F493402

General Info

Members Datasets Scaffolds Average Seq Length
1370 526 1319 136

Family's Representative Sequence

Representative Sequence 3300004625|Ga0055543_1012054|Ga0055543_10120542
Length 157
Sequence MIAVDSSVLIDLLGDAPGADAAEAALRLALSTGPVVLCDVVLSEVTAGLGHGSEVMDALEEMGLGFSPIDQRAAIRAGEMQRKFKQRLLEAGTRPSGKPQAKTVAADTPGASRAIADFLVGAHAMLQCDGLITRDHGFFRDYFKGLKVIVPEGASPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
15 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
19 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
20 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
21 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
22 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
23 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
24 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
25 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
26 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
27 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
28 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
29 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
30 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
31 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
32 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
33 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
34 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
35 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
36 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
37 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
38 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
39 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
40 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
43 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
44 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
45 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
46 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
47 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
48 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
49 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
52 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
53 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
54 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
59 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
60 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
61 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
62 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
65 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
66 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
67 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
73 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
74 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
75 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
76 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
86 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
87 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
90 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
91 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
92 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
93 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
94 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
95 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
96 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
97 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
98 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
99 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
100 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
104 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
105 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
106 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
114 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
118 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
130 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
131 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
135 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
136 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
144 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
149 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
150 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
151 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
165 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
176 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
177 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
178 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
179 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
180 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
181 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
182 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
183 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
184 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
188 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
193 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
194 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
197 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
266 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
277 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
278 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
279 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
280 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
281 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
282 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
283 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
284 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
285 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
286 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
287 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
288 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
289 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
290 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
291 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
292 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
293 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
294 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
295 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
296 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
299 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
300 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
301 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
302 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
303 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
304 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
305 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
306 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
307 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
308 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
309 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
310 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
311 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
312 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
313 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
314 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
315 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
316 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
317 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
318 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
319 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
320 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
321 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
322 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
323 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
328 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
331 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
332 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
333 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
334 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
335 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
336 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
337 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
338 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
339 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
340 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
341 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
342 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
343 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
344 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
345 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
346 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
347 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
348 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
349 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
352 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
353 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
354 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
355 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
356 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
357 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
358 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
359 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
360 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
361 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
362 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
363 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
364 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
365 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
366 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
367 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
368 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
369 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
370 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
371 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
372 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
373 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
376 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
377 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
378 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
385 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
386 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
387 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
388 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
389 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
390 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
391 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
392 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
393 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
394 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
395 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
401 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
402 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
403 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
404 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
405 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
406 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
407 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
408 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
409 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
410 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
411 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
412 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
413 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
414 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
415 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
416 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
417 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
418 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
419 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
420 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
421 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
422 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
423 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
424 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
425 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
426 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
431 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
448 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
449 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
450 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
451 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
470 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
473 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
474 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
475 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
476 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
477 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
478 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
479 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
480 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
481 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
482 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
483 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
484 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
485 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
486 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
487 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
488 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
491 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
492 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
493 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
494 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
495 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
496 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
501 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
502 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
503 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
504 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
505 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
506 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
507 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
508 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
509 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
510 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
511 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
512 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
513 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
514 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
515 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
516 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
517 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
518 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
521 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
524 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
525 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
526 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 1.17
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 10.36
Nodule 0.36
Rhizoplane 5.62
Rhizosphere 72.19
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2733011 2162886007 Bacteria 3098
2 SwRhRL2b_contig_3886549 2162886007 Bacteria 1068
3 JGI25156J39149_1002197 3300002705 Bacteria 7254
4 JGI25156J39149_1006806 3300002705 Bacteria 3078
5 JGI25154J39366_1001260 3300002738 Bacteria 9490
6 JGI25157J39369_1000491 3300002741 Bacteria 24512
7 JGI25164J39214_1009409 3300002772 Bacteria 961
8 Ga0006778J45830_1039144 3300003162 Bacteria 3623
9 rootH1_10002740 3300003316 Bacteria 3767
10 rootH1_10002744 3300003316 Bacteria 2748
11 rootH1_10017987 3300003316 Bacteria 2116
12 rootH2_10019340 3300003320 Bacteria 4011
13 rootH2_10083712 3300003320 Bacteria 2181
14 rootH2_10187889 3300003320 Bacteria 1336
15 rootL2_10002046 3300003322 Bacteria 4121
16 rootL2_10047399 3300003322 Bacteria 3286
17 rootL2_10049164 3300003322 Bacteria 5122
18 rootL2_10136592 3300003322 Bacteria 1066
19 rootL2_10197176 3300003322 Bacteria 1229
20 rootL2_10256599 3300003322 Bacteria 1968
21 rootH1_10038473 3300003323 Bacteria 4146
22 rootH1_10058276 3300003323 Bacteria 4017
23 rootH1_10061833 3300003323 Bacteria 2662
24 rootH1_10072793 3300003323 Bacteria 1181
25 rootH1_10143584 3300003323 Bacteria 1595
26 rootH1_10235777 3300003323 Bacteria 1878
27 Ga0055539_1000279 3300003752 Bacteria 29490
28 Ga0055539_1002101 3300003752 Bacteria 3240
29 Ga0055539_1023488 3300003752 Bacteria 724
30 Ga0055533_1000025 3300003756 Bacteria 332208
31 Ga0055525_1000046 3300003759 Bacteria 261587
32 Ga0055525_1001306 3300003759 Bacteria 5049
33 Ga0055535_1000122 3300003761 Bacteria 83657
34 Ga0055535_1016001 3300003761 Bacteria 1036
35 Ga0055529_1000199 3300003763 Bacteria 80950
36 Ga0055526_1000101 3300003771 Bacteria 76352
37 Ga0055526_1003565 3300003771 Bacteria 9799
38 Ga0055526_1006205 3300003771 Bacteria 6565
39 Ga0055537_1000091 3300003773 Bacteria 66379
40 Ga0055537_1000459 3300003773 Bacteria 25642
41 Ga0055537_1000560 3300003773 Bacteria 21020
42 Ga0055524_1000574 3300003775 Bacteria 27115
43 Ga0055524_1001859 3300003775 Bacteria 11558
44 Ga0055524_1012111 3300003775 Bacteria 3329
45 Ga0055524_1032069 3300003775 Bacteria 1498
46 Ga0055524_1032769 3300003775 Bacteria 1466
47 Ga0055536_1001901 3300003781 Bacteria 12114
48 Ga0055536_1003184 3300003781 Bacteria 8895
49 Ga0055536_1005396 3300003781 Bacteria 6263
50 Ga0055536_1014378 3300003781 Bacteria 2784
51 Ga0055534_1000043 3300003784 Bacteria 99338
52 Ga0055534_1000078 3300003784 Bacteria 75996
53 Ga0055528_1000075 3300003790 Bacteria 76054
54 Ga0055528_1000087 3300003790 Bacteria 72896
55 Ga0055530_10001911 3300003791 Bacteria 14253
56 Ga0055530_10007441 3300003791 Bacteria 4607
57 Ga0055530_10008282 3300003791 Bacteria 4197
58 Ga0055530_10010812 3300003791 Bacteria 3334
59 Ga0055530_10030449 3300003791 Bacteria 1429
60 Ga0055530_10053491 3300003791 Bacteria 927
61 Ga0055540_1000004 3300003792 Bacteria 395545
62 Ga0055540_1000035 3300003792 Bacteria 166843
63 Ga0055540_1014970 3300003792 Bacteria 2283
64 Ga0055540_1028470 3300003792 Bacteria 1321
65 Ga0055540_1046447 3300003792 Bacteria 913
66 Ga0055531_10010928 3300003794 Bacteria 4448
67 Ga0055531_10012582 3300003794 Bacteria 3969
68 Ga0055531_10020086 3300003794 Bacteria 2662
69 Ga0055531_10025346 3300003794 Bacteria 2157
70 Ga0055531_10028318 3300003794 Bacteria 1936
71 Ga0058692_1000060 3300003856 Bacteria 98866
72 Ga0058692_1000555 3300003856 Bacteria 15940
73 Ga0055543_1003835 3300004625 Bacteria 4268
74 Ga0055543_1012054 3300004625 Bacteria 1750
75 Ga0065165_1000239 3300005262 Bacteria 94061
76 Ga0065165_1000401 3300005262 Bacteria 69929
77 Ga0065165_1076663 3300005262 Bacteria 876
78 Ga0065704_10000521 3300005289 Bacteria 27858
79 Ga0065704_10078724 3300005289 Bacteria 4350
80 Ga0065704_10138923 3300005289 Bacteria 1539
81 Ga0065704_10193942 3300005289 Bacteria 1165
82 Ga0065715_10160732 3300005293 Bacteria 1632
83 Ga0070658_10005332 3300005327 Bacteria 10439
84 Ga0070658_10138163 3300005327 Bacteria 2034
85 Ga0070658_10166330 3300005327 Bacteria 1851
86 Ga0070658_10501468 3300005327 Bacteria 1048
87 Ga0070676_10116453 3300005328 Bacteria 1671
88 Ga0070676_10163474 3300005328 Bacteria 1434
89 Ga0070676_10232491 3300005328 Bacteria 1222
90 Ga0070676_10271029 3300005328 Bacteria 1140
91 Ga0070676_10301012 3300005328 Bacteria 1087
92 Ga0070676_10812898 3300005328 Bacteria 690
93 Ga0070683_100159377 3300005329 Bacteria 2141
94 Ga0070683_100239841 3300005329 Bacteria 1724
95 Ga0070690_100019205 3300005330 Bacteria 4143
96 Ga0070690_100028644 3300005330 Bacteria 3451
97 Ga0070690_100143883 3300005330 Bacteria 1620
