Ga0207639_10191144 | Ga0207639_101911441 | 433 |
| 425 | 3300026075 | Ga0207708_10000470 | Ga0207708_1000047033 | 433 |
| 426 | 3300026078 | Ga0207702_10188046 | Ga0207702_101880462 | 433 |
| 427 | 3300026088 | Ga0207641_10000003 | Ga0207641_10000003289 | 433 |
| 428 | 3300026088 | Ga0207641_10005247 | Ga0207641_100052477 | 433 |
| 429 | 3300026095 | Ga0207676_10000087 | Ga0207676_1000008744 | 433 |
| 430 | 3300026095 | Ga0207676_10283934 | Ga0207676_102839341 | 433 |
| 431 | 3300026116 | Ga0207674_10015660 | Ga0207674_100156609 | 433 |
| 432 | 3300026118 | Ga0207675_100186138 | Ga0207675_1001861382 | 433 |
| 433 | 3300026121 | Ga0207683_10007580 | Ga0207683_100075807 | 433 |
| 434 | 3300026142 | Ga0207698_10011829 | Ga0207698_100118291 | 433 |
| 435 | 3300028379 | Ga0268266_10000015 | Ga0268266_10000015455 | 433 |
| 436 | 3300028379 | Ga0268266_10000800 | Ga0268266_1000080024 | 433 |
| 437 | 3300028379 | Ga0268266_10017802 | Ga0268266_100178022 | 433 |
| 438 | 3300028380 | Ga0268265_10030171 | Ga0268265_100301713 | 433 |
| 439 | 3300028380 | Ga0268265_10181559 | Ga0268265_101815592 | 433 |
| 440 | 3300031251 | Ga0265327_10005240 | Ga0265327_1000524016 | 433 |
| 441 | 3300031456 | Ga0307513_10005039 | Ga0307513_100050393 | 433 |
| 442 | 3300031548 | Ga0307408_100080500 | Ga0307408_1000805001 | 433 |
| 443 | 3300031731 | Ga0307405_10099603 | Ga0307405_100996032 | 433 |
| 444 | 3300031824 | Ga0307413_10001468 | Ga0307413_100014689 | 433 |
| 445 | 3300031824 | Ga0307413_10005709 | Ga0307413_100057092 | 433 |
| 446 | 3300031824 | Ga0307413_10010862 | Ga0307413_100108622 | 433 |
| 447 | 3300031824 | Ga0307413_10111020 | Ga0307413_101110202 | 433 |
| 448 | 3300031824 | Ga0307413_10158372 | Ga0307413_101583722 | 433 |
| 449 | 3300031852 | Ga0307410_10003610 | Ga0307410_100036108 | 433 |
| 450 | 3300031852 | Ga0307410_10016374 | Ga0307410_100163744 | 433 |
| 451 | 3300031852 | Ga0307410_10046002 | Ga0307410_100460024 | 433 |
| 452 | 3300031911 | Ga0307412_10000805 | Ga0307412_1000080510 | 433 |
| 453 | 3300031911 | Ga0307412_10046590 | Ga0307412_100465902 | 433 |
| 454 | 3300031995 | Ga0307409_100001714 | Ga0307409_1000017144 | 433 |
| 455 | 3300032002 | Ga0307416_100090531 | Ga0307416_1000905313 | 433 |
| 456 | 3300032002 | Ga0307416_100103041 | Ga0307416_1001030412 | 433 |
| 457 | 3300032004 | Ga0307414_10003727 | Ga0307414_100037276 | 433 |
| 458 | 3300032004 | Ga0307414_10023772 | Ga0307414_100237722 | 433 |
| 459 | 3300032004 | Ga0307414_10080986 | Ga0307414_100809862 | 433 |
| 460 | 3300032004 | Ga0307414_10088170 | Ga0307414_100881702 | 433 |
| 461 | 3300032005 | Ga0307411_10018355 | Ga0307411_100183552 | 433 |
| 462 | 3300032005 | Ga0307411_10023473 | Ga0307411_100234732 | 433 |
| 463 | 3300032005 | Ga0307411_10063057 | Ga0307411_100630572 | 433 |
| 464 | 3300032005 | Ga0307411_10074867 | Ga0307411_100748672 | 433 |
| 465 | 3300037068 | Ga0373925_0171687 | Ga0373925_0171687_115_1455 | 433 |
| 466 | 3300037418 | Ga0395900_0001825 | Ga0395900_0001825_11621_12949 | 433 |
| 467 | 3300037418 | Ga0395900_0175542 | Ga0395900_0175542_630_1976 | 433 |
| 468 | 3300037466 | Ga0395898_0084365 | Ga0395898_0084365_1580_2926 | 433 |
| 469 | 3300037471 | Ga0395905_0000128 | Ga0395905_0000128_85494_86822 | 433 |
| 470 | 3300037471 | Ga0395905_0005732 | Ga0395905_0005732_3575_4879 | 433 |
| 471 | 3300037471 | Ga0395905_0015723 | Ga0395905_0015723_2675_4021 | 433 |
| 472 | 3300038443 | Ga0395901_0055064 | Ga0395901_0055064_412_1740 | 433 |
| 473 | 3300041410 | Ga0439461_0000264 | Ga0439461_0000264_6104_7417 | 433 |
| 474 | 3300041413 | Ga0439465_0000472 | Ga0439465_0000472_4954_6267 | 433 |
| 475 | 3300041997 | Ga0439431_0000300 | Ga0439431_0000300_6169_7482 | 433 |
| 476 | 3300042002 | Ga0439442_002932 | Ga0439442_002932_228_1541 | 433 |
| 477 | 3300042006 | Ga0439432_002280 | Ga0439432_002280_3538_4851 | 433 |
| 478 | 3300042010 | Ga0439452_018759 | Ga0439452_018759_222_1535 | 433 |
| 479 | 3300042015 | Ga0439462_0001923 | Ga0439462_0001923_1138_2451 | 433 |
| 480 | 3300042435 | Ga0439434_0000095 | Ga0439434_0000095_16148_17461 | 433 |
| 481 | 3300046499 | Ga0495594_0048015 | Ga0495594_0048015_686_2053 | 433 |
| 482 | 3300046507 | Ga0495606_0000809 | Ga0495606_0000809_23730_25043 | 433 |
| 483 | 3300046507 | Ga0495606_0011422 | Ga0495606_0011422_1813_3126 | 433 |
| 484 | 3300046522 | Ga0495643_0009120 | Ga0495643_0009120_3060_4373 | 433 |
| 485 | 3300046524 | Ga0495648_0000152 | Ga0495648_0000152_13282_14595 | 433 |
| 486 | 3300046648 | Ga0495611_0002954 | Ga0495611_0002954_2518_3831 | 433 |
| 487 | 3300046648 | Ga0495611_0011861 | Ga0495611_0011861_1864_3219 | 433 |
| 488 | 3300046660 | Ga0495625_0001440 | Ga0495625_0001440_25968_27281 | 433 |
| 489 | 3300046684 | Ga0495669_0000433 | Ga0495669_0000433_17169_18482 | 433 |
| 490 | 3300046684 | Ga0495669_0040720 | Ga0495669_0040720_136_1440 | 433 |
| 491 | 3300047443 | Ga0495687_010981 | Ga0495687_010981_1085_2398 | 433 |
| 492 | 3300047470 | Ga0495681_0007535 | Ga0495681_0007535_3586_4899 | 433 |
| 493 | 3300047472 | Ga0495686_0000650 | Ga0495686_0000650_16878_18191 | 433 |
| 494 | 3300048905 | Ga0496102_0000125 | Ga0496102_0000125_26667_27980 | 433 |
| 495 | 3300048906 | Ga0496103_0000322 | Ga0496103_0000322_26680_27993 | 433 |
| 496 | 3300048907 | Ga0496104_0015178 | Ga0496104_0015178_2308_3621 | 433 |
| 497 | 3300048908 | Ga0496105_0000261 | Ga0496105_0000261_15376_16689 | 433 |
| 498 | 3300048914 | Ga0496111_0011575 | Ga0496111_0011575_2988_4301 | 433 |
| 499 | 3300048916 | Ga0496113_0056296 | Ga0496113_0056296_1148_2461 | 433 |
| 500 | 3300048917 | Ga0496114_0001428 | Ga0496114_0001428_4274_5587 | 433 |
| 501 | 3300048918 | Ga0496115_0000142 | Ga0496115_0000142_36248_37561 | 433 |
| 502 | 3300048919 | Ga0496116_0029403 | Ga0496116_0029403_1314_2627 | 433 |
| 503 | 3300048920 | Ga0496117_0001219 | Ga0496117_0001219_1040_2353 | 433 |
| 504 | 3300048921 | Ga0496118_0000285 | Ga0496118_0000285_51163_52476 | 433 |
| 505 | 3300048923 | Ga0496120_0025661 | Ga0496120_0025661_1270_2583 | 433 |
| 506 | 3300048924 | Ga0496121_0001101 | Ga0496121_0001101_43859_45172 | 433 |
| 507 | 3300048926 | Ga0496123_0016451 | Ga0496123_0016451_1422_2732 | 433 |
| 508 | 3300048926 | Ga0496123_0016583 | Ga0496123_0016583_4652_5962 | 433 |
| 509 | 3300048927 | Ga0496124_0000320 | Ga0496124_0000320_51146_52459 | 433 |
| 510 | 3300048927 | Ga0496124_0006449 | Ga0496124_0006449_6653_7963 | 433 |
| 511 | 3300048927 | Ga0496124_0025914 | Ga0496124_0025914_1303_2613 | 433 |
| 512 | 3300048928 | Ga0496125_0001234 | Ga0496125_0001234_35573_36886 | 433 |
| 513 | 3300048929 | Ga0496126_0000655 | Ga0496126_0000655_36243_37556 | 433 |
| 514 | 3300048929 | Ga0496126_0005994 | Ga0496126_0005994_1020_2366 | 433 |
| 515 | 3300049581 | Ga0501047_0006070 | Ga0501047_0006070_2739_4097 | 433 |
| 516 | 3300049585 | Ga0501069_0023377 | Ga0501069_0023377_1044_2351 | 433 |
| 517 | 3300049588 | Ga0501072_0000844 | Ga0501072_0000844_14734_16092 | 433 |
| 518 | 3300049589 | Ga0501073_0007445 | Ga0501073_0007445_6297_7655 | 433 |
| 519 | 3300049674 | Ga0501242_002950 | Ga0501242_002950_353_1657 | 433 |
| 520 | 3300049705 | Ga0501225_0014233 | Ga0501225_0014233_828_2132 | 433 |
| 521 | 3300049741 | Ga0501079_0110693 | Ga0501079_0110693_298_1656 | 433 |
| 522 | 3300049767 | Ga0501270_002356 | Ga0501270_002356_496_1800 | 433 |
| 523 | 3300050510 | nmdc:mga06r32_69356_c1 | nmdc:mga06r32_69356_c1_192_1613 | 433 |
| 524 | 3300053079 | Ga0500610_0000036 | Ga0500610_0000036_16118_17431 | 433 |
| 525 | 3300053087 | Ga0500643_007637 | Ga0500643_007637_1493_2848 | 433 |
| 526 | 3300053087 | Ga0500643_026815 | Ga0500643_026815_427_1782 | 433 |
| 527 | 3300053096 | Ga0500641_0003987 | Ga0500641_0003987_3222_4577 | 433 |
| 528 | 3300053096 | Ga0500641_0006677 | Ga0500641_0006677_1750_3054 | 433 |
| 529 | 3300053104 | Ga0500556_0002605 | Ga0500556_0002605_4204_5559 | 433 |
| 530 | 3300053104 | Ga0500556_0016379 | Ga0500556_0016379_295_1650 | 433 |
| 531 | 3300053108 | Ga0500562_000724 | Ga0500562_000724_1560_2915 | 433 |
| 532 | 3300053136 | Ga0500559_0000048 | Ga0500559_0000048_71747_73186 | 433 |
| 533 | 3300053156 | Ga0500622_0011684 | Ga0500622_0011684_169_1524 | 433 |
| 534 | 3300053156 | Ga0500622_0036597 | Ga0500622_0036597_939_2315 | 433 |
| 535 | 3300053730 | Ga0500645_001524 | Ga0500645_001524_1772_3127 | 433 |
| 536 | 3300053735 | Ga0500596_000319 | Ga0500596_000319_3304_4617 | 433 |
| 537 | 3300003773 | Ga0055537_1003620 | Ga0055537_10036204 | 434 |
| 538 | 3300003775 | Ga0055524_1000172 | Ga0055524_100017272 | 434 |
| 539 | 3300003791 | Ga0055530_10001358 | Ga0055530_100013583 | 434 |
| 540 | 3300003794 | Ga0055531_10007465 | Ga0055531_100074652 | 434 |
| 541 | 3300005262 | Ga0065165_1000345 | Ga0065165_100034512 | 434 |
| 542 | 3300005355 | Ga0070671_100104541 | Ga0070671_1001045412 | 434 |
| 543 | 3300005355 | Ga0070671_100203484 | Ga0070671_1002034841 | 434 |
| 544 | 3300005457 | Ga0070662_100014743 | Ga0070662_1000147435 | 434 |