98 Ga0070690_100273359 3300005330 Bacteria 1203
99 Ga0070670_100003584 3300005331 Bacteria 12922
100 Ga0070670_100034566 3300005331 Bacteria 4350
101 Ga0070670_100117018 3300005331 Bacteria 2298
102 Ga0070670_100150580 3300005331 Bacteria 2013
103 Ga0070670_100164485 3300005331 Bacteria 1923
104 Ga0070670_100202876 3300005331 Bacteria 1723
105 Ga0070670_100265353 3300005331 Bacteria 1497
106 Ga0070670_101077045 3300005331 Bacteria 732
107 Ga0070670_101916629 3300005331 Bacteria 546
108 Ga0070677_10025590 3300005333 Bacteria 2204
109 Ga0070677_10052737 3300005333 Bacteria 1651
110 Ga0070677_10084279 3300005333 Bacteria 1367
111 Ga0070677_10125290 3300005333 Bacteria 1165
112 Ga0070677_10291543 3300005333 Bacteria 826
113 Ga0068869_100083709 3300005334 Bacteria 2386
114 Ga0068869_100092019 3300005334 Bacteria 2282
115 Ga0068869_100113189 3300005334 Bacteria 2066
116 Ga0068869_100133862 3300005334 Bacteria 1908
117 Ga0068869_100805593 3300005334 Bacteria 807
118 Ga0070666_10022849 3300005335 Bacteria 4065
119 Ga0070666_10033683 3300005335 Bacteria 3391
120 Ga0070666_10725171 3300005335 Bacteria 730
121 Ga0070680_100200755 3300005336 Bacteria 1682
122 Ga0070682_100319171 3300005337 Bacteria 1147
123 Ga0070682_100366638 3300005337 Bacteria 1079
124 Ga0070682_100441809 3300005337 Bacteria 994
125 Ga0068868_100010923 3300005338 Bacteria 6591
126 Ga0068868_100105165 3300005338 Bacteria 2288
127 Ga0068868_100625760 3300005338 Bacteria 956
128 Ga0068868_100627545 3300005338 Bacteria 955
129 Ga0068868_100628643 3300005338 Bacteria 954
130 Ga0068868_101225452 3300005338 Bacteria 695
131 Ga0070660_100177344 3300005339 Bacteria 1724
132 Ga0070660_100258905 3300005339 Bacteria 1420
133 Ga0070660_100415469 3300005339 Bacteria 1113
134 Ga0070660_100441923 3300005339 Bacteria 1078
135 Ga0070689_100080869 3300005340 Bacteria 2550
136 Ga0070689_100221359 3300005340 Bacteria 1553
137 Ga0070689_100240708 3300005340 Bacteria 1490
138 Ga0070689_100383657 3300005340 Bacteria 1185
139 Ga0070687_100008132 3300005343 Bacteria 4421
140 Ga0070687_100317632 3300005343 Bacteria 994
141 Ga0070687_100331125 3300005343 Bacteria 976
142 Ga0070687_100603233 3300005343 Bacteria 754
143 Ga0070661_100084736 3300005344 Bacteria 2341
144 Ga0070661_100230417 3300005344 Bacteria 1423
145 Ga0070661_100254344 3300005344 Bacteria 1356
146 Ga0070692_10275966 3300005345 Bacteria 1017
147 Ga0070668_100065280 3300005347 Bacteria 2823
148 Ga0070668_100106945 3300005347 Bacteria 2223
149 Ga0070668_100149654 3300005347 Bacteria 1887
150 Ga0070668_100436334 3300005347 Bacteria 1123
151 Ga0070668_101435490 3300005347 Bacteria 630
152 Ga0070669_100001896 3300005353 Bacteria 15091
153 Ga0070669_100021831 3300005353 Bacteria 4577
154 Ga0070669_100095163 3300005353 Bacteria 2239
155 Ga0070669_100497763 3300005353 Bacteria 1010
156 Ga0070669_100709599 3300005353 Bacteria 850
157 Ga0070669_100843272 3300005353 Bacteria 781
158 Ga0070675_100001199 3300005354 Bacteria 18865
159 Ga0070675_100027333 3300005354 Bacteria 4583
160 Ga0070675_100038320 3300005354 Bacteria 3906
161 Ga0070675_100262615 3300005354 Bacteria 1513
162 Ga0070675_100562965 3300005354 Bacteria 1032
163 Ga0070675_100633071 3300005354 Bacteria 971
164 Ga0070675_101151747 3300005354 Bacteria 714
165 Ga0070671_100009616 3300005355 Bacteria 7767
166 Ga0070671_100069035 3300005355 Bacteria 2947
167 Ga0070671_100121757 3300005355 Bacteria 2196
168 Ga0070671_100134304 3300005355 Bacteria 2085
169 Ga0070671_100158250 3300005355 Bacteria 1914
170 Ga0070671_100401989 3300005355 Bacteria 1172
171 Ga0070671_100437577 3300005355 Bacteria 1121
172 Ga0070671_100737062 3300005355 Bacteria 856
173 Ga0070671_100878486 3300005355 Bacteria 783
174 Ga0070674_100003764 3300005356 Bacteria 8562
175 Ga0070674_100187003 3300005356 Bacteria 1590
176 Ga0070674_100271492 3300005356 Bacteria 1340
177 Ga0070674_100588240 3300005356 Bacteria 939
178 Ga0070674_101091653 3300005356 Bacteria 704
179 Ga0070673_100073367 3300005364 Bacteria 2754
180 Ga0070673_100205364 3300005364 Bacteria 1698
181 Ga0070673_100227369 3300005364 Bacteria 1617
182 Ga0070673_100236454 3300005364 Bacteria 1586
183 Ga0070673_100366647 3300005364 Bacteria 1281
184 Ga0070673_100708241 3300005364 Bacteria 925
185 Ga0070673_100724620 3300005364 Bacteria 914
186 Ga0070688_100075599 3300005365 Bacteria 2165
187 Ga0070688_100114079 3300005365 Bacteria 1801
188 Ga0070659_100000336 3300005366 Bacteria 36297
189 Ga0070659_100090132 3300005366 Bacteria 2457
190 Ga0070659_100209986 3300005366 Bacteria 1604
191 Ga0070659_100377472 3300005366 Bacteria 1194
192 Ga0070659_101023812 3300005366 Bacteria 725
193 Ga0070667_100005446 3300005367 Bacteria 10632
194 Ga0070667_100016792 3300005367 Bacteria 6056
195 Ga0070667_100318288 3300005367 Bacteria 1403
196 Ga0070667_101317883 3300005367 Bacteria 677
197 Ga0070714_100259131 3300005435 Bacteria 1610
198 Ga0070701_10374466 3300005438 Bacteria 896
199 Ga0070701_10432580 3300005438 Bacteria 841
200 Ga0070663_100007308 3300005455 Bacteria 6715
201 Ga0070663_100130980 3300005455 Bacteria 1904
202 Ga0070663_100318737 3300005455 Bacteria 1249
203 Ga0070663_100549137 3300005455 Bacteria 965
204 Ga0070663_101180864 3300005455 Unclassified 672
205 Ga0070678_100010070 3300005456 Bacteria 5754
206 Ga0070678_100043335 3300005456 Bacteria 3204
207 Ga0070678_100160790 3300005456 Bacteria 1819
208 Ga0070678_100170193 3300005456 Bacteria 1773
209 Ga0070678_100174108 3300005456 Bacteria 1755
210 Ga0070678_100266817 3300005456 Bacteria 1442
211 Ga0070678_100310449 3300005456 Bacteria 1343
212 Ga0070678_101194906 3300005456 Bacteria 705
213 Ga0070662_100000867 3300005457 Bacteria 18517
214 Ga0070662_100178485 3300005457 Bacteria 1672
215 Ga0070662_100273071 3300005457 Bacteria 1365
216 Ga0070662_100313493 3300005457 Bacteria 1277
217 Ga0070662_100479368 3300005457 Bacteria 1035
218 Ga0070681_10464008 3300005458 Bacteria 1179
219 Ga0068867_100000005 3300005459 Bacteria 174097
220 Ga0068867_100082817 3300005459 Bacteria 2421
221 Ga0068867_100178603 3300005459 Bacteria 1686
222 Ga0068867_100398158 3300005459 Bacteria 1160
223 Ga0068867_100399280 3300005459 Bacteria 1159
224 Ga0068867_101466082 3300005459 Bacteria 635
225 Ga0070685_10554750 3300005466 Bacteria 821
226 Ga0070679_100003038 3300005530 Bacteria 15334
227 Ga0070684_100313579 3300005535 Bacteria 1440
228 Ga0070684_101159476 3300005535 Bacteria 727
229 Ga0068853_100264449 3300005539 Bacteria 1582
230 Ga0068853_100347810 3300005539 Bacteria 1378
231 Ga0068853_100371292 3300005539 Bacteria 1334
232 Ga0068853_100371500 3300005539 Bacteria 1334
233 Ga0068853_100417599 3300005539 Bacteria 1258
234 Ga0068853_100664387 3300005539 Bacteria 992
235 Ga0070672_100003244 3300005543 Bacteria 10530
236 Ga0070672_100220039 3300005543 Bacteria 1592
237 Ga0070672_100429558 3300005543 Bacteria 1136
238 Ga0070672_100438744 3300005543 Bacteria 1123
239 Ga0070672_100548588 3300005543 Bacteria 1003
240 Ga0070672_101241383 3300005543 Bacteria 664
241 Ga0070686_100208664 3300005544 Bacteria 1405
242 Ga0070686_100319526 3300005544 Bacteria 1157
243 Ga0070693_100218418 3300005547 Bacteria 1247
244 Ga0070693_100364409 3300005547 Bacteria 993
245 Ga0070665_100439011 3300005548 Bacteria 1315
246 Ga0070665_102536391 3300005548 Bacteria 514
247 Ga0068855_100035623 3300005563 Bacteria 5928
248 Ga0068855_100063395 3300005563 Bacteria 4313
249 Ga0068855_100065258 3300005563 Bacteria 4244
250 Ga0068855_100187491 3300005563 Bacteria 2335
251 Ga0068855_100288889 3300005563 Bacteria 1818
252 Ga0068855_101509026 3300005563 Bacteria 690
253 Ga0070664_100014426 3300005564 Bacteria 6443
254 Ga0070664_100266060 3300005564 Bacteria 1543
255 Ga0070664_100309246 3300005564 Bacteria 1430
256 Ga0070664_100517141 3300005564 Bacteria 1101
257 Ga0068857_100002880 3300005577 Bacteria 14152
258 Ga0068857_100643149 3300005577 Bacteria 1005
259 Ga0068857_100653711 3300005577 Bacteria 996
260 Ga0068857_100788733 3300005577 Bacteria 907
261 Ga0068857_101622759 3300005577 Bacteria 631
262 Ga0068854_100032823 3300005578 Bacteria 3615
263 Ga0068854_100188620 3300005578 Bacteria 1614
264 Ga0068854_100296805 3300005578 Bacteria 1306
265 Ga0068854_100342447 3300005578 Bacteria 1221
266 Ga0068856_100004237 3300005614 Bacteria 14324
267 Ga0068856_100287717 3300005614 Bacteria 1660
268 Ga0068856_100566739 3300005614 Bacteria 1157
269 Ga0070702_100266700 3300005615 Bacteria 1169
270 Ga0068852_100023003 3300005616 Bacteria 5008
271 Ga0068852_100051582 3300005616 Bacteria 3531
272 Ga0068852_100125132 3300005616 Bacteria 2359
273 Ga0068852_100173703 3300005616 Bacteria 2022
274 Ga0068852_100201955 3300005616 Bacteria 1881
275 Ga0068852_100228622 3300005616 Bacteria 1772
276 Ga0068852_100344478 3300005616 Bacteria 1453
277 Ga0068852_100927121 3300005616 Bacteria 888
278 Ga0068859_100010529 3300005617 Bacteria 9307
279 Ga0068859_100966507 3300005617 Bacteria 935
280 Ga0068864_100002556 3300005618 Bacteria 15030
281 Ga0068864_100010811 3300005618 Bacteria 7541
282 Ga0068864_100074072 3300005618 Bacteria 2970
283 Ga0068864_100219843 3300005618 Bacteria 1752
284 Ga0068864_100287767 3300005618 Bacteria 1535
285 Ga0068864_100311152 3300005618 Bacteria 1477
286 Ga0068864_100407153 3300005618 Bacteria 1294
287 Ga0068866_10022477 3300005718 Bacteria 2919
288 Ga0068866_10451577 3300005718 Bacteria 841
289 Ga0068866_10454602 3300005718 Bacteria 838
290 Ga0068861_100001169 3300005719 Bacteria 16352
291 Ga0068861_100003364 3300005719 Bacteria 10598
292 Ga0068861_100020439 3300005719 Bacteria 4743
293 Ga0068861_100637374 3300005719 Bacteria 983
294 Ga0068861_101175683 3300005719 Bacteria 741
295 Ga0068851_10107935 3300005834 Bacteria 1483
296 Ga0068851_10149319 3300005834 Bacteria 1276
297 Ga0068851_10170888 3300005834 Bacteria 1200
298 Ga0068851_10742335 3300005834 Bacteria 607
299 Ga0068870_10112703 3300005840 Bacteria 1556
300 Ga0068870_10198304 3300005840 Bacteria 1216
301 Ga0068870_10238358 3300005840 Bacteria 1122
302 Ga0068870_10561730 3300005840 Bacteria 770
303 Ga0068863_100019332 3300005841 Bacteria 6514
304 Ga0068863_100075179 3300005841 Bacteria 3196
305 Ga0068863_100185591 3300005841 Bacteria 1997
306 Ga0068863_100222829 3300005841 Bacteria 1817
307 Ga0068863_100511302 3300005841 Bacteria 1183
308 Ga0068858_100015946 3300005842 Bacteria 7058
309 Ga0068858_100201227 3300005842 Bacteria 1883
310 Ga0068858_100761124 3300005842 Bacteria 944
311 Ga0068860_100170425 3300005843 Bacteria 2102
312 Ga0068862_100112008 3300005844 Bacteria 2396
313 Ga0068862_100208709 3300005844 Bacteria 1764
314 Ga0068862_100707168 3300005844 Bacteria 977
315 Ga0068862_100758516 3300005844 Bacteria 945
316 Ga0081539_10083917 3300005985 Bacteria 1666
317 Ga0070717_10529892 3300006028 Bacteria 1066
318 Ga0075365_10065199 3300006038 Bacteria 2441
319 Ga0075365_10618794 3300006038 Bacteria 766
320 Ga0075363_100215076 3300006048 Bacteria 1101
321 Ga0075364_10001093 3300006051 Bacteria 14489
322 Ga0075364_10279616 3300006051 Bacteria 1135
323 Ga0075367_10153877 3300006178 Bacteria 1428
324 Ga0075369_10027960 3300006186 Bacteria 2361
325 Ga0075366_10055725 3300006195 Bacteria 2348
326 Ga0075366_10113036 3300006195 Bacteria 1635
327 Ga0075366_10155524 3300006195 Bacteria 1385
328 Ga0075366_10200893 3300006195 Bacteria 1213
329 Ga0097621_100009661 3300006237 Bacteria 7014
330 Ga0097621_100010826 3300006237 Bacteria 6691
331 Ga0097621_100017103 3300006237 Bacteria 5500
332 Ga0097621_100113913 3300006237 Bacteria 2287
333 Ga0097621_100230556 3300006237 Bacteria 1616
334 Ga0097621_100603380 3300006237 Bacteria 1003
335 Ga0075370_10002692 3300006353 Bacteria 8312
336 Ga0075370_10037091 3300006353 Bacteria 2740
337 Ga0075370_10166025 3300006353 Bacteria 1297
338 Ga0068871_100005809 3300006358 Bacteria 8669
339 Ga0068871_100057753 3300006358 Bacteria 3158
340 Ga0068871_100067624 3300006358 Bacteria 2932
341 Ga0068871_100141284 3300006358 Bacteria 2047
342 Ga0068871_100223359 3300006358 Bacteria 1633
343 Ga0068871_100550890 3300006358 Bacteria 1044
344 Ga0068871_101054900 3300006358 Bacteria 759
345 Ga0075429_100815997 3300006880 Bacteria 817
346 Ga0068865_100094158 3300006881 Bacteria 2179
347 Ga0068865_100166194 3300006881 Bacteria 1687
348 Ga0068865_100277296 3300006881 Bacteria 1333
349 Ga0068865_100536179 3300006881 Bacteria 981
350 Ga0097620_100010529 3300006931 Bacteria 9307
351 Ga0097620_100966531 3300006931 Bacteria 935
352 Ga0079104_1000352 3300006946 Bacteria 55479
353 Ga0099826_10560233 3300006948 Bacteria 525
354 Ga0105251_10000364 3300009011 Bacteria 44484
355 Ga0105244_10041838 3300009036 Bacteria 2373
356 Ga0105240_10055942 3300009093 Bacteria 4938
357 Ga0105240_10212788 3300009093 Bacteria 2258
358 Ga0105240_10654346 3300009093 Bacteria 1151
359 Ga0105240_11006023 3300009093 Bacteria 891
360 Ga0105240_11068556 3300009093 Bacteria 860
361 Ga0111539_10951431 3300009094 Bacteria 999
362 Ga0111539_11239148 3300009094 Bacteria 866
363 Ga0111539_11565602 3300009094 Bacteria 764
364 Ga0105245_10048722 3300009098 Bacteria 3790
365 Ga0105245_10502295 3300009098 Bacteria 1229
366 Ga0105245_10662157 3300009098 Bacteria 1075
367 Ga0105245_10732566 3300009098 Bacteria 1024
368 Ga0105243_10006867 3300009148 Bacteria 8775
369 Ga0105243_10013725 3300009148 Bacteria 6129
370 Ga0105243_10102698 3300009148 Bacteria 2376
371 Ga0105243_10433572 3300009148 Bacteria 1229
372 Ga0105243_11468364 3300009148 Bacteria 705
373 Ga0105243_11806122 3300009148 Bacteria 642
374 Ga0105243_11870583 3300009148 Bacteria 632
375 Ga0105243_12001301 3300009148 Bacteria 614
376 Ga0105241_10119752 3300009174 Bacteria 2118
377 Ga0105241_11523244 3300009174 Bacteria 644
378 Ga0105242_10330985 3300009176 Bacteria 1400
379 Ga0105242_10335390 3300009176 Bacteria 1392
380 Ga0105242_10912657 3300009176 Bacteria 879
381 Ga0105242_11028492 3300009176 Bacteria 833
382 Ga0105248_10014945 3300009177 Bacteria 8546
383 Ga0105248_10039291 3300009177 Bacteria 5299
384 Ga0105248_10105222 3300009177 Bacteria 3181
385 Ga0105248_10500405 3300009177 Bacteria 1370
386 Ga0105248_10585797 3300009177 Bacteria 1258
387 Ga0105248_10682446 3300009177 Bacteria 1159
388 Ga0105248_12289127 3300009177 Unclassified 615
389 Ga0105237_10043493 3300009545 Bacteria 4523
390 Ga0105237_10078237 3300009545 Bacteria 3297
391 Ga0105237_10332526 3300009545 Bacteria 1523
392 Ga0105238_10035279 3300009551 Bacteria 5085
393 Ga0105249_10060727 3300009553 Bacteria 3468
394 Ga0105249_10163245 3300009553 Bacteria 2154
395 Ga0105249_11447828 3300009553 Bacteria 759
396 Ga0105249_13359061 3300009553 Unclassified 515
397 Ga0105148_121146 3300009978 Bacteria 523
398 Ga0105239_10056095 3300010375 Bacteria 4321
399 Ga0105239_10320005 3300010375 Bacteria 1749
400 Ga0105239_10390603 3300010375 Bacteria 1574
401 Ga0105246_10055307 3300011119 Bacteria 2738
402 Ga0157319_1000031 3300012497 Bacteria 48442
403 Ga0157373_10613361 3300013100 Bacteria 793
404 Ga0157373_10815433 3300013100 Bacteria 689
405 Ga0157371_10002369 3300013102 Bacteria 18037
406 Ga0157371_10062945 3300013102 Bacteria 2630
407 Ga0157371_10079985 3300013102 Bacteria 2315
408 Ga0157371_10160203 3300013102 Bacteria 1607
409 Ga0157371_10162109 3300013102 Bacteria 1597
410 Ga0157371_10287601 3300013102 Bacteria 1188
411 Ga0157370_10102494 3300013104 Bacteria 2680
412 Ga0157370_10452984 3300013104 Bacteria 1180
413 Ga0157370_10487444 3300013104 Bacteria 1133
414 Ga0157370_11918103 3300013104 Bacteria 531
415 Ga0157369_10049772 3300013105 Bacteria 4541
416 Ga0157369_10227086 3300013105 Bacteria 1953
417 Ga0157369_10445204 3300013105 Bacteria 1342
418 Ga0157374_10105010 3300013296 Bacteria 2712
419 Ga0157374_10171153 3300013296 Bacteria 2119
420 Ga0157374_10330567 3300013296 Bacteria 1512
421 Ga0157374_10344207 3300013296 Bacteria 1480
422 Ga0157378_10152828 3300013297 Bacteria 2151
423 Ga0157378_10180200 3300013297 Bacteria 1987
424 Ga0157378_10578450 3300013297 Bacteria 1132
425 Ga0157378_12775830 3300013297 Bacteria 542
426 Ga0163162_10007486 3300013306 Bacteria 10624
427 Ga0163162_10025364 3300013306 Bacteria 5857
428 Ga0163162_10181423 3300013306 Bacteria 2231
429 Ga0163162_10265698 3300013306 Bacteria 1847
430 Ga0163162_10486191 3300013306 Bacteria 1366
431 Ga0163162_10674271 3300013306 Bacteria 1157
432 Ga0163162_10747585 3300013306 Bacteria 1097
433 Ga0163162_11074816 3300013306 Bacteria 911
434 Ga0157372_10243948 3300013307 Bacteria 2085
435 Ga0157372_11149127 3300013307 Bacteria 898
436 Ga0157375_10034088 3300013308 Bacteria 4846
437 Ga0157375_10109446 3300013308 Bacteria 2859
438 Ga0157375_10353768 3300013308 Bacteria 1635
439 Ga0157375_10408446 3300013308 Bacteria 1524
440 Ga0157375_10494459 3300013308 Bacteria 1388
441 Ga0157375_11009048 3300013308 Bacteria 972
442 Ga0157375_11513579 3300013308 Unclassified 792
443 Ga0157375_12642963 3300013308 Bacteria 600
444 Ga0163163_10010139 3300014325 Bacteria 8453
445 Ga0163163_10240216 3300014325 Bacteria 1861
446 Ga0163163_10329833 3300014325 Bacteria 1580
447 Ga0163163_10600868 3300014325 Bacteria 1163
448 Ga0163163_11222756 3300014325 Bacteria 814
449 Ga0163163_11443248 3300014325 Bacteria 750
450 Ga0157380_10153834 3300014326 Bacteria 1991
451 Ga0157380_10198110 3300014326 Bacteria 1779
452 Ga0157380_10316828 3300014326 Bacteria 1444
453 Ga0157380_10424330 3300014326 Bacteria 1269
454 Ga0157380_10449479 3300014326 Bacteria 1237
455 Ga0157380_10636066 3300014326 Bacteria 1062
456 Ga0157380_13027101 3300014326 Bacteria 536
457 Ga0182008_10010987 3300014497 Bacteria 4829
458 Ga0182008_10067339 3300014497 Bacteria 1762
459 Ga0182008_10495581 3300014497 Bacteria 671
460 Ga0157377_10000022 3300014745 Bacteria 146702
461 Ga0157377_10062240 3300014745 Bacteria 2135
462 Ga0157377_10336995 3300014745 Bacteria 1007
463 Ga0157379_10011032 3300014968 Bacteria 7876
464 Ga0157379_10018910 3300014968 Bacteria 6079
465 Ga0157379_10066973 3300014968 Bacteria 3211
466 Ga0157379_10183696 3300014968 Bacteria 1889
467 Ga0157379_10326475 3300014968 Bacteria 1401
468 Ga0157379_10568848 3300014968 Bacteria 1056
469 Ga0157379_10633969 3300014968 Bacteria 999
470 Ga0157376_10028517 3300014969 Bacteria 4438
471 Ga0157376_10129467 3300014969 Bacteria 2250
472 Ga0157376_10186237 3300014969 Bacteria 1901
473 Ga0157376_10210298 3300014969 Bacteria 1795
474 Ga0157376_10223886 3300014969 Bacteria 1744
475 Ga0157376_10360829 3300014969 Bacteria 1393
476 Ga0157376_10379663 3300014969 Bacteria 1361
477 Ga0157376_10670491 3300014969 Bacteria 1039
478 Ga0182006_1033096 3300015261 Bacteria 2073
479 Ga0182006_1064426 3300015261 Bacteria 1374
480 Ga0182006_1080302 3300015261 Bacteria 1191
481 Ga0182006_1081085 3300015261 Bacteria 1183
482 Ga0182006_1180587 3300015261 Bacteria 704
483 Ga0182007_10000236 3300015262 Bacteria 37233
484 Ga0182007_10173386 3300015262 Bacteria 743
485 Ga0182005_1001886 3300015265 Bacteria 7941
486 Ga0183360_10001 3300015689 Bacteria 3943671
487 Ga0163161_10033566 3300017792 Bacteria 3667
488 Ga0163161_10036693 3300017792 Bacteria 3511
489 Ga0163161_10059326 3300017792 Bacteria 2782
490 Ga0163161_10092187 3300017792 Bacteria 2243
491 Ga0163161_10094277 3300017792 Bacteria 2219
492 Ga0163161_10128293 3300017792 Bacteria 1911
493 Ga0163161_10263008 3300017792 Bacteria 1348
494 Ga0163161_10369432 3300017792 Bacteria 1144
495 Ga0163161_10799188 3300017792 Bacteria 793
496 Ga0206349_1304419 3300020075 Bacteria 3262
497 Ga0213872_10000029 3300021361 Bacteria 145850
498 Ga0213872_10000049 3300021361 Bacteria 109094
499 Ga0213872_10077224 3300021361 Bacteria 1497
500 Ga0213872_10092646 3300021361 Bacteria 1351
501 Ga0209674_100007 3300025226 Bacteria 1077082
502 Ga0209674_113028 3300025226 Bacteria 787
503 Ga0209563_100005 3300025230 Bacteria 1774893
504 Ga0209563_100052 3300025230 Bacteria 334307
505 Ga0207427_100516 3300025231 Bacteria 20429
506 Ga0209258_100284 3300025242 Bacteria 83713
507 Ga0209258_100957 3300025242 Bacteria 13752
508 Ga0207425_1023502 3300025245 Bacteria 1289
509 Ga0209646_1000245 3300025246 Bacteria 55317
510 Ga0209026_1000021 3300025250 Bacteria 375165
511 Ga0209026_1009092 3300025250 Bacteria 1992
512 Ga0209026_1035437 3300025250 Bacteria 732
513 Ga0209677_100015 3300025253 Bacteria 532137
514 Ga0209677_100477 3300025253 Bacteria 22940
515 Ga0209677_103158 3300025253 Bacteria 5562
516 Ga0209759_1000244 3300025256 Bacteria 80962
517 Ga0209759_1000382 3300025256 Bacteria 55345
518 Ga0209759_1002244 3300025256 Bacteria 8800
519 Ga0209759_1012333 3300025256 Bacteria 2373
520 Ga0209759_1027317 3300025256 Bacteria 1181
521 Ga0209759_1030695 3300025256 Bacteria 1058
522 Ga0209565_1000001 3300025263 Bacteria 2950419
523 Ga0209565_1000063 3300025263 Bacteria 183711
524 Ga0209565_1025074 3300025263 Bacteria 1208
525 Ga0209455_1000207 3300025272 Bacteria 83713
526 Ga0209673_1000001 3300025273 Bacteria 3176258
527 Ga0209673_1000065 3300025273 Bacteria 252799
528 Ga0209673_1005175 3300025273 Bacteria 6664
529 Ga0209130_1005935 3300025284 Bacteria 4096
530 Ga0209675_1000001 3300025291 Bacteria 2950293
531 Ga0209675_1000011 3300025291 Bacteria 520597
532 Ga0209676_1000011 3300025292 Bacteria 860463
533 Ga0209676_1000068 3300025292 Bacteria 314068
534 Ga0209676_1000086 3300025292 Bacteria 264155
535 Ga0209676_1001200 3300025292 Bacteria 27709
536 Ga0209676_1017012 3300025292 Bacteria 2593
537 Ga0209025_1137416 3300025294 Bacteria 698
538 Ga0209564_1000001 3300025295 Bacteria 3176258
539 Ga0209564_1000003 3300025295 Bacteria 1585848
540 Ga0209564_1002163 3300025295 Bacteria 16562
541 Ga0209050_1000239 3300025298 Bacteria 119530
542 Ga0209050_1000351 3300025298 Bacteria 88847
543 Ga0209050_1002510 3300025298 Bacteria 15448
544 Ga0209050_1004369 3300025298 Bacteria 9597
545 Ga0209050_1015764 3300025298 Bacteria 3148
546 Ga0209050_1018889 3300025298 Bacteria 2652
547 Ga0209256_1000002 3300025299 Bacteria 1906740
548 Ga0209256_1000011 3300025299 Bacteria 865309
549 Ga0209256_1004910 3300025299 Bacteria 8023
550 Ga0209256_1007888 3300025299 Bacteria 5100
551 Ga0209256_1009066 3300025299 Bacteria 4443
552 Ga0209256_1012612 3300025299 Bacteria 3210
553 Ga0209256_1016602 3300025299 Bacteria 2498
554 Ga0209256_1024840 3300025299 Bacteria 1757
555 Ga0209051_1000016 3300025303 Bacteria 541891
556 Ga0209051_1001060 3300025303 Bacteria 25669
557 Ga0209051_1001316 3300025303 Bacteria 21740
558 Ga0209051_1003382 3300025303 Bacteria 10483
559 Ga0209051_1008580 3300025303 Bacteria 5392
560 Ga0209257_1000014 3300025304 Bacteria 946850
561 Ga0209257_1000102 3300025304 Bacteria 251074
562 Ga0209257_1000121 3300025304 Bacteria 222588
563 Ga0209257_1000145 3300025304 Bacteria 195152
564 Ga0209257_1002604 3300025304 Bacteria 17480
565 Ga0209257_1002862 3300025304 Bacteria 16106
566 Ga0209257_1008078 3300025304 Bacteria 6124
567 Ga0209257_1111993 3300025304 Bacteria 650
568 Ga0209257_1139366 3300025304 Bacteria 546
569 Ga0207697_10023431 3300025315 Bacteria 2528
570 Ga0207697_10030415 3300025315 Bacteria 2210
571 Ga0207697_10152396 3300025315 Bacteria 1006
572 Ga0207656_10036941 3300025321 Bacteria 2052
573 Ga0207656_10070817 3300025321 Bacteria 1549
574 Ga0207656_10147624 3300025321 Bacteria 1112
575 Ga0207656_10269235 3300025321 Bacteria 838
576 Ga0207656_10295258 3300025321 Bacteria 801
577 Ga0207713_1000422 3300025735 Bacteria 44963
578 Ga0207682_10003227 3300025893 Bacteria 7131
579 Ga0207682_10037412 3300025893 Bacteria 1966
580 Ga0207682_10053884 3300025893 Bacteria 1669
581 Ga0207682_10164565 3300025893 Bacteria 1007
582 Ga0207682_10256053 3300025893 Bacteria 816
583 Ga0207682_10387567 3300025893 Bacteria 660
584 Ga0207642_10068647 3300025899 Bacteria 1678
585 Ga0207642_10211202 3300025899 Bacteria 1078
586 Ga0207642_10597097 3300025899 Bacteria 687
587 Ga0207680_10022332 3300025903 Bacteria 3439
588 Ga0207680_10321960 3300025903 Bacteria 1081
589 Ga0207685_10241477 3300025905 Bacteria 869
590 Ga0207645_10032610 3300025907 Bacteria 3348
591 Ga0207645_10067590 3300025907 Bacteria 2284
592 Ga0207645_10087967 3300025907 Bacteria 1997
593 Ga0207645_10297927 3300025907 Bacteria 1073
594 Ga0207645_10734092 3300025907 Bacteria 671
595 Ga0207643_10089513 3300025908 Bacteria 1793
596 Ga0207643_10178962 3300025908 Bacteria 1282
597 Ga0207643_10277041 3300025908 Bacteria 1039
598 Ga0207643_10937672 3300025908 Bacteria 561
599 Ga0207705_10024971 3300025909 Bacteria 4265
600 Ga0207705_10180438 3300025909 Bacteria 1593
601 Ga0207705_10322919 3300025909 Bacteria 1186
602 Ga0207705_10419583 3300025909 Bacteria 1036
603 Ga0207705_10422010 3300025909 Bacteria 1033
604 Ga0207705_10571654 3300025909 Bacteria 879
605 Ga0207705_11026422 3300025909 Bacteria 637
606 Ga0207654_10019747 3300025911 Bacteria 3562
607 Ga0207707_10396994 3300025912 Bacteria 1184
608 Ga0207695_10014006 3300025913 Bacteria 9524
609 Ga0207695_10180477 3300025913 Bacteria 2032
610 Ga0207695_10245272 3300025913 Bacteria 1691
611 Ga0207695_11249396 3300025913 Bacteria 623
612 Ga0207671_10040649 3300025914 Bacteria 3442
613 Ga0207671_10054875 3300025914 Bacteria 2952
614 Ga0207671_10779050 3300025914 Bacteria 759
615 Ga0207660_10008701 3300025917 Bacteria 6565
616 Ga0207662_10027872 3300025918 Bacteria 3262
617 Ga0207662_10644355 3300025918 Bacteria 740
618 Ga0207657_10048889 3300025919 Bacteria 3690
619 Ga0207657_10161733 3300025919 Bacteria 1818
620 Ga0207657_10193071 3300025919 Bacteria 1642
621 Ga0207649_10000854 3300025920 Bacteria 19496
622 Ga0207649_10185766 3300025920 Bacteria 1458
623 Ga0207649_10459151 3300025920 Bacteria 963
624 Ga0207649_10894139 3300025920 Bacteria 696
625 Ga0207652_10047333 3300025921 Bacteria 3673
626 Ga0207681_10000205 3300025923 Bacteria 47034
627 Ga0207681_10039158 3300025923 Bacteria 3145
628 Ga0207681_10102057 3300025923 Bacteria 2071
629 Ga0207681_10633531 3300025923 Bacteria 885
630 Ga0207694_10031573 3300025924 Bacteria 4047
631 Ga0207694_10272978 3300025924 Bacteria 1387
632 Ga0207650_10012226 3300025925 Bacteria 5923
633 Ga0207650_10012959 3300025925 Bacteria 5764
634 Ga0207650_10044672 3300025925 Bacteria 3256
635 Ga0207650_10103917 3300025925 Bacteria 2191
636 Ga0207650_10458750 3300025925 Bacteria 1061
637 Ga0207650_10796895 3300025925 Bacteria 801
638 Ga0207659_10016801 3300025926 Bacteria 4771
639 Ga0207659_10019506 3300025926 Bacteria 4466
640 Ga0207659_10019707 3300025926 Bacteria 4446
641 Ga0207659_10253328 3300025926 Bacteria 1429
642 Ga0207687_10322174 3300025927 Bacteria 1251
643 Ga0207687_11003990 3300025927 Bacteria 716
644 Ga0207644_10003106 3300025931 Bacteria 10690
645 Ga0207644_10009861 3300025931 Bacteria 6282
646 Ga0207644_10027264 3300025931 Bacteria 3946
647 Ga0207644_10042654 3300025931 Bacteria 3216
648 Ga0207644_10258571 3300025931 Bacteria 1391
649 Ga0207644_10491634 3300025931 Bacteria 1011
650 Ga0207644_10602757 3300025931 Bacteria 912
651 Ga0207644_10833212 3300025931 Bacteria 772
652 Ga0207644_11807705 3300025931 Bacteria 511
653 Ga0207690_10000647 3300025932 Bacteria 22356
654 Ga0207690_10032066 3300025932 Bacteria 3368
655 Ga0207690_10185032 3300025932 Bacteria 1571
656 Ga0207690_10624365 3300025932 Bacteria 881
657 Ga0207690_11109829 3300025932 Bacteria 659
658 Ga0207690_11203010 3300025932 Bacteria 633
659 Ga0207706_10000933 3300025933 Bacteria 29885
660 Ga0207706_10112176 3300025933 Bacteria 2399
661 Ga0207706_10126484 3300025933 Bacteria 2248
662 Ga0207706_10146781 3300025933 Bacteria 2075
663 Ga0207706_10484308 3300025933 Bacteria 1069
664 Ga0207706_10951065 3300025933 Bacteria 724
665 Ga0207686_10623790 3300025934 Bacteria 851
666 Ga0207709_10001039 3300025935 Bacteria 20507
667 Ga0207709_10001336 3300025935 Bacteria 17405
668 Ga0207709_10009154 3300025935 Bacteria 5454
669 Ga0207709_10045943 3300025935 Bacteria 2647
670 Ga0207709_10191960 3300025935 Bacteria 1452
671 Ga0207670_10283587 3300025936 Bacteria 1292
672 Ga0207670_10574333 3300025936 Bacteria 923
673 Ga0207669_10255865 3300025937 Bacteria 1307
674 Ga0207669_10398681 3300025937 Bacteria 1077
675 Ga0207669_10920399 3300025937 Bacteria 731
676 Ga0207704_10012031 3300025938 Bacteria 4282
677 Ga0207704_10013827 3300025938 Bacteria 4055
678 Ga0207704_10686111 3300025938 Bacteria 847
679 Ga0207704_10976203 3300025938 Bacteria 715
680 Ga0207691_10150581 3300025940 Bacteria 2046
681 Ga0207691_10167907 3300025940 Bacteria 1923
682 Ga0207691_10203561 3300025940 Bacteria 1722
683 Ga0207691_10215368 3300025940 Bacteria 1667
684 Ga0207691_10222523 3300025940 Bacteria 1636
685 Ga0207691_10237160 3300025940 Bacteria 1578
686 Ga0207691_10237716 3300025940 Bacteria 1576
687 Ga0207691_10422560 3300025940 Bacteria 1136
688 Ga0207691_10596866 3300025940 Bacteria 935
689 Ga0207711_10005887 3300025941 Bacteria 10351
690 Ga0207711_10017744 3300025941 Bacteria 5913
691 Ga0207711_10098799 3300025941 Bacteria 2579
692 Ga0207711_10161734 3300025941 Bacteria 2027
693 Ga0207711_10163673 3300025941 Bacteria 2015
694 Ga0207711_10620217 3300025941 Bacteria 1009
695 Ga0207689_10000150 3300025942 Bacteria 60037
696 Ga0207689_10004063 3300025942 Bacteria 13296
697 Ga0207689_10039825 3300025942 Bacteria 3890
698 Ga0207689_10092876 3300025942 Bacteria 2479
699 Ga0207661_10223625 3300025944 Bacteria 1664
700 Ga0207661_10251383 3300025944 Bacteria 1571
701 Ga0207679_10000526 3300025945 Bacteria 25924
702 Ga0207679_10376029 3300025945 Bacteria 1244
703 Ga0207679_10735391 3300025945 Bacteria 897
704 Ga0207679_11091027 3300025945 Bacteria 732
705 Ga0207667_10017670 3300025949 Bacteria 8024
706 Ga0207667_10051278 3300025949 Bacteria 4351
707 Ga0207667_10058792 3300025949 Bacteria 4030
708 Ga0207667_10365980 3300025949 Bacteria 1470
709 Ga0207667_10422799 3300025949 Bacteria 1356
710 Ga0207667_10947305 3300025949 Bacteria 850
711 Ga0207651_10024727 3300025960 Bacteria 3720
712 Ga0207651_10054500 3300025960 Bacteria 2740
713 Ga0207651_10070213 3300025960 Bacteria 2477
714 Ga0207651_10139322 3300025960 Bacteria 1871
715 Ga0207651_10250820 3300025960 Bacteria 1448
716 Ga0207651_10368328 3300025960 Bacteria 1215
717 Ga0207651_10667556 3300025960 Bacteria 913
718 Ga0207651_10915573 3300025960 Bacteria 781
719 Ga0207651_11025210 3300025960 Bacteria 738
720 Ga0207712_10005810 3300025961 Bacteria 7776
721 Ga0207712_10235612 3300025961 Bacteria 1472
722 Ga0207712_11092450 3300025961 Bacteria 710
723 Ga0207712_11125984 3300025961 Bacteria 699
724 Ga0207712_12025538 3300025961 Unclassified 515
725 Ga0207668_10011424 3300025972 Bacteria 5395
726 Ga0207668_10122135 3300025972 Bacteria 1974
727 Ga0207668_10562435 3300025972 Bacteria 989
728 Ga0207668_10722312 3300025972 Bacteria 877
729 Ga0207668_10824186 3300025972 Bacteria 822
730 Ga0207668_11066805 3300025972 Bacteria 723
731 Ga0207640_10028981 3300025981 Bacteria 3392
732 Ga0207640_10171123 3300025981 Bacteria 1619
733 Ga0207640_10997769 3300025981 Bacteria 736
734 Ga0207658_10214471 3300025986 Bacteria 1615
735 Ga0207658_10309228 3300025986 Bacteria 1364
736 Ga0207658_11228038 3300025986 Bacteria 685
737 Ga0207677_10004048 3300026023 Bacteria 7828
738 Ga0207677_10005813 3300026023 Bacteria 6713
739 Ga0207677_10324355 3300026023 Bacteria 1281
740 Ga0207677_10327566 3300026023 Bacteria 1275
741 Ga0207677_10428668 3300026023 Bacteria 1128
742 Ga0207677_10552653 3300026023 Bacteria 1004
743 Ga0207703_10004632 3300026035 Bacteria 11238
744 Ga0207703_10229407 3300026035 Bacteria 1664
745 Ga0207703_10433776 3300026035 Bacteria 1225
746 Ga0207639_10103548 3300026041 Bacteria 2306
747 Ga0207639_10168705 3300026041 Bacteria 1851
748 Ga0207639_10351030 3300026041 Bacteria 1317
749 Ga0207639_10615356 3300026041 Bacteria 1002
750 Ga0207639_10793875 3300026041 Bacteria 882
751 Ga0207639_11221784 3300026041 Bacteria 705
752 Ga0207678_10002944 3300026067 Bacteria 15425
753 Ga0207678_10019447 3300026067 Bacteria 5967
754 Ga0207678_10173833 3300026067 Bacteria 1839
755 Ga0207678_10342410 3300026067 Bacteria 1289
756 Ga0207708_10353375 3300026075 Bacteria 1206
757 Ga0207702_10000858 3300026078 Bacteria 31796
758 Ga0207702_10092086 3300026078 Bacteria 2656
759 Ga0207702_11283335 3300026078 Bacteria 726
760 Ga0207641_10023323 3300026088 Bacteria 5099
761 Ga0207641_10112740 3300026088 Bacteria 2413
762 Ga0207641_10115736 3300026088 Bacteria 2384
763 Ga0207641_10422615 3300026088 Bacteria 1283
764 Ga0207641_10494474 3300026088 Bacteria 1187
765 Ga0207641_11894274 3300026088 Bacteria 598
766 Ga0207648_10000032 3300026089 Bacteria 128009
767 Ga0207648_10046240 3300026089 Bacteria 3816
768 Ga0207648_10190457 3300026089 Bacteria 1817
769 Ga0207648_10201201 3300026089 Bacteria 1766
770 Ga0207648_10283704 3300026089 Bacteria 1481
771 Ga0207648_10343108 3300026089 Bacteria 1345
772 Ga0207648_10416284 3300026089 Bacteria 1220
773 Ga0207648_10478695 3300026089 Bacteria 1137
774 Ga0207648_11494378 3300026089 Bacteria 635
775 Ga0207676_10001384 3300026095 Bacteria 18052
776 Ga0207676_10041627 3300026095 Bacteria 3528
777 Ga0207676_10049899 3300026095 Bacteria 3259
778 Ga0207676_10076457 3300026095 Bacteria 2705
779 Ga0207676_10101156 3300026095 Bacteria 2389
780 Ga0207676_10270744 3300026095 Bacteria 1538
781 Ga0207676_10657058 3300026095 Bacteria 1012
782 Ga0207674_10026390 3300026116 Bacteria 6172
783 Ga0207674_10399920 3300026116 Bacteria 1327
784 Ga0207674_10640577 3300026116 Bacteria 1026
785 Ga0207675_100007544 3300026118 Bacteria 10277
786 Ga0207675_100019975 3300026118 Bacteria 6251
787 Ga0207675_100024771 3300026118 Bacteria 5583
788 Ga0207675_100276646 3300026118 Bacteria 1630
789 Ga0207675_100344070 3300026118 Bacteria 1460
790 Ga0207675_100512014 3300026118 Bacteria 1196
791 Ga0207675_102088726 3300026118 Bacteria 583
792 Ga0207683_10071385 3300026121 Bacteria 3069
793 Ga0207683_10087371 3300026121 Bacteria 2773
794 Ga0207683_10139849 3300026121 Bacteria 2181
795 Ga0207683_10203248 3300026121 Bacteria 1801
796 Ga0207683_10216018 3300026121 Bacteria 1746
797 Ga0207683_10222535 3300026121 Bacteria 1720
798 Ga0207683_10241093 3300026121 Bacteria 1649
799 Ga0207683_10264170 3300026121 Bacteria 1572
800 Ga0207683_10368754 3300026121 Bacteria 1319
801 Ga0207683_10657540 3300026121 Bacteria 971
802 Ga0207683_11426343 3300026121 Bacteria 640
803 Ga0207698_10017650 3300026142 Bacteria 4848
804 Ga0207698_10113841 3300026142 Bacteria 2274
805 Ga0207698_10222604 3300026142 Bacteria 1706
806 Ga0207698_10341704 3300026142 Bacteria 1410
807 Ga0207698_10616022 3300026142 Bacteria 1072
808 Ga0207698_11153163 3300026142 Bacteria 788
809 Ga0207698_11189237 3300026142 Bacteria 776
810 Ga0207698_11391276 3300026142 Bacteria 717
811 Ga0209281_1000454 3300027111 Bacteria 58234
812 Ga0209371_1000004 3300027312 Bacteria 1098197
813 Ga0209371_1000139 3300027312 Bacteria 120350
814 Ga0209371_1012163 3300027312 Bacteria 2510
815 Ga0209981_1033683 3300027378 Bacteria 755
816 Ga0209995_1000673 3300027471 Bacteria 5247
817 Ga0209968_1004004 3300027526 Bacteria 2211
818 Ga0209999_1006384 3300027543 Bacteria 2119
819 Ga0209966_1000013 3300027695 Bacteria 83121
820 Ga0209974_10127120 3300027876 Bacteria 907
821 Ga0268266_10500541 3300028379 Bacteria 1160
822 Ga0268266_10557448 3300028379 Bacteria 1098
823 Ga0268266_10943343 3300028379 Bacteria 835
824 Ga0268265_10184817 3300028380 Bacteria 1794
825 Ga0268265_10943258 3300028380 Bacteria 850
826 Ga0268265_11436131 3300028380 Bacteria 692
827 Ga0268265_11956048 3300028380 Bacteria 593
828 Ga0268264_10003680 3300028381 Bacteria 13159
829 Ga0268264_10184062 3300028381 Bacteria 1899
830 Ga0268264_11163655 3300028381 Bacteria 780
831 Ga0265334_10068616 3300028573 Bacteria 1324
832 Ga0265336_10000048 3300028666 Bacteria 121572
833 Ga0307515_10031544 3300028794 Bacteria 8829
834 Ga0307515_10094450 3300028794 Bacteria 3694
835 Ga0268256_1000109 3300030500 Bacteria 120350
836 Ga0268256_1001254 3300030500 Bacteria 15855
837 Ga0268256_1014691 3300030500 Bacteria 2312
838 Ga0307511_10226617 3300030521 Bacteria 931
839 Ga0316177_1050317 3300030731 Bacteria 3595
840 Ga0314311_1227100 3300030733 Bacteria 1618
841 Ga0316178_1026542 3300030735 Bacteria 1051
842 Ga0316178_1140499 3300030735 Bacteria 953
843 Ga0316183_1078833 3300030742 Bacteria 911
844 Ga0316181_1113656 3300030744 Bacteria 1970
845 Ga0265328_10016658 3300031239 Bacteria 2856
846 Ga0265331_10004885 3300031250 Bacteria 8247
847 Ga0265327_10000043 3300031251 Bacteria 285108
848 Ga0265327_10095114 3300031251 Bacteria 1447
849 Ga0307513_10015579 3300031456 Bacteria 9209
850 Ga0307513_10057584 3300031456 Bacteria 4138
851 Ga0307509_10276599 3300031507 Bacteria 1443
852 Ga0307509_10283844 3300031507 Bacteria 1415
853 Ga0307408_100000038 3300031548 Bacteria 183170
854 Ga0307408_100286496 3300031548 Bacteria 1374
855 Ga0307408_100378910 3300031548 Bacteria 1209
856 Ga0307408_100641997 3300031548 Bacteria 948
857 Ga0307408_101159865 3300031548 Bacteria 719
858 Ga0307408_101211774 3300031548 Bacteria 704
859 Ga0307514_10031043 3300031649 Bacteria 4285
860 Ga0307516_10044934 3300031730 Bacteria 4366
861 Ga0307405_10161697 3300031731 Bacteria 1587
862 Ga0307405_10360148 3300031731 Bacteria 1125
863 Ga0307405_10874873 3300031731 Bacteria 758
864 Ga0307413_10035338 3300031824 Bacteria 2865
865 Ga0307413_10783783 3300031824 Bacteria 800
866 Ga0307413_11255018 3300031824 Bacteria 646
867 Ga0307410_10811381 3300031852 Bacteria 796
868 Ga0307406_10234019 3300031901 Bacteria 1374
869 Ga0307406_10348724 3300031901 Bacteria 1156
870 Ga0307406_11570938 3300031901 Bacteria 580
871 Ga0307407_10795692 3300031903 Bacteria 719
872 Ga0307412_10052360 3300031911 Bacteria 2703
873 Ga0307412_10312586 3300031911 Bacteria 1246
874 Ga0307409_101340320 3300031995 Bacteria 741
875 Ga0307416_100005668 3300032002 Bacteria 7714
876 Ga0307416_100924902 3300032002 Bacteria 973
877 Ga0307416_102243329 3300032002 Bacteria 647
878 Ga0307414_10001112 3300032004 Bacteria 13729
879 Ga0307414_10030948 3300032004 Bacteria 3502
880 Ga0307414_10035139 3300032004 Bacteria 3332
881 Ga0307414_10084330 3300032004 Bacteria 2337
882 Ga0307414_10124210 3300032004 Bacteria 1990
883 Ga0307414_10157996 3300032004 Bacteria 1797
884 Ga0307411_10145016 3300032005 Bacteria 1756
885 Ga0307411_10559843 3300032005 Bacteria 977
886 Ga0307411_11534074 3300032005 Bacteria 613
887 Ga0307411_11614389 3300032005 Bacteria 598
888 Ga0307411_11673954 3300032005 Bacteria 588
889 Ga0307415_100229695 3300032126 Bacteria 1493
890 Ga0307510_10411944 3300033180 Bacteria 794
891 Ga0373926_0139989 3300035083 Bacteria 919
892 Ga0373934_0098868 3300035086 Bacteria 1179
893 Ga0373944_0023948 3300035089 Bacteria 1785
894 Ga0373944_0095002 3300035089 Bacteria 1001
895 Ga0373949_0008217 3300035090 Bacteria 2286
896 Ga0373939_0039567 3300035114 Bacteria 1412
897 Ga0373941_0194969 3300035115 Bacteria 767
898 Ga0373945_0130581 3300035116 Bacteria 1006
899 Ga0373954_0266143 3300035118 Bacteria 844
900 Ga0373943_0017704 3300035170 Bacteria 3262
901 Ga0373943_0182775 3300035170 Bacteria 1153
902 Ga0373943_0268024 3300035170 Bacteria 963
903 Ga0373946_0088812 3300035171 Bacteria 1366
904 Ga0373955_0044738 3300035172 Bacteria 2386
905 Ga0373931_0004526 3300035691 Bacteria 6359
906 Ga0373931_0015753 3300035691 Bacteria 3710
907 Ga0373931_0464139 3300035691 Bacteria 812
908 Ga0373935_0025734 3300035692 Bacteria 3627
909 Ga0373927_0100032 3300035695 Bacteria 1886
910 Ga0373933_0266582 3300035724 Bacteria 1105
911 Ga0373947_0176775 3300035725 Bacteria 1388
912 Ga0373937_1581300 3300036401 Archaea 603
913 Ga0373925_0034245 3300037068 Bacteria 3743
914 Ga0373925_0240421 3300037068 Bacteria 1450
915 Ga0395898_0071311 3300037466 Bacteria 3357
916 Ga0395905_0007830 3300037471 Bacteria 10586
917 Ga0395905_0085597 3300037471 Bacteria 2953
918 Ga0395905_0677221 3300037471 Bacteria 934
919 Ga0395901_0002425 3300038443 Bacteria 18923
920 Ga0237819_00165 3300038705 Bacteria 24228
921 Ga0237819_03731 3300038705 Bacteria 2637
922 Ga0237819_23238 3300038705 Bacteria 613
923 Ga0237816_00056 3300039145 Bacteria 7446
924 Ga0436361_0001966 3300039447 Bacteria 850
925 Ga0436361_0082864 3300039447 Bacteria 107951
926 Ga0436361_0196856 3300039447 Bacteria 12572
927 Ga0436361_0243330 3300039447 Bacteria 1905
928 Ga0436361_0298548 3300039447 Bacteria 2699
929 Ga0436361_0417753 3300039447 Bacteria 644
930 Ga0436361_0875016 3300039447 Bacteria 1585
931 Ga0439436_0029225 3300041404 Bacteria 1606
932 Ga0439436_0046239 3300041404 Bacteria 1237
933 Ga0439436_0049064 3300041404 Bacteria 1196
934 Ga0439436_0078777 3300041404 Bacteria 917
935 Ga0439439_0018662 3300041406 Bacteria 1716
936 Ga0439447_009343 3300041407 Bacteria 2980
937 Ga0439461_0098887 3300041410 Bacteria 708
938 Ga0439465_0000224 3300041413 Bacteria 15264
939 Ga0439465_0043300 3300041413 Bacteria 1460
940 Ga0451787_452960 3300041441 Bacteria 1038