| 545 | 3300005459 | Ga0068867_100069552 | Ga0068867_1000695522 | 434 |
| 546 | 3300005564 | Ga0070664_100250907 | Ga0070664_1002509071 | 434 |
| 547 | 3300009093 | Ga0105240_10003577 | Ga0105240_1000357711 | 434 |
| 548 | 3300013306 | Ga0163162_10117051 | Ga0163162_101170513 | 434 |
| 549 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007452 | 434 |
| 550 | 3300025263 | Ga0209565_1000172 | Ga0209565_10001724 | 434 |
| 551 | 3300025273 | Ga0209673_1000796 | Ga0209673_100079633 | 434 |
| 552 | 3300025292 | Ga0209676_1000316 | Ga0209676_10003167 | 434 |
| 553 | 3300025295 | Ga0209564_1002843 | Ga0209564_10028437 | 434 |
| 554 | 3300025297 | Ga0209758_1002605 | Ga0209758_10026059 | 434 |
| 555 | 3300025298 | Ga0209050_1000010 | Ga0209050_1000010717 | 434 |
| 556 | 3300025298 | Ga0209050_1000604 | Ga0209050_10006047 | 434 |
| 557 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008294 | 434 |
| 558 | 3300025303 | Ga0209051_1007732 | Ga0209051_10077325 | 434 |
| 559 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027359 | 434 |
| 560 | 3300025304 | Ga0209257_1000192 | Ga0209257_1000192136 | 434 |
| 561 | 3300025304 | Ga0209257_1001191 | Ga0209257_10011919 | 434 |
| 562 | 3300025304 | Ga0209257_1005979 | Ga0209257_10059795 | 434 |
| 563 | 3300025913 | Ga0207695_10002758 | Ga0207695_1000275829 | 434 |
| 564 | 3300025931 | Ga0207644_10043243 | Ga0207644_100432432 | 434 |
| 565 | 3300025933 | Ga0207706_10039609 | Ga0207706_100396095 | 434 |
| 566 | 3300026088 | Ga0207641_10061514 | Ga0207641_100615141 | 434 |
| 567 | 3300026095 | Ga0207676_10003035 | Ga0207676_100030353 | 434 |
| 568 | 3300026118 | Ga0207675_100000666 | Ga0207675_10000066635 | 434 |
| 569 | 3300028794 | Ga0307515_10040761 | Ga0307515_100407612 | 434 |
| 570 | 3300031456 | Ga0307513_10000649 | Ga0307513_1000064911 | 434 |
| 571 | 3300031456 | Ga0307513_10083368 | Ga0307513_100833683 | 434 |
| 572 | 3300033180 | Ga0307510_10008609 | Ga0307510_100086099 | 434 |
| 573 | 3300035170 | Ga0373943_0022108 | Ga0373943_0022108_740_2086 | 434 |
| 574 | 3300037068 | Ga0373925_0000199 | Ga0373925_0000199_10909_12255 | 434 |
| 575 | 3300037418 | Ga0395900_0060542 | Ga0395900_0060542_1092_2480 | 434 |
| 576 | 3300037471 | Ga0395905_0044731 | Ga0395905_0044731_261_1649 | 434 |
| 577 | 3300038443 | Ga0395901_0013736 | Ga0395901_0013736_6089_7477 | 434 |
| 578 | 3300038443 | Ga0395901_0050884 | Ga0395901_0050884_2686_4029 | 434 |
| 579 | 3300041997 | Ga0439431_0010999 | Ga0439431_0010999_105_1418 | 434 |
| 580 | 3300046453 | Ga0495627_000954 | Ga0495627_000954_3116_4468 | 434 |
| 581 | 3300046457 | Ga0495590_0000763 | Ga0495590_0000763_3742_5094 | 434 |
| 582 | 3300046460 | Ga0495638_0001571 | Ga0495638_0001571_10002_11354 | 434 |
| 583 | 3300046460 | Ga0495638_0006650 | Ga0495638_0006650_5049_6401 | 434 |
| 584 | 3300046460 | Ga0495638_0028107 | Ga0495638_0028107_281_1633 | 434 |
| 585 | 3300046471 | Ga0495650_0000468 | Ga0495650_0000468_42483_43835 | 434 |
| 586 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_450095_451447 | 434 |
| 587 | 3300046506 | Ga0495583_0006990 | Ga0495583_0006990_1334_2644 | 434 |
| 588 | 3300046507 | Ga0495606_0012552 | Ga0495606_0012552_2891_4243 | 434 |
| 589 | 3300046512 | Ga0495610_0000816 | Ga0495610_0000816_9498_10850 | 434 |
| 590 | 3300046512 | Ga0495610_0002953 | Ga0495610_0002953_5662_7014 | 434 |
| 591 | 3300046512 | Ga0495610_0005936 | Ga0495610_0005936_7048_8400 | 434 |
| 592 | 3300046513 | Ga0495616_0000405 | Ga0495616_0000405_18978_20330 | 434 |
| 593 | 3300046515 | Ga0495620_0018404 | Ga0495620_0018404_2074_3426 | 434 |
| 594 | 3300046518 | Ga0495631_0008844 | Ga0495631_0008844_2887_4239 | 434 |
| 595 | 3300046519 | Ga0495632_0003925 | Ga0495632_0003925_1381_2733 | 434 |
| 596 | 3300046524 | Ga0495648_0000107 | Ga0495648_0000107_102378_103730 | 434 |
| 597 | 3300046528 | Ga0495642_0002008 | Ga0495642_0002008_1924_3285 | 434 |
| 598 | 3300046530 | Ga0495654_0000199 | Ga0495654_0000199_20232_21584 | 434 |
| 599 | 3300046538 | Ga0495609_0019732 | Ga0495609_0019732_1660_3012 | 434 |
| 600 | 3300046616 | Ga0495668_0000389 | Ga0495668_0000389_5286_6638 | 434 |
| 601 | 3300046616 | Ga0495668_0035138 | Ga0495668_0035138_1343_2695 | 434 |
| 602 | 3300046660 | Ga0495625_0000707 | Ga0495625_0000707_40757_42109 | 434 |
| 603 | 3300046660 | Ga0495625_0004355 | Ga0495625_0004355_8410_9762 | 434 |
| 604 | 3300046660 | Ga0495625_0004577 | Ga0495625_0004577_7670_9022 | 434 |
| 605 | 3300046794 | Ga0495589_0003192 | Ga0495589_0003192_1701_3053 | 434 |
| 606 | 3300047318 | Ga0495636_0045637 | Ga0495636_0045637_75_1436 | 434 |
| 607 | 3300047320 | Ga0495672_0007833 | Ga0495672_0007833_5905_7257 | 434 |
| 608 | 3300047323 | Ga0495683_0034867 | Ga0495683_0034867_941_2293 | 434 |
| 609 | 3300047469 | Ga0495673_0001884 | Ga0495673_0001884_10150_11502 | 434 |
| 610 | 3300047472 | Ga0495686_0001170 | Ga0495686_0001170_5036_6388 | 434 |
| 611 | 3300047472 | Ga0495686_0006442 | Ga0495686_0006442_436_1788 | 434 |
| 612 | 3300047472 | Ga0495686_0016140 | Ga0495686_0016140_870_2222 | 434 |
| 613 | 3300047472 | Ga0495686_0020655 | Ga0495686_0020655_2788_4113 | 434 |
| 614 | 3300048905 | Ga0496102_0003298 | Ga0496102_0003298_10546_11907 | 434 |
| 615 | 3300048909 | Ga0496106_0050742 | Ga0496106_0050742_12_1364 | 434 |
| 616 | 3300048910 | Ga0496107_0000039 | Ga0496107_0000039_65266_66618 | 434 |
| 617 | 3300048912 | Ga0496109_0053549 | Ga0496109_0053549_956_2317 | 434 |
| 618 | 3300048924 | Ga0496121_0006291 | Ga0496121_0006291_8015_9367 | 434 |
| 619 | 3300049459 | Ga0495678_002387 | Ga0495678_002387_841_2193 | 434 |
| 620 | 3300049569 | Ga0501032_0001548 | Ga0501032_0001548_3986_5362 | 434 |
| 621 | 3300049572 | Ga0501036_0033991 | Ga0501036_0033991_2894_4270 | 434 |
| 622 | 3300049573 | Ga0501037_0004940 | Ga0501037_0004940_2438_3814 | 434 |
| 623 | 3300049579 | Ga0501043_0014517 | Ga0501043_0014517_4738_6114 | 434 |
| 624 | 3300049583 | Ga0501067_0000123 | Ga0501067_0000123_23507_24883 | 434 |
| 625 | 3300049584 | Ga0501068_0001282 | Ga0501068_0001282_9853_11229 | 434 |
| 626 | 3300049589 | Ga0501073_0000002 | Ga0501073_0000002_102057_103433 | 434 |
| 627 | 3300049593 | Ga0501077_0000002 | Ga0501077_0000002_153405_154781 | 434 |
| 628 | 3300049742 | Ga0501080_0000199 | Ga0501080_0000199_13388_14764 | 434 |
| 629 | 3300050516 | nmdc:mga0sz30_6928_c1 | nmdc:mga0sz30_6928_c1_16_1368 | 434 |
| 630 | 3300053087 | Ga0500643_003017 | Ga0500643_003017_5620_6930 | 434 |
| 631 | 3300053091 | Ga0500647_0054774 | Ga0500647_0054774_14_1354 | 434 |
| 632 | 3300053111 | Ga0500572_000052 | Ga0500572_000052_22919_24259 | 434 |
| 633 | 3300053118 | Ga0500594_0000117 | Ga0500594_0000117_11338_12690 | 434 |
| 634 | 3300053119 | Ga0500595_002453 | Ga0500595_002453_5267_6667 | 434 |
| 635 | 3300053122 | Ga0500608_000611 | Ga0500608_000611_11756_13108 | 434 |
| 636 | 3300053125 | Ga0500618_000617 | Ga0500618_000617_11924_13276 | 434 |
| 637 | 3300053134 | Ga0500658_0036719 | Ga0500658_0036719_68_1381 | 434 |
| 638 | 3300053136 | Ga0500559_0000009 | Ga0500559_0000009_161507_162859 | 434 |
| 639 | 3300053136 | Ga0500559_0005040 | Ga0500559_0005040_4650_6002 | 434 |
| 640 | 3300053136 | Ga0500559_0035175 | Ga0500559_0035175_42_1352 | 434 |
| 641 | 3300053139 | Ga0500568_0017483 | Ga0500568_0017483_838_2151 | 434 |
| 642 | 3300053153 | Ga0500616_0033237 | Ga0500616_0033237_331_1683 | 434 |
| 643 | 3300053156 | Ga0500622_0001045 | Ga0500622_0001045_11455_12807 | 434 |
| 644 | 3300053156 | Ga0500622_0021291 | Ga0500622_0021291_2037_3389 | 434 |
| 645 | 3300053158 | Ga0500627_0012643 | Ga0500627_0012643_489_1841 | 434 |
| 646 | 3300053730 | Ga0500645_000990 | Ga0500645_000990_12867_14219 | 434 |
| 647 | 3300053730 | Ga0500645_012044 | Ga0500645_012044_616_1926 | 434 |
| 648 | 3300053731 | Ga0500609_000937 | Ga0500609_000937_101_1453 | 434 |
| 649 | 3300053733 | Ga0500552_002336 | Ga0500552_002336_187_1527 | 434 |
| 650 | iso_pu_bacteria | 2946787523 | 2946789212 | 434 |
| 651 | 3300001915 | JGI24741J21665_1003085 | JGI24741J21665_10030855 | 435 |
| 652 | 3300001979 | JGI24740J21852_10004068 | JGI24740J21852_100040687 | 435 |
| 653 | 3300001989 | JGI24739J22299_10004442 | JGI24739J22299_100044427 | 435 |
| 654 | 3300001990 | JGI24737J22298_10000247 | JGI24737J22298_100002477 | 435 |
| 655 | 3300002067 | JGI24735J21928_10002583 | JGI24735J21928_100025838 | 435 |
| 656 | 3300003773 | Ga0055537_1002000 | Ga0055537_10020005 | 435 |
| 657 | 3300003791 | Ga0055530_10000586 | Ga0055530_1000058612 | 435 |
| 658 | 3300003794 | Ga0055531_10005543 | Ga0055531_100055438 | 435 |
| 659 | 3300005262 | Ga0065165_1000941 | Ga0065165_100094110 | 435 |
| 660 | 3300005262 | Ga0065165_1016452 | Ga0065165_10164524 | 435 |
| 661 | 3300005327 | Ga0070658_10012645 | Ga0070658_1001264510 | 435 |
| 662 | 3300005327 | Ga0070658_10015022 | Ga0070658_100150222 | 435 |
| 663 | 3300005329 | Ga0070683_100059652 | Ga0070683_1000596522 | 435 |
| 664 | 3300005337 | Ga0070682_100046621 | Ga0070682_1000466213 | 435 |