941 Ga0451789_0698365 3300041443 Bacteria 2226
942 Ga0451789_1349124 3300041443 Bacteria 872
943 Ga0451791_0319337 3300041451 Bacteria 1116
944 Ga0451791_0672470 3300041451 Bacteria 1622
945 Ga0451791_1799097 3300041451 Bacteria 783
946 Ga0451793_0050907 3300041452 Bacteria 608
947 Ga0451793_0143369 3300041452 Bacteria 1375
948 Ga0451793_0248334 3300041452 Bacteria 1186
949 Ga0451793_0594577 3300041452 Bacteria 3345
950 Ga0451793_0678761 3300041452 Bacteria 1002
951 Ga0451793_0736074 3300041452 Bacteria 883
952 Ga0451793_1247833 3300041452 Bacteria 576
953 Ga0451797_0685350 3300041453 Bacteria 637
954 Ga0451797_1106636 3300041453 Bacteria 1282
955 Ga0451797_1204767 3300041453 Bacteria 1499
956 Ga0451797_1248801 3300041453 Bacteria 1257
957 Ga0451795_1315014 3300041456 Bacteria 729
958 Ga0451795_1586870 3300041456 Bacteria 1220
959 Ga0451800_0098586 3300041459 Bacteria 16354
960 Ga0451800_0163389 3300041459 Bacteria 606
961 Ga0451800_0493538 3300041459 Bacteria 536
962 Ga0451800_1079773 3300041459 Bacteria 516
963 Ga0451802_1524292 3300041460 Bacteria 1115
964 Ga0451802_1644705 3300041460 Bacteria 687
965 Ga0451802_1817188 3300041460 Bacteria 800
966 Ga0451802_1988730 3300041460 Bacteria 1486
967 Ga0451806_420239 3300041462 Bacteria 6696
968 Ga0451804_0562792 3300041463 Bacteria 3717
969 Ga0451807_0155804 3300041486 Bacteria 1131
970 Ga0451807_0183383 3300041486 Bacteria 4326
971 Ga0451807_1621004 3300041486 Bacteria 1475
972 Ga0451807_1664147 3300041486 Bacteria 4084
973 Ga0451807_1787886 3300041486 Bacteria 743
974 Ga0451837_0237264 3300041494 Bacteria 1207
975 Ga0451837_0800704 3300041494 Bacteria 647
976 Ga0451837_1130467 3300041494 Bacteria 1050
977 Ga0451837_1211241 3300041494 Bacteria 3067
978 Ga0451841_0157733 3300041498 Bacteria 1074
979 Ga0451841_0649399 3300041498 Bacteria 573
980 Ga0451841_1302887 3300041498 Bacteria 855
981 Ga0451841_1334294 3300041498 Bacteria 1134
982 Ga0451849_1462010 3300041505 Bacteria 681
983 Ga0451843_0012520 3300041509 Bacteria 12259
984 Ga0451843_0155094 3300041509 Bacteria 1304
985 Ga0451843_0200154 3300041509 Bacteria 784
986 Ga0451843_0206726 3300041509 Bacteria 954
987 Ga0451843_0305339 3300041509 Bacteria 679
988 Ga0451843_1170934 3300041509 Bacteria 1602
989 Ga0451843_1499722 3300041509 Bacteria 812
990 Ga0451843_1503963 3300041509 Bacteria 532
991 Ga0451843_1540849 3300041509 Bacteria 898
992 Ga0451853_0334304 3300041512 Bacteria 802
993 Ga0451853_1029461 3300041512 Bacteria 799
994 Ga0439433_0053903 3300041999 Bacteria 951
995 Ga0439433_0070620 3300041999 Bacteria 841
996 Ga0439433_0092143 3300041999 Bacteria 746
997 Ga0439433_0093817 3300041999 Bacteria 740
998 Ga0439445_0004656 3300042004 Bacteria 3110
999 Ga0439445_0027529 3300042004 Bacteria 1461
1000 Ga0439445_0097862 3300042004 Bacteria 831
1001 Ga0439432_019776 3300042006 Bacteria 2241
1002 Ga0439432_120041 3300042006 Bacteria 779
1003 Ga0439432_172159 3300042006 Bacteria 632
1004 Ga0439449_0005798 3300042007 Bacteria 4721
1005 Ga0439449_0013136 3300042007 Bacteria 3115
1006 Ga0439449_0013961 3300042007 Bacteria 3021
1007 Ga0439449_0029827 3300042007 Bacteria 2032
1008 Ga0439449_0051250 3300042007 Bacteria 1526
1009 Ga0439449_0109806 3300042007 Bacteria 1021
1010 Ga0439452_025555 3300042010 Bacteria 1498
1011 Ga0439454_006386 3300042011 Bacteria 1447
1012 Ga0439462_0067379 3300042015 Bacteria 971
1013 Ga0439462_0172200 3300042015 Bacteria 612
1014 Ga0450911_005582 3300042115 Bacteria 1934
1015 Ga0450919_001239 3300042121 Bacteria 3337
1016 Ga0450890_007668 3300042127 Bacteria 1380
1017 Ga0450890_011251 3300042127 Bacteria 1154
1018 Ga0439458_0120940 3300042157 Bacteria 689
1019 Ga0439434_0041674 3300042435 Bacteria 1411
1020 Ga0439435_0099125 3300042436 Bacteria 894
1021 Ga0439459_0000618 3300042438 Bacteria 4773
1022 Ga0450918_000320 3300042531 Bacteria 10812
1023 Ga0450901_007565 3300042533 Bacteria 1118
1024 Ga0451577_0177731 3300042876 Bacteria 1919
1025 Ga0466963_0453115 3300044694 Bacteria 905
1026 Ga0466963_0935684 3300044694 Bacteria 610
1027 Ga0453684_0118653 3300044712 Bacteria 3199
1028 Ga0453684_0473057 3300044712 Bacteria 1391
1029 Ga0453684_0584012 3300044712 Bacteria 1227
1030 Ga0451576_0041719 3300045051 Bacteria 4850
1031 Ga0451576_2363323 3300045051 Bacteria 544
1032 Ga0495627_095254 3300046453 Bacteria 853
1033 Ga0495592_0473932 3300046454 Bacteria 781
1034 Ga0495629_0180753 3300046459 Bacteria 1462
1035 Ga0495629_0330467 3300046459 Bacteria 1041
1036 Ga0495638_0032789 3300046460 Bacteria 3325
1037 Ga0495638_0156728 3300046460 Bacteria 1317
1038 Ga0495638_0265569 3300046460 Bacteria 939
1039 Ga0495651_0260417 3300046462 Bacteria 1180
1040 Ga0495580_0213174 3300046472 Bacteria 1328
1041 Ga0495580_0517029 3300046472 Bacteria 796
1042 Ga0495639_0018018 3300046475 Bacteria 3071
1043 Ga0495639_0392848 3300046475 Bacteria 700
1044 Ga0495607_0053436 3300046501 Bacteria 2334
1045 Ga0495583_0000017 3300046506 Bacteria 310888
1046 Ga0495606_0002049 3300046507 Bacteria 24679
1047 Ga0495606_0017003 3300046507 Bacteria 5517
1048 Ga0495608_0257061 3300046511 Bacteria 1088
1049 Ga0495610_0013938 3300046512 Bacteria 4750
1050 Ga0495610_0214813 3300046512 Bacteria 780
1051 Ga0495616_0163313 3300046513 Bacteria 1000
1052 Ga0495616_0260072 3300046513 Bacteria 743
1053 Ga0495628_0053645 3300046516 Bacteria 3181
1054 Ga0495631_0020149 3300046518 Bacteria 3119
1055 Ga0495631_0424324 3300046518 Bacteria 566
1056 Ga0495643_0017194 3300046522 Bacteria 4232
1057 Ga0495643_0166135 3300046522 Bacteria 1082
1058 Ga0495643_0177871 3300046522 Bacteria 1036
1059 Ga0495644_0370484 3300046523 Bacteria 565
1060 Ga0495663_0000403 3300046525 Bacteria 15874
1061 Ga0495663_0010083 3300046525 Bacteria 2624
1062 Ga0495663_0025947 3300046525 Bacteria 1712
1063 Ga0495663_0037832 3300046525 Bacteria 1456
1064 Ga0495652_0149595 3300046529 Bacteria 1826
1065 Ga0495586_0174081 3300046535 Bacteria 1216
1066 Ga0495598_0002515 3300046537 Bacteria 3790
1067 Ga0495621_0018217 3300046539 Bacteria 2278
1068 Ga0495645_0205136 3300046543 Bacteria 1334
1069 Ga0495633_0041373 3300046558 Bacteria 2191
1070 Ga0495633_0065198 3300046558 Bacteria 1702
1071 Ga0495633_0073528 3300046558 Bacteria 1593
1072 Ga0495633_0075520 3300046558 Bacteria 1569
1073 Ga0495633_0172944 3300046558 Bacteria 995
1074 Ga0495667_0480747 3300046559 Bacteria 779
1075 Ga0495668_0004728 3300046616 Bacteria 9544
1076 Ga0495625_0162856 3300046660 Bacteria 1493
1077 Ga0495647_0081064 3300046681 Bacteria 1316
1078 Ga0495658_0067293 3300046683 Bacteria 2071
1079 Ga0495669_0043381 3300046684 Bacteria 2002
1080 Ga0495613_0315803 3300046689 Bacteria 1079
1081 Ga0495670_0304692 3300046691 Bacteria 854
1082 Ga0495649_0000290 3300046694 Bacteria 44246
1083 Ga0495589_0022418 3300046794 Bacteria 3222
1084 Ga0495600_0289034 3300046809 Bacteria 1036
1085 Ga0495660_0070482 3300046810 Bacteria 1855
1086 Ga0495581_0816904 3300047315 Bacteria 534
1087 Ga0495674_0170461 3300047319 Bacteria 1817
1088 Ga0495672_0020455 3300047320 Bacteria 4337
1089 Ga0495676_0677485 3300047321 Bacteria 668
1090 Ga0495680_0141619 3300047322 Bacteria 1759
1091 Ga0495681_0108015 3300047470 Bacteria 1208
1092 Ga0495681_0164916 3300047470 Bacteria 920
1093 Ga0495684_0194495 3300047471 Bacteria 1498
1094 Ga0495684_0414770 3300047471 Bacteria 942
1095 Ga0495686_0007645 3300047472 Bacteria 8069
1096 Ga0495686_0031505 3300047472 Bacteria 3438
1097 Ga0495686_0063006 3300047472 Bacteria 2298
1098 Ga0495614_0533740 3300048089 Bacteria 560
1099 Ga0496100_0352475 3300048903 Bacteria 1112
1100 Ga0496101_0025070 3300048904 Bacteria 4134
1101 Ga0496101_0605370 3300048904 Bacteria 866
1102 Ga0496101_1123846 3300048904 Bacteria 617
1103 Ga0496102_0021039 3300048905 Bacteria 5769
1104 Ga0496102_1164163 3300048905 Bacteria 691
1105 Ga0496102_1648442 3300048905 Bacteria 559
1106 Ga0496104_0031783 3300048907 Bacteria 4911
1107 Ga0496104_0180037 3300048907 Bacteria 2024
1108 Ga0496104_0274434 3300048907 Bacteria 1599
1109 Ga0496104_0834569 3300048907 Bacteria 827
1110 Ga0496105_0112275 3300048908 Bacteria 2249
1111 Ga0496105_0293844 3300048908 Bacteria 1308
1112 Ga0496105_0310431 3300048908 Bacteria 1266
1113 Ga0496105_1020548 3300048908 Bacteria 618
1114 Ga0496106_0136718 3300048909 Bacteria 1925
1115 Ga0496107_0009476 3300048910 Bacteria 6755
1116 Ga0496107_0617220 3300048910 Bacteria 801
1117 Ga0496107_1156862 3300048910 Bacteria 557
1118 Ga0496108_0028568 3300048911 Bacteria 4615
1119 Ga0496108_0090486 3300048911 Bacteria 2601
1120 Ga0496108_0171248 3300048911 Bacteria 1878
1121 Ga0496108_1358367 3300048911 Bacteria 596
1122 Ga0496108_1505014 3300048911 Bacteria 560
1123 Ga0496109_0241197 3300048912 Bacteria 1701
1124 Ga0496109_0303698 3300048912 Bacteria 1505
1125 Ga0496109_0318559 3300048912 Bacteria 1467
1126 Ga0496109_0499144 3300048912 Bacteria 1149
1127 Ga0496110_0085437 3300048913 Bacteria 2816
1128 Ga0496110_0415617 3300048913 Bacteria 1226
1129 Ga0496110_0528202 3300048913 Bacteria 1073
1130 Ga0496110_0597742 3300048913 Bacteria 1001
1131 Ga0496110_1190467 3300048913 Bacteria 671
1132 Ga0496111_0561302 3300048914 Bacteria 838
1133 Ga0496113_0040667 3300048916 Bacteria 3427
1134 Ga0496113_0321985 3300048916 Bacteria 1239
1135 Ga0496113_0886030 3300048916 Bacteria 706
1136 Ga0496114_0015156 3300048917 Bacteria 6200
1137 Ga0496114_0074221 3300048917 Bacteria 2863
1138 Ga0496114_0272554 3300048917 Bacteria 1491
1139 Ga0496114_0793921 3300048917 Bacteria 825
1140 Ga0496114_1346753 3300048917 Bacteria 601
1141 Ga0496115_0553805 3300048918 Bacteria 919
1142 Ga0496116_0031581 3300048919 Bacteria 3788
1143 Ga0496116_0033409 3300048919 Bacteria 3651
1144 Ga0496117_0001966 3300048920 Bacteria 27335
1145 Ga0496117_0040292 3300048920 Bacteria 3436
1146 Ga0496117_0058821 3300048920 Bacteria 2659
1147 Ga0496117_0070332 3300048920 Bacteria 2351
1148 Ga0496117_0070874 3300048920 Bacteria 2338
1149 Ga0496117_0342268 3300048920 Bacteria 775
1150 Ga0496118_0027915 3300048921 Bacteria 4766
1151 Ga0496118_0032595 3300048921 Bacteria 4287
1152 Ga0496118_0045304 3300048921 Bacteria 3435
1153 Ga0496118_0107848 3300048921 Bacteria 1858
1154 Ga0496118_0168104 3300048921 Bacteria 1344
1155 Ga0496118_0189991 3300048921 Bacteria 1229
1156 Ga0496118_0404177 3300048921 Bacteria 708
1157 Ga0496119_0000255 3300048922 Bacteria 75611
1158 Ga0496119_0004546 3300048922 Bacteria 13747
1159 Ga0496119_0149564 3300048922 Bacteria 1253
1160 Ga0496120_0000240 3300048923 Bacteria 93297
1161 Ga0496120_0000598 3300048923 Bacteria 54693
1162 Ga0496121_0008127 3300048924 Bacteria 12469
1163 Ga0496121_0098890 3300048924 Bacteria 2256
1164 Ga0496121_0157964 3300048924 Bacteria 1662
1165 Ga0496121_0648438 3300048924 Bacteria 643
1166 Ga0496122_0000663 3300048925 Bacteria 69218
1167 Ga0496122_0006648 3300048925 Bacteria 13181
1168 Ga0496122_0097579 3300048925 Bacteria 1977
1169 Ga0496122_0128618 3300048925 Bacteria 1615
1170 Ga0496122_0142513 3300048925 Bacteria 1496
1171 Ga0496122_0455300 3300048925 Bacteria 633
1172 Ga0496122_0472294 3300048925 Bacteria 616
1173 Ga0496123_0000828 3300048926 Bacteria 49715
1174 Ga0496123_0001279 3300048926 Bacteria 35949
1175 Ga0496123_0023685 3300048926 Bacteria 4692
1176 Ga0496123_0098020 3300048926 Bacteria 1715
1177 Ga0496123_0121913 3300048926 Bacteria 1464
1178 Ga0496123_0129133 3300048926 Bacteria 1404
1179 Ga0496123_0204322 3300048926 Bacteria 1009
1180 Ga0496123_0309310 3300048926 Bacteria 750
1181 Ga0496124_0000009 3300048927 Bacteria 734820
1182 Ga0496124_0021163 3300048927 Bacteria 5995
1183 Ga0496124_0026783 3300048927 Bacteria 5191
1184 Ga0496124_0030421 3300048927 Bacteria 4792
1185 Ga0496124_0076288 3300048927 Bacteria 2767
1186 Ga0496124_0172938 3300048927 Bacteria 1670
1187 Ga0496124_0188838 3300048927 Bacteria 1579
1188 Ga0496124_0204340 3300048927 Bacteria 1499
1189 Ga0496124_0280324 3300048927 Bacteria 1215
1190 Ga0496124_0303126 3300048927 Bacteria 1152
1191 Ga0496125_0025528 3300048928 Bacteria 5408
1192 Ga0496125_0071631 3300048928 Bacteria 2706
1193 Ga0496125_0077343 3300048928 Bacteria 2565
1194 Ga0496125_0089734 3300048928 Bacteria 2310
1195 Ga0496125_0100233 3300048928 Bacteria 2136
1196 Ga0496125_0112107 3300048928 Bacteria 1972
1197 Ga0496125_0148737 3300048928 Bacteria 1613
1198 Ga0496125_0717106 3300048928 Bacteria 528
1199 Ga0496126_0006652 3300048929 Bacteria 12862
1200 Ga0496126_0084112 3300048929 Bacteria 2807
1201 Ga0496126_0086702 3300048929 Bacteria 2759
1202 Ga0496126_0208506 3300048929 Bacteria 1646
1203 Ga0496126_0345333 3300048929 Bacteria 1218
1204 Ga0496126_0375082 3300048929 Bacteria 1159
1205 Ga0501306_023887 3300049127 Bacteria 870
1206 Ga0501308_007083 3300049128 Bacteria 1167
1207 Ga0501309_001733 3300049129 Bacteria 2217
1208 Ga0501310_000865 3300049130 Bacteria 2705
1209 Ga0501310_028433 3300049130 Bacteria 733
1210 Ga0501304_000917 3300049160 Bacteria 1739
1211 Ga0501304_018257 3300049160 Bacteria 676
1212 Ga0501305_003418 3300049161 Bacteria 1795
1213 Ga0501294_009168 3300049517 Bacteria 970
1214 Ga0501297_004528 3300049520 Bacteria 1426
1215 Ga0501298_083728 3300049521 Bacteria 705
1216 Ga0501300_001357 3300049523 Bacteria 3684
1217 Ga0501312_003406 3300049528 Bacteria 1802
1218 Ga0501313_023853 3300049529 Bacteria 768
1219 Ga0501314_002220 3300049530 Bacteria 1482
1220 Ga0501315_002024 3300049531 Bacteria 1848
1221 Ga0501317_004293 3300049533 Bacteria 1475
1222 Ga0501321_026828 3300049537 Bacteria 749
1223 Ga0501031_0025514 3300049568 Bacteria 3854
1224 Ga0501031_0042415 3300049568 Bacteria 2970
1225 Ga0501031_0656317 3300049568 Bacteria 674
1226 Ga0501032_0022123 3300049569 Bacteria 4411
1227 Ga0501032_0228684 3300049569 Bacteria 1209
1228 Ga0501033_0010061 3300049570 Bacteria 7261
1229 Ga0501033_0085355 3300049570 Bacteria 2312
1230 Ga0501033_0271942 3300049570 Bacteria 1197
1231 Ga0501034_0021863 3300049571 Bacteria 6517
1232 Ga0501034_0035289 3300049571 Bacteria 5070
1233 Ga0501034_0072309 3300049571 Bacteria 3457
1234 Ga0501036_0073796 3300049572 Bacteria 2884
1235 Ga0501036_0323981 3300049572 Bacteria 1287
1236 Ga0501036_1011383 3300049572 Bacteria 680
1237 Ga0501037_0020065 3300049573 Bacteria 4933
1238 Ga0501038_0014117 3300049574 Bacteria 7277
1239 Ga0501038_0026943 3300049574 Bacteria 5116
1240 Ga0501039_0067085 3300049575 Bacteria 2786
1241 Ga0501039_0255226 3300049575 Bacteria 1378
1242 Ga0501043_0000004 3300049579 Bacteria 291085
1243 Ga0501043_0021135 3300049579 Bacteria 5102
1244 Ga0501043_0229570 3300049579 Bacteria 1434
1245 Ga0501046_0000050 3300049580 Bacteria 134922
1246 Ga0501047_0000012 3300049581 Bacteria 368824
1247 Ga0501047_0021327 3300049581 Bacteria 6218
1248 Ga0501047_0171970 3300049581 Bacteria 2035
1249 Ga0501048_0010686 3300049582 Bacteria 6845
1250 Ga0501068_0936823 3300049584 Bacteria 570
1251 Ga0501070_0045102 3300049586 Bacteria 3667
1252 Ga0501070_0164408 3300049586 Bacteria 1829
1253 Ga0501071_0460648 3300049587 Bacteria 973
1254 Ga0501073_0065946 3300049589 Bacteria 2524
1255 Ga0501198_000004 3300049649 Bacteria 175146
1256 Ga0501199_015195 3300049650 Bacteria 860
1257 Ga0501206_006551 3300049653 Bacteria 1515
1258 Ga0501211_002448 3300049658 Bacteria 1961
1259 Ga0501217_027085 3300049661 Bacteria 1389
1260 Ga0501222_000038 3300049662 Bacteria 51424
1261 Ga0501222_008815 3300049662 Bacteria 1336
1262 Ga0501223_009832 3300049663 Bacteria 1931
1263 Ga0501235_024396 3300049669 Bacteria 1350
1264 Ga0501250_012952 3300049680 Bacteria 994
1265 Ga0501251_052739 3300049681 Bacteria 649
1266 Ga0501253_018493 3300049683 Bacteria 1190
1267 Ga0501255_001001 3300049684 Bacteria 2155
1268 Ga0501258_006361 3300049687 Bacteria 1170
1269 Ga0501261_009717 3300049690 Bacteria 1258
1270 Ga0501225_0025880 3300049705 Bacteria 1614
1271 Ga0501225_0038030 3300049705 Bacteria 1326
1272 Ga0501229_000597 3300049706 Bacteria 4050
1273 Ga0501080_0016883 3300049742 Bacteria 6742
1274 Ga0501080_1590210 3300049742 Bacteria 554
1275 Ga0501080_1872194 3300049742 Bacteria 503
1276 Ga0501232_032573 3300049757 Bacteria 731
1277 Ga0501262_002037 3300049759 Bacteria 2279
1278 Ga0501265_010324 3300049762 Bacteria 1138
1279 Ga0501267_001203 3300049764 Bacteria 2172
1280 Ga0501268_103430 3300049765 Bacteria 613
1281 Ga0501272_005104 3300049769 Bacteria 1376
1282 Ga0501282_013499 3300049778 Bacteria 885
1283 Ga0501035_0014880 3300049822 Bacteria 7180
1284 Ga0501035_0192031 3300049822 Bacteria 1755
1285 Ga0501044_0019187 3300049823 Bacteria 7319
1286 Ga0501044_0037114 3300049823 Bacteria 5095
1287 Ga0501044_1020321 3300049823 Bacteria 699
1288 Ga0501044_1567984 3300049823 Bacteria 523
1289 Ga0501044_1602328 3300049823 Bacteria 516
1290 Ga0501045_0016727 3300049824 Bacteria 5209
1291 Ga0501226_033241 3300049853 Bacteria 589
1292 nmdc:mga03683_315569_c1 3300050489 Bacteria 735
1293 nmdc:mga03n38_539604_c1 3300050490 Bacteria 659
1294 nmdc:mga00v17_153575_c1 3300050491 Bacteria 1480
1295 nmdc:mga0yw44_104612_c1 3300050492 Bacteria 1807
1296 nmdc:mga0k408_129139_c1 3300050493 Bacteria 1500
1297 nmdc:mga0k408_186563_c1 3300050493 Bacteria 1237
1298 nmdc:mga0k408_293352_c1 3300050493 Bacteria 970
1299 nmdc:mga07m45_187418_c1 3300050496 Bacteria 1203
1300 nmdc:mga07m45_46177_c1 3300050496 Bacteria 2446
1301 nmdc:mga07m45_61691_c1 3300050496 Bacteria 2124
1302 nmdc:mga08y16_1337202_c1 3300050511 Bacteria 682
1303 nmdc:mga08y16_749189_c1 3300050511 Bacteria 973
1304 Ga0495601_0144456 3300053077 Bacteria 1552
1305 Ga0495612_0238028 3300053078 Bacteria 808
1306 Ga0495612_0358143 3300053078 Bacteria 659
1307 Ga0500635_0000046 3300053080 Bacteria 84743
1308 Ga0495595_0160133 3300053084 Bacteria 1110
1309 Ga0495619_0173642 3300053085 Bacteria 1491
1310 Ga0500651_0000088 3300053093 Bacteria 59179
1311 Ga0500658_0180230 3300053134 Bacteria 962
1312 Ga0500559_0050725 3300053136 Bacteria 1831
1313 Ga0500564_088801 3300053138 Bacteria 1378
1314 Ga0500577_0340038 3300053142 Bacteria 656
1315 Ga0500604_0155491 3300053151 Bacteria 778
1316 Ga0500622_0019200 3300053156 Bacteria 3630
1317 Ga0500634_0000049 3300053161 Bacteria 53534
1318 Ga0500636_0182491 3300053177 Bacteria 1125
1319 Ga0501084_0879507 3300054114 Bacteria 754

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10833212 Ga0207644_108332122 110
2 3300053078 Ga0495612_0358143 Ga0495612_0358143_10_384 117
3 3300005355 Ga0070671_100121757 Ga0070671_1001217574 119
4 3300005455 Ga0070663_101180864 Ga0070663_1011808641 119
5 3300025931 Ga0207644_10027264 Ga0207644_100272642 119
6 3300041498 Ga0451841_0649399 Ga0451841_0649399_21_410 122
7 3300013296 Ga0157374_10330567 Ga0157374_103305673 123
8 3300042015 Ga0439462_0172200 Ga0439462_0172200_227_601 123
9 3300027876 Ga0209974_10127120 Ga0209974_101271201 127
10 iso_pu_bacteria 2547132130 2547503041 128
11 iso_pu_bacteria 2576861471 2578458467 128
12 iso_pu_bacteria 2643221544 2643745674 128
13 iso_pu_bacteria 2643221644 2644245444 128
14 iso_pu_bacteria 2747842428 2747947750 128
15 iso_pu_bacteria 2747842501 2748019495 128
16 iso_pu_bacteria 2765235840 2765578937 128
17 iso_pu_bacteria 2816332141 2816516997 128
18 iso_pu_bacteria 2818991457 2819659635 128
19 iso_pu_bacteria 2842391507 2842393018 128
20 iso_pu_bacteria 2842757796 2842760247 128
21 iso_pu_bacteria 2842780639 2842780750 128
22 iso_pu_bacteria 2852649853 2852650889 128
23 iso_pu_bacteria 2857442823 2857443732 128
24 iso_pu_bacteria 2874220319 2874221577 128
25 iso_pu_bacteria 2895498888 2895500662 128
26 iso_pu_bacteria 2895511927 2895516468 128
27 iso_pu_bacteria 2895522137 2895523612 128
28 iso_pu_bacteria 2895525241 2895526806 128
29 iso_pu_bacteria 2919089067 2919089756 128
30 iso_pu_bacteria 2919134579 2919137695 128
31 iso_pu_bacteria 2928496128 2928499461 128
32 iso_pu_bacteria 2931380184 2931380798 128
33 iso_pu_bacteria 2937610967 2937612396 128
34 iso_pu_bacteria 2939589442 2939591400 128
35 iso_pu_bacteria 2939626828 2939627373 128
36 iso_pu_bacteria 2941475908 2941478265 128
37 iso_pu_bacteria 2941489479 2941490126 128
38 iso_pu_bacteria 2961047084 2961048344 128
39 iso_pu_bacteria 2974307012 2974309038 128
40 iso_pu_bacteria 2977247770 2977249755 128
41 iso_pu_bacteria 2984514374 2984515755 128
42 iso_pu_bacteria 2987605356 2987606381 128
43 iso_pu_bacteria 2995948881 2995951936 128
44 3300003323 rootH1_10058276 rootH1_100582762 129
45 3300003775 Ga0055524_1012111 Ga0055524_10121112 129