| 665 | 3300005338 | Ga0068868_100001497 | Ga0068868_1000014978 | 435 |
| 666 | 3300005344 | Ga0070661_100023224 | Ga0070661_1000232242 | 435 |
| 667 | 3300005366 | Ga0070659_100001161 | Ga0070659_10000116111 | 435 |
| 668 | 3300005366 | Ga0070659_100006138 | Ga0070659_1000061387 | 435 |
| 669 | 3300005366 | Ga0070659_100027632 | Ga0070659_1000276322 | 435 |
| 670 | 3300005455 | Ga0070663_100014296 | Ga0070663_1000142967 | 435 |
| 671 | 3300005457 | Ga0070662_100088175 | Ga0070662_1000881752 | 435 |
| 672 | 3300005547 | Ga0070693_100008209 | Ga0070693_1000082097 | 435 |
| 673 | 3300005548 | Ga0070665_100002021 | Ga0070665_10000202113 | 435 |
| 674 | 3300005563 | Ga0068855_100009847 | Ga0068855_10000984714 | 435 |
| 675 | 3300005564 | Ga0070664_100000464 | Ga0070664_10000046423 | 435 |
| 676 | 3300005617 | Ga0068859_100032062 | Ga0068859_1000320625 | 435 |
| 677 | 3300005844 | Ga0068862_100120438 | Ga0068862_1001204382 | 435 |
| 678 | 3300005983 | Ga0081540_1002750 | Ga0081540_10027508 | 435 |
| 679 | 3300006881 | Ga0068865_100000389 | Ga0068865_10000038914 | 435 |
| 680 | 3300006931 | Ga0097620_100032062 | Ga0097620_1000320624 | 435 |
| 681 | 3300009098 | Ga0105245_10084495 | Ga0105245_100844952 | 435 |
| 682 | 3300009177 | Ga0105248_10000170 | Ga0105248_1000017076 | 435 |
| 683 | 3300009177 | Ga0105248_10055686 | Ga0105248_100556866 | 435 |
| 684 | 3300013102 | Ga0157371_10023869 | Ga0157371_100238694 | 435 |
| 685 | 3300013307 | Ga0157372_10069250 | Ga0157372_100692505 | 435 |
| 686 | 3300025250 | Ga0209026_1002551 | Ga0209026_10025518 | 435 |
| 687 | 3300025263 | Ga0209565_1000089 | Ga0209565_10000899 | 435 |
| 688 | 3300025295 | Ga0209564_1009726 | Ga0209564_10097264 | 435 |
| 689 | 3300025298 | Ga0209050_1000053 | Ga0209050_1000053242 | 435 |
| 690 | 3300025298 | Ga0209050_1010143 | Ga0209050_10101434 | 435 |
| 691 | 3300025302 | Ga0207426_1013452 | Ga0207426_10134523 | 435 |
| 692 | 3300025304 | Ga0209257_1000289 | Ga0209257_100028933 | 435 |
| 693 | 3300025304 | Ga0209257_1003844 | Ga0209257_100384410 | 435 |
| 694 | 3300025909 | Ga0207705_10003453 | Ga0207705_1000345312 | 435 |
| 695 | 3300025919 | Ga0207657_10004751 | Ga0207657_100047512 | 435 |
| 696 | 3300025919 | Ga0207657_10027824 | Ga0207657_100278242 | 435 |
| 697 | 3300025919 | Ga0207657_10041820 | Ga0207657_100418202 | 435 |
| 698 | 3300025921 | Ga0207652_10004969 | Ga0207652_100049699 | 435 |
| 699 | 3300025927 | Ga0207687_10014749 | Ga0207687_100147497 | 435 |
| 700 | 3300025932 | Ga0207690_10000142 | Ga0207690_1000014211 | 435 |
| 701 | 3300025938 | Ga0207704_10001695 | Ga0207704_100016953 | 435 |
| 702 | 3300025941 | Ga0207711_10000374 | Ga0207711_1000037416 | 435 |
| 703 | 3300025941 | Ga0207711_10046761 | Ga0207711_100467615 | 435 |
| 704 | 3300025945 | Ga0207679_10002863 | Ga0207679_100028635 | 435 |
| 705 | 3300025949 | Ga0207667_10018370 | Ga0207667_100183707 | 435 |
| 706 | 3300026023 | Ga0207677_10003316 | Ga0207677_100033162 | 435 |
| 707 | 3300026041 | Ga0207639_10139878 | Ga0207639_101398782 | 435 |
| 708 | 3300026041 | Ga0207639_10183816 | Ga0207639_101838162 | 435 |
| 709 | 3300026067 | Ga0207678_10009031 | Ga0207678_100090312 | 435 |
| 710 | 3300026067 | Ga0207678_10131918 | Ga0207678_101319181 | 435 |
| 711 | 3300026095 | Ga0207676_10045603 | Ga0207676_100456032 | 435 |
| 712 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031323 | 435 |
| 713 | 3300028381 | Ga0268264_10078942 | Ga0268264_100789423 | 435 |
| 714 | 3300028786 | Ga0307517_10073535 | Ga0307517_100735353 | 435 |
| 715 | 3300031711 | Ga0265314_10006363 | Ga0265314_100063639 | 435 |
| 716 | 3300033180 | Ga0307510_10080123 | Ga0307510_100801234 | 435 |
| 717 | 3300037312 | Ga0395899_0001948 | Ga0395899_0001948_10303_11610 | 435 |
| 718 | 3300037418 | Ga0395900_0006995 | Ga0395900_0006995_5671_6978 | 435 |
| 719 | 3300037466 | Ga0395898_0014210 | Ga0395898_0014210_5040_6347 | 435 |
| 720 | 3300037466 | Ga0395898_0030411 | Ga0395898_0030411_684_1991 | 435 |
| 721 | 3300037466 | Ga0395898_0064204 | Ga0395898_0064204_1066_2415 | 435 |
| 722 | 3300038443 | Ga0395901_0011351 | Ga0395901_0011351_5880_7187 | 435 |
| 723 | 3300042157 | Ga0439458_0000074 | Ga0439458_0000074_2108_3415 | 435 |
| 724 | 3300044694 | Ga0466963_0110203 | Ga0466963_0110203_508_1815 | 435 |
| 725 | 3300045976 | Ga0466967_0055997 | Ga0466967_0055997_1922_3229 | 435 |
| 726 | 3300045976 | Ga0466967_0088996 | Ga0466967_0088996_996_2303 | 435 |
| 727 | 3300046616 | Ga0495668_0009041 | Ga0495668_0009041_414_1721 | 435 |
| 728 | 3300046684 | Ga0495669_0000007 | Ga0495669_0000007_105434_106780 | 435 |
| 729 | 3300046684 | Ga0495669_0000318 | Ga0495669_0000318_18123_19469 | 435 |
| 730 | 3300046684 | Ga0495669_0027912 | Ga0495669_0027912_702_2009 | 435 |
| 731 | 3300047445 | Ga0495677_0021725 | Ga0495677_0021725_118_1425 | 435 |
| 732 | 3300048907 | Ga0496104_0000094 | Ga0496104_0000094_60898_62262 | 435 |
| 733 | 3300048908 | Ga0496105_0007066 | Ga0496105_0007066_7176_8540 | 435 |
| 734 | 3300048911 | Ga0496108_0025985 | Ga0496108_0025985_441_1805 | 435 |
| 735 | 3300048912 | Ga0496109_0014912 | Ga0496109_0014912_1690_3054 | 435 |
| 736 | 3300048912 | Ga0496109_0144902 | Ga0496109_0144902_39_1346 | 435 |
| 737 | 3300048913 | Ga0496110_0000954 | Ga0496110_0000954_11509_12873 | 435 |
| 738 | 3300048915 | Ga0496112_0016768 | Ga0496112_0016768_724_2073 | 435 |
| 739 | 3300048916 | Ga0496113_0000109 | Ga0496113_0000109_32574_33938 | 435 |
| 740 | 3300048918 | Ga0496115_0000784 | Ga0496115_0000784_4397_5746 | 435 |
| 741 | 3300049570 | Ga0501033_0011462 | Ga0501033_0011462_4390_5748 | 435 |
| 742 | 3300049571 | Ga0501034_0004898 | Ga0501034_0004898_6397_7755 | 435 |
| 743 | 3300049573 | Ga0501037_0114808 | Ga0501037_0114808_55_1413 | 435 |
| 744 | 3300049581 | Ga0501047_0004654 | Ga0501047_0004654_2312_3655 | 435 |
| 745 | 3300049581 | Ga0501047_0130014 | Ga0501047_0130014_764_2113 | 435 |
| 746 | 3300049582 | Ga0501048_0000615 | Ga0501048_0000615_16297_17646 | 435 |
| 747 | 3300049583 | Ga0501067_0019712 | Ga0501067_0019712_380_1729 | 435 |
| 748 | 3300049758 | Ga0501241_006104 | Ga0501241_006104_876_2204 | 435 |
| 749 | 3300049823 | Ga0501044_0059578 | Ga0501044_0059578_1462_2820 | 435 |
| 750 | 3300050492 | nmdc:mga0yw44_124867_c1 | nmdc:mga0yw44_124867_c1_59_1396 | 435 |
| 751 | 3300050494 | nmdc:mga06z11_9336_c1 | nmdc:mga06z11_9336_c1_2489_3826 | 435 |
| 752 | 3300053094 | Ga0500566_0001038 | Ga0500566_0001038_4538_5866 | 435 |
| 753 | 3300053096 | Ga0500641_0005963 | Ga0500641_0005963_2863_4206 | 435 |
| 754 | 3300053108 | Ga0500562_003755 | Ga0500562_003755_2162_3523 | 435 |
| 755 | 3300053134 | Ga0500658_0000037 | Ga0500658_0000037_51557_52864 | 435 |
| 756 | 3300053153 | Ga0500616_0009567 | Ga0500616_0009567_708_2048 | 435 |
| 757 | 3300002774 | JGI25150J39212_1000177 | JGI25150J39212_100017736 | 436 |
| 758 | 3300003187 | JGI25151J46595_10029424 | JGI25151J46595_100294241 | 436 |
| 759 | 3300003215 | JGI25153J46596_10000153 | JGI25153J46596_1000015352 | 436 |
| 760 | 3300005327 | Ga0070658_10101106 | Ga0070658_101011061 | 436 |
| 761 | 3300005331 | Ga0070670_100162912 | Ga0070670_1001629122 | 436 |
| 762 | 3300005338 | Ga0068868_100000021 | Ga0068868_10000002175 | 436 |
| 763 | 3300005339 | Ga0070660_100004476 | Ga0070660_1000044769 | 436 |
| 764 | 3300005341 | Ga0070691_10001596 | Ga0070691_100015965 | 436 |
| 765 | 3300005341 | Ga0070691_10018081 | Ga0070691_100180812 | 436 |
| 766 | 3300005366 | Ga0070659_100000027 | Ga0070659_100000027100 | 436 |
| 767 | 3300005366 | Ga0070659_100226012 | Ga0070659_1002260121 | 436 |
| 768 | 3300005435 | Ga0070714_100000769 | Ga0070714_10000076921 | 436 |
| 769 | 3300005458 | Ga0070681_10019769 | Ga0070681_100197693 | 436 |
| 770 | 3300005458 | Ga0070681_10053345 | Ga0070681_100533452 | 436 |
| 771 | 3300005530 | Ga0070679_100043339 | Ga0070679_1000433392 | 436 |
| 772 | 3300005539 | Ga0068853_100154613 | Ga0068853_1001546132 | 436 |
| 773 | 3300005563 | Ga0068855_100042440 | Ga0068855_1000424406 | 436 |
| 774 | 3300005563 | Ga0068855_100060501 | Ga0068855_1000605012 | 436 |
| 775 | 3300005937 | Ga0081455_10000100 | Ga0081455_1000010078 | 436 |
| 776 | 3300005983 | Ga0081540_1045461 | Ga0081540_10454612 | 436 |
| 777 | 3300005985 | Ga0081539_10024820 | Ga0081539_100248203 | 436 |
| 778 | 3300009093 | Ga0105240_10031721 | Ga0105240_100317212 | 436 |
| 779 | 3300009093 | Ga0105240_10122781 | Ga0105240_101227814 | 436 |
| 780 | 3300009545 | Ga0105237_10056680 | Ga0105237_100566804 | 436 |
| 781 | 3300009551 | Ga0105238_10227325 | Ga0105238_102273252 | 436 |
| 782 | 3300013104 | Ga0157370_10019472 | Ga0157370_100194726 | 436 |
| 783 | 3300025245 | Ga0207425_1000019 | Ga0207425_1000019323 | 436 |
| 784 | 3300025294 | Ga0209025_1000304 | Ga0209025_100030442 | 436 |
| 785 | 3300025297 | Ga0209758_1000019 | Ga0209758_1000019264 | 436 |
| 786 | 3300025298 | Ga0209050_1017409 | Ga0209050_10174092 | 436 |
| 787 | 3300025304 | Ga0209257_1001845 | Ga0209257_10018453 | 436 |
| 788 | 3300025893 | Ga0207682_10014983 | Ga0207682_100149832 | 436 |
| 789 | 3300025909 | Ga0207705_10000058 | Ga0207705_10000058153 | 436 |
| 790 | 3300025912 | Ga0207707_10005208 | Ga0207707_100052089 | 436 |
| 791 | 3300025913 | Ga0207695_10011899 | Ga0207695_1001189911 | 436 |
| 792 | 3300025913 | Ga0207695_10027405 | Ga0207695_100274055 | 436 |
| 793 | 3300025913 | Ga0207695_10032586 | Ga0207695_100325865 | 436 |
| 794 | 3300025919 | Ga0207657_10002881 | Ga0207657_100028819 | 436 |
| 795 | 3300025919 | Ga0207657_10003546 | Ga0207657_100035469 | 436 |
| 796 | 3300025919 | Ga0207657_10033675 | Ga0207657_100336752 | 436 |
| 797 | 3300025921 | Ga0207652_10001178 | Ga0207652_1000117813 | 436 |
| 798 | 3300025923 | Ga0207681_10009243 | Ga0207681_100092437 | 436 |
| 799 | 3300025925 | Ga0207650_10058633 | Ga0207650_100586334 | 436 |
| 800 | 3300025929 | Ga0207664_10001066 | Ga0207664_1000106617 | 436 |
| 801 | 3300025931 | Ga0207644_10120201 | Ga0207644_101202012 | 436 |
| 802 | 3300025932 | Ga0207690_10000161 | Ga0207690_1000016127 | 436 |
| 803 | 3300025933 | Ga0207706_10004879 | Ga0207706_100048797 | 436 |
| 804 | 3300025945 | Ga0207679_10053471 | Ga0207679_100534712 | 436 |
| 805 | 3300025949 | Ga0207667_10273244 | Ga0207667_102732442 | 436 |
| 806 | 3300026023 | Ga0207677_10000036 | Ga0207677_1000003663 | 436 |
| 807 | 3300026041 | Ga0207639_10047490 | Ga0207639_100474902 | 436 |
| 808 | 3300031251 | Ga0265327_10000110 | Ga0265327_1000011051 | 436 |
| 809 | 3300031344 | Ga0265316_10082109 | Ga0265316_100821093 | 436 |
| 810 | 3300031456 | Ga0307513_10000100 | Ga0307513_1000010048 | 436 |
| 811 | 3300031712 | Ga0265342_10043807 | Ga0265342_100438073 | 436 |
| 812 | 3300031824 | Ga0307413_10000417 | Ga0307413_1000041714 | 436 |
| 813 | 3300031903 | Ga0307407_10009898 | Ga0307407_100098983 | 436 |
| 814 | 3300031911 | Ga0307412_10066101 | Ga0307412_100661012 | 436 |
| 815 | 3300031995 | Ga0307409_100012813 | Ga0307409_1000128135 | 436 |
| 816 | 3300032002 | Ga0307416_100015498 | Ga0307416_1000154982 | 436 |
| 817 | 3300032126 | Ga0307415_100001725 | Ga0307415_1000017255 | 436 |
| 818 | 3300032126 | Ga0307415_100043012 | Ga0307415_1000430122 | 436 |
| 819 | 3300035695 | Ga0373927_0050106 | Ga0373927_0050106_1116_2474 | 436 |
| 820 | 3300036401 | Ga0373937_0071228 | Ga0373937_0071228_1707_3059 | 436 |
| 821 | 3300036401 | Ga0373937_0098781 | Ga0373937_0098781_798_2156 | 436 |
| 822 | 3300036401 | Ga0373937_0146980 | Ga0373937_0146980_143_1495 | 436 |
| 823 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_219868_221229 | 436 |
| 824 | 3300037466 | Ga0395898_0035284 | Ga0395898_0035284_2001_3371 | 436 |
| 825 | 3300037471 | Ga0395905_0014029 | Ga0395905_0014029_430_1791 | 436 |
| 826 | 3300038443 | Ga0395901_0000021 | Ga0395901_0000021_73665_75026 | 436 |
| 827 | 3300046536 | Ga0495587_0075380 | Ga0495587_0075380_259_1581 | 436 |
| 828 | 3300046684 | Ga0495669_0018193 | Ga0495669_0018193_1603_2916 | 436 |
| 829 | 3300046689 | Ga0495613_0001950 | Ga0495613_0001950_7109_8455 | 436 |
| 830 | 3300047322 | Ga0495680_0108286 | Ga0495680_0108286_407_1759 | 436 |
| 831 | 3300048927 | Ga0496124_0000576 | Ga0496124_0000576_49526_50881 | 436 |
| 832 | 3300049573 | Ga0501037_0087637 | Ga0501037_0087637_419_1774 | 436 |
| 833 | 3300049579 | Ga0501043_0011753 | Ga0501043_0011753_4216_5571 | 436 |
| 834 | 3300049581 | Ga0501047_0167660 | Ga0501047_0167660_176_1531 | 436 |
| 835 | 3300049586 | Ga0501070_0000111 | Ga0501070_0000111_22345_23700 | 436 |
| 836 | 3300049742 | Ga0501080_0002278 | Ga0501080_0002278_12746_14101 | 436 |
| 837 | 3300049822 | Ga0501035_0002698 | Ga0501035_0002698_5448_6803 | 436 |
| 838 | 3300049822 | Ga0501035_0247831 | Ga0501035_0247831_98_1450 | 436 |
| 839 | 3300049823 | Ga0501044_0001302 | Ga0501044_0001302_24058_25413 | 436 |
| 840 | 3300049823 | Ga0501044_0038309 | Ga0501044_0038309_1714_3069 | 436 |
| 841 | 3300053136 | Ga0500559_0061298 | Ga0500559_0061298_254_1615 | 436 |
| 842 | 3300053151 | Ga0500604_0000087 | Ga0500604_0000087_73_1401 | 436 |
| 843 | 3300061734 | Ga0530510_0062093 | Ga0530510_0062093_662_2008 | 436 |
| 844 | iso_pu_bacteria | 2738541275 | 2738711597 | 436 |
| 845 | iso_pu_bacteria | 2738541301 | 2738850022 | 436 |
| 846 | iso_pu_bacteria | 2738541304 | 2738865751 | 436 |
| 847 | iso_pu_bacteria | 2738543022 | 2739298269 | 436 |
| 848 | iso_pu_bacteria | 2738543033 | 2739359947 | 436 |
| 849 | iso_pu_bacteria | 2928959182 | 2928961680 | 436 |
| 850 | 3300002987 | JGI25159J45721_1003172 | JGI25159J45721_10031722 | 437 |
| 851 | 3300003187 | JGI25151J46595_10000335 | JGI25151J46595_1000033525 | 437 |
| 852 | 3300003214 | JGI25165J46597_1000208 | JGI25165J46597_100020884 | 437 |
| 853 | 3300005530 | Ga0070679_100028982 | Ga0070679_1000289822 | 437 |
| 854 | 3300005618 | Ga0068864_100000928 | Ga0068864_10000092822 | 437 |
| 855 | 3300005842 | Ga0068858_100000137 | Ga0068858_10000013770 | 437 |
| 856 | 3300006042 | Ga0075368_10000517 | Ga0075368_100005177 | 437 |
| 857 | 3300006051 | Ga0075364_10017758 | Ga0075364_100177582 | 437 |
| 858 | 3300006178 | Ga0075367_10002637 | Ga0075367_100026374 | 437 |
| 859 | 3300006186 | Ga0075369_10010903 | Ga0075369_100109034 | 437 |
| 860 | 3300009177 | Ga0105248_10039321 | Ga0105248_100393215 | 437 |
| 861 | 3300015690 | Ga0183363_1001 | Ga0183363_1001399 | 437 |
| 862 | 3300021384 | Ga0213876_10000522 | Ga0213876_1000052230 | 437 |
| 863 | 3300021388 | Ga0213875_10000101 | Ga0213875_1000010194 | 437 |
| 864 | 3300025261 | Ga0209233_1000186 | Ga0209233_100018654 | 437 |
| 865 | 3300025284 | Ga0209130_1000616 | Ga0209130_100061628 | 437 |
| 866 | 3300025297 | Ga0209758_1005251 | Ga0209758_10052517 | 437 |
| 867 | 3300025302 | Ga0207426_1000191 | Ga0207426_1000191135 | 437 |
| 868 | 3300025941 | Ga0207711_10063192 | Ga0207711_100631923 | 437 |
| 869 | 3300026035 | Ga0207703_10000330 | Ga0207703_1000033011 | 437 |
| 870 | 3300026095 | Ga0207676_10003136 | Ga0207676_1000313610 | 437 |
| 871 | 3300027866 | Ga0209813_10000130 | Ga0209813_1000013023 | 437 |
| 872 | 3300028786 | Ga0307517_10016334 | Ga0307517_100163341 | 437 |
| 873 | 3300031241 | Ga0265325_10000888 | Ga0265325_1000088814 | 437 |
| 874 | 3300031456 | Ga0307513_10015216 | Ga0307513_100152164 | 437 |
| 875 | 3300031507 | Ga0307509_10165295 | Ga0307509_101652952 | 437 |
| 876 | 3300031595 | Ga0265313_10000395 | Ga0265313_1000039531 | 437 |
| 877 | 3300031616 | Ga0307508_10012843 | Ga0307508_100128435 | 437 |
| 878 | 3300031711 | Ga0265314_10002588 | Ga0265314_100025882 | 437 |
| 879 | 3300031712 | Ga0265342_10047984 | Ga0265342_100479842 | 437 |
| 880 | 3300037853 | Ga0436364_0188471 | Ga0436364_0188471_41733_43058 | 437 |
| 881 | 3300039437 | Ga0436365_0298223 | Ga0436365_0298223_45988_47346 | 437 |
| 882 | 3300042876 | Ga0451577_0060900 | Ga0451577_0060900_510_1952 | 437 |
| 883 | 3300046506 | Ga0495583_0019104 | Ga0495583_0019104_1286_2611 | 437 |
| 884 | 3300046512 | Ga0495610_0013934 | Ga0495610_0013934_280_1683 | 437 |
| 885 | 3300046524 | Ga0495648_0023970 | Ga0495648_0023970_81_1412 | 437 |
| 886 | 3300046538 | Ga0495609_0016617 | Ga0495609_0016617_147_1499 | 437 |
| 887 | 3300046542 | Ga0495597_0001614 | Ga0495597_0001614_636_1988 | 437 |
| 888 | 3300046557 | Ga0495622_0002247 | Ga0495622_0002247_5260_6612 | 437 |
| 889 | 3300046809 | Ga0495600_0001465 | Ga0495600_0001465_5393_6718 | 437 |
| 890 | 3300047443 | Ga0495687_050161 | Ga0495687_050161_222_1574 | 437 |
| 891 | 3300048088 | Ga0495602_0057744 | Ga0495602_0057744_420_1772 | 437 |
| 892 | 3300048921 | Ga0496118_0003370 | Ga0496118_0003370_18049_19401 | 437 |
| 893 | 3300048924 | Ga0496121_0000042 | Ga0496121_0000042_88340_89692 | 437 |
| 894 | 3300049570 | Ga0501033_0172764 | Ga0501033_0172764_56_1399 | 437 |
| 895 | 3300049573 | Ga0501037_0005708 | Ga0501037_0005708_1817_3181 | 437 |
| 896 | 3300049578 | Ga0501042_0094542 | Ga0501042_0094542_160_1509 | 437 |
| 897 | 3300049591 | Ga0501075_0110505 | Ga0501075_0110505_356_1705 | 437 |
| 898 | 3300049592 | Ga0501076_0021665 | Ga0501076_0021665_3436_4785 | 437 |
| 899 | 3300049741 | Ga0501079_0011214 | Ga0501079_0011214_5354_6703 | 437 |
| 900 | 3300049742 | Ga0501080_0042676 | Ga0501080_0042676_186_1535 | 437 |
| 901 | 3300049823 | Ga0501044_0100855 | Ga0501044_0100855_355_1719 | 437 |
| 902 | 3300050489 | nmdc:mga03683_1197_c1 | nmdc:mga03683_1197_c1_2226_3560 | 437 |
| 903 | 3300050490 | nmdc:mga03n38_26053_c1 | nmdc:mga03n38_26053_c1_355_1689 | 437 |
| 904 | 3300050495 | nmdc:mga04h51_269_c1 | nmdc:mga04h51_269_c1_7149_8483 | 437 |
| 905 | 3300050496 | nmdc:mga07m45_90_c1 | nmdc:mga07m45_90_c1_4628_5962 | 437 |
| 906 | 3300053080 | Ga0500635_0000172 | Ga0500635_0000172_23684_25036 | 437 |
| 907 | 3300053109 | Ga0500569_004798 | Ga0500569_004798_198_1550 | 437 |
| 908 | 3300053119 | Ga0500595_000530 | Ga0500595_000530_20675_22000 | 437 |
| 909 | 3300053122 | Ga0500608_009357 | Ga0500608_009357_242_1594 | 437 |