46 3300003775 Ga0055524_1032769 Ga0055524_10327691 129
47 3300003791 Ga0055530_10030449 Ga0055530_100304491 129
48 3300006195 Ga0075366_10055725 Ga0075366_100557253 129
49 3300006353 Ga0075370_10002692 Ga0075370_100026926 129
50 3300012497 Ga0157319_1000031 Ga0157319_100003148 129
51 3300025273 Ga0209673_1005175 Ga0209673_10051752 129
52 3300025298 Ga0209050_1002510 Ga0209050_100251010 129
53 3300025299 Ga0209256_1004910 Ga0209256_10049102 129
54 3300025299 Ga0209256_1012612 Ga0209256_10126125 129
55 3300025303 Ga0209051_1008580 Ga0209051_10085802 129
56 3300025304 Ga0209257_1008078 Ga0209257_10080788 129
57 3300042127 Ga0450890_007668 Ga0450890_007668_524_961 129
58 3300050496 nmdc:mga07m45_187418_c1 nmdc:mga07m45_187418_c1_282_719 129
59 iso_pu_bacteria 2643221579 2643907762 129
60 iso_pu_bacteria 2643221581 2643916031 129
61 iso_pu_bacteria 2643221639 2644221564 129
62 iso_pu_bacteria 2643221646 2644257675 129
63 iso_pu_bacteria 2831864461 2831865637 129
64 iso_pu_bacteria 2919130084 2919131710 129
65 iso_pu_bacteria 2923516293 2923518440 129
66 iso_pu_bacteria 2929195423 2929197920 129
67 iso_pu_bacteria 2961064222 2961065340 129
68 iso_pu_bacteria 8002869464 8002871887 129
69 iso_pu_bacteria 8021622325 8021624682 129
70 iso_pu_bacteria 8021626552 8021629196 129
71 iso_pu_bacteria 8021648035 8021649063 129
72 3300009978 Ga0105148_121146 Ga0105148_1211461 130
73 3300031649 Ga0307514_10031043 Ga0307514_100310432 130
74 3300002705 JGI25156J39149_1002197 JGI25156J39149_10021972 131
75 3300002738 JGI25154J39366_1001260 JGI25154J39366_10012604 131
76 3300002741 JGI25157J39369_1000491 JGI25157J39369_100049116 131
77 3300002772 JGI25164J39214_1009409 JGI25164J39214_10094092 131
78 3300003316 rootH1_10002744 rootH1_100027445 131
79 3300003322 rootL2_10002046 rootL2_100020466 131
80 3300003752 Ga0055539_1000279 Ga0055539_100027913 131
81 3300003752 Ga0055539_1002101 Ga0055539_10021011 131
82 3300003752 Ga0055539_1023488 Ga0055539_10234882 131
83 3300003756 Ga0055533_1000025 Ga0055533_1000025212 131
84 3300003759 Ga0055525_1001306 Ga0055525_10013062 131
85 3300003761 Ga0055535_1016001 Ga0055535_10160012 131
86 3300003792 Ga0055540_1046447 Ga0055540_10464472 131
87 3300005327 Ga0070658_10005332 Ga0070658_100053322 131
88 3300005331 Ga0070670_101916629 Ga0070670_1019166291 131
89 3300005337 Ga0070682_100366638 Ga0070682_1003666381 131
90 3300005339 Ga0070660_100177344 Ga0070660_1001773441 131
91 3300005339 Ga0070660_100441923 Ga0070660_1004419232 131
92 3300005343 Ga0070687_100331125 Ga0070687_1003311252 131
93 3300005365 Ga0070688_100114079 Ga0070688_1001140792 131
94 3300005366 Ga0070659_100090132 Ga0070659_1000901322 131
95 3300005563 Ga0068855_100035623 Ga0068855_1000356233 131
96 3300005563 Ga0068855_100065258 Ga0068855_1000652582 131
97 3300005563 Ga0068855_100187491 Ga0068855_1001874912 131
98 3300005563 Ga0068855_100288889 Ga0068855_1002888893 131
99 3300005577 Ga0068857_100002880 Ga0068857_10000288010 131
100 3300005578 Ga0068854_100032823 Ga0068854_1000328232 131
101 3300005614 Ga0068856_100004237 Ga0068856_10000423710 131
102 3300005616 Ga0068852_100173703 Ga0068852_1001737031 131
103 3300006195 Ga0075366_10155524 Ga0075366_101555243 131
104 3300009093 Ga0105240_10055942 Ga0105240_100559422 131
105 3300009093 Ga0105240_11068556 Ga0105240_110685562 131
106 3300009174 Ga0105241_10119752 Ga0105241_101197523 131
107 3300009174 Ga0105241_11523244 Ga0105241_115232441 131
108 3300009176 Ga0105242_10912657 Ga0105242_109126572 131
109 3300009545 Ga0105237_10078237 Ga0105237_100782372 131
110 3300009545 Ga0105237_10332526 Ga0105237_103325263 131
111 3300009551 Ga0105238_10035279 Ga0105238_100352793 131
112 3300010375 Ga0105239_10056095 Ga0105239_100560952 131
113 3300013102 Ga0157371_10079985 Ga0157371_100799853 131
114 3300013105 Ga0157369_10049772 Ga0157369_100497723 131
115 3300013306 Ga0163162_10265698 Ga0163162_102656981 131
116 3300013306 Ga0163162_10674271 Ga0163162_106742712 131
117 3300013307 Ga0157372_11149127 Ga0157372_111491272 131
118 3300013308 Ga0157375_11513579 Ga0157375_115135792 131
119 3300021361 Ga0213872_10092646 Ga0213872_100926462 131
120 3300025226 Ga0209674_100007 Ga0209674_100007570 131
121 3300025230 Ga0209563_100052 Ga0209563_10005241 131
122 3300025231 Ga0207427_100516 Ga0207427_10051610 131
123 3300025242 Ga0209258_100957 Ga0209258_10095711 131
124 3300025246 Ga0209646_1000245 Ga0209646_100024515 131
125 3300025250 Ga0209026_1000021 Ga0209026_1000021286 131
126 3300025250 Ga0209026_1035437 Ga0209026_10354372 131
127 3300025253 Ga0209677_100015 Ga0209677_100015221 131
128 3300025253 Ga0209677_100477 Ga0209677_1004774 131
129 3300025253 Ga0209677_103158 Ga0209677_1031585 131
130 3300025256 Ga0209759_1000382 Ga0209759_100038216 131
131 3300025256 Ga0209759_1030695 Ga0209759_10306952 131
132 3300025303 Ga0209051_1003382 Ga0209051_10033828 131
133 3300025909 Ga0207705_10180438 Ga0207705_101804382 131
134 3300025909 Ga0207705_10571654 Ga0207705_105716542 131
135 3300025911 Ga0207654_10019747 Ga0207654_100197472 131
136 3300025913 Ga0207695_10014006 Ga0207695_100140062 131
137 3300025913 Ga0207695_10245272 Ga0207695_102452723 131
138 3300025913 Ga0207695_11249396 Ga0207695_112493961 131
139 3300025914 Ga0207671_10040649 Ga0207671_100406493 131
140 3300025914 Ga0207671_10779050 Ga0207671_107790502 131
141 3300025919 Ga0207657_10161733 Ga0207657_101617332 131
142 3300025919 Ga0207657_10193071 Ga0207657_101930712 131
143 3300025924 Ga0207694_10031573 Ga0207694_100315733 131
144 3300025932 Ga0207690_10032066 Ga0207690_100320663 131
145 3300025949 Ga0207667_10017670 Ga0207667_100176707 131
146 3300025949 Ga0207667_10058792 Ga0207667_100587923 131
147 3300025949 Ga0207667_10365980 Ga0207667_103659801 131
148 3300025949 Ga0207667_10947305 Ga0207667_109473052 131
149 3300026041 Ga0207639_10168705 Ga0207639_101687051 131
150 3300026041 Ga0207639_10615356 Ga0207639_106153562 131
151 3300026078 Ga0207702_10000858 Ga0207702_100008585 131
152 3300026116 Ga0207674_10026390 Ga0207674_100263905 131
153 3300026118 Ga0207675_100019975 Ga0207675_1000199756 131
154 3300026142 Ga0207698_10222604 Ga0207698_102226042 131
155 3300028379 Ga0268266_10943343 Ga0268266_109433431 131
156 3300030521 Ga0307511_10226617 Ga0307511_102266171 131
157 3300030731 Ga0316177_1050317 Ga0316177_10503173 131
158 3300030733 Ga0314311_1227100 Ga0314311_12271002 131
159 3300030735 Ga0316178_1140499 Ga0316178_11404991 131
160 3300033180 Ga0307510_10411944 Ga0307510_104119441 131
161 3300035086 Ga0373934_0098868 Ga0373934_0098868_175_591 131
162 3300039447 Ga0436361_0243330 Ga0436361_0243330_172_594 131
163 3300039447 Ga0436361_0298548 Ga0436361_0298548_1561_1983 131
164 3300041452 Ga0451793_0736074 Ga0451793_0736074_247_663 131
165 3300041505 Ga0451849_1462010 Ga0451849_1462010_39_452 131
166 3300041512 Ga0451853_0334304 Ga0451853_0334304_36_440 131
167 3300041512 Ga0451853_1029461 Ga0451853_1029461_243_659 131
168 3300041999 Ga0439433_0092143 Ga0439433_0092143_164_562 131
169 3300042006 Ga0439432_172159 Ga0439432_172159_67_471 131
170 3300042015 Ga0439462_0067379 Ga0439462_0067379_204_602 131
171 3300046462 Ga0495651_0260417 Ga0495651_0260417_464_880 131
172 3300046475 Ga0495639_0018018 Ga0495639_0018018_1614_2030 131
173 3300046506 Ga0495583_0000017 Ga0495583_0000017_308858_309274 131
174 3300046507 Ga0495606_0002049 Ga0495606_0002049_13416_13832 131
175 3300046511 Ga0495608_0257061 Ga0495608_0257061_605_1021 131
176 3300046529 Ga0495652_0149595 Ga0495652_0149595_258_674 131
177 3300046660 Ga0495625_0162856 Ga0495625_0162856_1034_1450 131
178 3300046684 Ga0495669_0043381 Ga0495669_0043381_674_1090 131
179 3300046694 Ga0495649_0000290 Ga0495649_0000290_42308_42724 131
180 3300046794 Ga0495589_0022418 Ga0495589_0022418_843_1259 131
181 3300048903 Ga0496100_0352475 Ga0496100_0352475_548_988 131
182 3300048904 Ga0496101_1123846 Ga0496101_1123846_146_562 131
183 3300048907 Ga0496104_0274434 Ga0496104_0274434_978_1394 131
184 3300048908 Ga0496105_0310431 Ga0496105_0310431_530_946 131
185 3300048912 Ga0496109_0499144 Ga0496109_0499144_465_881 131
186 3300048918 Ga0496115_0553805 Ga0496115_0553805_430_846 131
187 3300049571 Ga0501034_0035289 Ga0501034_0035289_3951_4358 131
188 3300050493 nmdc:mga0k408_129139_c1 nmdc:mga0k408_129139_c1_627_1064 131
189 iso_pu_bacteria 2571042365 2572253883 131
190 iso_pu_bacteria 2643221695 2644529358 131
191 3300002705 JGI25156J39149_1006806 JGI25156J39149_10068062 132
192 3300003316 rootH1_10017987 rootH1_100179873 132
193 3300003320 rootH2_10083712 rootH2_100837125 132
194 3300003320 rootH2_10187889 rootH2_101878893 132
195 3300003322 rootL2_10047399 rootL2_100473995 132
196 3300003322 rootL2_10197176 rootL2_101971763 132
197 3300003322 rootL2_10256599 rootL2_102565993 132
198 3300003323 rootH1_10072793 rootH1_100727932 132
199 3300003323 rootH1_10235777 rootH1_102357773 132
200 3300003761 Ga0055535_1000122 Ga0055535_100012220 132
201 3300003763 Ga0055529_1000199 Ga0055529_100019917 132
202 3300003771 Ga0055526_1000101 Ga0055526_100010118 132
203 3300003771 Ga0055526_1006205 Ga0055526_10062055 132
204 3300003773 Ga0055537_1000091 Ga0055537_100009115 132
205 3300003773 Ga0055537_1000459 Ga0055537_10004591 132
206 3300003773 Ga0055537_1000560 Ga0055537_10005604 132
207 3300003775 Ga0055524_1000574 Ga0055524_100057418 132
208 3300003775 Ga0055524_1001859 Ga0055524_10018595 132
209 3300003775 Ga0055524_1032069 Ga0055524_10320692 132
210 3300003781 Ga0055536_1001901 Ga0055536_10019011 132
211 3300003781 Ga0055536_1003184 Ga0055536_10031841 132
212 3300003781 Ga0055536_1005396 Ga0055536_10053966 132
213 3300003784 Ga0055534_1000043 Ga0055534_100004382 132
214 3300003784 Ga0055534_1000078 Ga0055534_100007819 132
215 3300003790 Ga0055528_1000075 Ga0055528_100007518 132
216 3300003790 Ga0055528_1000087 Ga0055528_100008747 132
217 3300003791 Ga0055530_10001911 Ga0055530_100019111 132
218 3300003791 Ga0055530_10007441 Ga0055530_100074412 132
219 3300003791 Ga0055530_10008282 Ga0055530_100082825 132
220 3300003791 Ga0055530_10010812 Ga0055530_100108124 132
221 3300003791 Ga0055530_10053491 Ga0055530_100534913 132
222 3300003792 Ga0055540_1000004 Ga0055540_1000004118 132
223 3300003792 Ga0055540_1000035 Ga0055540_100003517 132
224 3300003792 Ga0055540_1014970 Ga0055540_10149703 132
225 3300003792 Ga0055540_1028470 Ga0055540_10284702 132
226 3300003794 Ga0055531_10010928 Ga0055531_100109283 132
227 3300003794 Ga0055531_10012582 Ga0055531_100125821 132
228 3300003794 Ga0055531_10020086 Ga0055531_100200862 132
229 3300003794 Ga0055531_10025346 Ga0055531_100253464 132
230 3300003794 Ga0055531_10028318 Ga0055531_100283181 132
231 3300003856 Ga0058692_1000555 Ga0058692_100055510 132
232 3300005262 Ga0065165_1076663 Ga0065165_10766631 132
233 3300005289 Ga0065704_10138923 Ga0065704_101389232 132
234 3300005293 Ga0065715_10160732 Ga0065715_101607322 132
235 3300005327 Ga0070658_10166330 Ga0070658_101663302 132
236 3300005328 Ga0070676_10163474 Ga0070676_101634742 132
237 3300005328 Ga0070676_10271029 Ga0070676_102710292 132
238 3300005329 Ga0070683_100239841 Ga0070683_1002398413 132
239 3300005330 Ga0070690_100019205 Ga0070690_1000192052 132
240 3300005330 Ga0070690_100028644 Ga0070690_1000286442 132
241 3300005330 Ga0070690_100273359 Ga0070690_1002733592 132
242 3300005331 Ga0070670_100150580 Ga0070670_1001505802 132
243 3300005331 Ga0070670_100202876 Ga0070670_1002028763 132
244 3300005333 Ga0070677_10052737 Ga0070677_100527373 132
245 3300005333 Ga0070677_10084279 Ga0070677_100842792 132
246 3300005334 Ga0068869_100092019 Ga0068869_1000920193 132
247 3300005334 Ga0068869_100113189 Ga0068869_1001131892 132
248 3300005334 Ga0068869_100133862 Ga0068869_1001338622 132
249 3300005335 Ga0070666_10022849 Ga0070666_100228492 132
250 3300005336 Ga0070680_100200755 Ga0070680_1002007552 132
251 3300005338 Ga0068868_100010923 Ga0068868_1000109233 132
252 3300005338 Ga0068868_100105165 Ga0068868_1001051653 132
253 3300005338 Ga0068868_100628643 Ga0068868_1006286432 132
254 3300005339 Ga0070660_100258905 Ga0070660_1002589052 132
255 3300005340 Ga0070689_100080869 Ga0070689_1000808693 132
256 3300005340 Ga0070689_100240708 Ga0070689_1002407082 132
257 3300005343 Ga0070687_100603233 Ga0070687_1006032332 132
258 3300005344 Ga0070661_100230417 Ga0070661_1002304172 132
259 3300005347 Ga0070668_100106945 Ga0070668_1001069453 132
260 3300005347 Ga0070668_100149654 Ga0070668_1001496543 132
261 3300005347 Ga0070668_100436334 Ga0070668_1004363342 132
262 3300005347 Ga0070668_101435490 Ga0070668_1014354901 132
263 3300005353 Ga0070669_100021831 Ga0070669_1000218312 132
264 3300005353 Ga0070669_100095163 Ga0070669_1000951633 132
265 3300005353 Ga0070669_100709599 Ga0070669_1007095992 132
266 3300005353 Ga0070669_100843272 Ga0070669_1008432722 132
267 3300005354 Ga0070675_100001199 Ga0070675_1000011992 132
268 3300005354 Ga0070675_100038320 Ga0070675_1000383203 132
269 3300005355 Ga0070671_100134304 Ga0070671_1001343042 132
270 3300005356 Ga0070674_100187003 Ga0070674_1001870033 132
271 3300005356 Ga0070674_100588240 Ga0070674_1005882402 132
272 3300005364 Ga0070673_100073367 Ga0070673_1000733672 132
273 3300005365 Ga0070688_100075599 Ga0070688_1000755992 132
274 3300005366 Ga0070659_100000336 Ga0070659_10000033611 132
275 3300005366 Ga0070659_100209986 Ga0070659_1002099863 132
276 3300005366 Ga0070659_101023812 Ga0070659_1010238122 132
277 3300005367 Ga0070667_100016792 Ga0070667_1000167922 132
278 3300005435 Ga0070714_100259131 Ga0070714_1002591313 132
279 3300005438 Ga0070701_10432580 Ga0070701_104325802 132
280 3300005455 Ga0070663_100007308 Ga0070663_1000073082 132
281 3300005455 Ga0070663_100549137 Ga0070663_1005491372 132
282 3300005456 Ga0070678_100010070 Ga0070678_1000100702 132
283 3300005456 Ga0070678_100266817 Ga0070678_1002668172 132
284 3300005457 Ga0070662_100000867 Ga0070662_10000086716 132
285 3300005457 Ga0070662_100178485 Ga0070662_1001784853 132
286 3300005457 Ga0070662_100313493 Ga0070662_1003134932 132
287 3300005458 Ga0070681_10464008 Ga0070681_104640081 132
288 3300005459 Ga0068867_100178603 Ga0068867_1001786033 132
289 3300005459 Ga0068867_100398158 Ga0068867_1003981582 132
290 3300005459 Ga0068867_101466082 Ga0068867_1014660821 132
291 3300005466 Ga0070685_10554750 Ga0070685_105547502 132
292 3300005530 Ga0070679_100003038 Ga0070679_1000030387 132
293 3300005535 Ga0070684_100313579 Ga0070684_1003135793 132
294 3300005539 Ga0068853_100264449 Ga0068853_1002644492 132
295 3300005539 Ga0068853_100371500 Ga0068853_1003715001 132
296 3300005539 Ga0068853_100664387 Ga0068853_1006643872 132
297 3300005543 Ga0070672_100429558 Ga0070672_1004295582 132
298 3300005543 Ga0070672_101241383 Ga0070672_1012413832 132
299 3300005544 Ga0070686_100319526 Ga0070686_1003195262 132
300 3300005547 Ga0070693_100364409 Ga0070693_1003644091 132
301 3300005563 Ga0068855_100063395 Ga0068855_1000633955 132
302 3300005564 Ga0070664_100014426 Ga0070664_1000144262 132
303 3300005564 Ga0070664_100517141 Ga0070664_1005171413 132
304 3300005577 Ga0068857_100653711 Ga0068857_1006537112 132
305 3300005577 Ga0068857_100788733 Ga0068857_1007887332 132
306 3300005577 Ga0068857_101622759 Ga0068857_1016227592 132
307 3300005578 Ga0068854_100188620 Ga0068854_1001886203 132
308 3300005578 Ga0068854_100296805 Ga0068854_1002968053 132
309 3300005578 Ga0068854_100342447 Ga0068854_1003424472 132
310 3300005614 Ga0068856_100287717 Ga0068856_1002877172 132
311 3300005615 Ga0070702_100266700 Ga0070702_1002667002 132
312 3300005616 Ga0068852_100023003 Ga0068852_1000230032 132
313 3300005616 Ga0068852_100201955 Ga0068852_1002019553 132
314 3300005617 Ga0068859_100010529 Ga0068859_1000105298 132
315 3300005617 Ga0068859_100966507 Ga0068859_1009665072 132
316 3300005618 Ga0068864_100002556 Ga0068864_1000025564 132
317 3300005718 Ga0068866_10451577 Ga0068866_104515772 132
318 3300005719 Ga0068861_100001169 Ga0068861_1000011692 132
319 3300005719 Ga0068861_100020439 Ga0068861_1000204392 132
320 3300005719 Ga0068861_100637374 Ga0068861_1006373743 132
321 3300005719 Ga0068861_101175683 Ga0068861_1011756832 132
322 3300005834 Ga0068851_10170888 Ga0068851_101708882 132
323 3300005841 Ga0068863_100019332 Ga0068863_1000193322 132
324 3300005841 Ga0068863_100511302 Ga0068863_1005113022 132
325 3300005842 Ga0068858_100015946 Ga0068858_1000159462 132
326 3300005842 Ga0068858_100201227 Ga0068858_1002012272 132
327 3300005843 Ga0068860_100170425 Ga0068860_1001704253 132
328 3300005844 Ga0068862_100112008 Ga0068862_1001120082 132
329 3300005844 Ga0068862_100707168 Ga0068862_1007071682 132
330 3300005844 Ga0068862_100758516 Ga0068862_1007585162 132
331 3300005985 Ga0081539_10083917 Ga0081539_100839172 132
332 3300006038 Ga0075365_10065199 Ga0075365_100651993 132
333 3300006038 Ga0075365_10618794 Ga0075365_106187942 132
334 3300006048 Ga0075363_100215076 Ga0075363_1002150762 132
335 3300006051 Ga0075364_10001093 Ga0075364_100010935 132
336 3300006051 Ga0075364_10279616 Ga0075364_102796162 132
337 3300006178 Ga0075367_10153877 Ga0075367_101538772 132
338 3300006186 Ga0075369_10027960 Ga0075369_100279602 132
339 3300006195 Ga0075366_10113036 Ga0075366_101130362 132
340 3300006237 Ga0097621_100009661 Ga0097621_1000096616 132
341 3300006237 Ga0097621_100113913 Ga0097621_1001139132 132
342 3300006237 Ga0097621_100230556 Ga0097621_1002305562 132
343 3300006353 Ga0075370_10037091 Ga0075370_100370913 132
344 3300006353 Ga0075370_10166025 Ga0075370_101660252 132
345 3300006358 Ga0068871_100067624 Ga0068871_1000676242 132
346 3300006358 Ga0068871_100550890 Ga0068871_1005508902 132
347 3300006881 Ga0068865_100166194 Ga0068865_1001661943 132
348 3300006881 Ga0068865_100536179 Ga0068865_1005361791 132
349 3300006931 Ga0097620_100010529 Ga0097620_1000105298 132
350 3300006931 Ga0097620_100966531 Ga0097620_1009665312 132
351 3300006946 Ga0079104_1000352 Ga0079104_100035250 132
352 3300009036 Ga0105244_10041838 Ga0105244_100418382 132
353 3300009093 Ga0105240_10212788 Ga0105240_102127883 132
354 3300009093 Ga0105240_10654346 Ga0105240_106543462 132
355 3300009093 Ga0105240_11006023 Ga0105240_110060232 132
356 3300009094 Ga0111539_11239148 Ga0111539_112391482 132
357 3300009094 Ga0111539_11565602 Ga0111539_115656021 132
358 3300009098 Ga0105245_10048722 Ga0105245_100487225 132
359 3300009098 Ga0105245_10502295 Ga0105245_105022952 132
360 3300009148 Ga0105243_10013725 Ga0105243_100137252 132
361 3300009148 Ga0105243_10433572 Ga0105243_104335722 132
362 3300009148 Ga0105243_11468364 Ga0105243_114683642 132
363 3300009148 Ga0105243_11870583 Ga0105243_118705832 132
364 3300009176 Ga0105242_10335390 Ga0105242_103353902 132
365 3300009176 Ga0105242_11028492 Ga0105242_110284922 132
366 3300009177 Ga0105248_10014945 Ga0105248_100149455 132
367 3300009177 Ga0105248_10500405 Ga0105248_105004052 132
368 3300009177 Ga0105248_10585797 Ga0105248_105857973 132
369 3300009545 Ga0105237_10043493 Ga0105237_100434935 132
370 3300009553 Ga0105249_10163245 Ga0105249_101632452 132
371 3300009553 Ga0105249_11447828 Ga0105249_114478282 132
372 3300009553 Ga0105249_13359061 Ga0105249_133590611 132
373 3300010375 Ga0105239_10320005 Ga0105239_103200052 132
374 3300010375 Ga0105239_10390603 Ga0105239_103906033 132
375 3300011119 Ga0105246_10055307 Ga0105246_100553073 132
376 3300013100 Ga0157373_10613361 Ga0157373_106133612 132
377 3300013100 Ga0157373_10815433 Ga0157373_108154332 132
378 3300013102 Ga0157371_10002369 Ga0157371_100023694 132
379 3300013102 Ga0157371_10062945 Ga0157371_100629454 132
380 3300013102 Ga0157371_10160203 Ga0157371_101602033 132
381 3300013102 Ga0157371_10162109 Ga0157371_101621093 132
382 3300013104 Ga0157370_10102494 Ga0157370_101024942 132
383 3300013104 Ga0157370_10487444 Ga0157370_104874441 132
384 3300013104 Ga0157370_11918103 Ga0157370_119181032 132
385 3300013105 Ga0157369_10445204 Ga0157369_104452041 132
386 3300013296 Ga0157374_10171153 Ga0157374_101711532 132
387 3300013297 Ga0157378_10152828 Ga0157378_101528282 132
388 3300013297 Ga0157378_10180200 Ga0157378_101802004 132
389 3300013306 Ga0163162_10007486 Ga0163162_100074865 132
390 3300013306 Ga0163162_10181423 Ga0163162_101814233 132
391 3300013306 Ga0163162_10747585 Ga0163162_107475852 132
392 3300013307 Ga0157372_10243948 Ga0157372_102439482 132
393 3300013308 Ga0157375_10034088 Ga0157375_100340885 132
394 3300013308 Ga0157375_10494459 Ga0157375_104944592 132
395 3300013308 Ga0157375_12642963 Ga0157375_126429631 132
396 3300014325 Ga0163163_10010139 Ga0163163_100101392 132
397 3300014326 Ga0157380_10153834 Ga0157380_101538343 132
398 3300014326 Ga0157380_10424330 Ga0157380_104243303 132
399 3300014326 Ga0157380_10636066 Ga0157380_106360662 132
400 3300014497 Ga0182008_10010987 Ga0182008_100109873 132
401 3300014497 Ga0182008_10067339 Ga0182008_100673393 132
402 3300014497 Ga0182008_10495581 Ga0182008_104955812 132
403 3300014745 Ga0157377_10062240 Ga0157377_100622403 132
404 3300014968 Ga0157379_10011032 Ga0157379_100110326 132
405 3300014968 Ga0157379_10018910 Ga0157379_100189109 132
406 3300014968 Ga0157379_10183696 Ga0157379_101836962 132
407 3300014969 Ga0157376_10028517 Ga0157376_100285176 132
408 3300014969 Ga0157376_10129467 Ga0157376_101294672 132
409 3300014969 Ga0157376_10223886 Ga0157376_102238862 132
410 3300014969 Ga0157376_10379663 Ga0157376_103796633 132
411 3300014969 Ga0157376_10670491 Ga0157376_106704912 132
412 3300015261 Ga0182006_1033096 Ga0182006_10330962 132
413 3300015261 Ga0182006_1064426 Ga0182006_10644262 132
414 3300015261 Ga0182006_1080302 Ga0182006_10803021 132
415 3300015261 Ga0182006_1081085 Ga0182006_10810851 132
416 3300015261 Ga0182006_1180587 Ga0182006_11805872 132
417 3300015262 Ga0182007_10000236 Ga0182007_1000023621 132
418 3300015262 Ga0182007_10173386 Ga0182007_101733862 132
419 3300015265 Ga0182005_1001886 Ga0182005_10018864 132
420 3300015689 Ga0183360_10001 Ga0183360_100011316 132
421 3300017792 Ga0163161_10033566 Ga0163161_100335662 132
422 3300017792 Ga0163161_10036693 Ga0163161_100366932 132
423 3300017792 Ga0163161_10059326 Ga0163161_100593264 132
424 3300017792 Ga0163161_10094277 Ga0163161_100942772 132
425 3300017792 Ga0163161_10128293 Ga0163161_101282932 132
426 3300017792 Ga0163161_10263008 Ga0163161_102630082 132
427 3300017792 Ga0163161_10369432 Ga0163161_103694322 132
428 3300017792 Ga0163161_10799188 Ga0163161_107991882 132
429 3300020075 Ga0206349_1304419 Ga0206349_13044192 132
430 3300025242 Ga0209258_100284 Ga0209258_10028421 132
431 3300025245 Ga0207425_1023502 Ga0207425_10235022 132
432 3300025250 Ga0209026_1009092 Ga0209026_10090922 132
433 3300025256 Ga0209759_1000244 Ga0209759_100024418 132
434 3300025256 Ga0209759_1002244 Ga0209759_10022442 132
435 3300025256 Ga0209759_1012333 Ga0209759_10123332 132
436 3300025256 Ga0209759_1027317 Ga0209759_10273173 132
437 3300025263 Ga0209565_1000001 Ga0209565_10000012460 132
438 3300025263 Ga0209565_1000063 Ga0209565_100006373 132
439 3300025263 Ga0209565_1025074 Ga0209565_10250743 132
440 3300025272 Ga0209455_1000207 Ga0209455_100020721 132
441 3300025273 Ga0209673_1000001 Ga0209673_10000012460 132
442 3300025273 Ga0209673_1000065 Ga0209673_100006566 132
443 3300025284 Ga0209130_1005935 Ga0209130_10059352 132
444 3300025291 Ga0209675_1000001 Ga0209675_100000170 132
445 3300025291 Ga0209675_1000011 Ga0209675_1000011209 132
446 3300025292 Ga0209676_1000011 Ga0209676_1000011565 132
447 3300025292 Ga0209676_1000068 Ga0209676_1000068116 132
448 3300025292 Ga0209676_1001200 Ga0209676_10012001 132
449 3300025292 Ga0209676_1017012 Ga0209676_10170123 132
450 3300025294 Ga0209025_1137416 Ga0209025_11374162 132
451 3300025295 Ga0209564_1000001 Ga0209564_1000001232 132
452 3300025295 Ga0209564_1002163 Ga0209564_10021634 132
453 3300025298 Ga0209050_1000239 Ga0209050_100023936 132
454 3300025298 Ga0209050_1000351 Ga0209050_100035122 132
455 3300025298 Ga0209050_1004369 Ga0209050_100436912 132
456 3300025298 Ga0209050_1015764 Ga0209050_10157643 132
457 3300025298 Ga0209050_1018889 Ga0209050_10188891 132
458 3300025299 Ga0209256_1000002 Ga0209256_10000021318 132
459 3300025299 Ga0209256_1000011 Ga0209256_1000011120 132
460 3300025299 Ga0209256_1007888 Ga0209256_10078884 132
461 3300025299 Ga0209256_1009066 Ga0209256_10090661 132
462 3300025299 Ga0209256_1016602 Ga0209256_10166023 132
463 3300025303 Ga0209051_1000016 Ga0209051_1000016210 132
464 3300025303 Ga0209051_1001060 Ga0209051_10010603 132
465 3300025303 Ga0209051_1001316 Ga0209051_10013162 132
466 3300025304 Ga0209257_1000014 Ga0209257_1000014624 132
467 3300025304 Ga0209257_1000102 Ga0209257_100010283 132
468 3300025304 Ga0209257_1000121 Ga0209257_100012175 132
469 3300025304 Ga0209257_1000145 Ga0209257_1000145123 132
470 3300025304 Ga0209257_1002604 Ga0209257_10026042 132
471 3300025304 Ga0209257_1002862 Ga0209257_10028622 132
472 3300025304 Ga0209257_1111993 Ga0209257_11119932 132
473 3300025304 Ga0209257_1139366 Ga0209257_11393661 132
474 3300025315 Ga0207697_10030415 Ga0207697_100304152 132
475 3300025315 Ga0207697_10152396 Ga0207697_101523963 132
476 3300025321 Ga0207656_10070817 Ga0207656_100708172 132
477 3300025321 Ga0207656_10147624 Ga0207656_101476242 132
478 3300025893 Ga0207682_10037412 Ga0207682_100374123 132
479 3300025893 Ga0207682_10256053 Ga0207682_102560532 132
480 3300025899 Ga0207642_10068647 Ga0207642_100686473 132
481 3300025899 Ga0207642_10211202 Ga0207642_102112022 132
482 3300025903 Ga0207680_10022332 Ga0207680_100223323 132
483 3300025907 Ga0207645_10067590 Ga0207645_100675902 132
484 3300025907 Ga0207645_10087967 Ga0207645_100879672 132
485 3300025909 Ga0207705_10024971 Ga0207705_100249714 132
486 3300025912 Ga0207707_10396994 Ga0207707_103969943 132
487 3300025913 Ga0207695_10180477 Ga0207695_101804773 132
488 3300025914 Ga0207671_10054875 Ga0207671_100548755 132
489 3300025917 Ga0207660_10008701 Ga0207660_100087015 132
490 3300025918 Ga0207662_10644355 Ga0207662_106443552 132
491 3300025919 Ga0207657_10048889 Ga0207657_100488892 132
492 3300025920 Ga0207649_10000854 Ga0207649_1000085413 132
493 3300025920 Ga0207649_10185766 Ga0207649_101857662 132
494 3300025920 Ga0207649_10459151 Ga0207649_104591512 132
495 3300025921 Ga0207652_10047333 Ga0207652_100473332 132
496 3300025923 Ga0207681_10039158 Ga0207681_100391582 132
497 3300025923 Ga0207681_10633531 Ga0207681_106335312 132
498 3300025924 Ga0207694_10272978 Ga0207694_102729783 132
499 3300025925 Ga0207650_10458750 Ga0207650_104587502 132
500 3300025926 Ga0207659_10019506 Ga0207659_100195064 132
501 3300025926 Ga0207659_10019707 Ga0207659_100197073 132
502 3300025927 Ga0207687_11003990 Ga0207687_110039902 132
503 3300025931 Ga0207644_10009861 Ga0207644_100098612 132
504 3300025931 Ga0207644_11807705 Ga0207644_118077051 132
505 3300025932 Ga0207690_10000647 Ga0207690_1000064713 132
506 3300025932 Ga0207690_10185032 Ga0207690_101850322 132
507 3300025932 Ga0207690_11109829 Ga0207690_111098291 132
508 3300025932 Ga0207690_11203010 Ga0207690_112030102 132
509 3300025933 Ga0207706_10000933 Ga0207706_1000093333 132
510 3300025933 Ga0207706_10126484 Ga0207706_101264842 132
511 3300025933 Ga0207706_10146781 Ga0207706_101467812 132
512 3300025934 Ga0207686_10623790 Ga0207686_106237902 132
513 3300025935 Ga0207709_10001039 Ga0207709_100010397 132
514 3300025935 Ga0207709_10009154 Ga0207709_100091542 132
515 3300025935 Ga0207709_10045943 Ga0207709_100459431 132
516 3300025936 Ga0207670_10283587 Ga0207670_102835872 132
517 3300025937 Ga0207669_10398681 Ga0207669_103986813 132
518 3300025938 Ga0207704_10013827 Ga0207704_100138272 132
519 3300025940 Ga0207691_10215368 Ga0207691_102153683 132
520 3300025940 Ga0207691_10222523 Ga0207691_102225233 132
521 3300025940 Ga0207691_10596866 Ga0207691_105968662 132
522 3300025941 Ga0207711_10005887 Ga0207711_100058876 132
523 3300025941 Ga0207711_10163673 Ga0207711_101636732 132
524 3300025942 Ga0207689_10000150 Ga0207689_1000015060 132
525 3300025942 Ga0207689_10039825 Ga0207689_100398252 132
526 3300025942 Ga0207689_10092876 Ga0207689_100928763 132
527 3300025944 Ga0207661_10223625 Ga0207661_102236253 132
528 3300025945 Ga0207679_10000526 Ga0207679_100005263 132
529 3300025949 Ga0207667_10051278 Ga0207667_100512786 132
530 3300025949 Ga0207667_10422799 Ga0207667_104227991 132
531 3300025960 Ga0207651_10024727 Ga0207651_100247274 132
532 3300025960 Ga0207651_10368328 Ga0207651_103683283 132
533 3300025961 Ga0207712_10235612 Ga0207712_102356123 132
534 3300025961 Ga0207712_11092450 Ga0207712_110924502 132
535 3300025961 Ga0207712_12025538 Ga0207712_120255381 132
536 3300025972 Ga0207668_10122135 Ga0207668_101221352 132
537 3300025972 Ga0207668_10562435 Ga0207668_105624352 132
538 3300025972 Ga0207668_10722312 Ga0207668_107223122 132
539 3300025972 Ga0207668_10824186 Ga0207668_108241862 132
540 3300025972 Ga0207668_11066805 Ga0207668_110668052 132
541 3300025981 Ga0207640_10028981 Ga0207640_100289814 132
542 3300025981 Ga0207640_10171123 Ga0207640_101711233 132
543 3300025986 Ga0207658_10214471 Ga0207658_102144713 132
544 3300026023 Ga0207677_10004048 Ga0207677_100040485 132
545 3300026023 Ga0207677_10005813 Ga0207677_100058136 132
546 3300026023 Ga0207677_10327566 Ga0207677_103275662 132
547 3300026035 Ga0207703_10004632 Ga0207703_100046322 132
548 3300026035 Ga0207703_10229407 Ga0207703_102294072 132
549 3300026041 Ga0207639_10103548 Ga0207639_101035482 132
550 3300026041 Ga0207639_10793875 Ga0207639_107938752 132
551 3300026067 Ga0207678_10019447 Ga0207678_100194478 132
552 3300026067 Ga0207678_10342410 Ga0207678_103424102 132
553 3300026075 Ga0207708_10353375 Ga0207708_103533752 132
554 3300026078 Ga0207702_10092086 Ga0207702_100920862 132
555 3300026088 Ga0207641_10023323 Ga0207641_100233232 132
556 3300026088 Ga0207641_10422615 Ga0207641_104226153 132
557 3300026089 Ga0207648_10190457 Ga0207648_101904573 132
558 3300026089 Ga0207648_10201201 Ga0207648_102012012 132
559 3300026089 Ga0207648_10416284 Ga0207648_104162842 132
560 3300026089 Ga0207648_10478695 Ga0207648_104786952 132
561 3300026095 Ga0207676_10001384 Ga0207676_100013849 132
562 3300026116 Ga0207674_10640577 Ga0207674_106405772 132
563 3300026118 Ga0207675_100007544 Ga0207675_1000075448 132
564 3300026118 Ga0207675_100276646 Ga0207675_1002766463 132
565 3300026118 Ga0207675_100344070 Ga0207675_1003440703 132
566 3300026118 Ga0207675_102088726 Ga0207675_1020887262 132
567 3300026121 Ga0207683_10087371 Ga0207683_100873713 132
568 3300026121 Ga0207683_10139849 Ga0207683_101398493 132
569 3300026121 Ga0207683_10264170 Ga0207683_102641702 132
570 3300026142 Ga0207698_10017650 Ga0207698_100176506 132
571 3300026142 Ga0207698_11153163 Ga0207698_111531632 132
572 3300026142 Ga0207698_11189237 Ga0207698_111892372 132
573 3300027111 Ga0209281_1000454 Ga0209281_10004547 132
574 3300027312 Ga0209371_1000004 Ga0209371_10000046 132
575 3300028379 Ga0268266_10557448 Ga0268266_105574482 132
576 3300028380 Ga0268265_11436131 Ga0268265_114361312 132
577 3300028380 Ga0268265_11956048 Ga0268265_119560481 132
578 3300028381 Ga0268264_10184062 Ga0268264_101840622 132
579 3300028381 Ga0268264_11163655 Ga0268264_111636552 132
580 3300028573 Ga0265334_10068616 Ga0265334_100686162 132
581 3300028666 Ga0265336_10000048 Ga0265336_100000483 132
582 3300028794 Ga0307515_10031544 Ga0307515_100315443 132
583 3300028794 Ga0307515_10094450 Ga0307515_100944502 132
584 3300030500 Ga0268256_1001254 Ga0268256_10012549 132
585 3300030735 Ga0316178_1026542 Ga0316178_10265422 132
586 3300030742 Ga0316183_1078833 Ga0316183_10788332 132
587 3300030744 Ga0316181_1113656 Ga0316181_11136562 132
588 3300031456 Ga0307513_10015579 Ga0307513_100155792 132
589 3300031456 Ga0307513_10057584 Ga0307513_100575842 132
590 3300031507 Ga0307509_10276599 Ga0307509_102765992 132
591 3300031507 Ga0307509_10283844 Ga0307509_102838443 132
592 3300031548 Ga0307408_100000038 Ga0307408_100000038143 132
593 3300031548 Ga0307408_100286496 Ga0307408_1002864962 132
594 3300031548 Ga0307408_100378910 Ga0307408_1003789102 132
595 3300031548 Ga0307408_100641997 Ga0307408_1006419971 132
596 3300031548 Ga0307408_101159865 Ga0307408_1011598652 132
597 3300031548 Ga0307408_101211774 Ga0307408_1012117742 132
598 3300031730 Ga0307516_10044934 Ga0307516_100449343 132
599 3300031731 Ga0307405_10161697 Ga0307405_101616972 132
600 3300031731 Ga0307405_10360148 Ga0307405_103601483 132
601 3300031731 Ga0307405_10874873 Ga0307405_108748731 132
602 3300031824 Ga0307413_10035338 Ga0307413_100353382 132
603 3300031824 Ga0307413_10783783 Ga0307413_107837832 132
604 3300031824 Ga0307413_11255018 Ga0307413_112550181 132
605 3300031852 Ga0307410_10811381 Ga0307410_108113813 132
606 3300031901 Ga0307406_10234019 Ga0307406_102340192 132
607 3300031903 Ga0307407_10795692 Ga0307407_107956922 132
608 3300031911 Ga0307412_10052360 Ga0307412_100523604 132
609 3300031911 Ga0307412_10312586 Ga0307412_103125862 132
610 3300031995 Ga0307409_101340320 Ga0307409_1013403201 132
611 3300032002 Ga0307416_100924902 Ga0307416_1009249022 132
612 3300032004 Ga0307414_10001112 Ga0307414_100011125 132
613 3300032004 Ga0307414_10030948 Ga0307414_100309482 132
614 3300032004 Ga0307414_10035139 Ga0307414_100351394 132
615 3300032004 Ga0307414_10084330 Ga0307414_100843303 132
616 3300032004 Ga0307414_10124210 Ga0307414_101242102 132
617 3300032005 Ga0307411_10559843 Ga0307411_105598432 132
618 3300032005 Ga0307411_11534074 Ga0307411_115340742 132
619 3300032005 Ga0307411_11614389 Ga0307411_116143891 132
620 3300032005 Ga0307411_11673954 Ga0307411_116739541 132
621 3300035089 Ga0373944_0095002 Ga0373944_0095002_533_940 132
622 3300035090 Ga0373949_0008217 Ga0373949_0008217_916_1323 132
623 3300035114 Ga0373939_0039567 Ga0373939_0039567_444_851 132
624 3300035115 Ga0373941_0194969 Ga0373941_0194969_49_456 132
625 3300035171 Ga0373946_0088812 Ga0373946_0088812_279_686 132
626 3300035691 Ga0373931_0004526 Ga0373931_0004526_1099_1506 132
627 3300035691 Ga0373931_0015753 Ga0373931_0015753_1574_1993 132
628 3300035691 Ga0373931_0464139 Ga0373931_0464139_175_597 132
629 3300037068 Ga0373925_0240421 Ga0373925_0240421_92_499 132
630 3300037466 Ga0395898_0071311 Ga0395898_0071311_492_908 132
631 3300037471 Ga0395905_0677221 Ga0395905_0677221_385_804 132
632 3300038443 Ga0395901_0002425 Ga0395901_0002425_9430_9846 132
633 3300038705 Ga0237819_00165 Ga0237819_00165_16728_17126 132
634 3300038705 Ga0237819_03731 Ga0237819_03731_793_1191 132
635 3300038705 Ga0237819_23238 Ga0237819_23238_176_574 132
636 3300039447 Ga0436361_0001966 Ga0436361_0001966_293_712 132
637 3300039447 Ga0436361_0417753 Ga0436361_0417753_62_466 132
638 3300041404 Ga0439436_0029225 Ga0439436_0029225_753_1163 132
639 3300041404 Ga0439436_0046239 Ga0439436_0046239_567_968 132
640 3300041404 Ga0439436_0049064 Ga0439436_0049064_471_884 132
641 3300041404 Ga0439436_0078777 Ga0439436_0078777_297_704 132
642 3300041406 Ga0439439_0018662 Ga0439439_0018662_658_1068 132
643 3300041407 Ga0439447_009343 Ga0439447_009343_2064_2462 132
644 3300041410 Ga0439461_0098887 Ga0439461_0098887_282_683 132
645 3300041413 Ga0439465_0043300 Ga0439465_0043300_496_897 132
646 3300041441 Ga0451787_452960 Ga0451787_452960_471_878 132
647 3300041443 Ga0451789_0698365 Ga0451789_0698365_1202_1603 132
648 3300041443 Ga0451789_1349124 Ga0451789_1349124_157_558 132
649 3300041451 Ga0451791_0672470 Ga0451791_0672470_693_1094 132
650 3300041451 Ga0451791_1799097 Ga0451791_1799097_317_718 132
651 3300041452 Ga0451793_0143369 Ga0451793_0143369_321_722 132
652 3300041452 Ga0451793_0248334 Ga0451793_0248334_329_730 132
653 3300041452 Ga0451793_0678761 Ga0451793_0678761_243_650 132
654 3300041452 Ga0451793_1247833 Ga0451793_1247833_100_501 132
655 3300041453 Ga0451797_0685350 Ga0451797_0685350_206_607 132
656 3300041453 Ga0451797_1106636 Ga0451797_1106636_235_651 132
657 3300041453 Ga0451797_1204767 Ga0451797_1204767_195_596 132
658 3300041456 Ga0451795_1315014 Ga0451795_1315014_13_417 132
659 3300041456 Ga0451795_1586870 Ga0451795_1586870_244_651 132
660 3300041459 Ga0451800_0163389 Ga0451800_0163389_185_583 132
661 3300041459 Ga0451800_0493538 Ga0451800_0493538_52_453 132
662 3300041459 Ga0451800_1079773 Ga0451800_1079773_36_443 132
663 3300041460 Ga0451802_1524292 Ga0451802_1524292_340_741 132
664 3300041460 Ga0451802_1644705 Ga0451802_1644705_228_635 132
665 3300041460 Ga0451802_1817188 Ga0451802_1817188_92_493 132
666 3300041460 Ga0451802_1988730 Ga0451802_1988730_429_830 132
667 3300041486 Ga0451807_0155804 Ga0451807_0155804_374_775 132
668 3300041486 Ga0451807_1621004 Ga0451807_1621004_259_666 132
669 3300041486 Ga0451807_1664147 Ga0451807_1664147_1262_1669 132
670 3300041486 Ga0451807_1787886 Ga0451807_1787886_251_652 132
671 3300041494 Ga0451837_0237264 Ga0451837_0237264_325_726 132
672 3300041494 Ga0451837_0800704 Ga0451837_0800704_132_539 132
673 3300041498 Ga0451841_0157733 Ga0451841_0157733_10_408 132
674 3300041498 Ga0451841_1302887 Ga0451841_1302887_285_686 132
675 3300041498 Ga0451841_1334294 Ga0451841_1334294_203_610 132
676 3300041509 Ga0451843_0155094 Ga0451843_0155094_523_924 132
677 3300041509 Ga0451843_0206726 Ga0451843_0206726_410_817 132
678 3300041509 Ga0451843_0305339 Ga0451843_0305339_58_525 132
679 3300041509 Ga0451843_1170934 Ga0451843_1170934_814_1215 132
680 3300041509 Ga0451843_1499722 Ga0451843_1499722_10_411 132
681 3300041509 Ga0451843_1503963 Ga0451843_1503963_76_474 132
682 3300041999 Ga0439433_0053903 Ga0439433_0053903_400_801 132
683 3300041999 Ga0439433_0070620 Ga0439433_0070620_92_502 132
684 3300042004 Ga0439445_0097862 Ga0439445_0097862_182_589 132
685 3300042006 Ga0439432_019776 Ga0439432_019776_770_1180 132
686 3300042006 Ga0439432_120041 Ga0439432_120041_302_709 132
687 3300042007 Ga0439449_0013136 Ga0439449_0013136_2120_2530 132
688 3300042007 Ga0439449_0051250 Ga0439449_0051250_353_754 132
689 3300042007 Ga0439449_0109806 Ga0439449_0109806_26_436 132
690 3300042010 Ga0439452_025555 Ga0439452_025555_211_618 132
691 3300042115 Ga0450911_005582 Ga0450911_005582_141_542 132
692 3300042121 Ga0450919_001239 Ga0450919_001239_750_1157 132
693 3300042127 Ga0450890_011251 Ga0450890_011251_159_578 132
694 3300042157 Ga0439458_0120940 Ga0439458_0120940_256_663 132
695 3300042435 Ga0439434_0041674 Ga0439434_0041674_829_1230 132
696 3300042436 Ga0439435_0099125 Ga0439435_0099125_117_518 132
697 3300042531 Ga0450918_000320 Ga0450918_000320_4661_5068 132
698 3300042533 Ga0450901_007565 Ga0450901_007565_275_673 132
699 3300042876 Ga0451577_0177731 Ga0451577_0177731_244_645 132
700 3300044694 Ga0466963_0453115 Ga0466963_0453115_40_459 132
701 3300044712 Ga0453684_0473057 Ga0453684_0473057_126_527 132
702 3300046453 Ga0495627_095254 Ga0495627_095254_339_737 132
703 3300046454 Ga0495592_0473932 Ga0495592_0473932_30_449 132
704 3300046460 Ga0495638_0032789 Ga0495638_0032789_1695_2093 132
705 3300046460 Ga0495638_0156728 Ga0495638_0156728_513_911 132
706 3300046460 Ga0495638_0265569 Ga0495638_0265569_286_687 132
707 3300046472 Ga0495580_0517029 Ga0495580_0517029_229_636 132
708 3300046501 Ga0495607_0053436 Ga0495607_0053436_430_828 132
709 3300046507 Ga0495606_0017003 Ga0495606_0017003_4215_4613 132
710 3300046512 Ga0495610_0013938 Ga0495610_0013938_2685_3083 132
711 3300046512 Ga0495610_0214813 Ga0495610_0214813_184_582 132
712 3300046513 Ga0495616_0163313 Ga0495616_0163313_29_427 132
713 3300046513 Ga0495616_0260072 Ga0495616_0260072_288_686 132
714 3300046518 Ga0495631_0020149 Ga0495631_0020149_1593_1991 132
715 3300046518 Ga0495631_0424324 Ga0495631_0424324_119_517 132
716 3300046522 Ga0495643_0017194 Ga0495643_0017194_2144_2542 132
717 3300046522 Ga0495643_0166135 Ga0495643_0166135_297_698 132
718 3300046523 Ga0495644_0370484 Ga0495644_0370484_119_517 132
719 3300046525 Ga0495663_0000403 Ga0495663_0000403_2076_2477 132
720 3300046525 Ga0495663_0010083 Ga0495663_0010083_902_1300 132
721 3300046525 Ga0495663_0025947 Ga0495663_0025947_1157_1558 132
722 3300046525 Ga0495663_0037832 Ga0495663_0037832_921_1319 132
723 3300046537 Ga0495598_0002515 Ga0495598_0002515_618_1025 132
724 3300046539 Ga0495621_0018217 Ga0495621_0018217_1114_1521 132
725 3300046558 Ga0495633_0041373 Ga0495633_0041373_1394_1792 132
726 3300046558 Ga0495633_0065198 Ga0495633_0065198_1175_1576 132
727 3300046558 Ga0495633_0073528 Ga0495633_0073528_1072_1470 132
728 3300046558 Ga0495633_0075520 Ga0495633_0075520_67_465 132
729 3300046558 Ga0495633_0172944 Ga0495633_0172944_308_706 132
730 3300046616 Ga0495668_0004728 Ga0495668_0004728_8492_8890 132
731 3300046810 Ga0495660_0070482 Ga0495660_0070482_211_609 132
732 3300047320 Ga0495672_0020455 Ga0495672_0020455_1745_2143 132