| 910 | 3300053130 | Ga0500642_0022234 | Ga0500642_0022234_23_1375 | 437 |
| 911 | 3300053136 | Ga0500559_0015075 | Ga0500559_0015075_949_2301 | 437 |
| 912 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_244234_245613 | 437 |
| 913 | 3300053140 | Ga0500573_0000093 | Ga0500573_0000093_19830_21152 | 437 |
| 914 | 3300053154 | Ga0500619_008512 | Ga0500619_008512_1054_2379 | 437 |
| 915 | 3300053157 | Ga0500624_002025 | Ga0500624_002025_1416_2768 | 437 |
| 916 | 3300053162 | Ga0500638_014057 | Ga0500638_014057_1668_3020 | 437 |
| 917 | 3300053177 | Ga0500636_0036753 | Ga0500636_0036753_212_1564 | 437 |
| 918 | 3300053178 | Ga0500637_0001181 | Ga0500637_0001181_8896_10248 | 437 |
| 919 | 3300054114 | Ga0501084_0018673 | Ga0501084_0018673_1413_2762 | 437 |
| 920 | 3300060353 | Ga0501082_0087818 | Ga0501082_0087818_774_2123 | 437 |
| 921 | 3300061734 | Ga0530510_0006937 | Ga0530510_0006937_2612_3961 | 437 |
| 922 | iso_pu_bacteria | 2582581305 | 2585260335 | 437 |
| 923 | iso_pu_bacteria | 3000865235 | 3000867721 | 437 |
| 924 | 3300003792 | Ga0055540_1002368 | Ga0055540_10023684 | 438 |
| 925 | 3300005331 | Ga0070670_100000004 | Ga0070670_100000004182 | 438 |
| 926 | 3300005341 | Ga0070691_10006308 | Ga0070691_100063087 | 438 |
| 927 | 3300005347 | Ga0070668_100002111 | Ga0070668_1000021115 | 438 |
| 928 | 3300005367 | Ga0070667_100000067 | Ga0070667_10000006798 | 438 |
| 929 | 3300005367 | Ga0070667_100000175 | Ga0070667_10000017540 | 438 |
| 930 | 3300005406 | Ga0070703_10004937 | Ga0070703_100049373 | 438 |
| 931 | 3300005440 | Ga0070705_100001889 | Ga0070705_1000018893 | 438 |
| 932 | 3300005444 | Ga0070694_100107816 | Ga0070694_1001078161 | 438 |
| 933 | 3300005455 | Ga0070663_100015593 | Ga0070663_1000155932 | 438 |
| 934 | 3300005518 | Ga0070699_100015869 | Ga0070699_1000158693 | 438 |
| 935 | 3300005536 | Ga0070697_100047807 | Ga0070697_1000478072 | 438 |
| 936 | 3300005545 | Ga0070695_100008458 | Ga0070695_1000084583 | 438 |
| 937 | 3300005546 | Ga0070696_100000340 | Ga0070696_1000003403 | 438 |
| 938 | 3300005547 | Ga0070693_100092286 | Ga0070693_1000922861 | 438 |
| 939 | 3300005548 | Ga0070665_100032162 | Ga0070665_1000321624 | 438 |
| 940 | 3300005549 | Ga0070704_100002065 | Ga0070704_10000206512 | 438 |
| 941 | 3300005577 | Ga0068857_100016189 | Ga0068857_1000161893 | 438 |
| 942 | 3300005617 | Ga0068859_100006366 | Ga0068859_10000636612 | 438 |
| 943 | 3300005618 | Ga0068864_100000082 | Ga0068864_10000008249 | 438 |
| 944 | 3300005618 | Ga0068864_100077377 | Ga0068864_1000773773 | 438 |
| 945 | 3300005841 | Ga0068863_100000038 | Ga0068863_10000003896 | 438 |
| 946 | 3300005841 | Ga0068863_100000597 | Ga0068863_10000059711 | 438 |
| 947 | 3300005842 | Ga0068858_100031945 | Ga0068858_1000319454 | 438 |
| 948 | 3300005843 | Ga0068860_100000077 | Ga0068860_100000077182 | 438 |
| 949 | 3300005843 | Ga0068860_100013711 | Ga0068860_1000137113 | 438 |
| 950 | 3300005843 | Ga0068860_100019195 | Ga0068860_1000191957 | 438 |
| 951 | 3300005844 | Ga0068862_100000183 | Ga0068862_10000018361 | 438 |
| 952 | 3300005844 | Ga0068862_100001800 | Ga0068862_1000018003 | 438 |
| 953 | 3300005937 | Ga0081455_10000041 | Ga0081455_10000041101 | 438 |
| 954 | 3300005983 | Ga0081540_1000091 | Ga0081540_100009136 | 438 |
| 955 | 3300006042 | Ga0075368_10011642 | Ga0075368_100116425 | 438 |
| 956 | 3300006048 | Ga0075363_100006499 | Ga0075363_1000064993 | 438 |
| 957 | 3300006048 | Ga0075363_100061646 | Ga0075363_1000616462 | 438 |
| 958 | 3300006051 | Ga0075364_10008317 | Ga0075364_100083177 | 438 |
| 959 | 3300006058 | Ga0075432_10022132 | Ga0075432_100221322 | 438 |
| 960 | 3300006178 | Ga0075367_10019406 | Ga0075367_100194064 | 438 |
| 961 | 3300006195 | Ga0075366_10015605 | Ga0075366_100156052 | 438 |
| 962 | 3300006931 | Ga0097620_100006366 | Ga0097620_1000063663 | 438 |
| 963 | 3300009094 | Ga0111539_10033514 | Ga0111539_100335142 | 438 |
| 964 | 3300009098 | Ga0105245_10016411 | Ga0105245_100164117 | 438 |
| 965 | 3300009177 | Ga0105248_10087489 | Ga0105248_100874893 | 438 |
| 966 | 3300009553 | Ga0105249_10000438 | Ga0105249_100004387 | 438 |
| 967 | 3300025295 | Ga0209564_1007077 | Ga0209564_10070772 | 438 |
| 968 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011329 | 438 |
| 969 | 3300025303 | Ga0209051_1000309 | Ga0209051_100030940 | 438 |
| 970 | 3300025304 | Ga0209257_1001776 | Ga0209257_10017763 | 438 |
| 971 | 3300025885 | Ga0207653_10006282 | Ga0207653_100062822 | 438 |
| 972 | 3300025917 | Ga0207660_10015333 | Ga0207660_100153333 | 438 |
| 973 | 3300025925 | Ga0207650_10000118 | Ga0207650_1000011891 | 438 |
| 974 | 3300025927 | Ga0207687_10017758 | Ga0207687_100177586 | 438 |
| 975 | 3300025927 | Ga0207687_10153690 | Ga0207687_101536902 | 438 |
| 976 | 3300025944 | Ga0207661_10073728 | Ga0207661_100737282 | 438 |
| 977 | 3300025961 | Ga0207712_10022800 | Ga0207712_100228004 | 438 |
| 978 | 3300025972 | Ga0207668_10000464 | Ga0207668_1000046426 | 438 |
| 979 | 3300025972 | Ga0207668_10002103 | Ga0207668_100021032 | 438 |
| 980 | 3300025986 | Ga0207658_10000089 | Ga0207658_1000008935 | 438 |
| 981 | 3300025986 | Ga0207658_10000229 | Ga0207658_100002295 | 438 |
| 982 | 3300026035 | Ga0207703_10008806 | Ga0207703_100088064 | 438 |
| 983 | 3300026067 | Ga0207678_10019581 | Ga0207678_100195813 | 438 |
| 984 | 3300026088 | Ga0207641_10000060 | Ga0207641_1000006065 | 438 |
| 985 | 3300026088 | Ga0207641_10001900 | Ga0207641_1000190010 | 438 |
| 986 | 3300026088 | Ga0207641_10047698 | Ga0207641_100476982 | 438 |
| 987 | 3300026095 | Ga0207676_10000068 | Ga0207676_1000006832 | 438 |
| 988 | 3300026116 | Ga0207674_10002013 | Ga0207674_100020133 | 438 |
| 989 | 3300027866 | Ga0209813_10003413 | Ga0209813_100034133 | 438 |
| 990 | 3300027907 | Ga0207428_10061903 | Ga0207428_100619032 | 438 |
| 991 | 3300028379 | Ga0268266_10019517 | Ga0268266_100195174 | 438 |
| 992 | 3300028380 | Ga0268265_10000500 | Ga0268265_100005009 | 438 |
| 993 | 3300028380 | Ga0268265_10001504 | Ga0268265_1000150421 | 438 |
| 994 | 3300028381 | Ga0268264_10000032 | Ga0268264_10000032233 | 438 |
| 995 | 3300028381 | Ga0268264_10009741 | Ga0268264_100097416 | 438 |
| 996 | 3300028381 | Ga0268264_10040418 | Ga0268264_100404185 | 438 |
| 997 | 3300031824 | Ga0307413_10014827 | Ga0307413_100148272 | 438 |
| 998 | 3300035114 | Ga0373939_0006034 | Ga0373939_0006034_481_1863 | 438 |
| 999 | 3300035114 | Ga0373939_0020890 | Ga0373939_0020890_63_1445 | 438 |
| 1000 | 3300035115 | Ga0373941_0002377 | Ga0373941_0002377_1216_2598 | 438 |
| 1001 | 3300035115 | Ga0373941_0012176 | Ga0373941_0012176_722_2104 | 438 |
| 1002 | 3300035241 | Ga0373961_0006445 | Ga0373961_0006445_309_1691 | 438 |
| 1003 | 3300035691 | Ga0373931_0000951 | Ga0373931_0000951_9824_11206 | 438 |
| 1004 | 3300038705 | Ga0237819_02124 | Ga0237819_02124_789_2120 | 438 |
| 1005 | 3300039437 | Ga0436365_0938205 | Ga0436365_0938205_121_1437 | 438 |
| 1006 | 3300039437 | Ga0436365_1145611 | Ga0436365_1145611_574_1929 | 438 |
| 1007 | 3300041456 | Ga0451795_0707270 | Ga0451795_0707270_74_1399 | 438 |
| 1008 | 3300046460 | Ga0495638_0000613 | Ga0495638_0000613_24319_25641 | 438 |
| 1009 | 3300046471 | Ga0495650_0004694 | Ga0495650_0004694_4632_5966 | 438 |
| 1010 | 3300046528 | Ga0495642_0029966 | Ga0495642_0029966_824_2140 | 438 |
| 1011 | 3300046660 | Ga0495625_0013497 | Ga0495625_0013497_1553_2875 | 438 |
| 1012 | 3300046660 | Ga0495625_0047436 | Ga0495625_0047436_526_1848 | 438 |
| 1013 | 3300047472 | Ga0495686_0016988 | Ga0495686_0016988_277_1599 | 438 |
| 1014 | 3300047472 | Ga0495686_0040060 | Ga0495686_0040060_1511_2902 | 438 |
| 1015 | 3300048918 | Ga0496115_0017296 | Ga0496115_0017296_4101_5447 | 438 |
| 1016 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_47653_48984 | 438 |
| 1017 | 3300048924 | Ga0496121_0015763 | Ga0496121_0015763_598_1920 | 438 |
| 1018 | 3300048928 | Ga0496125_0096407 | Ga0496125_0096407_246_1616 | 438 |
| 1019 | 3300049513 | Ga0501290_000033 | Ga0501290_000033_15412_16731 | 438 |
| 1020 | 3300049515 | Ga0501292_000026 | Ga0501292_000026_18774_20093 | 438 |
| 1021 | 3300049517 | Ga0501294_000779 | Ga0501294_000779_245_1564 | 438 |
| 1022 | 3300049523 | Ga0501300_005984 | Ga0501300_005984_110_1429 | 438 |
| 1023 | 3300049571 | Ga0501034_0026896 | Ga0501034_0026896_2934_4349 | 438 |
| 1024 | 3300049581 | Ga0501047_0007181 | Ga0501047_0007181_6901_8316 | 438 |
| 1025 | 3300049589 | Ga0501073_0005548 | Ga0501073_0005548_5163_6578 | 438 |
| 1026 | 3300049662 | Ga0501222_000709 | Ga0501222_000709_522_1841 | 438 |
| 1027 | 3300049663 | Ga0501223_009167 | Ga0501223_009167_172_1491 | 438 |
| 1028 | 3300049668 | Ga0501233_006677 | Ga0501233_006677_370_1689 | 438 |
| 1029 | 3300049690 | Ga0501261_000055 | Ga0501261_000055_16090_17409 | 438 |
| 1030 | 3300049742 | Ga0501080_0001583 | Ga0501080_0001583_17079_18494 | 438 |
| 1031 | 3300049744 | Ga0501083_0007263 | Ga0501083_0007263_4051_5466 | 438 |
| 1032 | 3300049775 | Ga0501279_000027 | Ga0501279_000027_510_1829 | 438 |