733 3300047470 Ga0495681_0108015 Ga0495681_0108015_668_1066 132
734 3300047470 Ga0495681_0164916 Ga0495681_0164916_158_556 132
735 3300047472 Ga0495686_0007645 Ga0495686_0007645_7123_7542 132
736 3300047472 Ga0495686_0031505 Ga0495686_0031505_1869_2267 132
737 3300047472 Ga0495686_0063006 Ga0495686_0063006_958_1356 132
738 3300048904 Ga0496101_0605370 Ga0496101_0605370_164_571 132
739 3300048905 Ga0496102_0021039 Ga0496102_0021039_4841_5248 132
740 3300048905 Ga0496102_1648442 Ga0496102_1648442_39_440 132
741 3300048907 Ga0496104_0031783 Ga0496104_0031783_1860_2267 132
742 3300048907 Ga0496104_0834569 Ga0496104_0834569_137_535 132
743 3300048908 Ga0496105_0112275 Ga0496105_0112275_1740_2147 132
744 3300048908 Ga0496105_0293844 Ga0496105_0293844_762_1160 132
745 3300048909 Ga0496106_0136718 Ga0496106_0136718_352_759 132
746 3300048910 Ga0496107_0009476 Ga0496107_0009476_5945_6352 132
747 3300048910 Ga0496107_0617220 Ga0496107_0617220_80_487 132
748 3300048910 Ga0496107_1156862 Ga0496107_1156862_21_479 132
749 3300048911 Ga0496108_0028568 Ga0496108_0028568_208_615 132
750 3300048911 Ga0496108_0090486 Ga0496108_0090486_1987_2394 132
751 3300048912 Ga0496109_0241197 Ga0496109_0241197_350_757 132
752 3300048913 Ga0496110_0085437 Ga0496110_0085437_2174_2581 132
753 3300048913 Ga0496110_0415617 Ga0496110_0415617_308_715 132
754 3300048916 Ga0496113_0040667 Ga0496113_0040667_2685_3092 132
755 3300048916 Ga0496113_0321985 Ga0496113_0321985_747_1145 132
756 3300048917 Ga0496114_0074221 Ga0496114_0074221_19_426 132
757 3300048917 Ga0496114_0272554 Ga0496114_0272554_921_1328 132
758 3300048917 Ga0496114_1346753 Ga0496114_1346753_137_544 132
759 3300048919 Ga0496116_0031581 Ga0496116_0031581_168_569 132
760 3300048919 Ga0496116_0033409 Ga0496116_0033409_1059_1457 132
761 3300048920 Ga0496117_0040292 Ga0496117_0040292_1699_2097 132
762 3300048920 Ga0496117_0058821 Ga0496117_0058821_1310_1708 132
763 3300048920 Ga0496117_0070332 Ga0496117_0070332_586_984 132
764 3300048920 Ga0496117_0070874 Ga0496117_0070874_1810_2211 132
765 3300048920 Ga0496117_0342268 Ga0496117_0342268_231_629 132
766 3300048921 Ga0496118_0027915 Ga0496118_0027915_1315_1713 132
767 3300048921 Ga0496118_0032595 Ga0496118_0032595_1235_1633 132
768 3300048921 Ga0496118_0045304 Ga0496118_0045304_813_1211 132
769 3300048921 Ga0496118_0107848 Ga0496118_0107848_316_714 132
770 3300048921 Ga0496118_0404177 Ga0496118_0404177_211_621 132
771 3300048922 Ga0496119_0000255 Ga0496119_0000255_64509_64907 132
772 3300048922 Ga0496119_0149564 Ga0496119_0149564_145_546 132
773 3300048923 Ga0496120_0000240 Ga0496120_0000240_67651_68049 132
774 3300048924 Ga0496121_0008127 Ga0496121_0008127_4217_4615 132
775 3300048924 Ga0496121_0098890 Ga0496121_0098890_939_1337 132
776 3300048924 Ga0496121_0157964 Ga0496121_0157964_1100_1501 132
777 3300048924 Ga0496121_0648438 Ga0496121_0648438_180_578 132
778 3300048925 Ga0496122_0006648 Ga0496122_0006648_75_473 132
779 3300048925 Ga0496122_0097579 Ga0496122_0097579_997_1395 132
780 3300048925 Ga0496122_0128618 Ga0496122_0128618_326_724 132
781 3300048925 Ga0496122_0142513 Ga0496122_0142513_32_433 132
782 3300048925 Ga0496122_0455300 Ga0496122_0455300_147_545 132
783 3300048925 Ga0496122_0472294 Ga0496122_0472294_12_413 132
784 3300048926 Ga0496123_0001279 Ga0496123_0001279_35248_35646 132
785 3300048926 Ga0496123_0023685 Ga0496123_0023685_2607_3005 132
786 3300048926 Ga0496123_0098020 Ga0496123_0098020_430_828 132
787 3300048926 Ga0496123_0121913 Ga0496123_0121913_128_526 132
788 3300048926 Ga0496123_0129133 Ga0496123_0129133_263_661 132
789 3300048926 Ga0496123_0204322 Ga0496123_0204322_316_717 132
790 3300048926 Ga0496123_0309310 Ga0496123_0309310_203_604 132
791 3300048927 Ga0496124_0000009 Ga0496124_0000009_589236_589634 132
792 3300048927 Ga0496124_0021163 Ga0496124_0021163_1284_1682 132
793 3300048927 Ga0496124_0030421 Ga0496124_0030421_1240_1638 132
794 3300048927 Ga0496124_0076288 Ga0496124_0076288_814_1212 132
795 3300048927 Ga0496124_0172938 Ga0496124_0172938_1196_1594 132
796 3300048927 Ga0496124_0188838 Ga0496124_0188838_353_754 132
797 3300048927 Ga0496124_0204340 Ga0496124_0204340_1004_1402 132
798 3300048927 Ga0496124_0280324 Ga0496124_0280324_119_517 132
799 3300048927 Ga0496124_0303126 Ga0496124_0303126_678_1076 132
800 3300048928 Ga0496125_0025528 Ga0496125_0025528_4998_5396 132
801 3300048928 Ga0496125_0071631 Ga0496125_0071631_822_1244 132
802 3300048928 Ga0496125_0077343 Ga0496125_0077343_1050_1448 132
803 3300048928 Ga0496125_0089734 Ga0496125_0089734_1761_2162 132
804 3300048928 Ga0496125_0100233 Ga0496125_0100233_1394_1795 132
805 3300048928 Ga0496125_0148737 Ga0496125_0148737_633_1031 132
806 3300048928 Ga0496125_0717106 Ga0496125_0717106_112_510 132
807 3300048929 Ga0496126_0006652 Ga0496126_0006652_1523_1921 132
808 3300048929 Ga0496126_0084112 Ga0496126_0084112_1987_2385 132
809 3300048929 Ga0496126_0086702 Ga0496126_0086702_144_542 132
810 3300048929 Ga0496126_0345333 Ga0496126_0345333_142_543 132
811 3300048929 Ga0496126_0375082 Ga0496126_0375082_609_1007 132
812 3300049127 Ga0501306_023887 Ga0501306_023887_217_627 132
813 3300049130 Ga0501310_028433 Ga0501310_028433_80_490 132
814 3300049160 Ga0501304_018257 Ga0501304_018257_198_608 132
815 3300049568 Ga0501031_0025514 Ga0501031_0025514_2316_2714 132
816 3300049568 Ga0501031_0042415 Ga0501031_0042415_966_1364 132
817 3300049568 Ga0501031_0656317 Ga0501031_0656317_76_483 132
818 3300049569 Ga0501032_0022123 Ga0501032_0022123_738_1136 132
819 3300049569 Ga0501032_0228684 Ga0501032_0228684_12_410 132
820 3300049570 Ga0501033_0010061 Ga0501033_0010061_5869_6267 132
821 3300049570 Ga0501033_0085355 Ga0501033_0085355_1117_1515 132
822 3300049570 Ga0501033_0271942 Ga0501033_0271942_652_1050 132
823 3300049571 Ga0501034_0021863 Ga0501034_0021863_5868_6266 132
824 3300049572 Ga0501036_0073796 Ga0501036_0073796_1516_1914 132
825 3300049572 Ga0501036_0323981 Ga0501036_0323981_797_1195 132
826 3300049573 Ga0501037_0020065 Ga0501037_0020065_958_1356 132
827 3300049574 Ga0501038_0014117 Ga0501038_0014117_5842_6240 132
828 3300049574 Ga0501038_0026943 Ga0501038_0026943_898_1296 132
829 3300049575 Ga0501039_0067085 Ga0501039_0067085_847_1245 132
830 3300049575 Ga0501039_0255226 Ga0501039_0255226_809_1207 132
831 3300049579 Ga0501043_0021135 Ga0501043_0021135_719_1117 132
832 3300049579 Ga0501043_0229570 Ga0501043_0229570_704_1102 132
833 3300049581 Ga0501047_0021327 Ga0501047_0021327_4892_5290 132
834 3300049581 Ga0501047_0171970 Ga0501047_0171970_854_1252 132
835 3300049584 Ga0501068_0936823 Ga0501068_0936823_55_453 132
836 3300049586 Ga0501070_0045102 Ga0501070_0045102_883_1281 132
837 3300049586 Ga0501070_0164408 Ga0501070_0164408_1072_1470 132
838 3300049587 Ga0501071_0460648 Ga0501071_0460648_454_852 132
839 3300049589 Ga0501073_0065946 Ga0501073_0065946_1951_2349 132
840 3300049650 Ga0501199_015195 Ga0501199_015195_99_509 132
841 3300049680 Ga0501250_012952 Ga0501250_012952_37_447 132
842 3300049681 Ga0501251_052739 Ga0501251_052739_109_519 132
843 3300049742 Ga0501080_0016883 Ga0501080_0016883_757_1155 132
844 3300049742 Ga0501080_1590210 Ga0501080_1590210_71_469 132
845 3300049742 Ga0501080_1872194 Ga0501080_1872194_29_427 132
846 3300049822 Ga0501035_0014880 Ga0501035_0014880_897_1295 132
847 3300049822 Ga0501035_0192031 Ga0501035_0192031_455_853 132
848 3300049823 Ga0501044_0019187 Ga0501044_0019187_5997_6395 132
849 3300049823 Ga0501044_0037114 Ga0501044_0037114_3851_4249 132
850 3300049823 Ga0501044_1020321 Ga0501044_1020321_254_676 132
851 3300049823 Ga0501044_1567984 Ga0501044_1567984_56_454 132
852 3300049823 Ga0501044_1602328 Ga0501044_1602328_52_450 132
853 3300050489 nmdc:mga03683_315569_c1 nmdc:mga03683_315569_c1_189_599 132
854 3300050490 nmdc:mga03n38_539604_c1 nmdc:mga03n38_539604_c1_118_516 132
855 3300050491 nmdc:mga00v17_153575_c1 nmdc:mga00v17_153575_c1_521_919 132
856 3300050492 nmdc:mga0yw44_104612_c1 nmdc:mga0yw44_104612_c1_415_813 132
857 3300050493 nmdc:mga0k408_293352_c1 nmdc:mga0k408_293352_c1_175_594 132
858 3300050496 nmdc:mga07m45_46177_c1 nmdc:mga07m45_46177_c1_1123_1539 132
859 3300050496 nmdc:mga07m45_61691_c1 nmdc:mga07m45_61691_c1_316_735 132
860 3300050511 nmdc:mga08y16_1337202_c1 nmdc:mga08y16_1337202_c1_143_550 132
861 3300050511 nmdc:mga08y16_749189_c1 nmdc:mga08y16_749189_c1_369_776 132
862 3300053078 Ga0495612_0238028 Ga0495612_0238028_296_703 132
863 3300053080 Ga0500635_0000046 Ga0500635_0000046_61464_61883 132
864 3300053093 Ga0500651_0000088 Ga0500651_0000088_17736_18143 132
865 3300053134 Ga0500658_0180230 Ga0500658_0180230_333_734 132
866 3300053136 Ga0500559_0050725 Ga0500559_0050725_451_870 132
867 3300053138 Ga0500564_088801 Ga0500564_088801_775_1194 132
868 3300053142 Ga0500577_0340038 Ga0500577_0340038_192_593 132
869 3300053151 Ga0500604_0155491 Ga0500604_0155491_89_487 132
870 3300053161 Ga0500634_0000049 Ga0500634_0000049_3539_3937 132
871 3300053177 Ga0500636_0182491 Ga0500636_0182491_54_473 132
872 3300054114 Ga0501084_0879507 Ga0501084_0879507_42_449 132
873 iso_pu_bacteria 2852684882 2852685563 132
874 iso_pu_bacteria 2939622612 2939623537 132
875 2162886007 SwRhRL2b_contig_2733011 SwRhRL2b_0301.00007440 133
876 2162886007 SwRhRL2b_contig_3886549 SwRhRL2b_0353.00006270 133
877 3300003162 Ga0006778J45830_1039144 Ga0006778J45830_10391443 133
878 3300003316 rootH1_10002740 rootH1_100027402 133
879 3300003320 rootH2_10019340 rootH2_100193402 133
880 3300003322 rootL2_10049164 rootL2_100491646 133
881 3300003322 rootL2_10136592 rootL2_101365921 133
882 3300003323 rootH1_10038473 rootH1_100384735 133
883 3300003323 rootH1_10061833 rootH1_100618333 133
884 3300003323 rootH1_10143584 rootH1_101435841 133
885 3300003759 Ga0055525_1000046 Ga0055525_1000046147 133
886 3300003771 Ga0055526_1003565 Ga0055526_10035653 133
887 3300003781 Ga0055536_1014378 Ga0055536_10143782 133
888 3300003856 Ga0058692_1000060 Ga0058692_100006078 133
889 3300004625 Ga0055543_1003835 Ga0055543_10038353 133
890 3300004625 Ga0055543_1012054 Ga0055543_10120542 133
891 3300005262 Ga0065165_1000239 Ga0065165_100023973 133
892 3300005262 Ga0065165_1000401 Ga0065165_10004014 133
893 3300005289 Ga0065704_10000521 Ga0065704_100005218 133
894 3300005289 Ga0065704_10078724 Ga0065704_100787242 133
895 3300005289 Ga0065704_10193942 Ga0065704_101939423 133
896 3300005327 Ga0070658_10138163 Ga0070658_101381632 133
897 3300005327 Ga0070658_10501468 Ga0070658_105014681 133
898 3300005328 Ga0070676_10116453 Ga0070676_101164532 133
899 3300005328 Ga0070676_10232491 Ga0070676_102324912 133
900 3300005328 Ga0070676_10301012 Ga0070676_103010122 133
901 3300005328 Ga0070676_10812898 Ga0070676_108128982 133
902 3300005329 Ga0070683_100159377 Ga0070683_1001593772 133
903 3300005330 Ga0070690_100143883 Ga0070690_1001438832 133
904 3300005331 Ga0070670_100003584 Ga0070670_1000035843 133
905 3300005331 Ga0070670_100034566 Ga0070670_1000345662 133
906 3300005331 Ga0070670_100117018 Ga0070670_1001170181 133
907 3300005331 Ga0070670_100164485 Ga0070670_1001644852 133
908 3300005331 Ga0070670_100265353 Ga0070670_1002653533 133
909 3300005331 Ga0070670_101077045 Ga0070670_1010770452 133
910 3300005333 Ga0070677_10025590 Ga0070677_100255903 133
911 3300005333 Ga0070677_10125290 Ga0070677_101252902 133
912 3300005333 Ga0070677_10291543 Ga0070677_102915432 133
913 3300005334 Ga0068869_100083709 Ga0068869_1000837093 133
914 3300005334 Ga0068869_100805593 Ga0068869_1008055932 133
915 3300005335 Ga0070666_10033683 Ga0070666_100336835 133
916 3300005335 Ga0070666_10725171 Ga0070666_107251712 133
917 3300005337 Ga0070682_100319171 Ga0070682_1003191712 133
918 3300005337 Ga0070682_100441809 Ga0070682_1004418092 133
919 3300005338 Ga0068868_100625760 Ga0068868_1006257601 133
920 3300005338 Ga0068868_100627545 Ga0068868_1006275452 133
921 3300005338 Ga0068868_101225452 Ga0068868_1012254522 133
922 3300005339 Ga0070660_100415469 Ga0070660_1004154692 133
923 3300005340 Ga0070689_100221359 Ga0070689_1002213593 133
924 3300005340 Ga0070689_100383657 Ga0070689_1003836572 133
925 3300005343 Ga0070687_100008132 Ga0070687_1000081322 133
926 3300005343 Ga0070687_100317632 Ga0070687_1003176322 133
927 3300005344 Ga0070661_100084736 Ga0070661_1000847363 133
928 3300005344 Ga0070661_100254344 Ga0070661_1002543442 133
929 3300005345 Ga0070692_10275966 Ga0070692_102759662 133
930 3300005347 Ga0070668_100065280 Ga0070668_1000652802 133
931 3300005353 Ga0070669_100001896 Ga0070669_10000189617 133
932 3300005353 Ga0070669_100497763 Ga0070669_1004977632 133
933 3300005354 Ga0070675_100027333 Ga0070675_1000273332 133
934 3300005354 Ga0070675_100262615 Ga0070675_1002626153 133
935 3300005354 Ga0070675_100562965 Ga0070675_1005629652 133
936 3300005354 Ga0070675_100633071 Ga0070675_1006330711 133
937 3300005354 Ga0070675_101151747 Ga0070675_1011517471 133
938 3300005355 Ga0070671_100009616 Ga0070671_1000096168 133
939 3300005355 Ga0070671_100069035 Ga0070671_1000690353 133
940 3300005355 Ga0070671_100158250 Ga0070671_1001582503 133
941 3300005355 Ga0070671_100401989 Ga0070671_1004019893 133
942 3300005355 Ga0070671_100437577 Ga0070671_1004375772 133
943 3300005355 Ga0070671_100737062 Ga0070671_1007370621 133
944 3300005355 Ga0070671_100878486 Ga0070671_1008784862 133
945 3300005356 Ga0070674_100003764 Ga0070674_1000037646 133
946 3300005356 Ga0070674_100271492 Ga0070674_1002714922 133
947 3300005356 Ga0070674_101091653 Ga0070674_1010916532 133
948 3300005364 Ga0070673_100205364 Ga0070673_1002053642 133
949 3300005364 Ga0070673_100227369 Ga0070673_1002273692 133
950 3300005364 Ga0070673_100236454 Ga0070673_1002364542 133
951 3300005364 Ga0070673_100366647 Ga0070673_1003666473 133
952 3300005364 Ga0070673_100708241 Ga0070673_1007082411 133
953 3300005364 Ga0070673_100724620 Ga0070673_1007246201 133
954 3300005366 Ga0070659_100377472 Ga0070659_1003774722 133
955 3300005367 Ga0070667_100005446 Ga0070667_1000054468 133
956 3300005367 Ga0070667_100318288 Ga0070667_1003182882 133
957 3300005367 Ga0070667_101317883 Ga0070667_1013178831 133
958 3300005438 Ga0070701_10374466 Ga0070701_103744662 133
959 3300005455 Ga0070663_100130980 Ga0070663_1001309802 133
960 3300005455 Ga0070663_100318737 Ga0070663_1003187372 133
961 3300005456 Ga0070678_100043335 Ga0070678_1000433354 133
962 3300005456 Ga0070678_100160790 Ga0070678_1001607903 133
963 3300005456 Ga0070678_100170193 Ga0070678_1001701933 133
964 3300005456 Ga0070678_100174108 Ga0070678_1001741083 133
965 3300005456 Ga0070678_100310449 Ga0070678_1003104493 133
966 3300005456 Ga0070678_101194906 Ga0070678_1011949062 133
967 3300005457 Ga0070662_100273071 Ga0070662_1002730712 133
968 3300005457 Ga0070662_100479368 Ga0070662_1004793682 133
969 3300005459 Ga0068867_100000005 Ga0068867_10000000545 133
970 3300005459 Ga0068867_100082817 Ga0068867_1000828173 133
971 3300005459 Ga0068867_100399280 Ga0068867_1003992803 133
972 3300005535 Ga0070684_101159476 Ga0070684_1011594762 133
973 3300005539 Ga0068853_100347810 Ga0068853_1003478102 133
974 3300005539 Ga0068853_100371292 Ga0068853_1003712922 133
975 3300005539 Ga0068853_100417599 Ga0068853_1004175992 133
976 3300005543 Ga0070672_100003244 Ga0070672_1000032446 133
977 3300005543 Ga0070672_100220039 Ga0070672_1002200393 133
978 3300005543 Ga0070672_100438744 Ga0070672_1004387442 133
979 3300005543 Ga0070672_100548588 Ga0070672_1005485882 133
980 3300005544 Ga0070686_100208664 Ga0070686_1002086642 133
981 3300005547 Ga0070693_100218418 Ga0070693_1002184182 133
982 3300005548 Ga0070665_100439011 Ga0070665_1004390112 133
983 3300005548 Ga0070665_102536391 Ga0070665_1025363912 133
984 3300005563 Ga0068855_101509026 Ga0068855_1015090262 133
985 3300005564 Ga0070664_100266060 Ga0070664_1002660602 133
986 3300005564 Ga0070664_100309246 Ga0070664_1003092463 133
987 3300005577 Ga0068857_100643149 Ga0068857_1006431492 133
988 3300005614 Ga0068856_100566739 Ga0068856_1005667392 133
989 3300005616 Ga0068852_100051582 Ga0068852_1000515822 133
990 3300005616 Ga0068852_100125132 Ga0068852_1001251323 133
991 3300005616 Ga0068852_100228622 Ga0068852_1002286222 133
992 3300005616 Ga0068852_100344478 Ga0068852_1003444782 133
993 3300005616 Ga0068852_100927121 Ga0068852_1009271212 133
994 3300005618 Ga0068864_100010811 Ga0068864_1000108116 133
995 3300005618 Ga0068864_100074072 Ga0068864_1000740722 133
996 3300005618 Ga0068864_100219843 Ga0068864_1002198432 133
997 3300005618 Ga0068864_100287767 Ga0068864_1002877672 133
998 3300005618 Ga0068864_100311152 Ga0068864_1003111522 133
999 3300005618 Ga0068864_100407153 Ga0068864_1004071533 133
1000 3300005718 Ga0068866_10022477 Ga0068866_100224772 133
1001 3300005718 Ga0068866_10454602 Ga0068866_104546022 133
1002 3300005719 Ga0068861_100003364 Ga0068861_1000033648 133
1003 3300005834 Ga0068851_10107935 Ga0068851_101079352 133
1004 3300005834 Ga0068851_10149319 Ga0068851_101493192 133
1005 3300005834 Ga0068851_10742335 Ga0068851_107423351 133
1006 3300005840 Ga0068870_10112703 Ga0068870_101127033 133
1007 3300005840 Ga0068870_10198304 Ga0068870_101983043 133
1008 3300005840 Ga0068870_10238358 Ga0068870_102383582 133
1009 3300005840 Ga0068870_10561730 Ga0068870_105617302 133
1010 3300005841 Ga0068863_100075179 Ga0068863_1000751792 133
1011 3300005841 Ga0068863_100185591 Ga0068863_1001855913 133
1012 3300005841 Ga0068863_100222829 Ga0068863_1002228293 133
1013 3300005842 Ga0068858_100761124 Ga0068858_1007611241 133
1014 3300005844 Ga0068862_100208709 Ga0068862_1002087092 133
1015 3300006028 Ga0070717_10529892 Ga0070717_105298922 133
1016 3300006195 Ga0075366_10200893 Ga0075366_102008933 133
1017 3300006237 Ga0097621_100010826 Ga0097621_1000108262 133
1018 3300006237 Ga0097621_100017103 Ga0097621_1000171037 133
1019 3300006237 Ga0097621_100603380 Ga0097621_1006033802 133
1020 3300006358 Ga0068871_100005809 Ga0068871_1000058099 133
1021 3300006358 Ga0068871_100057753 Ga0068871_1000577533 133
1022 3300006358 Ga0068871_100141284 Ga0068871_1001412843 133
1023 3300006358 Ga0068871_100223359 Ga0068871_1002233593 133
1024 3300006358 Ga0068871_101054900 Ga0068871_1010549002 133
1025 3300006880 Ga0075429_100815997 Ga0075429_1008159971 133
1026 3300006881 Ga0068865_100094158 Ga0068865_1000941583 133
1027 3300006881 Ga0068865_100277296 Ga0068865_1002772962 133
1028 3300006948 Ga0099826_10560233 Ga0099826_105602332 133
1029 3300009011 Ga0105251_10000364 Ga0105251_100003644 133
1030 3300009094 Ga0111539_10951431 Ga0111539_109514311 133
1031 3300009098 Ga0105245_10662157 Ga0105245_106621572 133
1032 3300009098 Ga0105245_10732566 Ga0105245_107325662 133
1033 3300009148 Ga0105243_10006867 Ga0105243_1000686710 133
1034 3300009148 Ga0105243_10102698 Ga0105243_101026982 133
1035 3300009148 Ga0105243_11806122 Ga0105243_118061222 133
1036 3300009148 Ga0105243_12001301 Ga0105243_120013011 133
1037 3300009176 Ga0105242_10330985 Ga0105242_103309852 133
1038 3300009177 Ga0105248_10039291 Ga0105248_100392917 133
1039 3300009177 Ga0105248_10105222 Ga0105248_101052222 133
1040 3300009177 Ga0105248_10682446 Ga0105248_106824461 133
1041 3300009177 Ga0105248_12289127 Ga0105248_122891271 133
1042 3300009553 Ga0105249_10060727 Ga0105249_100607272 133
1043 3300013102 Ga0157371_10287601 Ga0157371_102876012 133
1044 3300013104 Ga0157370_10452984 Ga0157370_104529842 133
1045 3300013105 Ga0157369_10227086 Ga0157369_102270863 133
1046 3300013296 Ga0157374_10105010 Ga0157374_101050104 133
1047 3300013296 Ga0157374_10344207 Ga0157374_103442072 133
1048 3300013297 Ga0157378_10578450 Ga0157378_105784503 133
1049 3300013297 Ga0157378_12775830 Ga0157378_127758301 133
1050 3300013306 Ga0163162_10025364 Ga0163162_100253645 133
1051 3300013306 Ga0163162_10486191 Ga0163162_104861913 133
1052 3300013306 Ga0163162_11074816 Ga0163162_110748162 133
1053 3300013308 Ga0157375_10109446 Ga0157375_101094463 133
1054 3300013308 Ga0157375_10353768 Ga0157375_103537683 133
1055 3300013308 Ga0157375_10408446 Ga0157375_104084462 133
1056 3300013308 Ga0157375_11009048 Ga0157375_110090482 133
1057 3300014325 Ga0163163_10240216 Ga0163163_102402163 133
1058 3300014325 Ga0163163_10329833 Ga0163163_103298332 133
1059 3300014325 Ga0163163_10600868 Ga0163163_106008682 133
1060 3300014325 Ga0163163_11222756 Ga0163163_112227561 133
1061 3300014325 Ga0163163_11443248 Ga0163163_114432482 133
1062 3300014326 Ga0157380_10198110 Ga0157380_101981103 133
1063 3300014326 Ga0157380_10316828 Ga0157380_103168282 133
1064 3300014326 Ga0157380_10449479 Ga0157380_104494792 133
1065 3300014326 Ga0157380_13027101 Ga0157380_130271012 133
1066 3300014745 Ga0157377_10000022 Ga0157377_10000022129 133
1067 3300014745 Ga0157377_10336995 Ga0157377_103369952 133
1068 3300014968 Ga0157379_10066973 Ga0157379_100669732 133
1069 3300014968 Ga0157379_10326475 Ga0157379_103264752 133
1070 3300014968 Ga0157379_10568848 Ga0157379_105688482 133
1071 3300014968 Ga0157379_10633969 Ga0157379_106339692 133
1072 3300014969 Ga0157376_10186237 Ga0157376_101862372 133
1073 3300014969 Ga0157376_10210298 Ga0157376_102102982 133
1074 3300014969 Ga0157376_10360829 Ga0157376_103608291 133
1075 3300017792 Ga0163161_10092187 Ga0163161_100921872 133
1076 3300021361 Ga0213872_10000029 Ga0213872_100000293 133
1077 3300021361 Ga0213872_10000049 Ga0213872_1000004974 133
1078 3300021361 Ga0213872_10077224 Ga0213872_100772242 133
1079 3300025226 Ga0209674_113028 Ga0209674_1130282 133
1080 3300025230 Ga0209563_100005 Ga0209563_100005884 133
1081 3300025292 Ga0209676_1000086 Ga0209676_1000086217 133
1082 3300025295 Ga0209564_1000003 Ga0209564_10000031150 133
1083 3300025299 Ga0209256_1024840 Ga0209256_10248402 133
1084 3300025315 Ga0207697_10023431 Ga0207697_100234312 133
1085 3300025321 Ga0207656_10036941 Ga0207656_100369412 133
1086 3300025321 Ga0207656_10269235 Ga0207656_102692352 133
1087 3300025321 Ga0207656_10295258 Ga0207656_102952582 133
1088 3300025735 Ga0207713_1000422 Ga0207713_100042233 133
1089 3300025893 Ga0207682_10003227 Ga0207682_100032278 133
1090 3300025893 Ga0207682_10053884 Ga0207682_100538842 133
1091 3300025893 Ga0207682_10164565 Ga0207682_101645652 133
1092 3300025893 Ga0207682_10387567 Ga0207682_103875672 133
1093 3300025899 Ga0207642_10597097 Ga0207642_105970972 133
1094 3300025903 Ga0207680_10321960 Ga0207680_103219603 133
1095 3300025905 Ga0207685_10241477 Ga0207685_102414772 133
1096 3300025907 Ga0207645_10032610 Ga0207645_100326104 133
1097 3300025907 Ga0207645_10297927 Ga0207645_102979272 133
1098 3300025907 Ga0207645_10734092 Ga0207645_107340922 133
1099 3300025908 Ga0207643_10089513 Ga0207643_100895132 133
1100 3300025908 Ga0207643_10178962 Ga0207643_101789622 133
1101 3300025908 Ga0207643_10277041 Ga0207643_102770412 133
1102 3300025908 Ga0207643_10937672 Ga0207643_109376721 133
1103 3300025909 Ga0207705_10322919 Ga0207705_103229192 133
1104 3300025909 Ga0207705_10419583 Ga0207705_104195832 133
1105 3300025909 Ga0207705_10422010 Ga0207705_104220102 133
1106 3300025909 Ga0207705_11026422 Ga0207705_110264222 133
1107 3300025918 Ga0207662_10027872 Ga0207662_100278722 133
1108 3300025920 Ga0207649_10894139 Ga0207649_108941392 133
1109 3300025923 Ga0207681_10000205 Ga0207681_1000020528 133
1110 3300025923 Ga0207681_10102057 Ga0207681_101020572 133
1111 3300025925 Ga0207650_10012226 Ga0207650_100122264 133
1112 3300025925 Ga0207650_10012959 Ga0207650_100129593 133
1113 3300025925 Ga0207650_10044672 Ga0207650_100446723 133
1114 3300025925 Ga0207650_10103917 Ga0207650_101039172 133
1115 3300025925 Ga0207650_10796895 Ga0207650_107968952 133
1116 3300025926 Ga0207659_10016801 Ga0207659_100168012 133
1117 3300025926 Ga0207659_10253328 Ga0207659_102533282 133
1118 3300025927 Ga0207687_10322174 Ga0207687_103221742 133
1119 3300025931 Ga0207644_10003106 Ga0207644_100031068 133
1120 3300025931 Ga0207644_10042654 Ga0207644_100426543 133
1121 3300025931 Ga0207644_10258571 Ga0207644_102585712 133
1122 3300025931 Ga0207644_10491634 Ga0207644_104916341 133
1123 3300025931 Ga0207644_10602757 Ga0207644_106027572 133
1124 3300025932 Ga0207690_10624365 Ga0207690_106243652 133
1125 3300025933 Ga0207706_10112176 Ga0207706_101121762 133
1126 3300025933 Ga0207706_10484308 Ga0207706_104843083 133
1127 3300025933 Ga0207706_10951065 Ga0207706_109510652 133
1128 3300025935 Ga0207709_10001336 Ga0207709_1000133616 133
1129 3300025935 Ga0207709_10191960 Ga0207709_101919603 133
1130 3300025936 Ga0207670_10574333 Ga0207670_105743332 133
1131 3300025937 Ga0207669_10255865 Ga0207669_102558652 133
1132 3300025937 Ga0207669_10920399 Ga0207669_109203992 133
1133 3300025938 Ga0207704_10012031 Ga0207704_100120312 133
1134 3300025938 Ga0207704_10686111 Ga0207704_106861112 133
1135 3300025938 Ga0207704_10976203 Ga0207704_109762032 133
1136 3300025940 Ga0207691_10150581 Ga0207691_101505811 133
1137 3300025940 Ga0207691_10167907 Ga0207691_101679073 133
1138 3300025940 Ga0207691_10203561 Ga0207691_102035612 133
1139 3300025940 Ga0207691_10237160 Ga0207691_102371602 133
1140 3300025940 Ga0207691_10237716 Ga0207691_102377162 133
1141 3300025940 Ga0207691_10422560 Ga0207691_104225602 133
1142 3300025941 Ga0207711_10017744 Ga0207711_100177447 133
1143 3300025941 Ga0207711_10098799 Ga0207711_100987992 133
1144 3300025941 Ga0207711_10161734 Ga0207711_101617343 133
1145 3300025941 Ga0207711_10620217 Ga0207711_106202172 133
1146 3300025942 Ga0207689_10004063 Ga0207689_1000406310 133
1147 3300025944 Ga0207661_10251383 Ga0207661_102513832 133
1148 3300025945 Ga0207679_10376029 Ga0207679_103760293 133
1149 3300025945 Ga0207679_10735391 Ga0207679_107353912 133
1150 3300025945 Ga0207679_11091027 Ga0207679_110910272 133
1151 3300025960 Ga0207651_10054500 Ga0207651_100545004 133
1152 3300025960 Ga0207651_10070213 Ga0207651_100702132 133
1153 3300025960 Ga0207651_10139322 Ga0207651_101393222 133
1154 3300025960 Ga0207651_10250820 Ga0207651_102508202 133
1155 3300025960 Ga0207651_10667556 Ga0207651_106675563 133
1156 3300025960 Ga0207651_10915573 Ga0207651_109155732 133
1157 3300025960 Ga0207651_11025210 Ga0207651_110252102 133
1158 3300025961 Ga0207712_10005810 Ga0207712_100058104 133
1159 3300025961 Ga0207712_11125984 Ga0207712_111259842 133
1160 3300025972 Ga0207668_10011424 Ga0207668_100114243 133
1161 3300025981 Ga0207640_10997769 Ga0207640_109977691 133
1162 3300025986 Ga0207658_10309228 Ga0207658_103092283 133
1163 3300025986 Ga0207658_11228038 Ga0207658_112280382 133
1164 3300026023 Ga0207677_10324355 Ga0207677_103243552 133
1165 3300026023 Ga0207677_10428668 Ga0207677_104286682 133
1166 3300026023 Ga0207677_10552653 Ga0207677_105526532 133
1167 3300026035 Ga0207703_10433776 Ga0207703_104337762 133
1168 3300026041 Ga0207639_10351030 Ga0207639_103510302 133
1169 3300026041 Ga0207639_11221784 Ga0207639_112217842 133
1170 3300026067 Ga0207678_10002944 Ga0207678_1000294417 133
1171 3300026067 Ga0207678_10173833 Ga0207678_101738332 133
1172 3300026078 Ga0207702_11283335 Ga0207702_112833352 133
1173 3300026088 Ga0207641_10112740 Ga0207641_101127404 133
1174 3300026088 Ga0207641_10115736 Ga0207641_101157363 133
1175 3300026088 Ga0207641_10494474 Ga0207641_104944742 133
1176 3300026088 Ga0207641_11894274 Ga0207641_118942742 133
1177 3300026089 Ga0207648_10000032 Ga0207648_100000325 133
1178 3300026089 Ga0207648_10046240 Ga0207648_100462402 133
1179 3300026089 Ga0207648_10283704 Ga0207648_102837043 133
1180 3300026089 Ga0207648_10343108 Ga0207648_103431082 133
1181 3300026089 Ga0207648_11494378 Ga0207648_114943781 133
1182 3300026095 Ga0207676_10041627 Ga0207676_100416272 133
1183 3300026095 Ga0207676_10049899 Ga0207676_100498994 133
1184 3300026095 Ga0207676_10076457 Ga0207676_100764574 133
1185 3300026095 Ga0207676_10101156 Ga0207676_101011563 133
1186 3300026095 Ga0207676_10270744 Ga0207676_102707443 133
1187 3300026095 Ga0207676_10657058 Ga0207676_106570582 133
1188 3300026116 Ga0207674_10399920 Ga0207674_103999202 133
1189 3300026118 Ga0207675_100024771 Ga0207675_1000247712 133
1190 3300026118 Ga0207675_100512014 Ga0207675_1005120143 133
1191 3300026121 Ga0207683_10071385 Ga0207683_100713854 133
1192 3300026121 Ga0207683_10203248 Ga0207683_102032482 133
1193 3300026121 Ga0207683_10216018 Ga0207683_102160183 133
1194 3300026121 Ga0207683_10222535 Ga0207683_102225352 133
1195 3300026121 Ga0207683_10241093 Ga0207683_102410933 133
1196 3300026121 Ga0207683_10368754 Ga0207683_103687542 133
1197 3300026121 Ga0207683_10657540 Ga0207683_106575402 133
1198 3300026121 Ga0207683_11426343 Ga0207683_114263431 133
1199 3300026142 Ga0207698_10113841 Ga0207698_101138412 133
1200 3300026142 Ga0207698_10341704 Ga0207698_103417042 133
1201 3300026142 Ga0207698_10616022 Ga0207698_106160222 133
1202 3300026142 Ga0207698_11391276 Ga0207698_113912761 133
1203 3300027312 Ga0209371_1000139 Ga0209371_100013979 133
1204 3300027312 Ga0209371_1012163 Ga0209371_10121632 133
1205 3300027378 Ga0209981_1033683 Ga0209981_10336831 133
1206 3300027471 Ga0209995_1000673 Ga0209995_10006732 133
1207 3300027526 Ga0209968_1004004 Ga0209968_10040042 133
1208 3300027543 Ga0209999_1006384 Ga0209999_10063842 133
1209 3300027695 Ga0209966_1000013 Ga0209966_100001355 133
1210 3300028379 Ga0268266_10500541 Ga0268266_105005412 133
1211 3300028380 Ga0268265_10184817 Ga0268265_101848172 133
1212 3300028380 Ga0268265_10943258 Ga0268265_109432582 133
1213 3300028381 Ga0268264_10003680 Ga0268264_100036803 133
1214 3300030500 Ga0268256_1000109 Ga0268256_100010923 133
1215 3300030500 Ga0268256_1014691 Ga0268256_10146912 133
1216 3300031239 Ga0265328_10016658 Ga0265328_100166582 133
1217 3300031250 Ga0265331_10004885 Ga0265331_100048852 133
1218 3300031251 Ga0265327_10000043 Ga0265327_10000043193 133
1219 3300031251 Ga0265327_10095114 Ga0265327_100951143 133
1220 3300031901 Ga0307406_10348724 Ga0307406_103487242 133
1221 3300031901 Ga0307406_11570938 Ga0307406_115709381 133
1222 3300032002 Ga0307416_100005668 Ga0307416_1000056683 133
1223 3300032002 Ga0307416_102243329 Ga0307416_1022433291 133
1224 3300032004 Ga0307414_10157996 Ga0307414_101579962 133
1225 3300032005 Ga0307411_10145016 Ga0307411_101450162 133
1226 3300032126 Ga0307415_100229695 Ga0307415_1002296952 133
1227 3300035083 Ga0373926_0139989 Ga0373926_0139989_358_780 133
1228 3300035089 Ga0373944_0023948 Ga0373944_0023948_1081_1503 133
1229 3300035116 Ga0373945_0130581 Ga0373945_0130581_208_630 133
1230 3300035118 Ga0373954_0266143 Ga0373954_0266143_359_781 133
1231 3300035170 Ga0373943_0017704 Ga0373943_0017704_524_946 133
1232 3300035170 Ga0373943_0182775 Ga0373943_0182775_139_561 133
1233 3300035170 Ga0373943_0268024 Ga0373943_0268024_516_938 133
1234 3300035172 Ga0373955_0044738 Ga0373955_0044738_629_1051 133
1235 3300035692 Ga0373935_0025734 Ga0373935_0025734_2719_3141 133
1236 3300035695 Ga0373927_0100032 Ga0373927_0100032_866_1288 133
1237 3300035724 Ga0373933_0266582 Ga0373933_0266582_197_619 133
1238 3300035725 Ga0373947_0176775 Ga0373947_0176775_695_1117 133
1239 3300036401 Ga0373937_1581300 Ga0373937_1581300_117_539 133
1240 3300037068 Ga0373925_0034245 Ga0373925_0034245_978_1400 133
1241 3300037471 Ga0395905_0007830 Ga0395905_0007830_9732_10139 133
1242 3300037471 Ga0395905_0085597 Ga0395905_0085597_1153_1560 133
1243 3300039145 Ga0237816_00056 Ga0237816_00056_3314_3724 133
1244 3300039447 Ga0436361_0082864 Ga0436361_0082864_18348_18788 133
1245 3300039447 Ga0436361_0196856 Ga0436361_0196856_9854_10276 133
1246 3300039447 Ga0436361_0875016 Ga0436361_0875016_590_1030 133
1247 3300041413 Ga0439465_0000224 Ga0439465_0000224_14053_14457 133
1248 3300041451 Ga0451791_0319337 Ga0451791_0319337_57_479 133
1249 3300041452 Ga0451793_0050907 Ga0451793_0050907_141_548 133
1250 3300041452 Ga0451793_0594577 Ga0451793_0594577_665_1072 133
1251 3300041453 Ga0451797_1248801 Ga0451797_1248801_364_768 133
1252 3300041459 Ga0451800_0098586 Ga0451800_0098586_10636_11043 133
1253 3300041462 Ga0451806_420239 Ga0451806_420239_3153_3560 133
1254 3300041463 Ga0451804_0562792 Ga0451804_0562792_2450_2857 133
1255 3300041486 Ga0451807_0183383 Ga0451807_0183383_894_1301 133
1256 3300041494 Ga0451837_1130467 Ga0451837_1130467_100_504 133
1257 3300041494 Ga0451837_1211241 Ga0451837_1211241_1328_1732 133
1258 3300041509 Ga0451843_0012520 Ga0451843_0012520_2182_2586 133
1259 3300041509 Ga0451843_0200154 Ga0451843_0200154_89_496 133
1260 3300041509 Ga0451843_1540849 Ga0451843_1540849_376_780 133
1261 3300041999 Ga0439433_0093817 Ga0439433_0093817_18_419 133
1262 3300042004 Ga0439445_0004656 Ga0439445_0004656_1545_1949 133
1263 3300042004 Ga0439445_0027529 Ga0439445_0027529_532_936 133
1264 3300042007 Ga0439449_0005798 Ga0439449_0005798_1504_1908 133
1265 3300042007 Ga0439449_0013961 Ga0439449_0013961_2456_2857 133
1266 3300042007 Ga0439449_0029827 Ga0439449_0029827_770_1171 133
1267 3300042011 Ga0439454_006386 Ga0439454_006386_689_1126 133
1268 3300042438 Ga0439459_0000618 Ga0439459_0000618_332_769 133
1269 3300044694 Ga0466963_0935684 Ga0466963_0935684_31_465 133
1270 3300044712 Ga0453684_0118653 Ga0453684_0118653_2210_2617 133
1271 3300044712 Ga0453684_0584012 Ga0453684_0584012_193_597 133
1272 3300045051 Ga0451576_0041719 Ga0451576_0041719_202_609 133
1273 3300045051 Ga0451576_2363323 Ga0451576_2363323_18_425 133
1274 3300046459 Ga0495629_0180753 Ga0495629_0180753_104_526 133
1275 3300046459 Ga0495629_0330467 Ga0495629_0330467_262_684 133
1276 3300046472 Ga0495580_0213174 Ga0495580_0213174_145_567 133
1277 3300046475 Ga0495639_0392848 Ga0495639_0392848_25_447 133
1278 3300046516 Ga0495628_0053645 Ga0495628_0053645_1541_1963 133
1279 3300046522 Ga0495643_0177871 Ga0495643_0177871_132_566 133
1280 3300046535 Ga0495586_0174081 Ga0495586_0174081_487_909 133
1281 3300046543 Ga0495645_0205136 Ga0495645_0205136_707_1129 133
1282 3300046559 Ga0495667_0480747 Ga0495667_0480747_177_599 133
1283 3300046681 Ga0495647_0081064 Ga0495647_0081064_669_1091 133
1284 3300046683 Ga0495658_0067293 Ga0495658_0067293_1370_1792 133
1285 3300046689 Ga0495613_0315803 Ga0495613_0315803_438_860 133
1286 3300046691 Ga0495670_0304692 Ga0495670_0304692_240_662 133
1287 3300046809 Ga0495600_0289034 Ga0495600_0289034_392_814 133
1288 3300047315 Ga0495581_0816904 Ga0495581_0816904_26_448 133
1289 3300047319 Ga0495674_0170461 Ga0495674_0170461_1197_1619 133
1290 3300047321 Ga0495676_0677485 Ga0495676_0677485_130_552 133
1291 3300047322 Ga0495680_0141619 Ga0495680_0141619_526_948 133
1292 3300047471 Ga0495684_0194495 Ga0495684_0194495_292_714 133
1293 3300047471 Ga0495684_0414770 Ga0495684_0414770_57_479 133
1294 3300048089 Ga0495614_0533740 Ga0495614_0533740_70_492 133
1295 3300048904 Ga0496101_0025070 Ga0496101_0025070_165_587 133
1296 3300048905 Ga0496102_1164163 Ga0496102_1164163_247_669 133
1297 3300048907 Ga0496104_0180037 Ga0496104_0180037_1331_1753 133
1298 3300048908 Ga0496105_1020548 Ga0496105_1020548_172_594 133
1299 3300048911 Ga0496108_0171248 Ga0496108_0171248_94_516 133
1300 3300048911 Ga0496108_1358367 Ga0496108_1358367_155_577 133
1301 3300048911 Ga0496108_1505014 Ga0496108_1505014_62_484 133
1302 3300048912 Ga0496109_0303698 Ga0496109_0303698_598_1020 133
1303 3300048912 Ga0496109_0318559 Ga0496109_0318559_481_903 133
1304 3300048913 Ga0496110_0528202 Ga0496110_0528202_272_694 133
1305 3300048913 Ga0496110_0597742 Ga0496110_0597742_288_710 133
1306 3300048913 Ga0496110_1190467 Ga0496110_1190467_18_440 133
1307 3300048914 Ga0496111_0561302 Ga0496111_0561302_188_610 133
1308 3300048916 Ga0496113_0886030 Ga0496113_0886030_239_661 133
1309 3300048917 Ga0496114_0015156 Ga0496114_0015156_3137_3559 133
1310 3300048917 Ga0496114_0793921 Ga0496114_0793921_310_732 133
1311 3300048920 Ga0496117_0001966 Ga0496117_0001966_5724_6131 133
1312 3300048921 Ga0496118_0168104 Ga0496118_0168104_371_778 133
1313 3300048921 Ga0496118_0189991 Ga0496118_0189991_99_506 133
1314 3300048922 Ga0496119_0004546 Ga0496119_0004546_1482_1889 133
1315 3300048923 Ga0496120_0000598 Ga0496120_0000598_48548_48955 133
1316 3300048925 Ga0496122_0000663 Ga0496122_0000663_22173_22580 133
1317 3300048926 Ga0496123_0000828 Ga0496123_0000828_2545_2952 133
1318 3300048927 Ga0496124_0026783 Ga0496124_0026783_1761_2168 133
1319 3300048928 Ga0496125_0112107 Ga0496125_0112107_303_713 133
1320 3300048929 Ga0496126_0208506 Ga0496126_0208506_211_612 133
1321 3300049128 Ga0501308_007083 Ga0501308_007083_344_751 133
1322 3300049129 Ga0501309_001733 Ga0501309_001733_761_1168 133
1323 3300049130 Ga0501310_000865 Ga0501310_000865_1540_1947 133
1324 3300049160 Ga0501304_000917 Ga0501304_000917_956_1363 133
1325 3300049161 Ga0501305_003418 Ga0501305_003418_346_753 133
1326 3300049517 Ga0501294_009168 Ga0501294_009168_463_870 133
1327 3300049520 Ga0501297_004528 Ga0501297_004528_606_1013 133
1328 3300049521 Ga0501298_083728 Ga0501298_083728_121_528 133
1329 3300049523 Ga0501300_001357 Ga0501300_001357_529_936 133
1330 3300049528 Ga0501312_003406 Ga0501312_003406_346_753 133
1331 3300049529 Ga0501313_023853 Ga0501313_023853_41_448 133
1332 3300049530 Ga0501314_002220 Ga0501314_002220_437_844 133
1333 3300049531 Ga0501315_002024 Ga0501315_002024_756_1163 133
1334 3300049533 Ga0501317_004293 Ga0501317_004293_379_786 133
1335 3300049537 Ga0501321_026828 Ga0501321_026828_301_708 133
1336 3300049571 Ga0501034_0072309 Ga0501034_0072309_1228_1629 133
1337 3300049572 Ga0501036_1011383 Ga0501036_1011383_71_499 133
1338 3300049579 Ga0501043_0000004 Ga0501043_0000004_6797_7225 133
1339 3300049580 Ga0501046_0000050 Ga0501046_0000050_84113_84541 133
1340 3300049581 Ga0501047_0000012 Ga0501047_0000012_284291_284719 133
1341 3300049582 Ga0501048_0010686 Ga0501048_0010686_1084_1512 133
1342 3300049649 Ga0501198_000004 Ga0501198_000004_42796_43224 133
1343 3300049653 Ga0501206_006551 Ga0501206_006551_943_1350 133
1344 3300049658 Ga0501211_002448 Ga0501211_002448_541_948 133
1345 3300049661 Ga0501217_027085 Ga0501217_027085_931_1338 133
1346 3300049662 Ga0501222_000038 Ga0501222_000038_31774_32202 133
1347 3300049662 Ga0501222_008815 Ga0501222_008815_518_925 133
1348 3300049663 Ga0501223_009832 Ga0501223_009832_1488_1895 133
1349 3300049669 Ga0501235_024396 Ga0501235_024396_821_1228 133
1350 3300049683 Ga0501253_018493 Ga0501253_018493_656_1063 133
1351 3300049684 Ga0501255_001001 Ga0501255_001001_101_508 133
1352 3300049687 Ga0501258_006361 Ga0501258_006361_370_777 133
1353 3300049690 Ga0501261_009717 Ga0501261_009717_779_1186 133
1354 3300049705 Ga0501225_0025880 Ga0501225_0025880_879_1286 133
1355 3300049705 Ga0501225_0038030 Ga0501225_0038030_350_754 133
1356 3300049706 Ga0501229_000597 Ga0501229_000597_1045_1452 133
1357 3300049757 Ga0501232_032573 Ga0501232_032573_194_601 133
1358 3300049759 Ga0501262_002037 Ga0501262_002037_1488_1895 133
1359 3300049762 Ga0501265_010324 Ga0501265_010324_323_730 133
1360 3300049764 Ga0501267_001203 Ga0501267_001203_1172_1579 133
1361 3300049765 Ga0501268_103430 Ga0501268_103430_126_533 133
1362 3300049769 Ga0501272_005104 Ga0501272_005104_782_1189 133
1363 3300049778 Ga0501282_013499 Ga0501282_013499_328_735 133
1364 3300049824 Ga0501045_0016727 Ga0501045_0016727_3713_4141 133
1365 3300049853 Ga0501226_033241 Ga0501226_033241_26_433 133
1366 3300050493 nmdc:mga0k408_186563_c1 nmdc:mga0k408_186563_c1_222_644 133
1367 3300053077 Ga0495601_0144456 Ga0495601_0144456_384_806 133
1368 3300053084 Ga0495595_0160133 Ga0495595_0160133_234_656 133
1369 3300053085 Ga0495619_0173642 Ga0495619_0173642_589_1011 133
1370 3300053156 Ga0500622_0019200 Ga0500622_0019200_2845_3267 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

144

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.7867 2 131
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7765 1 129
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7695 1 129
1v96-assembly1.cif.gz_A crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii ot3 0.7661 2 129
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.7656 2 131
ID Description Score Start End Superfamily
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8262 1 127 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8083 1 127 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8076 2 131 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7783 2 131 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7765 1 129 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A349Y6C8-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9829 19 131 GO:0004518
GO:0046872
AF-A0A3D4TN72-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.978 1 88
AF-A0A1S0V9N5-F1-model_v4 deleted 0.9761 2 131
AF-Q9PGK7-F1-model_v4 PIN domain-containing protein 0.9748 2 131 GO:0004518
GO:0046872
AF-A0A0U3AAD4-F1-model_v4 DNA-binding protein (PIN domain-containing protein) 0.9731 1 131 GO:0003677
GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map