| 1033 | 3300049776 | Ga0501280_000543 | Ga0501280_000543_1080_2399 | 438 |
| 1034 | 3300049777 | Ga0501281_00070 | Ga0501281_00070_6396_7715 | 438 |
| 1035 | 3300049779 | Ga0501283_001097 | Ga0501283_001097_434_1753 | 438 |
| 1036 | 3300049822 | Ga0501035_0133714 | Ga0501035_0133714_38_1453 | 438 |
| 1037 | 3300049823 | Ga0501044_0019159 | Ga0501044_0019159_4246_5661 | 438 |
| 1038 | 3300050490 | nmdc:mga03n38_38213_c1 | nmdc:mga03n38_38213_c1_308_1684 | 438 |
| 1039 | 3300050491 | nmdc:mga00v17_481_c1 | nmdc:mga00v17_481_c1_10772_12127 | 438 |
| 1040 | 3300050493 | nmdc:mga0k408_87211_c1 | nmdc:mga0k408_87211_c1_212_1567 | 438 |
| 1041 | 3300050494 | nmdc:mga06z11_4155_c1 | nmdc:mga06z11_4155_c1_902_2257 | 438 |
| 1042 | 3300050495 | nmdc:mga04h51_1548_c1 | nmdc:mga04h51_1548_c1_1289_2644 | 438 |
| 1043 | 3300050495 | nmdc:mga04h51_879_c1 | nmdc:mga04h51_879_c1_3491_4867 | 438 |
| 1044 | 3300050511 | nmdc:mga08y16_52472_c1 | nmdc:mga08y16_52472_c1_1207_2589 | 438 |
| 1045 | 3300053134 | Ga0500658_0000225 | Ga0500658_0000225_24464_25786 | 438 |
| 1046 | 3300060353 | Ga0501082_0007636 | Ga0501082_0007636_1924_3339 | 438 |
| 1047 | iso_pu_bacteria | 2523231067 | 2523466790 | 438 |
| 1048 | iso_pu_bacteria | 2738543031 | 2739351006 | 438 |
| 1049 | iso_pu_bacteria | 2739367756 | 2739792758 | 438 |
| 1050 | iso_pu_bacteria | 2844533157 | 2844537473 | 438 |
| 1051 | 3300005544 | Ga0070686_100000152 | Ga0070686_10000015223 | 439 |
| 1052 | 3300009098 | Ga0105245_10028937 | Ga0105245_100289377 | 439 |
| 1053 | 3300021384 | Ga0213876_10088540 | Ga0213876_100885402 | 439 |
| 1054 | 3300028786 | Ga0307517_10004144 | Ga0307517_100041443 | 439 |
| 1055 | 3300031456 | Ga0307513_10004370 | Ga0307513_100043704 | 439 |
| 1056 | 3300039437 | Ga0436365_0616457 | Ga0436365_0616457_9063_10382 | 439 |
| 1057 | 3300039437 | Ga0436365_1574866 | Ga0436365_1574866_1822_3207 | 439 |
| 1058 | 3300042142 | Ga0450905_003894 | Ga0450905_003894_463_1797 | 439 |
| 1059 | 3300049570 | Ga0501033_0107904 | Ga0501033_0107904_498_1877 | 439 |
| 1060 | 3300049823 | Ga0501044_0013907 | Ga0501044_0013907_1182_2612 | 439 |
| 1061 | 3300053125 | Ga0500618_002790 | Ga0500618_002790_3342_4676 | 439 |
| 1062 | iso_pu_bacteria | 2643221560 | 2643821161 | 439 |
| 1063 | iso_pu_bacteria | 2643221563 | 2643832720 | 439 |
| 1064 | iso_pu_bacteria | 2643221606 | 2644045836 | 439 |
| 1065 | iso_pu_bacteria | 2643221608 | 2644053485 | 439 |
| 1066 | iso_pu_bacteria | 2643221671 | 2644393413 | 439 |
| 1067 | iso_pu_bacteria | 2941485952 | 2941488108 | 439 |
| 1068 | 3300005336 | Ga0070680_100000705 | Ga0070680_10000070516 | 440 |
| 1069 | 3300005339 | Ga0070660_100000197 | Ga0070660_10000019726 | 440 |
| 1070 | 3300005347 | Ga0070668_100028298 | Ga0070668_1000282983 | 440 |
| 1071 | 3300005366 | Ga0070659_100075209 | Ga0070659_1000752092 | 440 |
| 1072 | 3300005563 | Ga0068855_100020437 | Ga0068855_1000204372 | 440 |
| 1073 | 3300006177 | Ga0075362_10000119 | Ga0075362_1000011915 | 440 |
| 1074 | 3300006186 | Ga0075369_10001089 | Ga0075369_100010899 | 440 |
| 1075 | 3300006195 | Ga0075366_10000014 | Ga0075366_1000001441 | 440 |
| 1076 | 3300025919 | Ga0207657_10001791 | Ga0207657_1000179118 | 440 |
| 1077 | 3300025932 | Ga0207690_10003702 | Ga0207690_1000370211 | 440 |
| 1078 | 3300025949 | Ga0207667_10002049 | Ga0207667_100020498 | 440 |
| 1079 | 3300025972 | Ga0207668_10021931 | Ga0207668_100219313 | 440 |
| 1080 | 3300037471 | Ga0395905_0000108 | Ga0395905_0000108_40342_41709 | 440 |
| 1081 | 3300047472 | Ga0495686_0003469 | Ga0495686_0003469_6406_7773 | 440 |
| 1082 | 3300048922 | Ga0496119_0016109 | Ga0496119_0016109_3014_4366 | 440 |
| 1083 | 3300049571 | Ga0501034_0154648 | Ga0501034_0154648_881_2203 | 440 |
| 1084 | 3300049581 | Ga0501047_0014549 | Ga0501047_0014549_136_1569 | 440 |
| 1085 | 3300050496 | nmdc:mga07m45_3_c1 | nmdc:mga07m45_3_c1_100701_102080 | 440 |
| 1086 | 3300053087 | Ga0500643_001378 | Ga0500643_001378_10313_11707 | 440 |
| 1087 | 3300053093 | Ga0500651_0023648 | Ga0500651_0023648_720_2207 | 440 |
| 1088 | iso_pu_bacteria | 2643221574 | 2643882176 | 440 |
| 1089 | iso_pu_bacteria | 2643221699 | 2644547802 | 440 |
| 1090 | iso_pu_bacteria | 2808606401 | 2809061877 | 440 |
| 1091 | iso_pu_bacteria | 2808606404 | 2809077841 | 440 |
| 1092 | iso_pu_bacteria | 2808606405 | 2809082451 | 440 |
| 1093 | iso_pu_bacteria | 2818991438 | 2819551350 | 440 |
| 1094 | iso_pu_bacteria | 2919709256 | 2919711128 | 440 |
| 1095 | iso_pu_bacteria | 2928972540 | 2928973439 | 440 |
| 1096 | iso_pu_bacteria | 2977240413 | 2977240583 | 440 |
| 1097 | 3300005563 | Ga0068855_100002675 | Ga0068855_10000267513 | 441 |
| 1098 | 3300006847 | Ga0075431_100002734 | Ga0075431_10000273412 | 441 |
| 1099 | 3300009177 | Ga0105248_10006314 | Ga0105248_1000631410 | 441 |
| 1100 | 3300011119 | Ga0105246_10000589 | Ga0105246_100005891 | 441 |
| 1101 | 3300013100 | Ga0157373_10002751 | Ga0157373_100027512 | 441 |
| 1102 | 3300014326 | Ga0157380_10051725 | Ga0157380_100517253 | 441 |
| 1103 | 3300025933 | Ga0207706_10010885 | Ga0207706_100108854 | 441 |
| 1104 | 3300025949 | Ga0207667_10012946 | Ga0207667_1001294611 | 441 |
| 1105 | 3300032004 | Ga0307414_10039436 | Ga0307414_100394363 | 441 |
| 1106 | 3300032133 | Ga0316583_10001134 | Ga0316583_100011343 | 441 |
| 1107 | 3300037853 | Ga0436364_0582923 | Ga0436364_0582923_363_1751 | 441 |
| 1108 | 3300039450 | Ga0436363_0707542 | Ga0436363_0707542_265_1653 | 441 |
| 1109 | 3300046522 | Ga0495643_0026530 | Ga0495643_0026530_1233_2573 | 441 |
| 1110 | 3300046616 | Ga0495668_0032711 | Ga0495668_0032711_830_2170 | 441 |
| 1111 | 3300046694 | Ga0495649_0000118 | Ga0495649_0000118_35018_36439 | 441 |
| 1112 | 3300048927 | Ga0496124_0102508 | Ga0496124_0102508_778_2190 | 441 |
| 1113 | 3300048928 | Ga0496125_0019180 | Ga0496125_0019180_3309_4649 | 441 |
| 1114 | 3300049568 | Ga0501031_0127692 | Ga0501031_0127692_55_1392 | 441 |
| 1115 | 3300049570 | Ga0501033_0086258 | Ga0501033_0086258_124_1461 | 441 |
| 1116 | 3300049572 | Ga0501036_0019184 | Ga0501036_0019184_4231_5568 | 441 |
| 1117 | 3300049574 | Ga0501038_0010812 | Ga0501038_0010812_1432_2769 | 441 |
| 1118 | 3300049581 | Ga0501047_0057512 | Ga0501047_0057512_1962_3299 | 441 |
| 1119 | 3300049823 | Ga0501044_0093564 | Ga0501044_0093564_1454_2791 | 441 |
| 1120 | 3300050509 | nmdc:mga0qj67_10678_c1 | nmdc:mga0qj67_10678_c1_1256_2581 | 441 |
| 1121 | 3300050510 | nmdc:mga06r32_5383_c1 | nmdc:mga06r32_5383_c1_3775_5106 | 441 |
| 1122 | 3300053116 | Ga0500592_002384 | Ga0500592_002384_505_1845 | 441 |
| 1123 | 3300053125 | Ga0500618_004364 | Ga0500618_004364_694_2034 | 441 |
| 1124 | 3300053177 | Ga0500636_0007932 | Ga0500636_0007932_267_1682 | 441 |
| 1125 | iso_pu_bacteria | 2643221663 | 2644351344 | 441 |
| 1126 | iso_pu_bacteria | 2643221699 | 2644549109 | 441 |
| 1127 | iso_pu_bacteria | 2882806704 | 2882807298 | 441 |
| 1128 | iso_pu_bacteria | 2896184354 | 2896185306 | 441 |
| 1129 | iso_pu_bacteria | 2896253425 | 2896255696 | 441 |
| 1130 | 3300005367 | Ga0070667_100005409 | Ga0070667_1000054098 | 442 |
| 1131 | 3300005548 | Ga0070665_100025272 | Ga0070665_1000252726 | 442 |
| 1132 | 3300005563 | Ga0068855_100014465 | Ga0068855_1000144653 | 442 |
| 1133 | 3300005563 | Ga0068855_100036162 | Ga0068855_1000361625 | 442 |
| 1134 | 3300005616 | Ga0068852_100000142 | Ga0068852_10000014232 | 442 |
| 1135 | 3300005618 | Ga0068864_100054564 | Ga0068864_1000545642 | 442 |
| 1136 | 3300005841 | Ga0068863_100004185 | Ga0068863_10000418510 | 442 |
| 1137 | 3300005843 | Ga0068860_100008925 | Ga0068860_1000089254 | 442 |
| 1138 | 3300009011 | Ga0105251_10018337 | Ga0105251_100183372 | 442 |
| 1139 | 3300013102 | Ga0157371_10006522 | Ga0157371_100065224 | 442 |
| 1140 | 3300013105 | Ga0157369_10071265 | Ga0157369_100712654 | 442 |
| 1141 | 3300025294 | Ga0209025_1000179 | Ga0209025_1000179121 | 442 |
| 1142 | 3300025949 | Ga0207667_10030277 | Ga0207667_100302776 | 442 |
| 1143 | 3300025949 | Ga0207667_10030986 | Ga0207667_100309863 | 442 |
| 1144 | 3300026088 | Ga0207641_10005156 | Ga0207641_100051569 | 442 |
| 1145 | 3300026116 | Ga0207674_10032601 | Ga0207674_100326018 | 442 |
| 1146 | 3300028379 | Ga0268266_10027675 | Ga0268266_100276752 | 442 |
| 1147 | 3300028381 | Ga0268264_10000253 | Ga0268264_10000253116 | 442 |
| 1148 | 3300031911 | Ga0307412_10014753 | Ga0307412_100147533 | 442 |
| 1149 | 3300032004 | Ga0307414_10003221 | Ga0307414_100032219 | 442 |
| 1150 | 3300048919 | Ga0496116_0030724 | Ga0496116_0030724_2022_3440 | 442 |
| 1151 | 3300048928 | Ga0496125_0001397 | Ga0496125_0001397_19224_20642 | 442 |
| 1152 | 3300049571 | Ga0501034_0006655 | Ga0501034_0006655_716_2062 | 442 |
| 1153 | 3300049686 | Ga0501257_000040 | Ga0501257_000040_2814_4145 | 442 |
| 1154 | 3300049776 | Ga0501280_001354 | Ga0501280_001354_2140_3471 | 442 |
| 1155 | 3300003781 | Ga0055536_1017767 | Ga0055536_10177671 | 443 |
| 1156 | 3300005295 | Ga0065707_10081814 | Ga0065707_100818148 | 443 |
| 1157 | 3300005327 | Ga0070658_10002923 | Ga0070658_1000292311 | 443 |
| 1158 | 3300005327 | Ga0070658_10032050 | Ga0070658_100320504 | 443 |
| 1159 | 3300005353 | Ga0070669_100072327 | Ga0070669_1000723273 | 443 |
| 1160 | 3300005455 | Ga0070663_100106107 | Ga0070663_1001061072 | 443 |
| 1161 | 3300005457 | Ga0070662_100010097 | Ga0070662_1000100978 | 443 |
| 1162 | 3300005457 | Ga0070662_100036012 | Ga0070662_1000360122 | 443 |
| 1163 | 3300005530 | Ga0070679_100002011 | Ga0070679_1000020113 | 443 |
| 1164 | 3300005578 | Ga0068854_100002421 | Ga0068854_1000024218 | 443 |
| 1165 | 3300005614 | Ga0068856_100017510 | Ga0068856_1000175103 | 443 |
| 1166 | 3300005616 | Ga0068852_100000824 | Ga0068852_10000082421 | 443 |
| 1167 | 3300005618 | Ga0068864_100007684 | Ga0068864_1000076846 | 443 |
| 1168 | 3300005842 | Ga0068858_100131951 | Ga0068858_1001319511 | 443 |
| 1169 | 3300006177 | Ga0075362_10027389 | Ga0075362_100273892 | 443 |
| 1170 | 3300009093 | Ga0105240_10004776 | Ga0105240_1000477614 | 443 |
| 1171 | 3300009551 | Ga0105238_10017709 | Ga0105238_100177098 | 443 |
| 1172 | 3300009551 | Ga0105238_10035809 | Ga0105238_100358093 | 443 |
| 1173 | 3300025291 | Ga0209675_1000384 | Ga0209675_10003842 | 443 |
| 1174 | 3300025292 | Ga0209676_1000421 | Ga0209676_100042127 | 443 |
| 1175 | 3300025292 | Ga0209676_1000693 | Ga0209676_100069321 | 443 |
| 1176 | 3300025292 | Ga0209676_1001736 | Ga0209676_100173614 | 443 |
| 1177 | 3300025298 | Ga0209050_1000112 | Ga0209050_100011234 | 443 |
| 1178 | 3300025298 | Ga0209050_1006747 | Ga0209050_10067473 | 443 |
| 1179 | 3300025304 | Ga0209257_1000600 | Ga0209257_100060028 | 443 |
| 1180 | 3300025304 | Ga0209257_1000877 | Ga0209257_100087718 | 443 |
| 1181 | 3300025909 | Ga0207705_10000621 | Ga0207705_100006213 | 443 |
| 1182 | 3300025913 | Ga0207695_10003649 | Ga0207695_1000364919 | 443 |
| 1183 | 3300025921 | Ga0207652_10003184 | Ga0207652_1000318416 | 443 |
| 1184 | 3300025921 | Ga0207652_10097333 | Ga0207652_100973332 | 443 |
| 1185 | 3300025924 | Ga0207694_10054264 | Ga0207694_100542642 | 443 |
| 1186 | 3300025933 | Ga0207706_10011982 | Ga0207706_100119825 | 443 |
| 1187 | 3300025933 | Ga0207706_10027411 | Ga0207706_100274113 | 443 |
| 1188 | 3300025945 | Ga0207679_10031822 | Ga0207679_100318224 | 443 |
| 1189 | 3300025949 | Ga0207667_10151577 | Ga0207667_101515772 | 443 |
| 1190 | 3300025981 | Ga0207640_10006960 | Ga0207640_100069606 | 443 |
| 1191 | 3300026067 | Ga0207678_10066353 | Ga0207678_100663533 | 443 |
| 1192 | 3300026078 | Ga0207702_10014676 | Ga0207702_100146767 | 443 |
| 1193 | 3300026088 | Ga0207641_10000243 | Ga0207641_1000024332 | 443 |
| 1194 | 3300026095 | Ga0207676_10026183 | Ga0207676_100261832 | 443 |
| 1195 | 3300026116 | Ga0207674_10038271 | Ga0207674_100382712 | 443 |
| 1196 | 3300026142 | Ga0207698_10000005 | Ga0207698_10000005267 | 443 |
| 1197 | 3300026142 | Ga0207698_10014031 | Ga0207698_100140312 | 443 |
| 1198 | 3300031548 | Ga0307408_100245674 | Ga0307408_1002456741 | 443 |
| 1199 | 3300031731 | Ga0307405_10011232 | Ga0307405_100112322 | 443 |
| 1200 | 3300031824 | Ga0307413_10029026 | Ga0307413_100290263 | 443 |
| 1201 | 3300031852 | Ga0307410_10015739 | Ga0307410_100157392 | 443 |
| 1202 | 3300031995 | Ga0307409_100109153 | Ga0307409_1001091532 | 443 |
| 1203 | 3300032004 | Ga0307414_10001083 | Ga0307414_1000108317 | 443 |
| 1204 | 3300032004 | Ga0307414_10007076 | Ga0307414_100070764 | 443 |
| 1205 | 3300032004 | Ga0307414_10044478 | Ga0307414_100444783 | 443 |
| 1206 | 3300032004 | Ga0307414_10235506 | Ga0307414_102355062 | 443 |
| 1207 | 3300046512 | Ga0495610_0010540 | Ga0495610_0010540_603_2009 | 443 |
| 1208 | 3300046522 | Ga0495643_0000014 | Ga0495643_0000014_55609_56967 | 443 |
| 1209 | 3300046558 | Ga0495633_0000400 | Ga0495633_0000400_11633_13090 | 443 |
| 1210 | 3300046616 | Ga0495668_0003831 | Ga0495668_0003831_7878_9224 | 443 |
| 1211 | 3300046660 | Ga0495625_0000339 | Ga0495625_0000339_16442_17824 | 443 |
| 1212 | 3300046692 | Ga0495671_0000058 | Ga0495671_0000058_55609_56967 | 443 |
| 1213 | 3300047470 | Ga0495681_0030101 | Ga0495681_0030101_73_1431 | 443 |
| 1214 | 3300048905 | Ga0496102_0000049 | Ga0496102_0000049_77884_79227 | 443 |
| 1215 | 3300048906 | Ga0496103_0000037 | Ga0496103_0000037_100248_101591 | 443 |
| 1216 | 3300048919 | Ga0496116_0001001 | Ga0496116_0001001_29017_30360 | 443 |
| 1217 | 3300048920 | Ga0496117_0000115 | Ga0496117_0000115_77884_79227 | 443 |
| 1218 | 3300048920 | Ga0496117_0029261 | Ga0496117_0029261_2612_3961 | 443 |
| 1219 | 3300048921 | Ga0496118_0000086 | Ga0496118_0000086_100262_101605 | 443 |
| 1220 | 3300048921 | Ga0496118_0023332 | Ga0496118_0023332_3859_5208 | 443 |
| 1221 | 3300048925 | Ga0496122_0003299 | Ga0496122_0003299_2959_4395 | 443 |
| 1222 | 3300048926 | Ga0496123_0000968 | Ga0496123_0000968_38835_40331 | 443 |
| 1223 | 3300048927 | Ga0496124_0000102 | Ga0496124_0000102_100262_101605 | 443 |
| 1224 | 3300048928 | Ga0496125_0026259 | Ga0496125_0026259_1742_3085 | 443 |
| 1225 | 3300049571 | Ga0501034_0179597 | Ga0501034_0179597_609_2027 | 443 |
| 1226 | 3300049579 | Ga0501043_0156785 | Ga0501043_0156785_372_1721 | 443 |
| 1227 | 3300049581 | Ga0501047_0001118 | Ga0501047_0001118_25212_26561 | 443 |
| 1228 | 3300049663 | Ga0501223_000012 | Ga0501223_000012_27647_28996 | 443 |
| 1229 | 3300053087 | Ga0500643_013280 | Ga0500643_013280_1139_2482 | 443 |
| 1230 | 3300053104 | Ga0500556_0000044 | Ga0500556_0000044_15186_16529 | 443 |
| 1231 | 3300053108 | Ga0500562_001461 | Ga0500562_001461_1794_3143 | 443 |
| 1232 | 3300053116 | Ga0500592_000323 | Ga0500592_000323_206_1552 | 443 |
| 1233 | 3300053116 | Ga0500592_001827 | Ga0500592_001827_898_2235 | 443 |
| 1234 | 3300053130 | Ga0500642_0000008 | Ga0500642_0000008_225493_226836 | 443 |
| 1235 | 3300053139 | Ga0500568_0001920 | Ga0500568_0001920_4297_5634 | 443 |
| 1236 | 3300053157 | Ga0500624_000130 | Ga0500624_000130_4065_5414 | 443 |
| 1237 | 3300053158 | Ga0500627_0000006 | Ga0500627_0000006_147668_149005 | 443 |
| 1238 | 3300053730 | Ga0500645_002292 | Ga0500645_002292_3515_4858 | 443 |
| 1239 | 3300001976 | JGI24752J21851_1005100 | JGI24752J21851_10051002 | 444 |
| 1240 | 3300002459 | JGI24751J29686_10000118 | JGI24751J29686_1000011821 | 444 |
| 1241 | 3300003781 | Ga0055536_1000781 | Ga0055536_100078116 | 444 |
| 1242 | 3300005331 | Ga0070670_100007458 | Ga0070670_1000074589 | 444 |
| 1243 | 3300005331 | Ga0070670_100030976 | Ga0070670_1000309762 | 444 |
| 1244 | 3300005335 | Ga0070666_10000408 | Ga0070666_1000040812 | 444 |
| 1245 | 3300005347 | Ga0070668_100013147 | Ga0070668_1000131473 | 444 |
| 1246 | 3300005353 | Ga0070669_100000109 | Ga0070669_10000010942 | 444 |
| 1247 | 3300005355 | Ga0070671_100000020 | Ga0070671_10000002042 | 444 |
| 1248 | 3300005355 | Ga0070671_100009247 | Ga0070671_1000092472 | 444 |
| 1249 | 3300005355 | Ga0070671_100068538 | Ga0070671_1000685382 | 444 |
| 1250 | 3300005367 | Ga0070667_100001088 | Ga0070667_10000108818 | 444 |
| 1251 | 3300005548 | Ga0070665_100000878 | Ga0070665_10000087832 | 444 |
| 1252 | 3300005617 | Ga0068859_100000452 | Ga0068859_1000004526 | 444 |
| 1253 | 3300005719 | Ga0068861_100001980 | Ga0068861_10000198012 | 444 |
| 1254 | 3300005841 | Ga0068863_100011189 | Ga0068863_1000111899 | 444 |
| 1255 | 3300005841 | Ga0068863_100131813 | Ga0068863_1001318132 | 444 |
| 1256 | 3300005842 | Ga0068858_100001141 | Ga0068858_1000011418 | 444 |
| 1257 | 3300005842 | Ga0068858_100195628 | Ga0068858_1001956282 | 444 |
| 1258 | 3300005843 | Ga0068860_100002654 | Ga0068860_1000026548 | 444 |
| 1259 | 3300005843 | Ga0068860_100021477 | Ga0068860_1000214772 | 444 |
| 1260 | 3300005843 | Ga0068860_100041470 | Ga0068860_1000414702 | 444 |
| 1261 | 3300005844 | Ga0068862_100015404 | Ga0068862_1000154042 | 444 |
| 1262 | 3300005844 | Ga0068862_100031339 | Ga0068862_1000313392 | 444 |
| 1263 | 3300006051 | Ga0075364_10001169 | Ga0075364_100011696 | 444 |
| 1264 | 3300006175 | Ga0070712_100167572 | Ga0070712_1001675722 | 444 |
| 1265 | 3300006177 | Ga0075362_10030269 | Ga0075362_100302692 | 444 |
| 1266 | 3300006353 | Ga0075370_10002146 | Ga0075370_100021465 | 444 |
| 1267 | 3300006931 | Ga0097620_100000452 | Ga0097620_1000004526 | 444 |
| 1268 | 3300009177 | Ga0105248_10004550 | Ga0105248_1000455014 | 444 |
| 1269 | 3300009553 | Ga0105249_10001111 | Ga0105249_1000111120 | 444 |
| 1270 | 3300013306 | Ga0163162_10012113 | Ga0163162_100121139 | 444 |
| 1271 | 3300014326 | Ga0157380_10082902 | Ga0157380_100829022 | 444 |
| 1272 | 3300014968 | Ga0157379_10005111 | Ga0157379_1000511111 | 444 |
| 1273 | 3300025292 | Ga0209676_1000140 | Ga0209676_100014094 | 444 |
| 1274 | 3300025298 | Ga0209050_1000254 | Ga0209050_100025491 | 444 |
| 1275 | 3300025304 | Ga0209257_1000630 | Ga0209257_10006306 | 444 |
| 1276 | 3300025315 | Ga0207697_10000375 | Ga0207697_100003758 | 444 |
| 1277 | 3300025900 | Ga0207710_10005667 | Ga0207710_100056673 | 444 |
| 1278 | 3300025903 | Ga0207680_10002355 | Ga0207680_100023559 | 444 |
| 1279 | 3300025914 | Ga0207671_10004168 | Ga0207671_100041686 | 444 |
| 1280 | 3300025923 | Ga0207681_10000042 | Ga0207681_10000042129 | 444 |
| 1281 | 3300025931 | Ga0207644_10000034 | Ga0207644_1000003442 | 444 |
| 1282 | 3300025931 | Ga0207644_10002034 | Ga0207644_100020347 | 444 |
| 1283 | 3300025941 | Ga0207711_10024234 | Ga0207711_100242344 | 444 |
| 1284 | 3300025961 | Ga0207712_10002229 | Ga0207712_100022297 | 444 |
| 1285 | 3300025972 | Ga0207668_10000668 | Ga0207668_1000066820 | 444 |
| 1286 | 3300025986 | Ga0207658_10001929 | Ga0207658_1000192910 | 444 |
| 1287 | 3300025986 | Ga0207658_10006621 | Ga0207658_100066214 | 444 |
| 1288 | 3300026035 | Ga0207703_10016909 | Ga0207703_100169092 | 444 |
| 1289 | 3300026088 | Ga0207641_10011979 | Ga0207641_100119794 | 444 |
| 1290 | 3300026088 | Ga0207641_10021125 | Ga0207641_100211256 | 444 |
| 1291 | 3300026118 | Ga0207675_100000225 | Ga0207675_10000022519 | 444 |
| 1292 | 3300028379 | Ga0268266_10001045 | Ga0268266_1000104529 | 444 |
| 1293 | 3300028379 | Ga0268266_10046135 | Ga0268266_100461352 | 444 |
| 1294 | 3300028380 | Ga0268265_10000043 | Ga0268265_1000004376 | 444 |
| 1295 | 3300028380 | Ga0268265_10080763 | Ga0268265_100807632 | 444 |
| 1296 | 3300028381 | Ga0268264_10000154 | Ga0268264_1000015434 | 444 |
| 1297 | 3300028381 | Ga0268264_10003985 | Ga0268264_1000398510 | 444 |
| 1298 | 3300028381 | Ga0268264_10083068 | Ga0268264_100830682 | 444 |
| 1299 | 3300031691 | Ga0316579_10012348 | Ga0316579_100123484 | 444 |
| 1300 | 3300031901 | Ga0307406_10020684 | Ga0307406_100206844 | 444 |
| 1301 | 3300031995 | Ga0307409_100091403 | Ga0307409_1000914033 | 444 |
| 1302 | 3300032004 | Ga0307414_10049975 | Ga0307414_100499753 | 444 |
| 1303 | 3300032004 | Ga0307414_10081483 | Ga0307414_100814832 | 444 |
| 1304 | 3300046453 | Ga0495627_000230 | Ga0495627_000230_8496_9830 | 444 |
| 1305 | 3300046471 | Ga0495650_0000926 | Ga0495650_0000926_27195_28529 | 444 |
| 1306 | 3300046500 | Ga0495596_0000314 | Ga0495596_0000314_5677_7026 | 444 |
| 1307 | 3300046500 | Ga0495596_0001189 | Ga0495596_0001189_11899_13233 | 444 |
| 1308 | 3300046501 | Ga0495607_0023019 | Ga0495607_0023019_1822_3156 | 444 |
| 1309 | 3300046512 | Ga0495610_0000031 | Ga0495610_0000031_116094_117428 | 444 |
| 1310 | 3300046512 | Ga0495610_0002416 | Ga0495610_0002416_2923_4272 | 444 |
| 1311 | 3300046519 | Ga0495632_0001835 | Ga0495632_0001835_9815_11149 | 444 |
| 1312 | 3300046522 | Ga0495643_0008243 | Ga0495643_0008243_1787_3121 | 444 |
| 1313 | 3300046530 | Ga0495654_0043994 | Ga0495654_0043994_81_1442 | 444 |
| 1314 | 3300046538 | Ga0495609_0002848 | Ga0495609_0002848_1071_2405 | 444 |
| 1315 | 3300046557 | Ga0495622_0070321 | Ga0495622_0070321_194_1555 | 444 |
| 1316 | 3300046692 | Ga0495671_0064432 | Ga0495671_0064432_175_1536 | 444 |
| 1317 | 3300047470 | Ga0495681_0000211 | Ga0495681_0000211_20077_21411 | 444 |
| 1318 | 3300048091 | Ga0495626_0000139 | Ga0495626_0000139_23518_24867 | 444 |
| 1319 | 3300048904 | Ga0496101_0056532 | Ga0496101_0056532_310_1644 | 444 |
| 1320 | 3300048919 | Ga0496116_0000045 | Ga0496116_0000045_232631_233965 | 444 |
| 1321 | 3300048920 | Ga0496117_0070924 | Ga0496117_0070924_386_1720 | 444 |
| 1322 | 3300048921 | Ga0496118_0016614 | Ga0496118_0016614_5223_6602 | 444 |
| 1323 | 3300048921 | Ga0496118_0119716 | Ga0496118_0119716_50_1414 | 444 |
| 1324 | 3300048924 | Ga0496121_0000136 | Ga0496121_0000136_39018_40397 | 444 |
| 1325 | 3300048924 | Ga0496121_0000671 | Ga0496121_0000671_8556_9920 | 444 |
| 1326 | 3300048924 | Ga0496121_0001923 | Ga0496121_0001923_25719_27053 | 444 |
| 1327 | 3300048924 | Ga0496121_0014630 | Ga0496121_0014630_1900_3234 | 444 |
| 1328 | 3300048925 | Ga0496122_0000216 | Ga0496122_0000216_97739_99097 | 444 |
| 1329 | 3300048925 | Ga0496122_0030555 | Ga0496122_0030555_30_1364 | 444 |
| 1330 | 3300048926 | Ga0496123_0000233 | Ga0496123_0000233_97797_99155 | 444 |
| 1331 | 3300048926 | Ga0496123_0000785 | Ga0496123_0000785_26474_27808 | 444 |
| 1332 | 3300048927 | Ga0496124_0009450 | Ga0496124_0009450_344_1678 | 444 |
| 1333 | 3300048927 | Ga0496124_0110382 | Ga0496124_0110382_81_1415 | 444 |
| 1334 | 3300048928 | Ga0496125_0008737 | Ga0496125_0008737_3813_5147 | 444 |
| 1335 | 3300048928 | Ga0496125_0015787 | Ga0496125_0015787_1091_2437 | 444 |
| 1336 | 3300048929 | Ga0496126_0001266 | Ga0496126_0001266_34760_36094 | 444 |
| 1337 | 3300048929 | Ga0496126_0015056 | Ga0496126_0015056_951_2315 | 444 |
| 1338 | 3300048929 | Ga0496126_0022090 | Ga0496126_0022090_4484_5842 | 444 |
| 1339 | 3300049823 | Ga0501044_0000826 | Ga0501044_0000826_16340_17674 | 444 |
| 1340 | 3300050489 | nmdc:mga03683_3999_c1 | nmdc:mga03683_3999_c1_1782_3116 | 444 |
| 1341 | 3300050491 | nmdc:mga00v17_687_c1 | nmdc:mga00v17_687_c1_13071_14405 | 444 |
| 1342 | 3300050496 | nmdc:mga07m45_1567_c1 | nmdc:mga07m45_1567_c1_5148_6485 | 444 |
| 1343 | 3300050496 | nmdc:mga07m45_48438_c1 | nmdc:mga07m45_48438_c1_786_2132 | 444 |
| 1344 | 3300053087 | Ga0500643_000821 | Ga0500643_000821_13337_14689 | 444 |
| 1345 | 3300053118 | Ga0500594_0002743 | Ga0500594_0002743_168_1529 | 444 |
| 1346 | 3300053119 | Ga0500595_013172 | Ga0500595_013172_310_1647 | 444 |
| 1347 | 3300053121 | Ga0500607_000107 | Ga0500607_000107_10625_12040 | 444 |
| 1348 | 3300053121 | Ga0500607_101417 | Ga0500607_101417_69_1418 | 444 |
| 1349 | 3300053136 | Ga0500559_0001513 | Ga0500559_0001513_10121_11536 | 444 |
| 1350 | 3300053151 | Ga0500604_0015267 | Ga0500604_0015267_16_1362 | 444 |
| 1351 | 3300053730 | Ga0500645_017119 | Ga0500645_017119_676_2022 | 444 |
| 1352 | iso_pu_bacteria | 2510917021 | 2511130846 | 444 |
| 1353 | iso_pu_bacteria | 2919138771 | 2919141343 | 444 |
| 1354 | iso_pu_bacteria | 8054302542 | 8054307400 | 444 |
| 1355 | 3300005335 | Ga0070666_10011967 | Ga0070666_100119672 | 445 |
| 1356 | 3300005353 | Ga0070669_100000620 | Ga0070669_10000062018 | 445 |
| 1357 | 3300005355 | Ga0070671_100000062 | Ga0070671_10000006270 | 445 |
| 1358 | 3300005842 | Ga0068858_100054189 | Ga0068858_1000541892 | 445 |
| 1359 | 3300009177 | Ga0105248_10036168 | Ga0105248_100361686 | 445 |
| 1360 | 3300013102 | Ga0157371_10024127 | Ga0157371_100241271 | 445 |
| 1361 | 3300025923 | Ga0207681_10000558 | Ga0207681_1000055817 | 445 |
| 1362 | 3300025931 | Ga0207644_10000005 | Ga0207644_1000000595 | 445 |
| 1363 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_433669_435057 | 445 |
| 1364 | 3300048905 | Ga0496102_0309549 | Ga0496102_0309549_111_1451 | 445 |
| 1365 | 3300048916 | Ga0496113_0036227 | Ga0496113_0036227_440_1780 | 445 |
| 1366 | 3300049573 | Ga0501037_0164605 | Ga0501037_0164605_118_1461 | 445 |
| 1367 | 3300049823 | Ga0501044_0152650 | Ga0501044_0152650_895_2238 | 445 |
| 1368 | 2162886007 | SwRhRL2b_contig_1584582 | SwRhRL2b_0526.00004000 | 448 |
| 1369 | 3300005289 | Ga0065704_10000204 | Ga0065704_10000204210 | 448 |
| 1370 | 3300005843 | Ga0068860_100024619 | Ga0068860_1000246192 | 448 |
| 1371 | 3300028381 | Ga0268264_10014571 | Ga0268264_100145713 | 448 |
| 1372 | 3300048909 | Ga0496106_0003336 | Ga0496106_0003336_3227_4612 | 448 |
| 1373 | 3300053153 | Ga0500616_0023122 | Ga0500616_0023122_1666_3024 | 448 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mjx-assembly1.cif.gz_A | miab in the complex with 5'-deoxyadenosine, methionine and rna | 0.943 | 7 | 443 |
| 7mjz-assembly1.cif.gz_A | the structure of miab with pentasulfide bridge | 0.9419 | 6 | 444 |
| 7mjx-assembly1.cif.gz_A | miab in the complex with 5'-deoxyadenosine, methionine and rna | 0.9306 | 7 | 443 |
| 7mjz-assembly1.cif.gz_A | the structure of miab with pentasulfide bridge | 0.9296 | 6 | 444 |
| 2qgq-assembly1.cif.gz_A | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.9029 | 151 | 443 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0IRV7_127_250_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.9826 | 264 | 371 | 3.30.750.200 |
| af_P0AEI1_145_378_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.9781 | 150 | 381 | 3.80.30.20 |
| 4jc0B03 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.9713 | 268 | 384 | 3.30.750.200 |
| af_P0AEI1_145_378_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.9658 | 150 | 381 | 3.80.30.20 |
| af_F1LV76_14_128_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.9656 | 266 | 376 | 3.30.750.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7XLY8-F1-model_v4 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | 0.9873 | 276 | 374 |
GO:0005829
GO:0035597 GO:0051539 |
| AF-A0A2N3DJZ1-F1-model_v4 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | 0.98 | 8 | 319 |
GO:0005829
GO:0035597 GO:0046872 GO:0051539 |
| AF-A0A2E8LX22-F1-model_v4 | deleted | 0.9797 | 1 | 322 |
|
| AF-A0A3R9WW79-F1-model_v4 | deleted | 0.9772 | 358 | 448 |
|
| AF-A0A7V3SUC0-F1-model_v4 | tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (EC 2.8.4.3) | 0.9757 | 258 | 443 |
GO:0005829
GO:0035597 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar