F493372

General Info

Members Datasets Scaffolds Average Seq Length
1365 529 1365 60

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0232990|Ga0495673_0232990_379_594
Length 71
Sequence MAGTRFEESPAMAVPKRKTSPSRRNMRRSHHALAPNSFVDDKETGELKRPHHVDLKTGMYKGRQVLTPKED

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
219 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
220 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
221 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
222 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
238 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
257 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
262 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
295 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
296 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
297 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
298 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
299 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
300 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
301 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
302 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
303 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
304 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
305 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
306 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
307 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
308 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
309 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
310 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
311 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
312 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
313 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
314 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
315 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
316 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
317 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
320 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
328 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
329 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
332 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
333 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
348 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
349 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
350 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
358 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
369 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
372 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
373 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
374 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
375 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
376 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
377 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
378 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
379 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
380 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
381 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
387 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
390 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
391 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
392 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
396 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
408 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
409 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
410 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
411 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
412 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
413 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
414 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
417 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
437 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
438 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
439 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
440 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
441 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
442 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
443 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
444 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
445 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
446 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
447 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
448 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
449 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
450 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
451 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
452 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
453 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
454 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
458 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
459 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
460 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
461 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
462 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
466 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
467 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
468 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
469 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
470 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
471 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
472 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
473 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
474 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
475 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
476 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
477 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
478 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
481 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
482 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
483 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
484 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
485 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
486 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
487 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
488 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
489 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
490 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
491 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
492 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
493 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
494 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
495 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
496 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
497 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
498 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
499 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
500 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
501 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
502 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
503 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
504 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
505 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
506 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
507 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
508 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
509 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
512 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
513 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
514 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
515 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
516 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
517 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
518 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
519 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
520 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
521 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
522 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
523 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
524 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
529 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.87
Nodule 0.37
Rhizoplane 4.03
Rhizosphere 74.29
Stem 0
Stem Tuber 0
Unclassified 6.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000317 3300001979 Bacteria 20540
2 JGI24740J21852_10082774 3300001979 Bacteria 838
3 JGI24740J21852_10101924 3300001979 Bacteria 730
4 JGI24740J21852_10176685 3300001979 Bacteria 529
5 JGI24739J22299_10118348 3300001989 Bacteria 792
6 JGI24737J22298_10246203 3300001990 Bacteria 528
7 JGI24735J21928_10121791 3300002067 Bacteria 751
8 JGI25162J39368_1000199 3300002737 Bacteria 63139
9 JGI25152J39213_1001688 3300002773 Bacteria 9115
10 JGI25152J39213_1003233 3300002773 Bacteria 5663
11 JGI25151J46595_10003651 3300003187 Bacteria 8395
12 JGI25151J46595_10050220 3300003187 Bacteria 1423
13 JGI25165J46597_1000307 3300003214 Bacteria 59794
14 JGI25165J46597_1003183 3300003214 Bacteria 4322
15 JGI25160J50197_1018865 3300003354 Bacteria 2135
16 Ga0055536_1005132 3300003781 Bacteria 6476
17 Ga0055536_1005459 3300003781 Bacteria 6210
18 Ga0055540_1033556 3300003792 Bacteria 1162
19 Ga0055540_1099987 3300003792 Bacteria 541
20 Ga0055531_10001759 3300003794 Bacteria 15441
21 Ga0055531_10033269 3300003794 Bacteria 1664
22 Ga0058692_1001101 3300003856 Bacteria 10465
23 Ga0065704_10809058 3300005289 Bacteria 522
24 Ga0065715_10038113 3300005293 Bacteria 1338
25 Ga0070658_10037406 3300005327 Bacteria 3913
26 Ga0070658_10120646 3300005327 Bacteria 2178
27 Ga0070658_10230339 3300005327 Bacteria 1568
28 Ga0070658_10962084 3300005327 Bacteria 742
29 Ga0070658_11126232 3300005327 Bacteria 683
30 Ga0070658_11245182 3300005327 Bacteria 647
31 Ga0070658_11296796 3300005327 Bacteria 632
32 Ga0070658_11897721 3300005327 Bacteria 515
33 Ga0070676_10117486 3300005328 Bacteria 1665
34 Ga0070676_10201527 3300005328 Bacteria 1305
35 Ga0070683_100239781 3300005329 Bacteria 1724
36 Ga0070683_100501443 3300005329 Bacteria 1160
37 Ga0070670_100000037 3300005331 Bacteria 156070
38 Ga0070670_100000061 3300005331 Bacteria 113254
39 Ga0070670_100097305 3300005331 Bacteria 2532
40 Ga0070670_100114793 3300005331 Bacteria 2321
41 Ga0070670_100239057 3300005331 Bacteria 1581
42 Ga0070670_100780865 3300005331 Bacteria 862
43 Ga0070670_101031068 3300005331 Bacteria 749
44 Ga0068869_100670951 3300005334 Bacteria 882
45 Ga0070666_10156501 3300005335 Bacteria 1592
46 Ga0070666_10243716 3300005335 Bacteria 1271
47 Ga0070666_10308471 3300005335 Bacteria 1128
48 Ga0070666_10623783 3300005335 Bacteria 788
49 Ga0070666_11486998 3300005335 Bacteria 507
50 Ga0070680_100028910 3300005336 Bacteria 4449
51 Ga0070680_100063220 3300005336 Bacteria 3031
52 Ga0070680_100592280 3300005336 Bacteria 952
53 Ga0070680_100719008 3300005336 Bacteria 859
54 Ga0070682_100201014 3300005337 Bacteria 1406
55 Ga0070682_101284689 3300005337 Bacteria 621
56 Ga0068868_100054268 3300005338 Bacteria 3158
57 Ga0068868_101352203 3300005338 Bacteria 663
58 Ga0070660_100049520 3300005339 Bacteria 3230
59 Ga0070660_100062622 3300005339 Bacteria 2890
60 Ga0070660_100123508 3300005339 Bacteria 2067
61 Ga0070660_100632862 3300005339 Bacteria 895
62 Ga0070691_10006942 3300005341 Bacteria 5183
63 Ga0070691_10468279 3300005341 Bacteria 723
64 Ga0070661_100059856 3300005344 Bacteria 2794
65 Ga0070661_100125177 3300005344 Bacteria 1927
66 Ga0070661_100231753 3300005344 Bacteria 1419
67 Ga0070661_100259299 3300005344 Bacteria 1344
68 Ga0070661_100386980 3300005344 Bacteria 1103
69 Ga0070661_100467090 3300005344 Bacteria 1006
70 Ga0070661_100791305 3300005344 Bacteria 778
71 Ga0070661_101162213 3300005344 Bacteria 644
72 Ga0070661_101436225 3300005344 Bacteria 581
73 Ga0070668_100000097 3300005347 Bacteria 53800
74 Ga0070668_100001398 3300005347 Bacteria 17348
75 Ga0070668_100006261 3300005347 Bacteria 8813
76 Ga0070668_100023971 3300005347 Bacteria 4620
77 Ga0070668_100026662 3300005347 Bacteria 4386
78 Ga0070668_100397774 3300005347 Bacteria 1176
79 Ga0070668_100696881 3300005347 Bacteria 895
80 Ga0070668_100927278 3300005347 Bacteria 779
81 Ga0070669_100007690 3300005353 Bacteria 7706
82 Ga0070669_100052266 3300005353 Bacteria 2989
83 Ga0070669_100069357 3300005353 Bacteria 2604
84 Ga0070669_100100055 3300005353 Bacteria 2186
85 Ga0070669_100308986 3300005353 Bacteria 1274
86 Ga0070669_101586422 3300005353 Bacteria 570
87 Ga0070675_100461172 3300005354 Bacteria 1141
88 Ga0070675_101543746 3300005354 Bacteria 612
89 Ga0070671_100000342 3300005355 Bacteria 32006
90 Ga0070671_100000890 3300005355 Bacteria 21800
91 Ga0070671_100151193 3300005355 Bacteria 1960
92 Ga0070671_100183764 3300005355 Bacteria 1771
93 Ga0070671_100494765 3300005355 Bacteria 1051
94 Ga0070674_101638054 3300005356 Bacteria 581
95 Ga0070688_101292261 3300005365 Bacteria 589
96 Ga0070659_100000206 3300005366 Bacteria 45867
97 Ga0070659_100005903 3300005366 Bacteria 8821
98 Ga0070659_100020949 3300005366 Bacteria 4972
99 Ga0070659_100207804 3300005366 Bacteria 1613
100 Ga0070659_101427097 3300005366 Bacteria 616
101 Ga0070667_100000083 3300005367 Bacteria 118261
102 Ga0070667_100040040 3300005367 Bacteria 3929
103 Ga0070667_100046049 3300005367 Bacteria 3668
104 Ga0070667_100066504 3300005367 Bacteria 3063
105 Ga0070667_100290300 3300005367 Bacteria 1470
106 Ga0070667_101284997 3300005367 Bacteria 685
107 Ga0070667_101628249 3300005367 Bacteria 607
108 Ga0070705_100212578 3300005440 Bacteria 1334
109 Ga0070708_100093937 3300005445 Bacteria 2736
110 Ga0070708_100141843 3300005445 Bacteria 2228
111 Ga0070708_101623113 3300005445 Bacteria 602
112 Ga0070663_100483486 3300005455 Bacteria 1025
113 Ga0070663_100738339 3300005455 Bacteria 840
114 Ga0070663_100775075 3300005455 Bacteria 821
115 Ga0070663_100991189 3300005455 Bacteria 730
116 Ga0070663_100998649 3300005455 Bacteria 727
117 Ga0070678_100246264 3300005456 Bacteria 1497
118 Ga0070678_100879050 3300005456 Bacteria 818
119 Ga0070662_100079996 3300005457 Bacteria 2432
120 Ga0070662_100161703 3300005457 Bacteria 1752
121 Ga0070662_100255983 3300005457 Bacteria 1409
122 Ga0070662_101323726 3300005457 Bacteria 620
123 Ga0070681_10077685 3300005458 Bacteria 3277
124 Ga0070681_10101301 3300005458 Bacteria 2825
125 Ga0070681_10477736 3300005458 Bacteria 1159
126 Ga0070681_10750034 3300005458 Bacteria 893
127 Ga0070681_10806527 3300005458 Bacteria 856
128 Ga0068867_100243024 3300005459 Bacteria 1461
129 Ga0070706_100530272 3300005467 Bacteria 1095
130 Ga0070707_101049691 3300005468 Bacteria 780
131 Ga0070698_100132761 3300005471 Bacteria 2444
132 Ga0070699_100157214 3300005518 Bacteria 2012
133 Ga0070679_100003462 3300005530 Bacteria 14454
134 Ga0070679_100882651 3300005530 Bacteria 838
135 Ga0070679_101033610 3300005530 Bacteria 766
136 Ga0070679_101115383 3300005530 Bacteria 734
137 Ga0070684_100106711 3300005535 Bacteria 2508
138 Ga0070684_100858679 3300005535 Bacteria 850
139 Ga0070684_102357950 3300005535 Bacteria 502
140 Ga0068853_100007846 3300005539 Bacteria 8560
141 Ga0068853_100028237 3300005539 Bacteria 4717
142 Ga0068853_100177892 3300005539 Bacteria 1928
143 Ga0068853_100296779 3300005539 Bacteria 1493
144 Ga0068853_101012572 3300005539 Bacteria 800
145 Ga0068853_101504580 3300005539 Bacteria 652
146 Ga0068853_101758587 3300005539 Bacteria 601
147 Ga0070672_100309369 3300005543 Bacteria 1341
148 Ga0070672_100969192 3300005543 Bacteria 753
149 Ga0070672_101423668 3300005543 Bacteria 620
150 Ga0070696_100893054 3300005546 Bacteria 737
151 Ga0070693_100138542 3300005547 Bacteria 1529
152 Ga0070665_100000116 3300005548 Bacteria 150141
153 Ga0070665_100000278 3300005548 Bacteria 84248
154 Ga0070665_100000483 3300005548 Bacteria 57237
155 Ga0070665_100003518 3300005548 Bacteria 16659
156 Ga0070665_100006101 3300005548 Bacteria 12320
157 Ga0070665_100042615 3300005548 Bacteria 4562
158 Ga0070665_100100096 3300005548 Bacteria 2903
159 Ga0070665_100205584 3300005548 Bacteria 1969
160 Ga0070665_100262649 3300005548 Bacteria 1727
161 Ga0070665_100442617 3300005548 Bacteria 1309
162 Ga0070665_100706317 3300005548 Bacteria 1021
163 Ga0070665_101173048 3300005548 Bacteria 779
164 Ga0070665_101617521 3300005548 Bacteria 656
165 Ga0070665_101697412 3300005548 Bacteria 639
166 Ga0070665_102590297 3300005548 Unclassified 508
167 Ga0070704_101214572 3300005549 Bacteria 688
168 Ga0070704_101661965 3300005549 Bacteria 590
169 Ga0068855_100114613 3300005563 Bacteria 3090
170 Ga0068855_100164536 3300005563 Bacteria 2515
171 Ga0068855_100227544 3300005563 Bacteria 2089
172 Ga0068855_100361294 3300005563 Bacteria 1598
173 Ga0068855_100510096 3300005563 Bacteria 1306
174 Ga0068855_100604355 3300005563 Bacteria 1182
175 Ga0068855_100643314 3300005563 Bacteria 1139
176 Ga0068855_100884043 3300005563 Bacteria 945
177 Ga0068855_100903913 3300005563 Bacteria 932
178 Ga0068855_101077840 3300005563 Bacteria 841
179 Ga0070664_100032151 3300005564 Bacteria 4388
180 Ga0070664_100128100 3300005564 Bacteria 2228
181 Ga0070664_100539963 3300005564 Bacteria 1077
182 Ga0070664_102348081 3300005564 Bacteria 506
183 Ga0068857_100008234 3300005577 Bacteria 9010
184 Ga0068857_100310468 3300005577 Bacteria 1455
185 Ga0068857_100513179 3300005577 Bacteria 1126
186 Ga0068857_100596708 3300005577 Bacteria 1044
187 Ga0068857_100745242 3300005577 Bacteria 933
188 Ga0068857_101551255 3300005577 Bacteria 646
189 Ga0068857_102119091 3300005577 Bacteria 552
190 Ga0068854_100011218 3300005578 Bacteria 5824
191 Ga0068854_100216344 3300005578 Bacteria 1514
192 Ga0068854_100696271 3300005578 Bacteria 877
193 Ga0068854_100704745 3300005578 Bacteria 872
194 Ga0068854_101008208 3300005578 Bacteria 738
195 Ga0068856_100017487 3300005614 Bacteria 6948
196 Ga0068856_100036110 3300005614 Bacteria 4846
197 Ga0068856_100118032 3300005614 Bacteria 2654
198 Ga0068856_100242993 3300005614 Bacteria 1815
199 Ga0068856_100641513 3300005614 Bacteria 1083
200 Ga0068856_101010843 3300005614 Bacteria 850
201 Ga0068856_101691569 3300005614 Bacteria 645
202 Ga0068856_102376714 3300005614 Bacteria 537
203 Ga0068852_100019264 3300005616 Bacteria 5396
204 Ga0068852_100073366 3300005616 Bacteria 3010
205 Ga0068852_100131790 3300005616 Bacteria 2303
206 Ga0068852_100144567 3300005616 Bacteria 2204
207 Ga0068852_101508007 3300005616 Bacteria 695
208 Ga0068852_102101990 3300005616 Bacteria 586
209 Ga0068859_100000435 3300005617 Bacteria 41931
210 Ga0068859_100049354 3300005617 Bacteria 4227
211 Ga0068859_100183093 3300005617 Bacteria 2178
212 Ga0068859_100814918 3300005617 Bacteria 1021
213 Ga0068859_101423464 3300005617 Bacteria 765
214 Ga0068859_102776195 3300005617 Bacteria 538
215 Ga0068864_100000115 3300005618 Bacteria 79542
216 Ga0068864_100000786 3300005618 Bacteria 26635
217 Ga0068864_100026445 3300005618 Bacteria 4894
218 Ga0068864_100555600 3300005618 Bacteria 1110
219 Ga0068864_100611800 3300005618 Bacteria 1058
220 Ga0068864_100680565 3300005618 Bacteria 1004
221 Ga0068864_100892398 3300005618 Bacteria 877
222 Ga0068866_10942109 3300005718 Bacteria 610
223 Ga0068861_100155784 3300005719 Bacteria 1879
224 Ga0068861_100400550 3300005719 Bacteria 1218
225 Ga0068861_100627849 3300005719 Bacteria 990
226 Ga0068861_100651681 3300005719 Bacteria 973
227 Ga0068861_100913917 3300005719 Bacteria 832
228 Ga0068851_10012066 3300005834 Bacteria 4068
229 Ga0068851_10014841 3300005834 Bacteria 3705
230 Ga0068851_10616181 3300005834 Bacteria 662
231 Ga0068870_10839108 3300005840 Bacteria 645
232 Ga0068863_100000007 3300005841 Bacteria 257578
233 Ga0068863_100000392 3300005841 Bacteria 44421
234 Ga0068863_100014231 3300005841 Bacteria 7665
235 Ga0068863_100079690 3300005841 Bacteria 3101
236 Ga0068863_100131031 3300005841 Bacteria 2394
237 Ga0068863_100597867 3300005841 Bacteria 1092
238 Ga0068863_101267707 3300005841 Bacteria 743
239 Ga0068863_102123324 3300005841 Bacteria 572
240 Ga0068858_100000031 3300005842 Bacteria 143397
241 Ga0068858_100003423 3300005842 Bacteria 15780
242 Ga0068858_100004211 3300005842 Bacteria 14164
243 Ga0068858_100275097 3300005842 Bacteria 1603
244 Ga0068858_100639209 3300005842 Bacteria 1034
245 Ga0068860_100000128 3300005843 Bacteria 122731
246 Ga0068860_100000145 3300005843 Bacteria 115830
247 Ga0068860_100045797 3300005843 Bacteria 4171
248 Ga0068860_100108311 3300005843 Bacteria 2656
249 Ga0068860_101369569 3300005843 Bacteria 729
250 Ga0068860_101726844 3300005843 Bacteria 648
251 Ga0068862_100001627 3300005844 Bacteria 20442
252 Ga0068862_100007701 3300005844 Bacteria 8910
253 Ga0068862_100022748 3300005844 Bacteria 5245
254 Ga0068862_100063108 3300005844 Bacteria 3188
255 Ga0068862_100063168 3300005844 Bacteria 3186
256 Ga0068862_100272019 3300005844 Bacteria 1550
257 Ga0068862_100719416 3300005844 Bacteria 969
258 Ga0068862_100835632 3300005844 Bacteria 902
259 Ga0081540_1003960 3300005983 Bacteria 11507
260 Ga0070717_11305739 3300006028 Bacteria 660
261 Ga0075365_10374786 3300006038 Bacteria 1004
262 Ga0075368_10002625 3300006042 Bacteria 5901
263 Ga0075368_10007666 3300006042 Bacteria 3816
264 Ga0075368_10088106 3300006042 Bacteria 1268
265 Ga0075368_10281896 3300006042 Bacteria 714
266 Ga0075363_100026589 3300006048 Bacteria 2961
267 Ga0075363_100032636 3300006048 Bacteria 2706
268 Ga0075363_100047395 3300006048 Bacteria 2282
269 Ga0075363_100378161 3300006048 Bacteria 830
270 Ga0075363_100856113 3300006048 Bacteria 555
271 Ga0075364_10003475 3300006051 Bacteria 8968
272 Ga0075364_10053598 3300006051 Bacteria 2636
273 Ga0075364_10143115 3300006051 Bacteria 1609
274 Ga0075364_10218379 3300006051 Bacteria 1293
275 Ga0075364_10723759 3300006051 Bacteria 679
276 Ga0070712_100207331 3300006175 Bacteria 1544
277 Ga0070712_100926124 3300006175 Bacteria 752
278 Ga0075362_10009435 3300006177 Bacteria 3774
279 Ga0075362_10062334 3300006177 Bacteria 1689
280 Ga0075367_10005360 3300006178 Bacteria 6357
281 Ga0075367_10068389 3300006178 Bacteria 2131
282 Ga0075367_10218474 3300006178 Bacteria 1192
283 Ga0075367_10306281 3300006178 Bacteria 1000
284 Ga0075367_10882675 3300006178 Bacteria 570
285 Ga0075367_11045080 3300006178 Bacteria 522
286 Ga0075369_10009705 3300006186 Bacteria 3747
287 Ga0075369_10101645 3300006186 Bacteria 1290
288 Ga0075369_10283175 3300006186 Bacteria 772
289 Ga0075369_10424721 3300006186 Bacteria 628
290 Ga0075369_10486736 3300006186 Bacteria 586
291 Ga0075366_10022416 3300006195 Bacteria 3674
292 Ga0075366_10030071 3300006195 Bacteria 3192
293 Ga0075366_10375640 3300006195 Bacteria 874
294 Ga0075366_10837511 3300006195 Bacteria 572
295 Ga0075366_10986023 3300006195 Bacteria 525
296 Ga0097621_100309224 3300006237 Bacteria 1398
297 Ga0097621_100910367 3300006237 Bacteria 820
298 Ga0075370_10005219 3300006353 Bacteria 6426
299 Ga0075370_10013637 3300006353 Bacteria 4325
300 Ga0075370_10039168 3300006353 Bacteria 2670
301 Ga0075370_10337651 3300006353 Bacteria 899
302 Ga0075370_10394678 3300006353 Bacteria 830
303 Ga0075370_10700728 3300006353 Bacteria 616
304 Ga0075370_10707771 3300006353 Bacteria 612
305 Ga0075370_10708620 3300006353 Bacteria 612
306 Ga0068871_100383643 3300006358 Bacteria 1249
307 Ga0068871_100892381 3300006358 Bacteria 824
308 Ga0075433_11145322 3300006852 Bacteria 676
309 Ga0068865_100004059 3300006881 Bacteria 8794
310 Ga0097620_100000435 3300006931 Bacteria 41931
311 Ga0097620_100049353 3300006931 Bacteria 4227
312 Ga0097620_100183098 3300006931 Bacteria 2178
313 Ga0097620_100814973 3300006931 Bacteria 1021
314 Ga0097620_101423286 3300006931 Bacteria 765
315 Ga0097620_102775686 3300006931 Bacteria 538
316 Ga0079104_1030697 3300006946 Bacteria 1339
317 Ga0099826_10000704 3300006948 Bacteria 17489
318 Ga0099826_10014270 3300006948 Bacteria 5999
319 Ga0105251_10212891 3300009011 Bacteria 870
320 Ga0105251_10536935 3300009011 Bacteria 550
321 Ga0105244_10194446 3300009036 Bacteria 958
322 Ga0105250_10006718 3300009092 Bacteria 4998
323 Ga0105240_10043434 3300009093 Bacteria 5719
324 Ga0105240_10073611 3300009093 Bacteria 4218
325 Ga0105240_10076980 3300009093 Bacteria 4111
326 Ga0105240_10081004 3300009093 Bacteria 3991
327 Ga0105240_10104804 3300009093 Bacteria 3434
328 Ga0105240_11361855 3300009093 Bacteria 747
329 Ga0105240_12454470 3300009093 Bacteria 539
330 Ga0105245_11822568 3300009098 Bacteria 661
331 Ga0105245_11950873 3300009098 Bacteria 640
332 Ga0105247_10168493 3300009101 Bacteria 1455
333 Ga0105247_10515003 3300009101 Bacteria 874
334 Ga0114129_12232847 3300009147 Bacteria 658
335 Ga0105243_10009275 3300009148 Bacteria 7510
336 Ga0105243_10559294 3300009148 Bacteria 1094
337 Ga0105243_11202764 3300009148 Bacteria 771
338 Ga0105241_10519968 3300009174 Bacteria 1064
339 Ga0105241_10863091 3300009174 Bacteria 838
340 Ga0105241_11400609 3300009174 Bacteria 669
341 Ga0105241_11610100 3300009174 Bacteria 628
342 Ga0105242_10055341 3300009176 Bacteria 3245
343 Ga0105242_10399698 3300009176 Bacteria 1282
344 Ga0105242_13164752 3300009176 Bacteria 511
345 Ga0105248_10007787 3300009177 Bacteria 11756
346 Ga0105248_10038574 3300009177 Bacteria 5347
347 Ga0105248_10041310 3300009177 Bacteria 5170
348 Ga0105248_10082220 3300009177 Bacteria 3621
349 Ga0105248_10102723 3300009177 Bacteria 3222
350 Ga0105248_10286371 3300009177 Bacteria 1855
351 Ga0105248_10543159 3300009177 Bacteria 1311
352 Ga0105248_10626607 3300009177 Bacteria 1213
353 Ga0105248_11541333 3300009177 Bacteria 753
354 Ga0105237_10214516 3300009545 Bacteria 1925
355 Ga0105237_11020032 3300009545 Bacteria 834
356 Ga0105238_10026734 3300009551 Bacteria 5882
357 Ga0105238_10087665 3300009551 Bacteria 3099
358 Ga0105238_10191222 3300009551 Bacteria 2023
359 Ga0105238_10345589 3300009551 Bacteria 1476
360 Ga0105238_10367629 3300009551 Bacteria 1428
361 Ga0105238_11067770 3300009551 Bacteria 829
362 Ga0105238_11394847 3300009551 Bacteria 728
363 Ga0105238_12188600 3300009551 Bacteria 588
364 Ga0105238_12604913 3300009551 Bacteria 542
365 Ga0105249_10000410 3300009553 Bacteria 41122
366 Ga0105249_10115487 3300009553 Bacteria 2543
367 Ga0105249_11108098 3300009553 Bacteria 862
368 Ga0105249_12274578 3300009553 Bacteria 615
369 Ga0105239_10288771 3300010375 Bacteria 1847
370 Ga0105239_10464722 3300010375 Bacteria 1436
371 Ga0105239_11367739 3300010375 Bacteria 817
372 Ga0105239_12009977 3300010375 Bacteria 671
373 Ga0105239_12651460 3300010375 Bacteria 585
374 Ga0105246_10073748 3300011119 Bacteria 2410
375 Ga0105246_10456512 3300011119 Bacteria 1075
376 Ga0157373_10008653 3300013100 Bacteria 7550
377 Ga0157371_10000004 3300013102 Bacteria 512593
378 Ga0157371_10032519 3300013102 Bacteria 3753
379 Ga0157371_10205940 3300013102 Bacteria 1411
380 Ga0157371_10504488 3300013102 Bacteria 894
381 Ga0157370_10001047 3300013104 Bacteria 34825
382 Ga0157370_10026878 3300013104 Bacteria 5678
383 Ga0157370_10169243 3300013104 Bacteria 2031
384 Ga0157370_10198035 3300013104 Bacteria 1864
385 Ga0157370_10218409 3300013104 Bacteria 1766
386 Ga0157370_10244147 3300013104 Bacteria 1661
387 Ga0157370_11741633 3300013104 Bacteria 559
388 Ga0157369_10291159 3300013105 Bacteria 1700
389 Ga0157369_10295251 3300013105 Bacteria 1686
390 Ga0157369_11019070 3300013105 Bacteria 847
391 Ga0157374_10174233 3300013296 Bacteria 2100
392 Ga0157374_10471786 3300013296 Bacteria 1257
393 Ga0157378_10757173 3300013297 Bacteria 994
394 Ga0157378_11139770 3300013297 Bacteria 818
395 Ga0163162_10027619 3300013306 Bacteria 5613
396 Ga0163162_10063898 3300013306 Bacteria 3725
397 Ga0163162_10619135 3300013306 Bacteria 1208
398 Ga0163162_10710773 3300013306 Bacteria 1126
399 Ga0163162_12092666 3300013306 Bacteria 649
400 Ga0157372_10056762 3300013307 Bacteria 4375
401 Ga0157372_10286129 3300013307 Bacteria 1917
402 Ga0157372_11097531 3300013307 Bacteria 921
403 Ga0157372_11248851 3300013307 Bacteria 858
404 Ga0157372_11388633 3300013307 Bacteria 810
405 Ga0157372_11527146 3300013307 Bacteria 769
406 Ga0157375_11989773 3300013308 Bacteria 691
407 Ga0163163_10033603 3300014325 Bacteria 4963
408 Ga0163163_10072795 3300014325 Bacteria 3426
409 Ga0163163_10313723 3300014325 Bacteria 1621
410 Ga0163163_11233002 3300014325 Bacteria 810
411 Ga0163163_11558363 3300014325 Bacteria 722
412 Ga0163163_13014387 3300014325 Bacteria 525
413 Ga0157380_10952059 3300014326 Bacteria 889
414 Ga0157380_11914231 3300014326 Bacteria 654
415 Ga0182008_10269253 3300014497 Bacteria 883
416 Ga0157377_11208318 3300014745 Bacteria 586
417 Ga0157379_10007276 3300014968 Bacteria 9581
418 Ga0157379_10080776 3300014968 Bacteria 2913
419 Ga0157379_10187762 3300014968 Bacteria 1868
420 Ga0157379_10359470 3300014968 Bacteria 1334
421 Ga0157379_10482129 3300014968 Bacteria 1148
422 Ga0157379_11119088 3300014968 Bacteria 755
423 Ga0157376_10470617 3300014969 Bacteria 1229
424 Ga0157376_10519222 3300014969 Bacteria 1174
425 Ga0157376_10792822 3300014969 Bacteria 959
426 Ga0182006_1131262 3300015261 Bacteria 862
427 Ga0182005_1004873 3300015265 Bacteria 4265
428 Ga0183365_10002 3300015684 Bacteria 545891
429 Ga0163161_10344065 3300017792 Bacteria 1184
430 Ga0163161_11364776 3300017792 Bacteria 618
431 Ga0206355_1455122 3300020076 Bacteria 524
432 Ga0206354_10432311 3300020081 Bacteria 532
433 Ga0213876_10006256 3300021384 Bacteria 6494
434 Ga0213876_10035545 3300021384 Bacteria 2628
435 Ga0209563_103803 3300025230 Bacteria 3030
436 Ga0209437_100182 3300025233 Bacteria 130514
437 Ga0209437_115842 3300025233 Bacteria 1023
438 Ga0207425_1029390 3300025245 Bacteria 1108
439 Ga0207425_1041137 3300025245 Bacteria 880
440 Ga0207425_1062936 3300025245 Bacteria 651
441 Ga0209026_1009684 3300025250 Bacteria 1866
442 Ga0209026_1054154 3300025250 Bacteria 569
443 Ga0209026_1062172 3300025250 Bacteria 524
444 Ga0209677_100265 3300025253 Bacteria 35526
445 Ga0209148_1026954 3300025254 Bacteria 888
446 Ga0209129_1000050 3300025258 Bacteria 267408
447 Ga0209129_1004912 3300025258 Bacteria 4987
448 Ga0209233_1000231 3300025261 Bacteria 97534
449 Ga0209233_1000255 3300025261 Bacteria 82230
450 Ga0209233_1072761 3300025261 Bacteria 631
451 Ga0209565_1000641 3300025263 Bacteria 22666
452 Ga0209455_1016011 3300025272 Bacteria 1626
453 Ga0209455_1017988 3300025272 Bacteria 1463
454 Ga0209673_1000523 3300025273 Bacteria 62816
455 Ga0209673_1021682 3300025273 Bacteria 2239
456 Ga0209673_1074035 3300025273 Bacteria 801
457 Ga0209676_1000057 3300025292 Bacteria 361061
458 Ga0209676_1000061 3300025292 Bacteria 332674
459 Ga0209676_1000679 3300025292 Bacteria 48245
460 Ga0209025_1000553 3300025294 Bacteria 69760
461 Ga0209025_1003440 3300025294 Bacteria 14990
462 Ga0209025_1042265 3300025294 Bacteria 1939
463 Ga0209564_1033319 3300025295 Bacteria 1534
464 Ga0209758_1050577 3300025297 Bacteria 1456
465 Ga0209758_1066324 3300025297 Bacteria 1160
466 Ga0209050_1013814 3300025298 Bacteria 3547
467 Ga0209050_1014339 3300025298 Bacteria 3424
468 Ga0209050_1017660 3300025298 Bacteria 2825
469 Ga0209050_1062943 3300025298 Bacteria 867
470 Ga0209050_1078881 3300025298 Bacteria 707
471 Ga0209256_1002428 3300025299 Bacteria 15246
472 Ga0209256_1006344 3300025299 Bacteria 6309
473 Ga0209256_1012333 3300025299 Bacteria 3292
474 Ga0209256_1079385 3300025299 Bacteria 720
475 Ga0207426_1000798 3300025302 Bacteria 34125
476 Ga0209051_1014576 3300025303 Bacteria 3660
477 Ga0209051_1027659 3300025303 Bacteria 2255
478 Ga0209051_1028291 3300025303 Bacteria 2216
479 Ga0209051_1029985 3300025303 Bacteria 2119
480 Ga0209257_1000199 3300025304 Bacteria 148045
481 Ga0209257_1000944 3300025304 Bacteria 40166
482 Ga0209257_1047759 3300025304 Bacteria 1229
483 Ga0207656_10042169 3300025321 Bacteria 1941
484 Ga0207656_10077523 3300025321 Bacteria 1488
485 Ga0207656_10507384 3300025321 Bacteria 612
486 Ga0207696_1034957 3300025711 Bacteria 1498
487 Ga0207710_10192911 3300025900 Bacteria 1003
488 Ga0207710_10224133 3300025900 Bacteria 934
489 Ga0207680_10109945 3300025903 Bacteria 1786
490 Ga0207680_10310106 3300025903 Bacteria 1101
491 Ga0207680_10314530 3300025903 Bacteria 1094
492 Ga0207680_10618778 3300025903 Bacteria 775
493 Ga0207647_10320327 3300025904 Bacteria 881
494 Ga0207645_10171016 3300025907 Bacteria 1424
495 Ga0207643_10960303 3300025908 Bacteria 553
496 Ga0207705_10007993 3300025909 Bacteria 7759
497 Ga0207705_10089421 3300025909 Bacteria 2254
498 Ga0207705_10098335 3300025909 Bacteria 2150
499 Ga0207705_10214787 3300025909 Bacteria 1459
500 Ga0207705_10428991 3300025909 Bacteria 1024
501 Ga0207705_10819447 3300025909 Bacteria 722
502 Ga0207654_10329634 3300025911 Bacteria 1046
503 Ga0207654_10602770 3300025911 Bacteria 784
504 Ga0207654_10829254 3300025911 Bacteria 669
505 Ga0207654_11338738 3300025911 Bacteria 522
506 Ga0207654_11365928 3300025911 Bacteria 517
507 Ga0207707_10016260 3300025912 Bacteria 6490
508 Ga0207707_10050471 3300025912 Bacteria 3624
509 Ga0207707_10202302 3300025912 Bacteria 1731
510 Ga0207707_10561843 3300025912 Bacteria 969
511 Ga0207695_10000044 3300025913 Bacteria 440819
512 Ga0207695_10001670 3300025913 Bacteria 35733
513 Ga0207695_10001727 3300025913 Bacteria 34901
514 Ga0207695_10015061 3300025913 Bacteria 9122
515 Ga0207695_10018020 3300025913 Bacteria 8176
516 Ga0207695_10021597 3300025913 Bacteria 7340
517 Ga0207695_10952896 3300025913 Bacteria 738
518 Ga0207695_11213074 3300025913 Bacteria 635
519 Ga0207695_11313748 3300025913 Bacteria 604
520 Ga0207695_11755744 3300025913 Bacteria 502
521 Ga0207671_10000043 3300025914 Bacteria 206915
522 Ga0207671_10102970 3300025914 Bacteria 2164
523 Ga0207671_10247897 3300025914 Bacteria 1400
524 Ga0207671_10512235 3300025914 Bacteria 957
525 Ga0207693_10238977 3300025915 Bacteria 1426
526 Ga0207663_10524440 3300025916 Bacteria 923
527 Ga0207660_10111031 3300025917 Bacteria 2063
528 Ga0207660_10129788 3300025917 Bacteria 1917
529 Ga0207660_10495248 3300025917 Bacteria 991
530 Ga0207660_11279587 3300025917 Bacteria 596
531 Ga0207657_10012251 3300025919 Bacteria 8472
532 Ga0207657_10023890 3300025919 Bacteria 5677
533 Ga0207657_10120748 3300025919 Bacteria 2156
534 Ga0207657_10157456 3300025919 Bacteria 1846
535 Ga0207657_10626768 3300025919 Bacteria 838
536 Ga0207649_10090983 3300025920 Bacteria 1998
537 Ga0207649_10108801 3300025920 Bacteria 1848
538 Ga0207649_10128000 3300025920 Bacteria 1721
539 Ga0207649_10449557 3300025920 Bacteria 972
540 Ga0207649_10571109 3300025920 Bacteria 867
541 Ga0207649_10892428 3300025920 Bacteria 697
542 Ga0207652_10024709 3300025921 Bacteria 4987
543 Ga0207652_10592795 3300025921 Bacteria 994
544 Ga0207646_10489633 3300025922 Bacteria 1108
545 Ga0207681_10069475 3300025923 Bacteria 2450
546 Ga0207681_10106943 3300025923 Bacteria 2028
547 Ga0207681_11272991 3300025923 Bacteria 618
548 Ga0207694_10051518 3300025924 Bacteria 3190
549 Ga0207694_10180029 3300025924 Bacteria 1714
550 Ga0207694_10635561 3300025924 Bacteria 899
551 Ga0207694_10661738 3300025924 Bacteria 880
552 Ga0207694_10681830 3300025924 Bacteria 866
553 Ga0207694_11307309 3300025924 Bacteria 613
554 Ga0207650_10000062 3300025925 Bacteria 149776
555 Ga0207650_10000630 3300025925 Bacteria 28133
556 Ga0207650_10019108 3300025925 Bacteria 4815
557 Ga0207650_10023019 3300025925 Bacteria 4415
558 Ga0207650_10190641 3300025925 Bacteria 1638
559 Ga0207659_10681360 3300025926 Bacteria 880
560 Ga0207687_10168182 3300025927 Bacteria 1688
561 Ga0207687_11292381 3300025927 Bacteria 627
562 Ga0207687_11345682 3300025927 Bacteria 614
563 Ga0207700_10774928 3300025928 Bacteria 857
564 Ga0207644_10002578 3300025931 Bacteria 11664
565 Ga0207644_10088031 3300025931 Bacteria 2309
566 Ga0207644_10203056 3300025931 Bacteria 1564
567 Ga0207644_10516404 3300025931 Bacteria 986
568 Ga0207644_10677595 3300025931 Bacteria 859
569 Ga0207690_10000129 3300025932 Bacteria 62350
570 Ga0207690_10325308 3300025932 Bacteria 1210
571 Ga0207690_10514721 3300025932 Bacteria 969
572 Ga0207690_10895278 3300025932 Bacteria 736
573 Ga0207690_11293884 3300025932 Bacteria 609
574 Ga0207706_10032271 3300025933 Bacteria 4664
575 Ga0207706_10145037 3300025933 Bacteria 2088
576 Ga0207706_10433526 3300025933 Bacteria 1138
577 Ga0207706_10491611 3300025933 Bacteria 1060
578 Ga0207706_11090220 3300025933 Bacteria 668
579 Ga0207686_10025144 3300025934 Bacteria 3459
580 Ga0207709_10024990 3300025935 Bacteria 3417
581 Ga0207709_11412384 3300025935 Bacteria 576
582 Ga0207704_10000400 3300025938 Bacteria 19733
583 Ga0207691_10538486 3300025940 Bacteria 990
584 Ga0207711_10000887 3300025941 Bacteria 28843
585 Ga0207711_10022877 3300025941 Bacteria 5231
586 Ga0207711_10024435 3300025941 Bacteria 5063
587 Ga0207711_10034735 3300025941 Bacteria 4271
588 Ga0207711_10035994 3300025941 Bacteria 4199
589 Ga0207711_10057489 3300025941 Bacteria 3344
590 Ga0207711_10106029 3300025941 Bacteria 2493
591 Ga0207711_10256278 3300025941 Bacteria 1607
592 Ga0207711_10849418 3300025941 Bacteria 849
593 Ga0207711_10901018 3300025941 Bacteria 822
594 Ga0207661_10153261 3300025944 Bacteria 1994
595 Ga0207661_11015844 3300025944 Bacteria 764
596 Ga0207661_11223831 3300025944 Bacteria 691
597 Ga0207661_11609772 3300025944 Bacteria 594
598 Ga0207679_10035890 3300025945 Bacteria 3511
599 Ga0207679_10107222 3300025945 Bacteria 2198
600 Ga0207679_10159436 3300025945 Bacteria 1845
601 Ga0207667_10043300 3300025949 Bacteria 4778
602 Ga0207667_10067953 3300025949 Bacteria 3712
603 Ga0207667_10110987 3300025949 Bacteria 2828
604 Ga0207667_10180291 3300025949 Bacteria 2169
605 Ga0207667_10340351 3300025949 Bacteria 1531
606 Ga0207667_10459767 3300025949 Bacteria 1293
607 Ga0207667_10473609 3300025949 Bacteria 1271
608 Ga0207667_10803398 3300025949 Bacteria 937
609 Ga0207667_11317066 3300025949 Bacteria 698
610 Ga0207667_11558665 3300025949 Bacteria 630
611 Ga0207651_11073139 3300025960 Bacteria 721
612 Ga0207712_10001004 3300025961 Bacteria 20092
613 Ga0207712_11270817 3300025961 Bacteria 657
614 Ga0207668_10000028 3300025972 Bacteria 125361
615 Ga0207668_10000507 3300025972 Bacteria 24393
616 Ga0207668_10001494 3300025972 Bacteria 13660
617 Ga0207668_10005956 3300025972 Bacteria 7185
618 Ga0207668_10010307 3300025972 Bacteria 5644
619 Ga0207668_10045259 3300025972 Bacteria 3000
620 Ga0207668_10140712 3300025972 Bacteria 1855
621 Ga0207668_10499171 3300025972 Bacteria 1046
622 Ga0207668_10850330 3300025972 Bacteria 810
623 Ga0207668_11267022 3300025972 Bacteria 663
624 Ga0207640_10120452 3300025981 Bacteria 1879
625 Ga0207640_10538390 3300025981 Bacteria 979
626 Ga0207640_10717762 3300025981 Bacteria 859
627 Ga0207640_10720827 3300025981 Bacteria 857
628 Ga0207640_11353579 3300025981 Bacteria 637
629 Ga0207640_11513818 3300025981 Bacteria 603
630 Ga0207658_10000209 3300025986 Bacteria 61041
631 Ga0207658_10013446 3300025986 Bacteria 5590
632 Ga0207658_10019362 3300025986 Bacteria 4707
633 Ga0207658_10063310 3300025986 Bacteria 2771
634 Ga0207658_10237459 3300025986 Bacteria 1542
635 Ga0207658_10238788 3300025986 Bacteria 1538
636 Ga0207658_11287886 3300025986 Bacteria 668
637 Ga0207677_10083680 3300026023 Bacteria 2297
638 Ga0207677_10484827 3300026023 Bacteria 1066
639 Ga0207703_10000038 3300026035 Bacteria 175917
640 Ga0207703_10039636 3300026035 Bacteria 3765
641 Ga0207703_10300534 3300026035 Bacteria 1464
642 Ga0207703_10595679 3300026035 Bacteria 1045
643 Ga0207703_10664568 3300026035 Bacteria 989
644 Ga0207639_10010574 3300026041 Bacteria 6393
645 Ga0207639_10025186 3300026041 Bacteria 4313
646 Ga0207639_10109120 3300026041 Bacteria 2251
647 Ga0207639_10260073 3300026041 Bacteria 1518
648 Ga0207639_10355587 3300026041 Bacteria 1309
649 Ga0207639_10601572 3300026041 Bacteria 1014
650 Ga0207639_10903399 3300026041 Bacteria 825
651 Ga0207639_11070835 3300026041 Bacteria 756
652 Ga0207639_11391678 3300026041 Bacteria 658
653 Ga0207639_11684718 3300026041 Bacteria 594
654 Ga0207678_10128637 3300026067 Bacteria 2160
655 Ga0207678_10157011 3300026067 Bacteria 1942
656 Ga0207678_10353395 3300026067 Bacteria 1267
657 Ga0207678_10874277 3300026067 Bacteria 794
658 Ga0207678_10918614 3300026067 Bacteria 774
659 Ga0207678_11388116 3300026067 Bacteria 621
660 Ga0207708_11789061 3300026075 Bacteria 539
661 Ga0207702_10020911 3300026078 Bacteria 5416
662 Ga0207702_10105414 3300026078 Bacteria 2497
663 Ga0207702_10160682 3300026078 Bacteria 2051
664 Ga0207702_10270259 3300026078 Bacteria 1603
665 Ga0207702_10535492 3300026078 Bacteria 1144
666 Ga0207702_11030032 3300026078 Bacteria 817
667 Ga0207702_11390768 3300026078 Bacteria 696
668 Ga0207702_11535613 3300026078 Bacteria 659
669 Ga0207702_12396472 3300026078 Bacteria 515
670 Ga0207641_10000012 3300026088 Bacteria 375486
671 Ga0207641_10000341 3300026088 Bacteria 56155
672 Ga0207641_10017703 3300026088 Bacteria 5836
673 Ga0207641_10241261 3300026088 Bacteria 1684
674 Ga0207641_10377996 3300026088 Bacteria 1356
675 Ga0207641_11101932 3300026088 Bacteria 792
676 Ga0207648_10014268 3300026089 Bacteria 7345
677 Ga0207648_11500664 3300026089 Bacteria 634
678 Ga0207648_12061243 3300026089 Bacteria 532
679 Ga0207676_10000255 3300026095 Bacteria 46136
680 Ga0207676_10000797 3300026095 Bacteria 24574
681 Ga0207676_10005948 3300026095 Bacteria 8607
682 Ga0207676_10417656 3300026095 Bacteria 1257
683 Ga0207676_10671535 3300026095 Bacteria 1001
684 Ga0207676_11445148 3300026095 Bacteria 684
685 Ga0207676_12038615 3300026095 Bacteria 572
686 Ga0207674_10009842 3300026116 Bacteria 10885
687 Ga0207674_10082106 3300026116 Bacteria 3225
688 Ga0207674_10242139 3300026116 Bacteria 1751
689 Ga0207674_10439688 3300026116 Bacteria 1261
690 Ga0207674_10717466 3300026116 Bacteria 965
691 Ga0207674_12109269 3300026116 Bacteria 528
692 Ga0207675_100070063 3300026118 Bacteria 3277
693 Ga0207675_100156670 3300026118 Bacteria 2170
694 Ga0207675_100536319 3300026118 Bacteria 1168
695 Ga0207675_100625164 3300026118 Bacteria 1081
696 Ga0207683_10189655 3300026121 Bacteria 1866
697 Ga0207683_10472003 3300026121 Bacteria 1157
698 Ga0207683_11446344 3300026121 Bacteria 635
699 Ga0207683_11710728 3300026121 Bacteria 578
700 Ga0207698_10070086 3300026142 Bacteria 2776
701 Ga0207698_10100302 3300026142 Bacteria 2398
702 Ga0207698_10291534 3300026142 Bacteria 1514
703 Ga0207698_10602913 3300026142 Bacteria 1083
704 Ga0207698_11110804 3300026142 Bacteria 803
705 Ga0207698_11319785 3300026142 Bacteria 736
706 Ga0207698_11549291 3300026142 Bacteria 678
707 Ga0207698_11691079 3300026142 Bacteria 648
708 Ga0207698_12060132 3300026142 Bacteria 584
709 Ga0207698_12118962 3300026142 Bacteria 576
710 Ga0207698_12588170 3300026142 Bacteria 517
711 Ga0209281_1023777 3300027111 Bacteria 1158
712 Ga0209371_1000009 3300027312 Bacteria 963030
713 Ga0209371_1000753 3300027312 Bacteria 27006
714 Ga0209983_1113472 3300027665 Bacteria 616
715 Ga0209282_1000849 3300027666 Bacteria 15779
716 Ga0209966_1072905 3300027695 Bacteria 754
717 Ga0209813_10088886 3300027866 Bacteria 1034
718 Ga0209813_10147252 3300027866 Bacteria 841
719 Ga0209813_10303949 3300027866 Bacteria 620
720 Ga0209813_10337275 3300027866 Bacteria 594
721 Ga0207428_10417551 3300027907 Bacteria 981
722 Ga0268266_10000064 3300028379 Bacteria 249533
723 Ga0268266_10000792 3300028379 Bacteria 42146
724 Ga0268266_10001340 3300028379 Bacteria 29786
725 Ga0268266_10018885 3300028379 Bacteria 5873
726 Ga0268266_10096119 3300028379 Bacteria 2603
727 Ga0268266_10161086 3300028379 Bacteria 2030
728 Ga0268266_10728634 3300028379 Bacteria 956
729 Ga0268266_10731974 3300028379 Bacteria 954
730 Ga0268266_10740575 3300028379 Bacteria 948
731 Ga0268266_11562466 3300028379 Unclassified 635
732 Ga0268266_11607616 3300028379 Bacteria 625
733 Ga0268265_10004003 3300028380 Bacteria 10375
734 Ga0268265_10005054 3300028380 Bacteria 9055
735 Ga0268265_10016564 3300028380 Bacteria 5067
736 Ga0268265_10044261 3300028380 Bacteria 3314
737 Ga0268265_10096703 3300028380 Bacteria 2374
738 Ga0268265_10450092 3300028380 Bacteria 1202
739 Ga0268265_11537479 3300028380 Bacteria 669
740 Ga0268264_10000046 3300028381 Bacteria 364597
741 Ga0268264_10000059 3300028381 Bacteria 306927
742 Ga0268264_10016967 3300028381 Bacteria 5961
743 Ga0268264_10028586 3300028381 Bacteria 4561
744 Ga0265319_1157264 3300028563 Bacteria 703
745 Ga0265334_10134763 3300028573 Bacteria 877
746 Ga0265318_10002680 3300028577 Bacteria 9349
747 Ga0307517_10000497 3300028786 Bacteria 67390
748 Ga0307517_10082691 3300028786 Bacteria 2723
749 Ga0307517_10488538 3300028786 Bacteria 629
750 Ga0307517_10602099 3300028786 Bacteria 541
751 Ga0307515_10054933 3300028794 Bacteria 5833
752 Ga0307515_10066345 3300028794 Bacteria 5002
753 Ga0307515_10627394 3300028794 Bacteria 686
754 Ga0307515_10925088 3300028794 Bacteria 505
755 Ga0265338_10018457 3300028800 Bacteria 7466
756 Ga0265338_10044345 3300028800 Bacteria 4108
757 Ga0265338_10083238 3300028800 Bacteria 2677
758 Ga0268256_1000010 3300030500 Bacteria 963034
759 Ga0268256_1003130 3300030500 Bacteria 7711
760 Ga0307511_10014914 3300030521 Bacteria 7543
761 Ga0316183_1171265 3300030742 Bacteria 504
762 Ga0316183_1208086 3300030742 Bacteria 514
763 Ga0316182_1361217 3300030745 Bacteria 905
764 Ga0316182_1451093 3300030745 Bacteria 620
765 Ga0265760_10086106 3300031090 Bacteria 978
766 Ga0265330_10035499 3300031235 Bacteria 2224
767 Ga0265330_10239705 3300031235 Unclassified 765
768 Ga0265332_10052946 3300031238 Bacteria 1742
769 Ga0265320_10051193 3300031240 Bacteria 2005
770 Ga0265325_10002041 3300031241 Bacteria 13873
771 Ga0265329_10024932 3300031242 Bacteria 1982
772 Ga0265340_10095632 3300031247 Bacteria 1385
773 Ga0265339_10003193 3300031249 Bacteria 11505
774 Ga0265331_10017136 3300031250 Bacteria 3785
775 Ga0265331_10319527 3300031250 Unclassified 695
776 Ga0265327_10018935 3300031251 Bacteria 4249
777 Ga0265327_10083111 3300031251 Bacteria 1577
778 Ga0265316_10008753 3300031344 Bacteria 9358
779 Ga0265316_10498578 3300031344 Bacteria 870
780 Ga0307513_10000448 3300031456 Bacteria 59427
781 Ga0307513_10009333 3300031456 Bacteria 12420
782 Ga0307513_10507243 3300031456 Bacteria 923
783 Ga0307513_10659130 3300031456 Bacteria 753
784 Ga0307513_10990635 3300031456 Bacteria 550
785 Ga0307408_100350310 3300031548 Bacteria 1253
786 Ga0307408_101020152 3300031548 Bacteria 763
787 Ga0307408_101460613 3300031548 Bacteria 645
788 Ga0307408_101841299 3300031548 Bacteria 579
789 Ga0265313_10000070 3300031595 Bacteria 99384
790 Ga0265313_10004088 3300031595 Bacteria 11369
791 Ga0265313_10007724 3300031595 Bacteria 7281
792 Ga0307508_10404734 3300031616 Bacteria 956
793 Ga0316575_10049055 3300031665 Bacteria 1680
794 Ga0316579_10499764 3300031691 Bacteria 588
795 Ga0265314_10011207 3300031711 Bacteria 7422
796 Ga0265314_10034101 3300031711 Bacteria 3723
797 Ga0265314_10104086 3300031711 Bacteria 1818
798 Ga0265314_10380713 3300031711 Bacteria 768
799 Ga0265314_10384211 3300031711 Unclassified 763
800 Ga0265342_10243688 3300031712 Bacteria 961
801 Ga0316578_10586102 3300031728 Bacteria 654
802 Ga0307516_10000004 3300031730 Bacteria 367451
803 Ga0307405_10215905 3300031731 Bacteria 1404
804 Ga0307405_12161306 3300031731 Bacteria 500
805 Ga0307413_10118701 3300031824 Bacteria 1786
806 Ga0307413_10240404 3300031824 Bacteria 1336
807 Ga0307413_10352999 3300031824 Bacteria 1135
808 Ga0307413_10744247 3300031824 Bacteria 819
809 Ga0307410_10151226 3300031852 Bacteria 1728
810 Ga0307410_10407000 3300031852 Bacteria 1100
811 Ga0307410_10506159 3300031852 Bacteria 994
812 Ga0307410_11603655 3300031852 Bacteria 575
813 Ga0307410_11866437 3300031852 Bacteria 534
814 Ga0307410_12148422 3300031852 Bacteria 500
815 Ga0326468_10100846 3300031889 Bacteria 532
816 Ga0307406_10000538 3300031901 Bacteria 21814
817 Ga0307406_10040954 3300031901 Bacteria 2884
818 Ga0307406_10379229 3300031901 Bacteria 1114
819 Ga0307406_10381357 3300031901 Bacteria 1111
820 Ga0307406_10668542 3300031901 Bacteria 864
821 Ga0307406_10838192 3300031901 Bacteria 778
822 Ga0307406_11075264 3300031901 Bacteria 693
823 Ga0307407_10024120 3300031903 Bacteria 3184
824 Ga0307407_10065509 3300031903 Bacteria 2139
825 Ga0307407_10342875 3300031903 Bacteria 1055
826 Ga0307407_10413171 3300031903 Bacteria 971
827 Ga0307407_10690478 3300031903 Bacteria 768
828 Ga0307407_10843521 3300031903 Bacteria 700
829 Ga0307407_11544024 3300031903 Bacteria 526
830 Ga0307412_10361128 3300031911 Bacteria 1169
831 Ga0307412_10483439 3300031911 Bacteria 1027
832 Ga0307412_10581406 3300031911 Bacteria 945
833 Ga0307412_11077282 3300031911 Bacteria 714
834 Ga0307412_11282944 3300031911 Bacteria 659
835 Ga0307412_11625459 3300031911 Bacteria 590
836 Ga0307409_100076722 3300031995 Bacteria 2681
837 Ga0307409_100245719 3300031995 Bacteria 1632
838 Ga0307409_100582796 3300031995 Bacteria 1103
839 Ga0307409_101132224 3300031995 Bacteria 804
840 Ga0307409_101749516 3300031995 Bacteria 650
841 Ga0307416_100077132 3300032002 Bacteria 2797
842 Ga0307416_100684930 3300032002 Bacteria 1113
843 Ga0307416_101109960 3300032002 Bacteria 896
844 Ga0307416_102102398 3300032002 Bacteria 666
845 Ga0307416_103540377 3300032002 Bacteria 522
846 Ga0307414_10033620 3300032004 Bacteria 3391
847 Ga0307414_10061652 3300032004 Bacteria 2657
848 Ga0307414_10080583 3300032004 Bacteria 2381
849 Ga0307414_10144786 3300032004 Bacteria 1865
850 Ga0307414_10387252 3300032004 Bacteria 1210
851 Ga0307414_10467870 3300032004 Bacteria 1109
852 Ga0307414_10646652 3300032004 Bacteria 953
853 Ga0307414_10682392 3300032004 Bacteria 928
854 Ga0307414_10868743 3300032004 Bacteria 825
855 Ga0307414_10924834 3300032004 Bacteria 800
856 Ga0307414_10986504 3300032004 Bacteria 775
857 Ga0307414_11207139 3300032004 Bacteria 700
858 Ga0307414_11253991 3300032004 Bacteria 687
859 Ga0307414_11374641 3300032004 Bacteria 656
860 Ga0307414_11626754 3300032004 Bacteria 602
861 Ga0307411_10056123 3300032005 Bacteria 2594
862 Ga0307411_10216913 3300032005 Bacteria 1481
863 Ga0307411_10299717 3300032005 Bacteria 1288
864 Ga0307411_10475053 3300032005 Bacteria 1051
865 Ga0307411_10488055 3300032005 Bacteria 1039
866 Ga0307411_10884389 3300032005 Bacteria 793
867 Ga0307411_11786241 3300032005 Bacteria 570
868 Ga0307411_11854707 3300032005 Bacteria 560
869 Ga0307415_100077652 3300032126 Bacteria 2358
870 Ga0307415_100445461 3300032126 Bacteria 1118
871 Ga0307415_100634423 3300032126 Bacteria 955
872 Ga0307415_101022557 3300032126 Bacteria 769
873 Ga0307415_101377245 3300032126 Bacteria 671
874 Ga0307510_10013265 3300033180 Bacteria 9772
875 Ga0373948_0056544 3300034817 Bacteria 853
876 Ga0373938_0011096 3300034957 Bacteria 1669
877 Ga0373926_0053000 3300035083 Bacteria 1467
878 Ga0373928_0135085 3300035084 Bacteria 672
879 Ga0373934_0057302 3300035086 Bacteria 1550
880 Ga0373944_0011172 3300035089 Bacteria 2457
881 Ga0373949_0176121 3300035090 Bacteria 631
882 Ga0373936_0000998 3300035113 Bacteria 10090
883 Ga0373936_0288322 3300035113 Bacteria 739
884 Ga0373936_0423306 3300035113 Bacteria 613
885 Ga0373939_0055238 3300035114 Bacteria 1246
886 Ga0373941_0296226 3300035115 Bacteria 644
887 Ga0373953_0064809 3300035117 Bacteria 1499
888 Ga0373954_0028925 3300035118 Bacteria 2550
889 Ga0373956_0030070 3300035119 Bacteria 2372
890 Ga0373957_0341548 3300035120 Bacteria 638
891 Ga0373960_0183253 3300035121 Bacteria 732
892 Ga0373943_0012285 3300035170 Bacteria 3853
893 Ga0373943_0035963 3300035170 Bacteria 2370
894 Ga0373946_0358210 3300035171 Bacteria 730
895 Ga0373955_0041670 3300035172 Bacteria 2462
896 Ga0373942_0027587 3300035207 Bacteria 1479
897 Ga0373942_0088421 3300035207 Bacteria 930
898 Ga0373962_0248339 3300035242 Bacteria 617
899 Ga0373924_0053116 3300035410 Bacteria 1683
900 Ga0373931_0615884 3300035691 Bacteria 711
901 Ga0373931_1206254 3300035691 Bacteria 518
902 Ga0373935_0296207 3300035692 Bacteria 1142
903 Ga0373927_0001126 3300035695 Bacteria 20271
904 Ga0373933_0001765 3300035724 Bacteria 12526
905 Ga0373947_0643298 3300035725 Bacteria 723
906 Ga0373937_0006878 3300036401 Bacteria 9815
907 Ga0373925_0000061 3300037068 Bacteria 117783
908 Ga0373925_0001803 3300037068 Bacteria 17861
909 Ga0373925_1495618 3300037068 Bacteria 553
910 Ga0373925_1784479 3300037068 Bacteria 502
911 Ga0395899_0041622 3300037312 Bacteria 3432
912 Ga0395899_0206782 3300037312 Bacteria 1366
913 Ga0395899_0919648 3300037312 Bacteria 532
914 Ga0395900_0334425 3300037418 Bacteria 1491
915 Ga0395900_0339027 3300037418 Bacteria 1479
916 Ga0395900_0889358 3300037418 Bacteria 814
917 Ga0395900_0962807 3300037418 Bacteria 774
918 Ga0395900_1156084 3300037418 Bacteria 690
919 Ga0395898_0069290 3300037466 Bacteria 3412
920 Ga0395898_0087345 3300037466 Bacteria 3004
921 Ga0395898_1518276 3300037466 Bacteria 595
922 Ga0395905_0009297 3300037471 Bacteria 9615
923 Ga0395905_0104518 3300037471 Bacteria 2659
924 Ga0395905_0170538 3300037471 Bacteria 2044
925 Ga0395905_1217762 3300037471 Bacteria 656
926 Ga0436364_0183155 3300037853 Bacteria 1096
927 Ga0436364_0610524 3300037853 Bacteria 571
928 Ga0436364_0824263 3300037853 Unclassified 515
929 Ga0395901_0149762 3300038443 Bacteria 2452
930 Ga0395901_0471972 3300038443 Bacteria 1281
931 Ga0395901_0989624 3300038443 Bacteria 817
932 Ga0395901_1329362 3300038443 Bacteria 679
933 Ga0436365_0029920 3300039437 Bacteria 3132
934 Ga0436365_0073009 3300039437 Bacteria 818
935 Ga0436365_0306093 3300039437 Bacteria 1457
936 Ga0436365_1750735 3300039437 Bacteria 3537
937 Ga0436365_1837953 3300039437 Bacteria 2874
938 Ga0436360_0227752 3300039438 Bacteria 1200
939 Ga0436361_0835775 3300039447 Bacteria 1822
940 Ga0436363_1484678 3300039450 Bacteria 503
941 Ga0436362_0149703 3300039453 Bacteria 1048
942 Ga0436362_0297190 3300039453 Bacteria 734
943 Ga0436362_1022103 3300039453 Bacteria 705
944 Ga0439461_0155082 3300041410 Bacteria 594
945 Ga0439466_0206085 3300041411 Bacteria 598
946 Ga0439465_0014311 3300041413 Bacteria 2473
947 Ga0451793_0361570 3300041452 Bacteria 514
948 Ga0451793_1900854 3300041452 Bacteria 1003
949 Ga0451793_1926393 3300041452 Bacteria 587
950 Ga0451795_0925728 3300041456 Bacteria 768
951 Ga0451795_1551248 3300041456 Bacteria 808
952 Ga0451798_0838824 3300041458 Bacteria 599
953 Ga0451800_0464072 3300041459 Bacteria 583
954 Ga0451802_1476308 3300041460 Bacteria 801
955 Ga0451805_005031 3300041461 Bacteria 534
956 Ga0451807_0142193 3300041486 Bacteria 1125
957 Ga0451837_1073011 3300041494 Bacteria 1145
958 Ga0451839_0183986 3300041496 Bacteria 578
959 Ga0451849_0020168 3300041505 Bacteria 828
960 Ga0451843_1308798 3300041509 Bacteria 690
961 Ga0451853_1702220 3300041512 Bacteria 565
962 Ga0451853_3393834 3300041512 Bacteria 644
963 Ga0451853_4061060 3300041512 Bacteria 1222
964 Ga0439442_050511 3300042002 Bacteria 877
965 Ga0439445_0032864 3300042004 Bacteria 1354
966 Ga0439445_0179473 3300042004 Bacteria 622
967 Ga0439432_158478 3300042006 Bacteria 663
968 Ga0439455_0011348 3300042012 Bacteria 1977
969 Ga0439462_0105014 3300042015 Bacteria 780
970 Ga0439458_0091866 3300042157 Bacteria 782
971 Ga0439434_0233390 3300042435 Bacteria 626
972 Ga0439459_0015574 3300042438 Bacteria 1395
973 Ga0466966_0064946 3300044684 Bacteria 2296
974 Ga0466961_0119483 3300044693 Bacteria 1655
975 Ga0466970_0170236 3300044765 Bacteria 1207
976 Ga0466957_1387097 3300044842 Bacteria 511
977 Ga0466959_0195141 3300045049 Bacteria 1411
978 Ga0466958_0445342 3300045836 Bacteria 838
979 Ga0466958_0524950 3300045836 Bacteria 769
980 Ga0495592_0124849 3300046454 Bacteria 1807
981 Ga0495592_0166268 3300046454 Bacteria 1514
982 Ga0495590_0261925 3300046457 Bacteria 645
983 Ga0495629_0038896 3300046459 Bacteria 3349
984 Ga0495629_0047462 3300046459 Bacteria 3012
985 Ga0495629_0467504 3300046459 Unclassified 853
986 Ga0495651_0161486 3300046462 Bacteria 1605
987 Ga0495653_0218391 3300046463 Bacteria 1283
988 Ga0495650_0040709 3300046471 Bacteria 1992
989 Ga0495580_0820505 3300046472 Bacteria 602
990 Ga0495639_0329567 3300046475 Unclassified 764
991 Ga0495662_0027078 3300046476 Bacteria 2769
992 Ga0495664_0144213 3300046477 Bacteria 1444
993 Ga0495585_0112411 3300046492 Bacteria 1447
994 Ga0495585_0119277 3300046492 Bacteria 1397
995 Ga0495585_0313985 3300046492 Bacteria 768
996 Ga0495607_0460828 3300046501 Bacteria 569
997 Ga0495583_0127457 3300046506 Bacteria 1067
998 Ga0495606_0009975 3300046507 Bacteria 7944
999 Ga0495608_0126446 3300046511 Bacteria 1637
1000 Ga0495610_0000530 3300046512 Bacteria 38418
1001 Ga0495610_0047010 3300046512 Bacteria 2125
1002 Ga0495618_0737711 3300046514 Bacteria 577
1003 Ga0495618_0895405 3300046514 Bacteria 512
1004 Ga0495620_0062173 3300046515 Bacteria 1551
1005 Ga0495628_0134207 3300046516 Bacteria 1893
1006 Ga0495628_0408110 3300046516 Bacteria 991
1007 Ga0495628_0966973 3300046516 Bacteria 587
1008 Ga0495630_1125977 3300046517 Bacteria 595
1009 Ga0495631_0200675 3300046518 Bacteria 853
1010 Ga0495643_0009536 3300046522 Bacteria 6029
1011 Ga0495643_0091285 3300046522 Bacteria 1571
1012 Ga0495644_0294987 3300046523 Bacteria 634
1013 Ga0495648_0173144 3300046524 Bacteria 1104
1014 Ga0495648_0425133 3300046524 Bacteria 587
1015 Ga0495642_0003852 3300046528 Bacteria 5880
1016 Ga0495654_0169882 3300046530 Bacteria 951
1017 Ga0495640_0132628 3300046533 Bacteria 1611
1018 Ga0495587_0452180 3300046536 Bacteria 712
1019 Ga0495609_0171090 3300046538 Bacteria 917
1020 Ga0495621_0142166 3300046539 Bacteria 940
1021 Ga0495597_0001737 3300046542 Bacteria 15014
1022 Ga0495622_0036577 3300046557 Bacteria 2288
1023 Ga0495633_0065587 3300046558 Bacteria 1696
1024 Ga0495667_0544642 3300046559 Bacteria 725
1025 Ga0495668_0116616 3300046616 Bacteria 1460
1026 Ga0495668_0697987 3300046616 Bacteria 561
1027 Ga0495611_0001817 3300046648 Bacteria 10230
1028 Ga0495611_0266435 3300046648 Bacteria 793
1029 Ga0495625_0016679 3300046660 Bacteria 5770
1030 Ga0495625_0049278 3300046660 Bacteria 3029
1031 Ga0495635_0056822 3300046663 Bacteria 2694
1032 Ga0495635_0915246 3300046663 Bacteria 561
1033 Ga0495659_0223139 3300046664 Bacteria 779
1034 Ga0495588_0005383 3300046674 Bacteria 5692
1035 Ga0495588_0071865 3300046674 Bacteria 1800
1036 Ga0495657_0152288 3300046675 Bacteria 1435
1037 Ga0495657_0466685 3300046675 Bacteria 738
1038 Ga0495658_0067764 3300046683 Bacteria 2065
1039 Ga0495669_0000114 3300046684 Bacteria 52644
1040 Ga0495669_0000375 3300046684 Bacteria 22695
1041 Ga0495669_0020657 3300046684 Bacteria 2852
1042 Ga0495669_0210846 3300046684 Bacteria 930
1043 Ga0495669_0255651 3300046684 Bacteria 841
1044 Ga0495613_0016976 3300046689 Bacteria 5418
1045 Ga0495613_0342822 3300046689 Bacteria 1028
1046 Ga0495624_0064980 3300046690 Bacteria 2280
1047 Ga0495624_0082628 3300046690 Bacteria 1988
1048 Ga0495624_0286422 3300046690 Bacteria 994
1049 Ga0495671_0130573 3300046692 Bacteria 1225
1050 Ga0495600_0204355 3300046809 Bacteria 1267
1051 Ga0495600_0308639 3300046809 Bacteria 997
1052 Ga0495604_0022630 3300047317 Bacteria 5018
1053 Ga0495636_0417144 3300047318 Bacteria 641
1054 Ga0495672_0069043 3300047320 Bacteria 2007
1055 Ga0495676_0627109 3300047321 Bacteria 699
1056 Ga0495680_1101131 3300047322 Bacteria 502
1057 Ga0495683_0459000 3300047323 Bacteria 522
1058 Ga0495687_021229 3300047443 Bacteria 3147
1059 Ga0495675_0353251 3300047444 Bacteria 864
1060 Ga0495677_0014060 3300047445 Bacteria 2914
1061 Ga0495677_0019944 3300047445 Bacteria 2430
1062 Ga0495677_0303681 3300047445 Bacteria 628
1063 Ga0495685_172539 3300047447 Bacteria 698
1064 Ga0495673_0232990 3300047469 Bacteria 678
1065 Ga0495681_0002425 3300047470 Bacteria 13322
1066 Ga0495681_0317634 3300047470 Bacteria 599
1067 Ga0495684_0437837 3300047471 Bacteria 911
1068 Ga0495684_0688114 3300047471 Bacteria 680
1069 Ga0495684_1044394 3300047471 Bacteria 516
1070 Ga0495686_0003490 3300047472 Bacteria 13592
1071 Ga0495686_0160588 3300047472 Bacteria 1313
1072 Ga0495593_0019427 3300047673 Bacteria 3810
1073 Ga0495602_0210122 3300048088 Bacteria 1478
1074 Ga0495602_0336494 3300048088 Bacteria 1093
1075 Ga0495615_0106747 3300048090 Bacteria 797
1076 Ga0496100_0713875 3300048903 Bacteria 783
1077 Ga0496100_0770290 3300048903 Bacteria 753
1078 Ga0496100_1043367 3300048903 Bacteria 644
1079 Ga0496100_1600379 3300048903 Bacteria 515
1080 Ga0496101_0043794 3300048904 Bacteria 3200
1081 Ga0496101_0540884 3300048904 Bacteria 921
1082 Ga0496101_0958343 3300048904 Bacteria 673
1083 Ga0496101_1307025 3300048904 Bacteria 567
1084 Ga0496102_0000034 3300048905 Bacteria 213826
1085 Ga0496102_0031117 3300048905 Bacteria 4784
1086 Ga0496102_0193636 3300048905 Bacteria 1916
1087 Ga0496102_0344473 3300048905 Bacteria 1403
1088 Ga0496102_0859348 3300048905 Bacteria 829
1089 Ga0496103_0000026 3300048906 Bacteria 213826
1090 Ga0496103_0396937 3300048906 Bacteria 886
1091 Ga0496103_0863148 3300048906 Bacteria 569
1092 Ga0496104_0205507 3300048907 Bacteria 1881
1093 Ga0496104_0499506 3300048907 Bacteria 1128
1094 Ga0496105_0646552 3300048908 Bacteria 816
1095 Ga0496106_0407120 3300048909 Bacteria 1093
1096 Ga0496107_0168265 3300048910 Bacteria 1626
1097 Ga0496107_0315776 3300048910 Bacteria 1163
1098 Ga0496107_0346416 3300048910 Bacteria 1106
1099 Ga0496108_0252642 3300048911 Bacteria 1534
1100 Ga0496108_0451166 3300048911 Bacteria 1123
1101 Ga0496108_1313230 3300048911 Bacteria 608
1102 Ga0496109_0021464 3300048912 Bacteria 5710
1103 Ga0496109_0456005 3300048912 Bacteria 1207
1104 Ga0496109_0638925 3300048912 Bacteria 1001
1105 Ga0496109_0884690 3300048912 Bacteria 831
1106 Ga0496110_0094902 3300048913 Bacteria 2671
1107 Ga0496110_0504435 3300048913 Bacteria 1101
1108 Ga0496111_0330750 3300048914 Bacteria 1128
1109 Ga0496111_0379999 3300048914 Bacteria 1045
1110 Ga0496111_0554619 3300048914 Bacteria 843
1111 Ga0496112_0077655 3300048915 Bacteria 3284
1112 Ga0496112_0204968 3300048915 Bacteria 1930
1113 Ga0496112_1398908 3300048915 Bacteria 614
1114 Ga0496112_1519189 3300048915 Bacteria 583
1115 Ga0496113_0143794 3300048916 Bacteria 1878
1116 Ga0496113_0181414 3300048916 Bacteria 1669
1117 Ga0496113_1174131 3300048916 Bacteria 600
1118 Ga0496115_0160335 3300048918 Bacteria 1858
1119 Ga0496115_0570284 3300048918 Bacteria 903
1120 Ga0496115_0899614 3300048918 Bacteria 683
1121 Ga0496116_0002308 3300048919 Bacteria 20225
1122 Ga0496116_0080690 3300048919 Bacteria 2019
1123 Ga0496116_0270728 3300048919 Bacteria 830
1124 Ga0496116_0334329 3300048919 Bacteria 702
1125 Ga0496117_0000002 3300048920 Bacteria 2483758
1126 Ga0496117_0000072 3300048920 Bacteria 238366
1127 Ga0496117_0019825 3300048920 Bacteria 5507
1128 Ga0496117_0104602 3300048920 Bacteria 1781
1129 Ga0496117_0179655 3300048920 Bacteria 1218
1130 Ga0496118_0000030 3300048921 Bacteria 339946
1131 Ga0496118_0001144 3300048921 Bacteria 40942
1132 Ga0496118_0071304 3300048921 Bacteria 2502
1133 Ga0496119_0009454 3300048922 Bacteria 8364
1134 Ga0496119_0020857 3300048922 Bacteria 4756
1135 Ga0496119_0036947 3300048922 Bacteria 3180
1136 Ga0496119_0038724 3300048922 Bacteria 3076
1137 Ga0496119_0050737 3300048922 Bacteria 2554
1138 Ga0496120_0000897 3300048923 Bacteria 41807
1139 Ga0496121_0000009 3300048924 Bacteria 836971
1140 Ga0496121_0054257 3300048924 Bacteria 3351
1141 Ga0496121_0319213 3300048924 Bacteria 1046
1142 Ga0496121_0369749 3300048924 Bacteria 949
1143 Ga0496121_0539712 3300048924 Bacteria 732
1144 Ga0496121_0685436 3300048924 Bacteria 619
1145 Ga0496122_0000001 3300048925 Bacteria 1827766
1146 Ga0496122_0005325 3300048925 Bacteria 15380
1147 Ga0496122_0010228 3300048925 Bacteria 9721
1148 Ga0496122_0077402 3300048925 Bacteria 2336
1149 Ga0496122_0186794 3300048925 Bacteria 1228
1150 Ga0496122_0507641 3300048925 Bacteria 584
1151 Ga0496123_0000001 3300048926 Bacteria 1831497
1152 Ga0496123_0000539 3300048926 Bacteria 65166
1153 Ga0496123_0048548 3300048926 Bacteria 2855
1154 Ga0496123_0069298 3300048926 Bacteria 2215
1155 Ga0496124_0000061 3300048927 Bacteria 238225
1156 Ga0496124_0000855 3300048927 Bacteria 49698
1157 Ga0496124_0040338 3300048927 Bacteria 4039
1158 Ga0496124_0044707 3300048927 Bacteria 3798
1159 Ga0496124_0106630 3300048927 Bacteria 2262
1160 Ga0496124_0435032 3300048927 Bacteria 899
1161 Ga0496124_0629884 3300048927 Bacteria 692
1162 Ga0496124_0894558 3300048927 Bacteria 539
1163 Ga0496125_0068486 3300048928 Bacteria 2792
1164 Ga0496126_0026844 3300048929 Bacteria 5514
1165 Ga0496126_0058965 3300048929 Bacteria 3459
1166 Ga0496126_0063284 3300048929 Bacteria 3316
1167 Ga0496126_0072053 3300048929 Bacteria 3074
1168 Ga0496126_0564777 3300048929 Bacteria 901
1169 Ga0496126_1229169 3300048929 Bacteria 549
1170 Ga0501310_031570 3300049130 Bacteria 706
1171 Ga0501307_044598 3300049162 Bacteria 652
1172 Ga0495678_030444 3300049459 Bacteria 2258
1173 Ga0501311_095454 3300049527 Bacteria 521
1174 Ga0501312_087508 3300049528 Bacteria 571
1175 Ga0501315_091535 3300049531 Bacteria 528
1176 Ga0501316_072603 3300049532 Bacteria 523
1177 Ga0501317_070626 3300049533 Bacteria 589
1178 Ga0501320_069732 3300049536 Bacteria 507
1179 Ga0501321_040259 3300049537 Bacteria 655
1180 Ga0501323_070654 3300049539 Bacteria 558
1181 Ga0501333_022213 3300049549 Bacteria 511
1182 Ga0501336_026000 3300049552 Bacteria 555
1183 Ga0501340_025454 3300049556 Bacteria 516
1184 Ga0501032_0467633 3300049569 Bacteria 807
1185 Ga0501033_0000741 3300049570 Bacteria 29982
1186 Ga0501033_0222417 3300049570 Bacteria 1343
1187 Ga0501033_0279467 3300049570 Bacteria 1179
1188 Ga0501033_0351065 3300049570 Bacteria 1033
1189 Ga0501033_0655231 3300049570 Bacteria 717
1190 Ga0501034_0001360 3300049571 Bacteria 33027
1191 Ga0501034_0017349 3300049571 Bacteria 7384
1192 Ga0501034_0036387 3300049571 Bacteria 4987
1193 Ga0501034_0168950 3300049571 Bacteria 2155
1194 Ga0501034_0273907 3300049571 Bacteria 1628
1195 Ga0501034_0356313 3300049571 Bacteria 1391
1196 Ga0501034_0409635 3300049571 Bacteria 1278
1197 Ga0501034_0917453 3300049571 Bacteria 763
1198 Ga0501034_1491997 3300049571 Bacteria 550
1199 Ga0501038_0685285 3300049574 Bacteria 769
1200 Ga0501043_0321652 3300049579 Bacteria 1179
1201 Ga0501043_0969052 3300049579 Bacteria 607
1202 Ga0501047_0005360 3300049581 Bacteria 12051
1203 Ga0501047_0015925 3300049581 Bacteria 7168
1204 Ga0501047_0112286 3300049581 Bacteria 2607
1205 Ga0501047_0503412 3300049581 Bacteria 1038
1206 Ga0501048_0441810 3300049582 Bacteria 931
1207 Ga0501067_0174629 3300049583 Bacteria 1197
1208 Ga0501070_0079969 3300049586 Bacteria 2705
1209 Ga0501070_0535013 3300049586 Bacteria 939
1210 Ga0501072_1560675 3300049588 Bacteria 509
1211 Ga0501073_0107948 3300049589 Bacteria 1932
1212 Ga0501073_0242720 3300049589 Bacteria 1244
1213 Ga0501073_1146747 3300049589 Bacteria 534
1214 Ga0501074_0437778 3300049590 Bacteria 927
1215 Ga0501077_0652508 3300049593 Bacteria 676
1216 Ga0501217_117316 3300049661 Bacteria 770
1217 Ga0501217_260318 3300049661 Bacteria 562
1218 Ga0501223_122000 3300049663 Bacteria 551
1219 Ga0501233_181258 3300049668 Bacteria 603
1220 Ga0501235_217132 3300049669 Bacteria 523
1221 Ga0501239_071890 3300049672 Bacteria 540
1222 Ga0501240_024707 3300049673 Bacteria 928
1223 Ga0501242_086216 3300049674 Bacteria 510
1224 Ga0501243_021746 3300049675 Bacteria 1060
1225 Ga0501247_035849 3300049677 Bacteria 694
1226 Ga0501251_091380 3300049681 Bacteria 547
1227 Ga0501257_146522 3300049686 Bacteria 648
1228 Ga0501225_0306999 3300049705 Bacteria 538
1229 Ga0501229_048652 3300049706 Bacteria 621
1230 Ga0501234_026341 3300049707 Bacteria 934
1231 Ga0501080_1026561 3300049742 Bacteria 714
1232 Ga0501083_0519070 3300049744 Bacteria 775
1233 Ga0501241_136699 3300049758 Bacteria 556
1234 Ga0501264_044832 3300049761 Bacteria 554
1235 Ga0501267_015401 3300049764 Bacteria 809
1236 Ga0501267_019969 3300049764 Bacteria 734
1237 Ga0501268_026257 3300049765 Bacteria 1028
1238 Ga0501268_162885 3300049765 Bacteria 521
1239 Ga0501272_065843 3300049769 Bacteria 524
1240 Ga0501273_041434 3300049770 Bacteria 682
1241 Ga0501035_0004335 3300049822 Bacteria 13467
1242 Ga0501035_0037612 3300049822 Bacteria 4382
1243 Ga0501035_0040735 3300049822 Bacteria 4196
1244 Ga0501035_0055251 3300049822 Bacteria 3545
1245 Ga0501044_0191921 3300049823 Bacteria 2005
1246 Ga0501044_0270849 3300049823 Bacteria 1634
1247 Ga0501044_0373120 3300049823 Bacteria 1343
1248 Ga0501044_0406439 3300049823 Bacteria 1273
1249 Ga0501044_0757498 3300049823 Bacteria 853
1250 Ga0501044_1452874 3300049823 Bacteria 551
1251 Ga0501204_071374 3300049850 Bacteria 573
1252 Ga0501212_044071 3300049851 Bacteria 744
1253 nmdc:mga03683_14575_c1 3300050489 Bacteria 2912
1254 nmdc:mga03683_263655_c1 3300050489 Bacteria 802
1255 nmdc:mga03683_95267_c1 3300050489 Bacteria 1303
1256 nmdc:mga03n38_453666_c1 3300050490 Bacteria 714
1257 nmdc:mga03n38_626595_c1 3300050490 Bacteria 615
1258 nmdc:mga03n38_72384_c1 3300050490 Bacteria 1598
1259 nmdc:mga00v17_838_c1 3300050491 Bacteria 16681
1260 nmdc:mga00v17_98091_c1 3300050491 Bacteria 1847
1261 nmdc:mga0yw44_197941_c1 3300050492 Bacteria 1326
1262 nmdc:mga0yw44_3160_c1 3300050492 Bacteria 7230
1263 nmdc:mga0yw44_803420_c1 3300050492 Bacteria 639
1264 nmdc:mga0k408_466200_c1 3300050493 Bacteria 750
1265 nmdc:mga0k408_894208_c1 3300050493 Bacteria 515
1266 nmdc:mga06z11_455553_c1 3300050494 Bacteria 773
1267 nmdc:mga06z11_545393_c1 3300050494 Bacteria 704
1268 nmdc:mga06z11_549185_c1 3300050494 Bacteria 701
1269 nmdc:mga06z11_810645_c1 3300050494 Bacteria 570
1270 nmdc:mga06z11_978283_c1 3300050494 Bacteria 516
1271 nmdc:mga04h51_111221_c1 3300050495 Bacteria 1010
1272 nmdc:mga04h51_389572_c1 3300050495 Bacteria 582
1273 nmdc:mga04h51_51802_c1 3300050495 Bacteria 1381
1274 nmdc:mga07m45_140770_c1 3300050496 Bacteria 1397
1275 nmdc:mga07m45_156640_c1 3300050496 Bacteria 1322
1276 nmdc:mga07m45_201028_c1 3300050496 Bacteria 1159
1277 nmdc:mga07m45_592194_c1 3300050496 Bacteria 640
1278 nmdc:mga0sz30_268_c1 3300050516 Bacteria 19941
1279 Ga0495601_0045173 3300053077 Bacteria 2769
1280 Ga0495601_0259792 3300053077 Bacteria 1134
1281 Ga0495601_0472317 3300053077 Bacteria 810
1282 Ga0500635_0000302 3300053080 Bacteria 17373
1283 Ga0495595_0110042 3300053084 Bacteria 1335
1284 Ga0495619_0045254 3300053085 Bacteria 2891
1285 Ga0495619_0245844 3300053085 Bacteria 1240
1286 Ga0500578_0270703 3300053086 Bacteria 1016
1287 Ga0500643_114283 3300053087 Bacteria 728
1288 Ga0500643_132126 3300053087 Bacteria 671
1289 Ga0500643_138299 3300053087 Bacteria 654
1290 Ga0500644_0504222 3300053088 Bacteria 533
1291 Ga0500646_0158878 3300053090 Bacteria 753
1292 Ga0500583_0068270 3300053092 Bacteria 1695
1293 Ga0500651_0038819 3300053093 Bacteria 2999
1294 Ga0500566_0075858 3300053094 Bacteria 1880
1295 Ga0500641_0000513 3300053096 Bacteria 13949
1296 Ga0500641_0001354 3300053096 Bacteria 8713
1297 Ga0500641_0123532 3300053096 Bacteria 1116
1298 Ga0500641_0317682 3300053096 Bacteria 635
1299 Ga0500554_044660 3300053102 Bacteria 1374
1300 Ga0500555_008578 3300053103 Bacteria 2915
1301 Ga0500555_022840 3300053103 Bacteria 1795
1302 Ga0500556_0000944 3300053104 Bacteria 15720
1303 Ga0500556_0188512 3300053104 Bacteria 815
1304 Ga0500557_124052 3300053105 Bacteria 857
1305 Ga0500560_266297 3300053107 Bacteria 527
1306 Ga0500562_000464 3300053108 Bacteria 9836
1307 Ga0500562_002035 3300053108 Bacteria 5064
1308 Ga0500562_003673 3300053108 Bacteria 3855
1309 Ga0500569_001963 3300053109 Bacteria 3987
1310 Ga0500572_001459 3300053111 Bacteria 6456
1311 Ga0500572_264183 3300053111 Bacteria 558
1312 Ga0500595_004249 3300053119 Bacteria 6464
1313 Ga0500607_093214 3300053121 Bacteria 1511
1314 Ga0500607_130368 3300053121 Bacteria 1200
1315 Ga0500608_000573 3300053122 Bacteria 13643
1316 Ga0500614_002131 3300053123 Bacteria 4514
1317 Ga0500614_075922 3300053123 Bacteria 932
1318 Ga0500642_0106206 3300053130 Bacteria 1309
1319 Ga0500655_053593 3300053133 Bacteria 806
1320 Ga0500559_0003926 3300053136 Bacteria 7179
1321 Ga0500559_0012527 3300053136 Bacteria 3601
1322 Ga0500559_0284235 3300053136 Bacteria 778
1323 Ga0500561_0001340 3300053137 Bacteria 4005
1324 Ga0500568_0056872 3300053139 Bacteria 1523
1325 Ga0500568_0068224 3300053139 Bacteria 1365
1326 Ga0500573_0504641 3300053140 Bacteria 546
1327 Ga0500577_0267177 3300053142 Bacteria 744
1328 Ga0500590_000122 3300053148 Bacteria 21279
1329 Ga0500590_130785 3300053148 Bacteria 1161
1330 Ga0500603_059463 3300053150 Bacteria 1065
1331 Ga0500604_0000092 3300053151 Bacteria 28708
1332 Ga0500604_0283855 3300053151 Bacteria 574
1333 Ga0500616_0056412 3300053153 Bacteria 2050
1334 Ga0500616_0068784 3300053153 Bacteria 1812
1335 Ga0500619_008319 3300053154 Bacteria 2512
1336 Ga0500620_153731 3300053155 Bacteria 800
1337 Ga0500622_0037145 3300053156 Bacteria 2545
1338 Ga0500622_0104173 3300053156 Bacteria 1393
1339 Ga0500624_000595 3300053157 Bacteria 9879
1340 Ga0500624_003662 3300053157 Bacteria 2013
1341 Ga0500624_031755 3300053157 Bacteria 911
1342 Ga0500633_0076085 3300053160 Bacteria 1207
1343 Ga0500634_0001711 3300053161 Bacteria 8755
1344 Ga0500634_0002130 3300053161 Bacteria 8203
1345 Ga0500638_045794 3300053162 Bacteria 2122
1346 Ga0500636_0000094 3300053177 Bacteria 44967
1347 Ga0500636_0001328 3300053177 Bacteria 13421
1348 Ga0500636_0008358 3300053177 Bacteria 6004
1349 Ga0500636_0330724 3300053177 Bacteria 736
1350 Ga0500636_0353667 3300053177 Bacteria 700
1351 Ga0500637_0187831 3300053178 Bacteria 1181
1352 Ga0500637_0384570 3300053178 Bacteria 734
1353 Ga0500657_220977 3300053728 Bacteria 601
1354 Ga0500625_015994 3300053729 Bacteria 3489
1355 Ga0500645_002978 3300053730 Bacteria 7180
1356 Ga0500645_059370 3300053730 Bacteria 1107
1357 Ga0500596_000489 3300053735 Bacteria 7420
1358 Ga0587084_128359 3300059477 Bacteria 540
1359 Ga0587085_102438 3300059506 Bacteria 606
1360 Ga0587062_063902 3300059639 Bacteria 652
1361 Ga0587062_096072 3300059639 Bacteria 571
1362 Ga0587076_200370 3300059645 Bacteria 513
1363 Ga0501082_1074369 3300060353 Bacteria 704
1364 Ga0466962_0163736 3300061719 Bacteria 1082
1365 Ga0466962_0618384 3300061719 Bacteria 553

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1003960 Ga0081540_10039606 55
2 3300005445 Ga0070708_100093937 Ga0070708_1000939373 56
3 3300005841 Ga0068863_102123324 Ga0068863_1021233242 56
4 3300006175 Ga0070712_100926124 Ga0070712_1009261242 56
5 3300025913 Ga0207695_10952896 Ga0207695_109528962 56
6 3300001979 JGI24740J21852_10101924 JGI24740J21852_101019241 59
7 3300005327 Ga0070658_10962084 Ga0070658_109620842 59
8 3300005337 Ga0070682_101284689 Ga0070682_1012846891 59
9 3300005339 Ga0070660_100123508 Ga0070660_1001235082 59
10 3300005344 Ga0070661_100259299 Ga0070661_1002592992 59
11 3300005355 Ga0070671_100000890 Ga0070671_1000008907 59
12 3300005458 Ga0070681_10477736 Ga0070681_104777362 59
13 3300005458 Ga0070681_10750034 Ga0070681_107500342 59
14 3300005539 Ga0068853_100007846 Ga0068853_1000078467 59
15 3300005543 Ga0070672_101423668 Ga0070672_1014236682 59
16 3300005548 Ga0070665_101173048 Ga0070665_1011730482 59
17 3300005577 Ga0068857_101551255 Ga0068857_1015512552 59
18 3300005614 Ga0068856_101691569 Ga0068856_1016915692 59
19 3300005616 Ga0068852_102101990 Ga0068852_1021019902 59
20 3300006048 Ga0075363_100856113 Ga0075363_1008561132 59
21 3300009174 Ga0105241_11610100 Ga0105241_116101002 59
22 3300009545 Ga0105237_10214516 Ga0105237_102145163 59
23 3300009551 Ga0105238_12604913 Ga0105238_126049132 59
24 3300010375 Ga0105239_12651460 Ga0105239_126514602 59
25 3300013104 Ga0157370_10169243 Ga0157370_101692432 59
26 3300013104 Ga0157370_11741633 Ga0157370_117416331 59
27 3300013307 Ga0157372_11527146 Ga0157372_115271462 59
28 3300021384 Ga0213876_10006256 Ga0213876_100062564 59
29 3300025904 Ga0207647_10320327 Ga0207647_103203272 59
30 3300025909 Ga0207705_10214787 Ga0207705_102147872 59
31 3300025911 Ga0207654_11365928 Ga0207654_113659282 59
32 3300025912 Ga0207707_10561843 Ga0207707_105618432 59
33 3300025914 Ga0207671_10512235 Ga0207671_105122352 59
34 3300025919 Ga0207657_10157456 Ga0207657_101574562 59
35 3300025920 Ga0207649_10449557 Ga0207649_104495572 59
36 3300025924 Ga0207694_10681830 Ga0207694_106818302 59
37 3300026041 Ga0207639_10010574 Ga0207639_100105747 59
38 3300026078 Ga0207702_11030032 Ga0207702_110300322 59
39 3300026078 Ga0207702_12396472 Ga0207702_123964722 59
40 3300028379 Ga0268266_10740575 Ga0268266_107405752 59
41 3300028577 Ga0265318_10002680 Ga0265318_100026805 59
42 3300028794 Ga0307515_10627394 Ga0307515_106273941 59
43 3300030742 Ga0316183_1208086 Ga0316183_12080861 59
44 3300030745 Ga0316182_1451093 Ga0316182_14510931 59
45 3300031235 Ga0265330_10239705 Ga0265330_102397052 59
46 3300031240 Ga0265320_10051193 Ga0265320_100511932 59
47 3300031250 Ga0265331_10017136 Ga0265331_100171365 59
48 3300031250 Ga0265331_10319527 Ga0265331_103195272 59
49 3300031344 Ga0265316_10498578 Ga0265316_104985782 59
50 3300031456 Ga0307513_10990635 Ga0307513_109906352 59
51 3300031548 Ga0307408_101020152 Ga0307408_1010201522 59
52 3300031548 Ga0307408_101460613 Ga0307408_1014606131 59
53 3300031548 Ga0307408_101841299 Ga0307408_1018412992 59
54 3300031595 Ga0265313_10004088 Ga0265313_100040885 59
55 3300031595 Ga0265313_10007724 Ga0265313_1000772410 59
56 3300031665 Ga0316575_10049055 Ga0316575_100490551 59
57 3300031691 Ga0316579_10499764 Ga0316579_104997641 59
58 3300031711 Ga0265314_10011207 Ga0265314_100112077 59
59 3300031711 Ga0265314_10034101 Ga0265314_100341013 59
60 3300031711 Ga0265314_10384211 Ga0265314_103842112 59
61 3300031731 Ga0307405_12161306 Ga0307405_121613062 59
62 3300031824 Ga0307413_10118701 Ga0307413_101187012 59
63 3300031824 Ga0307413_10240404 Ga0307413_102404042 59
64 3300031824 Ga0307413_10352999 Ga0307413_103529992 59
65 3300031824 Ga0307413_10744247 Ga0307413_107442472 59
66 3300031852 Ga0307410_10151226 Ga0307410_101512262 59
67 3300031852 Ga0307410_10407000 Ga0307410_104070002 59
68 3300031852 Ga0307410_10506159 Ga0307410_105061592 59
69 3300031852 Ga0307410_11603655 Ga0307410_116036551 59
70 3300031852 Ga0307410_11866437 Ga0307410_118664371 59
71 3300031852 Ga0307410_12148422 Ga0307410_121484221 59
72 3300031901 Ga0307406_10379229 Ga0307406_103792292 59
73 3300031901 Ga0307406_10381357 Ga0307406_103813572 59
74 3300031901 Ga0307406_10838192 Ga0307406_108381922 59
75 3300031903 Ga0307407_10024120 Ga0307407_100241203 59
76 3300031903 Ga0307407_10065509 Ga0307407_100655092 59
77 3300031903 Ga0307407_10342875 Ga0307407_103428752 59
78 3300031903 Ga0307407_10413171 Ga0307407_104131712 59
79 3300031903 Ga0307407_10843521 Ga0307407_108435212 59
80 3300031903 Ga0307407_11544024 Ga0307407_115440241 59
81 3300031911 Ga0307412_10361128 Ga0307412_103611282 59
82 3300031911 Ga0307412_10483439 Ga0307412_104834392 59
83 3300031911 Ga0307412_10581406 Ga0307412_105814062 59
84 3300031911 Ga0307412_11625459 Ga0307412_116254592 59
85 3300031995 Ga0307409_100076722 Ga0307409_1000767223 59
86 3300031995 Ga0307409_100245719 Ga0307409_1002457193 59
87 3300031995 Ga0307409_101132224 Ga0307409_1011322242 59
88 3300031995 Ga0307409_101749516 Ga0307409_1017495162 59
89 3300032002 Ga0307416_100077132 Ga0307416_1000771323 59
90 3300032002 Ga0307416_100684930 Ga0307416_1006849302 59
91 3300032002 Ga0307416_101109960 Ga0307416_1011099601 59
92 3300032002 Ga0307416_102102398 Ga0307416_1021023982 59
93 3300032002 Ga0307416_103540377 Ga0307416_1035403771 59
94 3300032004 Ga0307414_10061652 Ga0307414_100616522 59
95 3300032004 Ga0307414_10144786 Ga0307414_101447862 59
96 3300032004 Ga0307414_10387252 Ga0307414_103872523 59
97 3300032004 Ga0307414_10467870 Ga0307414_104678702 59
98 3300032004 Ga0307414_10682392 Ga0307414_106823922 59
99 3300032004 Ga0307414_10924834 Ga0307414_109248342 59
100 3300032004 Ga0307414_11253991 Ga0307414_112539912 59
101 3300032004 Ga0307414_11626754 Ga0307414_116267541 59
102 3300032005 Ga0307411_10056123 Ga0307411_100561232 59
103 3300032005 Ga0307411_10216913 Ga0307411_102169132 59
104 3300032005 Ga0307411_10299717 Ga0307411_102997172 59
105 3300032005 Ga0307411_10488055 Ga0307411_104880552 59
106 3300032005 Ga0307411_11786241 Ga0307411_117862412 59
107 3300032005 Ga0307411_11854707 Ga0307411_118547072 59
108 3300032126 Ga0307415_100077652 Ga0307415_1000776523 59
109 3300032126 Ga0307415_100445461 Ga0307415_1004454612 59
110 3300032126 Ga0307415_100634423 Ga0307415_1006344232 59
111 3300035170 Ga0373943_0012285 Ga0373943_0012285_249_428 59
112 3300037068 Ga0373925_0001803 Ga0373925_0001803_6429_6608 59
113 3300037471 Ga0395905_0170538 Ga0395905_0170538_1705_1884 59
114 3300037853 Ga0436364_0824263 Ga0436364_0824263_138_317 59
115 3300041411 Ga0439466_0206085 Ga0439466_0206085_342_521 59
116 3300041413 Ga0439465_0014311 Ga0439465_0014311_2244_2423 59
117 3300041452 Ga0451793_1926393 Ga0451793_1926393_52_231 59
118 3300041458 Ga0451798_0838824 Ga0451798_0838824_383_562 59
119 3300041459 Ga0451800_0464072 Ga0451800_0464072_197_376 59
120 3300041460 Ga0451802_1476308 Ga0451802_1476308_430_609 59
121 3300041509 Ga0451843_1308798 Ga0451843_1308798_171_350 59
122 3300042002 Ga0439442_050511 Ga0439442_050511_533_712 59
123 3300042004 Ga0439445_0032864 Ga0439445_0032864_440_619 59
124 3300042004 Ga0439445_0179473 Ga0439445_0179473_49_228 59
125 3300044684 Ga0466966_0064946 Ga0466966_0064946_1609_1788 59
126 3300044693 Ga0466961_0119483 Ga0466961_0119483_689_868 59
127 3300044765 Ga0466970_0170236 Ga0466970_0170236_423_602 59
128 3300045049 Ga0466959_0195141 Ga0466959_0195141_824_1003 59
129 3300045836 Ga0466958_0445342 Ga0466958_0445342_184_363 59
130 3300046459 Ga0495629_0467504 Ga0495629_0467504_329_508 59
131 3300046475 Ga0495639_0329567 Ga0495639_0329567_284_463 59
132 3300046501 Ga0495607_0460828 Ga0495607_0460828_43_222 59
133 3300046683 Ga0495658_0067764 Ga0495658_0067764_641_820 59
134 3300046690 Ga0495624_0082628 Ga0495624_0082628_882_1061 59
135 3300048905 Ga0496102_0000034 Ga0496102_0000034_166399_166578 59
136 3300048906 Ga0496103_0000026 Ga0496103_0000026_166399_166578 59
137 3300048908 Ga0496105_0646552 Ga0496105_0646552_314_493 59
138 3300048911 Ga0496108_0252642 Ga0496108_0252642_14_193 59
139 3300048912 Ga0496109_0638925 Ga0496109_0638925_642_821 59
140 3300048919 Ga0496116_0002308 Ga0496116_0002308_10486_10665 59
141 3300048920 Ga0496117_0000072 Ga0496117_0000072_190939_191118 59
142 3300048921 Ga0496118_0000030 Ga0496118_0000030_47249_47428 59
143 3300048922 Ga0496119_0036947 Ga0496119_0036947_1401_1580 59
144 3300048924 Ga0496121_0539712 Ga0496121_0539712_501_680 59
145 3300048927 Ga0496124_0000061 Ga0496124_0000061_47249_47428 59
146 3300048929 Ga0496126_0026844 Ga0496126_0026844_1367_1546 59
147 3300048929 Ga0496126_0564777 Ga0496126_0564777_310_489 59
148 3300049130 Ga0501310_031570 Ga0501310_031570_291_470 59
149 3300049162 Ga0501307_044598 Ga0501307_044598_322_501 59
150 3300049527 Ga0501311_095454 Ga0501311_095454_257_436 59
151 3300049528 Ga0501312_087508 Ga0501312_087508_157_336 59
152 3300049531 Ga0501315_091535 Ga0501315_091535_90_269 59
153 3300049532 Ga0501316_072603 Ga0501316_072603_85_264 59
154 3300049533 Ga0501317_070626 Ga0501317_070626_347_526 59
155 3300049536 Ga0501320_069732 Ga0501320_069732_270_449 59
156 3300049537 Ga0501321_040259 Ga0501321_040259_257_436 59
157 3300049539 Ga0501323_070654 Ga0501323_070654_246_425 59
158 3300049549 Ga0501333_022213 Ga0501333_022213_87_266 59
159 3300049552 Ga0501336_026000 Ga0501336_026000_281_460 59
160 3300049556 Ga0501340_025454 Ga0501340_025454_239_418 59
161 3300049570 Ga0501033_0279467 Ga0501033_0279467_348_527 59
162 3300049571 Ga0501034_0001360 Ga0501034_0001360_61_240 59
163 3300049571 Ga0501034_0036387 Ga0501034_0036387_1390_1569 59
164 3300049571 Ga0501034_0273907 Ga0501034_0273907_1434_1613 59
165 3300049571 Ga0501034_0409635 Ga0501034_0409635_281_460 59
166 3300049571 Ga0501034_0917453 Ga0501034_0917453_371_550 59
167 3300049581 Ga0501047_0503412 Ga0501047_0503412_485_664 59
168 3300049661 Ga0501217_117316 Ga0501217_117316_334_513 59
169 3300049661 Ga0501217_260318 Ga0501217_260318_246_425 59
170 3300049663 Ga0501223_122000 Ga0501223_122000_147_326 59
171 3300049668 Ga0501233_181258 Ga0501233_181258_258_437 59
172 3300049669 Ga0501235_217132 Ga0501235_217132_95_274 59
173 3300049672 Ga0501239_071890 Ga0501239_071890_71_250 59
174 3300049673 Ga0501240_024707 Ga0501240_024707_177_356 59
175 3300049674 Ga0501242_086216 Ga0501242_086216_283_462 59
176 3300049675 Ga0501243_021746 Ga0501243_021746_518_697 59
177 3300049677 Ga0501247_035849 Ga0501247_035849_300_479 59
178 3300049681 Ga0501251_091380 Ga0501251_091380_73_252 59
179 3300049686 Ga0501257_146522 Ga0501257_146522_218_397 59
180 3300049705 Ga0501225_0306999 Ga0501225_0306999_179_358 59
181 3300049706 Ga0501229_048652 Ga0501229_048652_154_333 59
182 3300049707 Ga0501234_026341 Ga0501234_026341_604_783 59
183 3300049744 Ga0501083_0519070 Ga0501083_0519070_150_329 59
184 3300049758 Ga0501241_136699 Ga0501241_136699_31_210 59
185 3300049761 Ga0501264_044832 Ga0501264_044832_94_273 59
186 3300049764 Ga0501267_015401 Ga0501267_015401_551_730 59
187 3300049764 Ga0501267_019969 Ga0501267_019969_418_597 59
188 3300049765 Ga0501268_026257 Ga0501268_026257_680_859 59
189 3300049765 Ga0501268_162885 Ga0501268_162885_26_205 59
190 3300049769 Ga0501272_065843 Ga0501272_065843_215_394 59
191 3300049770 Ga0501273_041434 Ga0501273_041434_322_501 59
192 3300049822 Ga0501035_0037612 Ga0501035_0037612_2602_2781 59
193 3300049850 Ga0501204_071374 Ga0501204_071374_44_223 59
194 3300049851 Ga0501212_044071 Ga0501212_044071_247_426 59
195 3300053140 Ga0500573_0504641 Ga0500573_0504641_192_371 59
196 3300053142 Ga0500577_0267177 Ga0500577_0267177_136_315 59
197 3300053151 Ga0500604_0000092 Ga0500604_0000092_11031_11210 59
198 3300053151 Ga0500604_0283855 Ga0500604_0283855_92_271 59
199 3300061719 Ga0466962_0163736 Ga0466962_0163736_507_686 59
200 3300001979 JGI24740J21852_10082774 JGI24740J21852_100827742 60
201 3300001990 JGI24737J22298_10246203 JGI24737J22298_102462031 60
202 3300002067 JGI24735J21928_10121791 JGI24735J21928_101217912 60
203 3300003781 Ga0055536_1005132 Ga0055536_10051327 60
204 3300003781 Ga0055536_1005459 Ga0055536_10054596 60
205 3300003794 Ga0055531_10001759 Ga0055531_100017598 60
206 3300003794 Ga0055531_10033269 Ga0055531_100332692 60
207 3300005293 Ga0065715_10038113 Ga0065715_100381132 60
208 3300005327 Ga0070658_10037406 Ga0070658_100374066 60
209 3300005327 Ga0070658_10120646 Ga0070658_101206463 60
210 3300005327 Ga0070658_10230339 Ga0070658_102303392 60
211 3300005327 Ga0070658_11126232 Ga0070658_111262322 60
212 3300005327 Ga0070658_11245182 Ga0070658_112451821 60
213 3300005327 Ga0070658_11296796 Ga0070658_112967961 60
214 3300005327 Ga0070658_11897721 Ga0070658_118977211 60
215 3300005328 Ga0070676_10201527 Ga0070676_102015272 60
216 3300005329 Ga0070683_100239781 Ga0070683_1002397812 60
217 3300005329 Ga0070683_100501443 Ga0070683_1005014432 60
218 3300005331 Ga0070670_100000037 Ga0070670_10000003779 60
219 3300005331 Ga0070670_100097305 Ga0070670_1000973052 60
220 3300005331 Ga0070670_100114793 Ga0070670_1001147931 60
221 3300005331 Ga0070670_100239057 Ga0070670_1002390572 60
222 3300005331 Ga0070670_101031068 Ga0070670_1010310682 60
223 3300005334 Ga0068869_100670951 Ga0068869_1006709512 60
224 3300005335 Ga0070666_10156501 Ga0070666_101565012 60
225 3300005335 Ga0070666_10308471 Ga0070666_103084712 60
226 3300005335 Ga0070666_10623783 Ga0070666_106237832 60
227 3300005335 Ga0070666_11486998 Ga0070666_114869982 60
228 3300005336 Ga0070680_100028910 Ga0070680_1000289107 60
229 3300005336 Ga0070680_100063220 Ga0070680_1000632204 60
230 3300005336 Ga0070680_100592280 Ga0070680_1005922802 60
231 3300005336 Ga0070680_100719008 Ga0070680_1007190082 60
232 3300005337 Ga0070682_100201014 Ga0070682_1002010143 60
233 3300005338 Ga0068868_100054268 Ga0068868_1000542685 60
234 3300005339 Ga0070660_100049520 Ga0070660_1000495204 60
235 3300005339 Ga0070660_100062622 Ga0070660_1000626222 60
236 3300005339 Ga0070660_100632862 Ga0070660_1006328622 60
237 3300005341 Ga0070691_10006942 Ga0070691_100069425 60
238 3300005344 Ga0070661_100059856 Ga0070661_1000598563 60
239 3300005344 Ga0070661_100125177 Ga0070661_1001251772 60
240 3300005344 Ga0070661_100231753 Ga0070661_1002317532 60
241 3300005344 Ga0070661_100386980 Ga0070661_1003869803 60
242 3300005344 Ga0070661_100467090 Ga0070661_1004670902 60
243 3300005344 Ga0070661_100791305 Ga0070661_1007913051 60
244 3300005344 Ga0070661_101162213 Ga0070661_1011622132 60
245 3300005344 Ga0070661_101436225 Ga0070661_1014362251 60
246 3300005347 Ga0070668_100000097 Ga0070668_10000009740 60
247 3300005347 Ga0070668_100001398 Ga0070668_1000013987 60
248 3300005347 Ga0070668_100006261 Ga0070668_1000062616 60
249 3300005347 Ga0070668_100023971 Ga0070668_1000239714 60
250 3300005347 Ga0070668_100026662 Ga0070668_1000266622 60
251 3300005347 Ga0070668_100397774 Ga0070668_1003977742 60
252 3300005353 Ga0070669_100007690 Ga0070669_1000076905 60
253 3300005353 Ga0070669_100100055 Ga0070669_1001000552 60
254 3300005353 Ga0070669_101586422 Ga0070669_1015864221 60
255 3300005354 Ga0070675_101543746 Ga0070675_1015437461 60
256 3300005355 Ga0070671_100000342 Ga0070671_10000034235 60
257 3300005355 Ga0070671_100151193 Ga0070671_1001511933 60
258 3300005355 Ga0070671_100494765 Ga0070671_1004947652 60
259 3300005365 Ga0070688_101292261 Ga0070688_1012922611 60
260 3300005366 Ga0070659_100000206 Ga0070659_10000020643 60
261 3300005366 Ga0070659_100005903 Ga0070659_10000590310 60
262 3300005366 Ga0070659_100020949 Ga0070659_1000209494 60
263 3300005367 Ga0070667_100000083 Ga0070667_10000008379 60
264 3300005367 Ga0070667_100046049 Ga0070667_1000460492 60
265 3300005367 Ga0070667_100066504 Ga0070667_1000665042 60
266 3300005367 Ga0070667_100290300 Ga0070667_1002903001 60
267 3300005367 Ga0070667_101284997 Ga0070667_1012849972 60
268 3300005367 Ga0070667_101628249 Ga0070667_1016282491 60
269 3300005445 Ga0070708_101623113 Ga0070708_1016231131 60
270 3300005455 Ga0070663_100738339 Ga0070663_1007383392 60
271 3300005455 Ga0070663_100775075 Ga0070663_1007750751 60
272 3300005455 Ga0070663_100998649 Ga0070663_1009986492 60
273 3300005456 Ga0070678_100246264 Ga0070678_1002462641 60
274 3300005457 Ga0070662_100079996 Ga0070662_1000799962 60
275 3300005457 Ga0070662_100161703 Ga0070662_1001617032 60
276 3300005458 Ga0070681_10077685 Ga0070681_100776854 60
277 3300005458 Ga0070681_10101301 Ga0070681_101013013 60
278 3300005458 Ga0070681_10806527 Ga0070681_108065271 60
279 3300005459 Ga0068867_100243024 Ga0068867_1002430242 60
280 3300005530 Ga0070679_100003462 Ga0070679_10000346210 60
281 3300005530 Ga0070679_100882651 Ga0070679_1008826512 60
282 3300005530 Ga0070679_101115383 Ga0070679_1011153831 60
283 3300005535 Ga0070684_100106711 Ga0070684_1001067113 60
284 3300005535 Ga0070684_100858679 Ga0070684_1008586792 60
285 3300005535 Ga0070684_102357950 Ga0070684_1023579502 60
286 3300005539 Ga0068853_100028237 Ga0068853_1000282372 60
287 3300005539 Ga0068853_100177892 Ga0068853_1001778923 60
288 3300005539 Ga0068853_100296779 Ga0068853_1002967792 60
289 3300005539 Ga0068853_101504580 Ga0068853_1015045801 60
290 3300005546 Ga0070696_100893054 Ga0070696_1008930541 60
291 3300005547 Ga0070693_100138542 Ga0070693_1001385422 60
292 3300005548 Ga0070665_100000116 Ga0070665_10000011669 60
293 3300005548 Ga0070665_100000278 Ga0070665_10000027817 60
294 3300005548 Ga0070665_100000483 Ga0070665_10000048315 60
295 3300005548 Ga0070665_100042615 Ga0070665_1000426151 60
296 3300005548 Ga0070665_100100096 Ga0070665_1001000962 60
297 3300005548 Ga0070665_100205584 Ga0070665_1002055843 60
298 3300005548 Ga0070665_100442617 Ga0070665_1004426172 60
299 3300005548 Ga0070665_100706317 Ga0070665_1007063172 60
300 3300005548 Ga0070665_101617521 Ga0070665_1016175212 60
301 3300005548 Ga0070665_101697412 Ga0070665_1016974122 60
302 3300005549 Ga0070704_101661965 Ga0070704_1016619651 60
303 3300005563 Ga0068855_100114613 Ga0068855_1001146132 60
304 3300005563 Ga0068855_100164536 Ga0068855_1001645363 60
305 3300005563 Ga0068855_100227544 Ga0068855_1002275442 60
306 3300005563 Ga0068855_100361294 Ga0068855_1003612942 60
307 3300005563 Ga0068855_100510096 Ga0068855_1005100962 60
308 3300005563 Ga0068855_100604355 Ga0068855_1006043552 60
309 3300005563 Ga0068855_100643314 Ga0068855_1006433142 60
310 3300005563 Ga0068855_100903913 Ga0068855_1009039132 60
311 3300005564 Ga0070664_100032151 Ga0070664_1000321512 60
312 3300005564 Ga0070664_100128100 Ga0070664_1001281002 60
313 3300005564 Ga0070664_100539963 Ga0070664_1005399632 60
314 3300005564 Ga0070664_102348081 Ga0070664_1023480811 60
315 3300005577 Ga0068857_100008234 Ga0068857_1000082342 60
316 3300005577 Ga0068857_100310468 Ga0068857_1003104682 60
317 3300005577 Ga0068857_100596708 Ga0068857_1005967082 60
318 3300005577 Ga0068857_102119091 Ga0068857_1021190911 60
319 3300005578 Ga0068854_100011218 Ga0068854_1000112182 60
320 3300005578 Ga0068854_100704745 Ga0068854_1007047452 60
321 3300005578 Ga0068854_101008208 Ga0068854_1010082082 60
322 3300005614 Ga0068856_100017487 Ga0068856_1000174873 60
323 3300005614 Ga0068856_100242993 Ga0068856_1002429933 60
324 3300005614 Ga0068856_100641513 Ga0068856_1006415133 60
325 3300005614 Ga0068856_101010843 Ga0068856_1010108432 60
326 3300005614 Ga0068856_102376714 Ga0068856_1023767141 60
327 3300005616 Ga0068852_100019264 Ga0068852_1000192644 60
328 3300005616 Ga0068852_100073366 Ga0068852_1000733663 60
329 3300005616 Ga0068852_100144567 Ga0068852_1001445671 60
330 3300005616 Ga0068852_101508007 Ga0068852_1015080072 60
331 3300005617 Ga0068859_100000435 Ga0068859_10000043534 60
332 3300005617 Ga0068859_100049354 Ga0068859_1000493542 60
333 3300005617 Ga0068859_100183093 Ga0068859_1001830932 60
334 3300005617 Ga0068859_100814918 Ga0068859_1008149182 60
335 3300005617 Ga0068859_101423464 Ga0068859_1014234642 60
336 3300005618 Ga0068864_100000115 Ga0068864_10000011525 60
337 3300005618 Ga0068864_100000786 Ga0068864_10000078614 60
338 3300005618 Ga0068864_100026445 Ga0068864_1000264452 60
339 3300005618 Ga0068864_100555600 Ga0068864_1005556002 60
340 3300005618 Ga0068864_100680565 Ga0068864_1006805652 60
341 3300005618 Ga0068864_100892398 Ga0068864_1008923982 60
342 3300005718 Ga0068866_10942109 Ga0068866_109421092 60
343 3300005719 Ga0068861_100400550 Ga0068861_1004005502 60
344 3300005719 Ga0068861_100627849 Ga0068861_1006278492 60
345 3300005719 Ga0068861_100651681 Ga0068861_1006516812 60
346 3300005719 Ga0068861_100913917 Ga0068861_1009139172 60
347 3300005834 Ga0068851_10014841 Ga0068851_100148413 60
348 3300005834 Ga0068851_10616181 Ga0068851_106161811 60
349 3300005840 Ga0068870_10839108 Ga0068870_108391082 60
350 3300005841 Ga0068863_100000007 Ga0068863_100000007151 60
351 3300005841 Ga0068863_100000392 Ga0068863_1000003927 60
352 3300005841 Ga0068863_100014231 Ga0068863_1000142315 60
353 3300005841 Ga0068863_100079690 Ga0068863_1000796903 60
354 3300005841 Ga0068863_100131031 Ga0068863_1001310313 60
355 3300005841 Ga0068863_100597867 Ga0068863_1005978672 60
356 3300005841 Ga0068863_101267707 Ga0068863_1012677072 60
357 3300005842 Ga0068858_100000031 Ga0068858_10000003191 60
358 3300005842 Ga0068858_100003423 Ga0068858_1000034234 60
359 3300005842 Ga0068858_100004211 Ga0068858_1000042115 60
360 3300005842 Ga0068858_100275097 Ga0068858_1002750972 60
361 3300005842 Ga0068858_100639209 Ga0068858_1006392093 60
362 3300005843 Ga0068860_100000128 Ga0068860_10000012821 60
363 3300005843 Ga0068860_100000145 Ga0068860_10000014588 60
364 3300005843 Ga0068860_100045797 Ga0068860_1000457972 60
365 3300005843 Ga0068860_100108311 Ga0068860_1001083111 60
366 3300005843 Ga0068860_101369569 Ga0068860_1013695692 60
367 3300005843 Ga0068860_101726844 Ga0068860_1017268441 60
368 3300005844 Ga0068862_100001627 Ga0068862_1000016277 60
369 3300005844 Ga0068862_100007701 Ga0068862_1000077015 60
370 3300005844 Ga0068862_100022748 Ga0068862_1000227485 60
371 3300005844 Ga0068862_100063108 Ga0068862_1000631084 60
372 3300005844 Ga0068862_100063168 Ga0068862_1000631682 60
373 3300005844 Ga0068862_100272019 Ga0068862_1002720192 60
374 3300005844 Ga0068862_100835632 Ga0068862_1008356322 60
375 3300006028 Ga0070717_11305739 Ga0070717_113057392 60
376 3300006042 Ga0075368_10002625 Ga0075368_100026252 60
377 3300006042 Ga0075368_10088106 Ga0075368_100881062 60
378 3300006042 Ga0075368_10281896 Ga0075368_102818961 60
379 3300006048 Ga0075363_100026589 Ga0075363_1000265894 60
380 3300006048 Ga0075363_100047395 Ga0075363_1000473952 60
381 3300006048 Ga0075363_100378161 Ga0075363_1003781611 60
382 3300006051 Ga0075364_10003475 Ga0075364_100034756 60
383 3300006177 Ga0075362_10009435 Ga0075362_100094354 60
384 3300006178 Ga0075367_10005360 Ga0075367_100053606 60
385 3300006178 Ga0075367_10882675 Ga0075367_108826752 60
386 3300006186 Ga0075369_10283175 Ga0075369_102831752 60
387 3300006186 Ga0075369_10486736 Ga0075369_104867362 60
388 3300006195 Ga0075366_10022416 Ga0075366_100224165 60
389 3300006195 Ga0075366_10030071 Ga0075366_100300712 60
390 3300006195 Ga0075366_10375640 Ga0075366_103756402 60
391 3300006237 Ga0097621_100309224 Ga0097621_1003092243 60
392 3300006237 Ga0097621_100910367 Ga0097621_1009103671 60
393 3300006353 Ga0075370_10013637 Ga0075370_100136375 60
394 3300006353 Ga0075370_10337651 Ga0075370_103376512 60
395 3300006353 Ga0075370_10700728 Ga0075370_107007281 60
396 3300006353 Ga0075370_10708620 Ga0075370_107086201 60
397 3300006358 Ga0068871_100383643 Ga0068871_1003836432 60
398 3300006358 Ga0068871_100892381 Ga0068871_1008923812 60
399 3300006881 Ga0068865_100004059 Ga0068865_10000405910 60
400 3300006931 Ga0097620_100000435 Ga0097620_10000043534 60
401 3300006931 Ga0097620_100049353 Ga0097620_1000493532 60
402 3300006931 Ga0097620_100183098 Ga0097620_1001830982 60
403 3300006931 Ga0097620_100814973 Ga0097620_1008149731 60
404 3300006931 Ga0097620_101423286 Ga0097620_1014232862 60
405 3300006946 Ga0079104_1030697 Ga0079104_10306972 60
406 3300009093 Ga0105240_10043434 Ga0105240_100434346 60
407 3300009093 Ga0105240_10073611 Ga0105240_100736115 60
408 3300009093 Ga0105240_10076980 Ga0105240_100769804 60
409 3300009093 Ga0105240_10081004 Ga0105240_100810044 60
410 3300009093 Ga0105240_10104804 Ga0105240_101048045 60
411 3300009093 Ga0105240_11361855 Ga0105240_113618551 60
412 3300009093 Ga0105240_12454470 Ga0105240_124544702 60
413 3300009098 Ga0105245_11822568 Ga0105245_118225682 60
414 3300009101 Ga0105247_10168493 Ga0105247_101684932 60
415 3300009101 Ga0105247_10515003 Ga0105247_105150032 60
416 3300009174 Ga0105241_10863091 Ga0105241_108630912 60
417 3300009174 Ga0105241_11400609 Ga0105241_114006092 60
418 3300009176 Ga0105242_10055341 Ga0105242_100553414 60
419 3300009176 Ga0105242_13164752 Ga0105242_131647522 60
420 3300009177 Ga0105248_10007787 Ga0105248_100077879 60
421 3300009177 Ga0105248_10038574 Ga0105248_100385742 60
422 3300009177 Ga0105248_10041310 Ga0105248_100413105 60
423 3300009177 Ga0105248_10082220 Ga0105248_100822202 60
424 3300009177 Ga0105248_10102723 Ga0105248_101027231 60
425 3300009177 Ga0105248_10286371 Ga0105248_102863712 60
426 3300009177 Ga0105248_10543159 Ga0105248_105431592 60
427 3300009177 Ga0105248_10626607 Ga0105248_106266072 60
428 3300009177 Ga0105248_11541333 Ga0105248_115413332 60
429 3300009545 Ga0105237_11020032 Ga0105237_110200322 60
430 3300009551 Ga0105238_10026734 Ga0105238_100267346 60
431 3300009551 Ga0105238_10087665 Ga0105238_100876654 60
432 3300009551 Ga0105238_10191222 Ga0105238_101912223 60
433 3300009551 Ga0105238_10367629 Ga0105238_103676293 60
434 3300009551 Ga0105238_11067770 Ga0105238_110677702 60
435 3300009551 Ga0105238_11394847 Ga0105238_113948472 60
436 3300009551 Ga0105238_12188600 Ga0105238_121886001 60
437 3300009553 Ga0105249_10000410 Ga0105249_1000041044 60
438 3300009553 Ga0105249_10115487 Ga0105249_101154874 60
439 3300010375 Ga0105239_10288771 Ga0105239_102887712 60
440 3300010375 Ga0105239_10464722 Ga0105239_104647222 60
441 3300010375 Ga0105239_11367739 Ga0105239_113677391 60
442 3300010375 Ga0105239_12009977 Ga0105239_120099771 60
443 3300013102 Ga0157371_10032519 Ga0157371_100325192 60
444 3300013102 Ga0157371_10205940 Ga0157371_102059402 60
445 3300013102 Ga0157371_10504488 Ga0157371_105044882 60
446 3300013104 Ga0157370_10026878 Ga0157370_100268784 60
447 3300013104 Ga0157370_10198035 Ga0157370_101980353 60
448 3300013104 Ga0157370_10218409 Ga0157370_102184092 60
449 3300013104 Ga0157370_10244147 Ga0157370_102441471 60
450 3300013105 Ga0157369_10291159 Ga0157369_102911591 60
451 3300013105 Ga0157369_10295251 Ga0157369_102952513 60
452 3300013105 Ga0157369_11019070 Ga0157369_110190702 60
453 3300013296 Ga0157374_10174233 Ga0157374_101742332 60
454 3300013296 Ga0157374_10471786 Ga0157374_104717862 60
455 3300013297 Ga0157378_10757173 Ga0157378_107571732 60
456 3300013297 Ga0157378_11139770 Ga0157378_111397702 60
457 3300013306 Ga0163162_10027619 Ga0163162_100276192 60
458 3300013306 Ga0163162_10063898 Ga0163162_100638982 60
459 3300013306 Ga0163162_10619135 Ga0163162_106191354 60
460 3300013306 Ga0163162_10710773 Ga0163162_107107732 60
461 3300013306 Ga0163162_12092666 Ga0163162_120926662 60
462 3300013307 Ga0157372_10056762 Ga0157372_100567626 60
463 3300013307 Ga0157372_10286129 Ga0157372_102861293 60
464 3300013307 Ga0157372_11097531 Ga0157372_110975312 60
465 3300013307 Ga0157372_11248851 Ga0157372_112488512 60
466 3300014325 Ga0163163_10033603 Ga0163163_100336035 60
467 3300014325 Ga0163163_10072795 Ga0163163_100727955 60
468 3300014325 Ga0163163_10313723 Ga0163163_103137232 60
469 3300014325 Ga0163163_11233002 Ga0163163_112330022 60
470 3300014325 Ga0163163_11558363 Ga0163163_115583632 60
471 3300014325 Ga0163163_13014387 Ga0163163_130143871 60
472 3300014326 Ga0157380_10952059 Ga0157380_109520592 60
473 3300014326 Ga0157380_11914231 Ga0157380_119142312 60
474 3300014497 Ga0182008_10269253 Ga0182008_102692532 60
475 3300014745 Ga0157377_11208318 Ga0157377_112083181 60
476 3300014968 Ga0157379_10007276 Ga0157379_100072766 60
477 3300014968 Ga0157379_10080776 Ga0157379_100807762 60
478 3300014968 Ga0157379_10187762 Ga0157379_101877622 60
479 3300014968 Ga0157379_10482129 Ga0157379_104821292 60
480 3300014968 Ga0157379_11119088 Ga0157379_111190882 60
481 3300014969 Ga0157376_10470617 Ga0157376_104706172 60
482 3300014969 Ga0157376_10519222 Ga0157376_105192222 60
483 3300014969 Ga0157376_10792822 Ga0157376_107928221 60
484 3300015684 Ga0183365_10002 Ga0183365_10002255 60
485 3300017792 Ga0163161_10344065 Ga0163161_103440652 60
486 3300017792 Ga0163161_11364776 Ga0163161_113647762 60
487 3300020076 Ga0206355_1455122 Ga0206355_14551221 60
488 3300020081 Ga0206354_10432311 Ga0206354_104323112 60
489 3300021384 Ga0213876_10035545 Ga0213876_100355452 60
490 3300025250 Ga0209026_1009684 Ga0209026_10096844 60
491 3300025254 Ga0209148_1026954 Ga0209148_10269542 60
492 3300025261 Ga0209233_1072761 Ga0209233_10727612 60
493 3300025263 Ga0209565_1000641 Ga0209565_100064119 60
494 3300025272 Ga0209455_1017988 Ga0209455_10179882 60
495 3300025273 Ga0209673_1000523 Ga0209673_100052360 60
496 3300025292 Ga0209676_1000057 Ga0209676_10000575 60
497 3300025292 Ga0209676_1000061 Ga0209676_1000061165 60
498 3300025292 Ga0209676_1000679 Ga0209676_10006797 60
499 3300025298 Ga0209050_1013814 Ga0209050_10138142 60
500 3300025298 Ga0209050_1014339 Ga0209050_10143394 60
501 3300025298 Ga0209050_1017660 Ga0209050_10176602 60
502 3300025298 Ga0209050_1062943 Ga0209050_10629433 60
503 3300025299 Ga0209256_1002428 Ga0209256_100242810 60
504 3300025299 Ga0209256_1012333 Ga0209256_10123332 60
505 3300025303 Ga0209051_1014576 Ga0209051_10145764 60
506 3300025304 Ga0209257_1000199 Ga0209257_1000199152 60
507 3300025304 Ga0209257_1000944 Ga0209257_100094415 60
508 3300025304 Ga0209257_1047759 Ga0209257_10477592 60
509 3300025321 Ga0207656_10077523 Ga0207656_100775233 60
510 3300025321 Ga0207656_10507384 Ga0207656_105073842 60
511 3300025711 Ga0207696_1034957 Ga0207696_10349572 60
512 3300025900 Ga0207710_10224133 Ga0207710_102241332 60
513 3300025903 Ga0207680_10109945 Ga0207680_101099452 60
514 3300025903 Ga0207680_10618778 Ga0207680_106187782 60
515 3300025907 Ga0207645_10171016 Ga0207645_101710162 60
516 3300025908 Ga0207643_10960303 Ga0207643_109603031 60
517 3300025909 Ga0207705_10007993 Ga0207705_100079937 60
518 3300025909 Ga0207705_10089421 Ga0207705_100894212 60
519 3300025909 Ga0207705_10098335 Ga0207705_100983353 60
520 3300025909 Ga0207705_10428991 Ga0207705_104289911 60
521 3300025909 Ga0207705_10819447 Ga0207705_108194472 60
522 3300025911 Ga0207654_10329634 Ga0207654_103296341 60
523 3300025911 Ga0207654_10602770 Ga0207654_106027702 60
524 3300025911 Ga0207654_10829254 Ga0207654_108292542 60
525 3300025911 Ga0207654_11338738 Ga0207654_113387382 60
526 3300025912 Ga0207707_10016260 Ga0207707_100162602 60
527 3300025912 Ga0207707_10050471 Ga0207707_100504714 60
528 3300025912 Ga0207707_10202302 Ga0207707_102023023 60
529 3300025913 Ga0207695_10001670 Ga0207695_1000167033 60
530 3300025913 Ga0207695_10001727 Ga0207695_1000172737 60
531 3300025913 Ga0207695_10015061 Ga0207695_1001506110 60
532 3300025913 Ga0207695_10018020 Ga0207695_100180205 60
533 3300025913 Ga0207695_10021597 Ga0207695_100215978 60
534 3300025913 Ga0207695_11213074 Ga0207695_112130742 60
535 3300025913 Ga0207695_11313748 Ga0207695_113137482 60
536 3300025913 Ga0207695_11755744 Ga0207695_117557442 60
537 3300025914 Ga0207671_10102970 Ga0207671_101029703 60
538 3300025914 Ga0207671_10247897 Ga0207671_102478973 60
539 3300025916 Ga0207663_10524440 Ga0207663_105244402 60
540 3300025917 Ga0207660_10111031 Ga0207660_101110313 60
541 3300025917 Ga0207660_10129788 Ga0207660_101297884 60
542 3300025917 Ga0207660_10495248 Ga0207660_104952482 60
543 3300025917 Ga0207660_11279587 Ga0207660_112795871 60
544 3300025919 Ga0207657_10012251 Ga0207657_1001225110 60
545 3300025919 Ga0207657_10023890 Ga0207657_100238904 60
546 3300025919 Ga0207657_10120748 Ga0207657_101207481 60
547 3300025919 Ga0207657_10626768 Ga0207657_106267682 60
548 3300025920 Ga0207649_10090983 Ga0207649_100909832 60
549 3300025920 Ga0207649_10108801 Ga0207649_101088013 60
550 3300025920 Ga0207649_10128000 Ga0207649_101280002 60
551 3300025920 Ga0207649_10571109 Ga0207649_105711092 60
552 3300025920 Ga0207649_10892428 Ga0207649_108924282 60
553 3300025921 Ga0207652_10024709 Ga0207652_100247091 60
554 3300025921 Ga0207652_10592795 Ga0207652_105927952 60
555 3300025923 Ga0207681_10069475 Ga0207681_100694752 60
556 3300025924 Ga0207694_10051518 Ga0207694_100515183 60
557 3300025924 Ga0207694_10635561 Ga0207694_106355612 60
558 3300025924 Ga0207694_10661738 Ga0207694_106617382 60
559 3300025924 Ga0207694_11307309 Ga0207694_113073092 60
560 3300025925 Ga0207650_10000062 Ga0207650_1000006211 60
561 3300025925 Ga0207650_10019108 Ga0207650_100191083 60
562 3300025925 Ga0207650_10023019 Ga0207650_100230195 60
563 3300025925 Ga0207650_10190641 Ga0207650_101906412 60
564 3300025926 Ga0207659_10681360 Ga0207659_106813601 60
565 3300025927 Ga0207687_10168182 Ga0207687_101681821 60
566 3300025927 Ga0207687_11292381 Ga0207687_112923811 60
567 3300025927 Ga0207687_11345682 Ga0207687_113456822 60
568 3300025931 Ga0207644_10002578 Ga0207644_100025789 60
569 3300025931 Ga0207644_10088031 Ga0207644_100880314 60
570 3300025931 Ga0207644_10677595 Ga0207644_106775952 60
571 3300025932 Ga0207690_10000129 Ga0207690_1000012923 60
572 3300025932 Ga0207690_10514721 Ga0207690_105147212 60
573 3300025932 Ga0207690_10895278 Ga0207690_108952782 60
574 3300025932 Ga0207690_11293884 Ga0207690_112938841 60
575 3300025933 Ga0207706_10032271 Ga0207706_100322715 60
576 3300025933 Ga0207706_10145037 Ga0207706_101450372 60
577 3300025933 Ga0207706_10433526 Ga0207706_104335262 60
578 3300025934 Ga0207686_10025144 Ga0207686_100251444 60
579 3300025938 Ga0207704_10000400 Ga0207704_100004009 60
580 3300025941 Ga0207711_10000887 Ga0207711_1000088724 60
581 3300025941 Ga0207711_10022877 Ga0207711_100228776 60
582 3300025941 Ga0207711_10024435 Ga0207711_100244352 60
583 3300025941 Ga0207711_10034735 Ga0207711_100347352 60
584 3300025941 Ga0207711_10035994 Ga0207711_100359944 60
585 3300025941 Ga0207711_10057489 Ga0207711_100574892 60
586 3300025941 Ga0207711_10106029 Ga0207711_101060291 60
587 3300025941 Ga0207711_10901018 Ga0207711_109010181 60
588 3300025944 Ga0207661_10153261 Ga0207661_101532612 60
589 3300025944 Ga0207661_11015844 Ga0207661_110158441 60
590 3300025944 Ga0207661_11223831 Ga0207661_112238312 60
591 3300025944 Ga0207661_11609772 Ga0207661_116097722 60
592 3300025945 Ga0207679_10035890 Ga0207679_100358905 60
593 3300025945 Ga0207679_10107222 Ga0207679_101072222 60
594 3300025945 Ga0207679_10159436 Ga0207679_101594365 60
595 3300025949 Ga0207667_10043300 Ga0207667_100433001 60
596 3300025949 Ga0207667_10067953 Ga0207667_100679534 60
597 3300025949 Ga0207667_10110987 Ga0207667_101109873 60
598 3300025949 Ga0207667_10180291 Ga0207667_101802914 60
599 3300025949 Ga0207667_10459767 Ga0207667_104597671 60
600 3300025949 Ga0207667_10473609 Ga0207667_104736092 60
601 3300025949 Ga0207667_10803398 Ga0207667_108033982 60
602 3300025949 Ga0207667_11317066 Ga0207667_113170661 60
603 3300025949 Ga0207667_11558665 Ga0207667_115586651 60
604 3300025960 Ga0207651_11073139 Ga0207651_110731391 60
605 3300025961 Ga0207712_10001004 Ga0207712_1000100411 60
606 3300025972 Ga0207668_10000028 Ga0207668_1000002861 60
607 3300025972 Ga0207668_10000507 Ga0207668_100005079 60
608 3300025972 Ga0207668_10001494 Ga0207668_100014947 60
609 3300025972 Ga0207668_10005956 Ga0207668_100059569 60
610 3300025972 Ga0207668_10010307 Ga0207668_100103073 60
611 3300025972 Ga0207668_10045259 Ga0207668_100452594 60
612 3300025972 Ga0207668_11267022 Ga0207668_112670222 60
613 3300025981 Ga0207640_10120452 Ga0207640_101204523 60
614 3300025981 Ga0207640_10538390 Ga0207640_105383902 60
615 3300025981 Ga0207640_10720827 Ga0207640_107208273 60
616 3300025981 Ga0207640_11353579 Ga0207640_113535792 60
617 3300025986 Ga0207658_10000209 Ga0207658_1000020942 60
618 3300025986 Ga0207658_10013446 Ga0207658_100134463 60
619 3300025986 Ga0207658_10019362 Ga0207658_100193622 60
620 3300025986 Ga0207658_10063310 Ga0207658_100633102 60
621 3300025986 Ga0207658_10238788 Ga0207658_102387883 60
622 3300026023 Ga0207677_10083680 Ga0207677_100836802 60
623 3300026023 Ga0207677_10484827 Ga0207677_104848271 60
624 3300026035 Ga0207703_10000038 Ga0207703_1000003896 60
625 3300026035 Ga0207703_10039636 Ga0207703_100396365 60
626 3300026035 Ga0207703_10595679 Ga0207703_105956792 60
627 3300026035 Ga0207703_10664568 Ga0207703_106645681 60
628 3300026041 Ga0207639_10025186 Ga0207639_100251867 60
629 3300026041 Ga0207639_10109120 Ga0207639_101091204 60
630 3300026041 Ga0207639_10260073 Ga0207639_102600732 60
631 3300026041 Ga0207639_10355587 Ga0207639_103555872 60
632 3300026041 Ga0207639_10903399 Ga0207639_109033991 60
633 3300026041 Ga0207639_11070835 Ga0207639_110708351 60
634 3300026041 Ga0207639_11684718 Ga0207639_116847182 60
635 3300026067 Ga0207678_10128637 Ga0207678_101286372 60
636 3300026067 Ga0207678_10157011 Ga0207678_101570112 60
637 3300026067 Ga0207678_10353395 Ga0207678_103533952 60
638 3300026067 Ga0207678_10874277 Ga0207678_108742772 60
639 3300026075 Ga0207708_11789061 Ga0207708_117890611 60
640 3300026078 Ga0207702_10160682 Ga0207702_101606822 60
641 3300026078 Ga0207702_10270259 Ga0207702_102702592 60
642 3300026078 Ga0207702_10535492 Ga0207702_105354921 60
643 3300026078 Ga0207702_11390768 Ga0207702_113907682 60
644 3300026078 Ga0207702_11535613 Ga0207702_115356132 60
645 3300026088 Ga0207641_10000012 Ga0207641_10000012158 60
646 3300026088 Ga0207641_10000341 Ga0207641_1000034123 60
647 3300026088 Ga0207641_10017703 Ga0207641_100177034 60
648 3300026088 Ga0207641_10241261 Ga0207641_102412612 60
649 3300026088 Ga0207641_10377996 Ga0207641_103779963 60
650 3300026088 Ga0207641_11101932 Ga0207641_111019321 60
651 3300026089 Ga0207648_10014268 Ga0207648_100142686 60
652 3300026089 Ga0207648_11500664 Ga0207648_115006641 60
653 3300026089 Ga0207648_12061243 Ga0207648_120612431 60
654 3300026095 Ga0207676_10000255 Ga0207676_1000025521 60
655 3300026095 Ga0207676_10000797 Ga0207676_1000079715 60
656 3300026095 Ga0207676_10005948 Ga0207676_100059487 60
657 3300026095 Ga0207676_10417656 Ga0207676_104176562 60
658 3300026095 Ga0207676_10671535 Ga0207676_106715352 60
659 3300026095 Ga0207676_12038615 Ga0207676_120386151 60
660 3300026116 Ga0207674_10009842 Ga0207674_100098422 60
661 3300026116 Ga0207674_10082106 Ga0207674_100821062 60
662 3300026116 Ga0207674_10242139 Ga0207674_102421392 60
663 3300026116 Ga0207674_10439688 Ga0207674_104396882 60
664 3300026116 Ga0207674_10717466 Ga0207674_107174662 60
665 3300026118 Ga0207675_100070063 Ga0207675_1000700634 60
666 3300026118 Ga0207675_100536319 Ga0207675_1005363192 60
667 3300026118 Ga0207675_100625164 Ga0207675_1006251641 60
668 3300026121 Ga0207683_10189655 Ga0207683_101896553 60
669 3300026121 Ga0207683_11446344 Ga0207683_114463442 60
670 3300026142 Ga0207698_10070086 Ga0207698_100700864 60
671 3300026142 Ga0207698_10291534 Ga0207698_102915341 60
672 3300026142 Ga0207698_10602913 Ga0207698_106029132 60
673 3300026142 Ga0207698_11110804 Ga0207698_111108041 60
674 3300026142 Ga0207698_11319785 Ga0207698_113197852 60
675 3300026142 Ga0207698_11549291 Ga0207698_115492912 60
676 3300026142 Ga0207698_11691079 Ga0207698_116910792 60
677 3300026142 Ga0207698_12060132 Ga0207698_120601322 60
678 3300026142 Ga0207698_12118962 Ga0207698_121189622 60
679 3300026142 Ga0207698_12588170 Ga0207698_125881701 60
680 3300027111 Ga0209281_1023777 Ga0209281_10237772 60
681 3300027665 Ga0209983_1113472 Ga0209983_11134721 60
682 3300027695 Ga0209966_1072905 Ga0209966_10729052 60
683 3300027866 Ga0209813_10147252 Ga0209813_101472522 60
684 3300027866 Ga0209813_10303949 Ga0209813_103039492 60
685 3300027866 Ga0209813_10337275 Ga0209813_103372751 60
686 3300028379 Ga0268266_10000064 Ga0268266_10000064175 60
687 3300028379 Ga0268266_10000792 Ga0268266_1000079239 60
688 3300028379 Ga0268266_10001340 Ga0268266_1000134015 60
689 3300028379 Ga0268266_10096119 Ga0268266_100961192 60
690 3300028379 Ga0268266_10161086 Ga0268266_101610862 60
691 3300028379 Ga0268266_10728634 Ga0268266_107286343 60
692 3300028380 Ga0268265_10004003 Ga0268265_1000400310 60
693 3300028380 Ga0268265_10005054 Ga0268265_100050546 60
694 3300028380 Ga0268265_10016564 Ga0268265_100165644 60
695 3300028380 Ga0268265_10044261 Ga0268265_100442613 60
696 3300028380 Ga0268265_10096703 Ga0268265_100967031 60
697 3300028380 Ga0268265_10450092 Ga0268265_104500922 60
698 3300028380 Ga0268265_11537479 Ga0268265_115374792 60
699 3300028381 Ga0268264_10000046 Ga0268264_10000046137 60
700 3300028381 Ga0268264_10000059 Ga0268264_10000059231 60
701 3300028381 Ga0268264_10016967 Ga0268264_100169675 60
702 3300028381 Ga0268264_10028586 Ga0268264_100285865 60
703 3300028573 Ga0265334_10134763 Ga0265334_101347632 60
704 3300028786 Ga0307517_10000497 Ga0307517_1000049721 60
705 3300028786 Ga0307517_10082691 Ga0307517_100826912 60
706 3300028786 Ga0307517_10488538 Ga0307517_104885381 60
707 3300028786 Ga0307517_10602099 Ga0307517_106020992 60
708 3300028794 Ga0307515_10054933 Ga0307515_100549332 60
709 3300028794 Ga0307515_10066345 Ga0307515_100663453 60
710 3300028800 Ga0265338_10018457 Ga0265338_100184575 60
711 3300028800 Ga0265338_10044345 Ga0265338_100443453 60
712 3300028800 Ga0265338_10083238 Ga0265338_100832382 60
713 3300030521 Ga0307511_10014914 Ga0307511_100149145 60
714 3300030742 Ga0316183_1171265 Ga0316183_11712652 60
715 3300031090 Ga0265760_10086106 Ga0265760_100861063 60
716 3300031235 Ga0265330_10035499 Ga0265330_100354994 60
717 3300031238 Ga0265332_10052946 Ga0265332_100529462 60
718 3300031241 Ga0265325_10002041 Ga0265325_100020412 60
719 3300031242 Ga0265329_10024932 Ga0265329_100249324 60
720 3300031247 Ga0265340_10095632 Ga0265340_100956322 60
721 3300031249 Ga0265339_10003193 Ga0265339_100031936 60
722 3300031251 Ga0265327_10018935 Ga0265327_100189355 60
723 3300031251 Ga0265327_10083111 Ga0265327_100831113 60
724 3300031344 Ga0265316_10008753 Ga0265316_100087539 60
725 3300031456 Ga0307513_10000448 Ga0307513_1000044822 60
726 3300031456 Ga0307513_10009333 Ga0307513_100093337 60
727 3300031456 Ga0307513_10507243 Ga0307513_105072432 60
728 3300031456 Ga0307513_10659130 Ga0307513_106591302 60
729 3300031548 Ga0307408_100350310 Ga0307408_1003503102 60
730 3300031595 Ga0265313_10000070 Ga0265313_1000007043 60
731 3300031616 Ga0307508_10404734 Ga0307508_104047341 60
732 3300031711 Ga0265314_10104086 Ga0265314_101040862 60
733 3300031711 Ga0265314_10380713 Ga0265314_103807132 60
734 3300031712 Ga0265342_10243688 Ga0265342_102436882 60
735 3300031730 Ga0307516_10000004 Ga0307516_10000004343 60
736 3300031731 Ga0307405_10215905 Ga0307405_102159052 60
737 3300031889 Ga0326468_10100846 Ga0326468_101008461 60
738 3300031901 Ga0307406_10000538 Ga0307406_100005387 60
739 3300031901 Ga0307406_10040954 Ga0307406_100409545 60
740 3300031901 Ga0307406_10668542 Ga0307406_106685422 60
741 3300031903 Ga0307407_10690478 Ga0307407_106904781 60
742 3300031911 Ga0307412_11077282 Ga0307412_110772821 60
743 3300032004 Ga0307414_10033620 Ga0307414_100336203 60
744 3300032004 Ga0307414_10646652 Ga0307414_106466522 60
745 3300032004 Ga0307414_10868743 Ga0307414_108687432 60
746 3300032004 Ga0307414_10986504 Ga0307414_109865041 60
747 3300032004 Ga0307414_11207139 Ga0307414_112071392 60
748 3300032005 Ga0307411_10475053 Ga0307411_104750532 60
749 3300032005 Ga0307411_10884389 Ga0307411_108843892 60
750 3300032126 Ga0307415_101022557 Ga0307415_1010225571 60
751 3300032126 Ga0307415_101377245 Ga0307415_1013772452 60
752 3300033180 Ga0307510_10013265 Ga0307510_100132657 60
753 3300034817 Ga0373948_0056544 Ga0373948_0056544_485_667 60
754 3300034957 Ga0373938_0011096 Ga0373938_0011096_455_637 60
755 3300035083 Ga0373926_0053000 Ga0373926_0053000_1117_1299 60
756 3300035084 Ga0373928_0135085 Ga0373928_0135085_255_437 60
757 3300035089 Ga0373944_0011172 Ga0373944_0011172_2226_2408 60
758 3300035090 Ga0373949_0176121 Ga0373949_0176121_130_312 60
759 3300035113 Ga0373936_0000998 Ga0373936_0000998_9139_9321 60
760 3300035113 Ga0373936_0423306 Ga0373936_0423306_90_272 60
761 3300035114 Ga0373939_0055238 Ga0373939_0055238_337_519 60
762 3300035115 Ga0373941_0296226 Ga0373941_0296226_197_379 60
763 3300035121 Ga0373960_0183253 Ga0373960_0183253_224_406 60
764 3300035170 Ga0373943_0035963 Ga0373943_0035963_247_429 60
765 3300035171 Ga0373946_0358210 Ga0373946_0358210_58_240 60
766 3300035207 Ga0373942_0027587 Ga0373942_0027587_493_675 60
767 3300035207 Ga0373942_0088421 Ga0373942_0088421_486_668 60
768 3300035242 Ga0373962_0248339 Ga0373962_0248339_233_415 60
769 3300035691 Ga0373931_0615884 Ga0373931_0615884_458_640 60
770 3300035691 Ga0373931_1206254 Ga0373931_1206254_98_280 60
771 3300035692 Ga0373935_0296207 Ga0373935_0296207_282_464 60
772 3300035695 Ga0373927_0001126 Ga0373927_0001126_16994_17176 60
773 3300035725 Ga0373947_0643298 Ga0373947_0643298_394_576 60
774 3300037068 Ga0373925_0000061 Ga0373925_0000061_4946_5128 60
775 3300037068 Ga0373925_1495618 Ga0373925_1495618_327_509 60
776 3300037312 Ga0395899_0041622 Ga0395899_0041622_2379_2561 60
777 3300037312 Ga0395899_0206782 Ga0395899_0206782_1005_1187 60
778 3300037312 Ga0395899_0919648 Ga0395899_0919648_301_483 60
779 3300037418 Ga0395900_0334425 Ga0395900_0334425_921_1103 60
780 3300037418 Ga0395900_0339027 Ga0395900_0339027_1158_1340 60
781 3300037418 Ga0395900_0889358 Ga0395900_0889358_245_427 60
782 3300037418 Ga0395900_0962807 Ga0395900_0962807_388_570 60
783 3300037418 Ga0395900_1156084 Ga0395900_1156084_446_628 60
784 3300037466 Ga0395898_0069290 Ga0395898_0069290_425_607 60
785 3300037466 Ga0395898_0087345 Ga0395898_0087345_114_296 60
786 3300037466 Ga0395898_1518276 Ga0395898_1518276_24_206 60
787 3300037471 Ga0395905_0009297 Ga0395905_0009297_4593_4775 60
788 3300037471 Ga0395905_0104518 Ga0395905_0104518_1744_1926 60
789 3300037471 Ga0395905_1217762 Ga0395905_1217762_119_301 60
790 3300037853 Ga0436364_0183155 Ga0436364_0183155_394_576 60
791 3300038443 Ga0395901_0149762 Ga0395901_0149762_1247_1429 60
792 3300038443 Ga0395901_0471972 Ga0395901_0471972_815_997 60
793 3300038443 Ga0395901_0989624 Ga0395901_0989624_83_265 60
794 3300038443 Ga0395901_1329362 Ga0395901_1329362_243_425 60
795 3300039437 Ga0436365_0029920 Ga0436365_0029920_2588_2770 60
796 3300039437 Ga0436365_0073009 Ga0436365_0073009_272_454 60
797 3300039437 Ga0436365_0306093 Ga0436365_0306093_264_446 60
798 3300039437 Ga0436365_1750735 Ga0436365_1750735_1531_1713 60
799 3300039438 Ga0436360_0227752 Ga0436360_0227752_959_1141 60
800 3300041410 Ga0439461_0155082 Ga0439461_0155082_85_267 60
801 3300041452 Ga0451793_0361570 Ga0451793_0361570_86_268 60
802 3300041456 Ga0451795_0925728 Ga0451795_0925728_186_368 60
803 3300041505 Ga0451849_0020168 Ga0451849_0020168_258_440 60
804 3300041512 Ga0451853_3393834 Ga0451853_3393834_27_209 60
805 3300042006 Ga0439432_158478 Ga0439432_158478_350_532 60
806 3300044842 Ga0466957_1387097 Ga0466957_1387097_80_262 60
807 3300045836 Ga0466958_0524950 Ga0466958_0524950_43_225 60
808 3300046457 Ga0495590_0261925 Ga0495590_0261925_174_356 60
809 3300046459 Ga0495629_0047462 Ga0495629_0047462_449_631 60
810 3300046472 Ga0495580_0820505 Ga0495580_0820505_355_537 60
811 3300046492 Ga0495585_0119277 Ga0495585_0119277_582_764 60
812 3300046492 Ga0495585_0313985 Ga0495585_0313985_155_337 60
813 3300046506 Ga0495583_0127457 Ga0495583_0127457_337_519 60
814 3300046512 Ga0495610_0047010 Ga0495610_0047010_1923_2105 60
815 3300046515 Ga0495620_0062173 Ga0495620_0062173_540_722 60
816 3300046516 Ga0495628_0966973 Ga0495628_0966973_189_371 60
817 3300046517 Ga0495630_1125977 Ga0495630_1125977_223_405 60
818 3300046518 Ga0495631_0200675 Ga0495631_0200675_293_475 60
819 3300046522 Ga0495643_0009536 Ga0495643_0009536_3493_3675 60
820 3300046523 Ga0495644_0294987 Ga0495644_0294987_209_391 60
821 3300046524 Ga0495648_0425133 Ga0495648_0425133_106_288 60
822 3300046528 Ga0495642_0003852 Ga0495642_0003852_1437_1619 60
823 3300046530 Ga0495654_0169882 Ga0495654_0169882_37_219 60
824 3300046538 Ga0495609_0171090 Ga0495609_0171090_286_468 60
825 3300046539 Ga0495621_0142166 Ga0495621_0142166_658_840 60
826 3300046542 Ga0495597_0001737 Ga0495597_0001737_4864_5046 60
827 3300046557 Ga0495622_0036577 Ga0495622_0036577_1276_1458 60
828 3300046616 Ga0495668_0116616 Ga0495668_0116616_685_867 60
829 3300046616 Ga0495668_0697987 Ga0495668_0697987_66_248 60
830 3300046648 Ga0495611_0001817 Ga0495611_0001817_2863_3045 60
831 3300046648 Ga0495611_0266435 Ga0495611_0266435_469_651 60
832 3300046660 Ga0495625_0016679 Ga0495625_0016679_3371_3553 60
833 3300046660 Ga0495625_0049278 Ga0495625_0049278_33_215 60
834 3300046663 Ga0495635_0915246 Ga0495635_0915246_176_358 60
835 3300046664 Ga0495659_0223139 Ga0495659_0223139_292_474 60
836 3300046675 Ga0495657_0466685 Ga0495657_0466685_430_612 60
837 3300046684 Ga0495669_0000114 Ga0495669_0000114_50270_50452 60
838 3300046684 Ga0495669_0000375 Ga0495669_0000375_3223_3405 60
839 3300046684 Ga0495669_0020657 Ga0495669_0020657_1170_1352 60
840 3300046684 Ga0495669_0210846 Ga0495669_0210846_671_907 60
841 3300046684 Ga0495669_0255651 Ga0495669_0255651_188_370 60
842 3300046689 Ga0495613_0016976 Ga0495613_0016976_2144_2326 60
843 3300046690 Ga0495624_0064980 Ga0495624_0064980_108_290 60
844 3300046809 Ga0495600_0308639 Ga0495600_0308639_219_401 60
845 3300047318 Ga0495636_0417144 Ga0495636_0417144_371_553 60
846 3300047320 Ga0495672_0069043 Ga0495672_0069043_1106_1288 60
847 3300047322 Ga0495680_1101131 Ga0495680_1101131_290_478 60
848 3300047323 Ga0495683_0459000 Ga0495683_0459000_59_241 60
849 3300047443 Ga0495687_021229 Ga0495687_021229_1365_1547 60
850 3300047444 Ga0495675_0353251 Ga0495675_0353251_512_700 60
851 3300047445 Ga0495677_0014060 Ga0495677_0014060_899_1081 60
852 3300047445 Ga0495677_0019944 Ga0495677_0019944_333_515 60
853 3300047445 Ga0495677_0303681 Ga0495677_0303681_100_282 60
854 3300047447 Ga0495685_172539 Ga0495685_172539_17_199 60
855 3300047469 Ga0495673_0232990 Ga0495673_0232990_379_594 60
856 3300047470 Ga0495681_0317634 Ga0495681_0317634_401_583 60
857 3300047471 Ga0495684_1044394 Ga0495684_1044394_222_410 60
858 3300047673 Ga0495593_0019427 Ga0495593_0019427_1487_1669 60
859 3300048088 Ga0495602_0336494 Ga0495602_0336494_170_352 60
860 3300048090 Ga0495615_0106747 Ga0495615_0106747_578_760 60
861 3300048903 Ga0496100_0713875 Ga0496100_0713875_68_250 60
862 3300048903 Ga0496100_1043367 Ga0496100_1043367_335_517 60
863 3300048903 Ga0496100_1600379 Ga0496100_1600379_315_497 60
864 3300048904 Ga0496101_0043794 Ga0496101_0043794_317_499 60
865 3300048904 Ga0496101_0958343 Ga0496101_0958343_397_579 60
866 3300048905 Ga0496102_0031117 Ga0496102_0031117_3674_3856 60
867 3300048905 Ga0496102_0193636 Ga0496102_0193636_362_544 60
868 3300048905 Ga0496102_0344473 Ga0496102_0344473_132_314 60
869 3300048906 Ga0496103_0396937 Ga0496103_0396937_240_422 60
870 3300048907 Ga0496104_0499506 Ga0496104_0499506_300_482 60
871 3300048910 Ga0496107_0315776 Ga0496107_0315776_392_574 60
872 3300048910 Ga0496107_0346416 Ga0496107_0346416_237_419 60
873 3300048911 Ga0496108_0451166 Ga0496108_0451166_278_460 60
874 3300048912 Ga0496109_0021464 Ga0496109_0021464_104_286 60
875 3300048913 Ga0496110_0094902 Ga0496110_0094902_2214_2396 60
876 3300048914 Ga0496111_0379999 Ga0496111_0379999_399_581 60
877 3300048914 Ga0496111_0554619 Ga0496111_0554619_415_597 60
878 3300048915 Ga0496112_0077655 Ga0496112_0077655_264_446 60
879 3300048915 Ga0496112_1398908 Ga0496112_1398908_154_336 60
880 3300048915 Ga0496112_1519189 Ga0496112_1519189_141_323 60
881 3300048916 Ga0496113_0143794 Ga0496113_0143794_405_587 60
882 3300048916 Ga0496113_1174131 Ga0496113_1174131_114_296 60
883 3300048918 Ga0496115_0160335 Ga0496115_0160335_37_219 60
884 3300048918 Ga0496115_0570284 Ga0496115_0570284_501_683 60
885 3300048918 Ga0496115_0899614 Ga0496115_0899614_108_290 60
886 3300048919 Ga0496116_0270728 Ga0496116_0270728_629_811 60
887 3300048920 Ga0496117_0019825 Ga0496117_0019825_58_240 60
888 3300048921 Ga0496118_0071304 Ga0496118_0071304_1063_1245 60
889 3300048922 Ga0496119_0009454 Ga0496119_0009454_660_842 60
890 3300048924 Ga0496121_0000009 Ga0496121_0000009_36969_37151 60
891 3300048924 Ga0496121_0369749 Ga0496121_0369749_381_563 60
892 3300048924 Ga0496121_0685436 Ga0496121_0685436_46_228 60
893 3300048925 Ga0496122_0010228 Ga0496122_0010228_932_1114 60
894 3300048926 Ga0496123_0000539 Ga0496123_0000539_42727_42909 60
895 3300048927 Ga0496124_0894558 Ga0496124_0894558_64_246 60
896 3300048929 Ga0496126_0058965 Ga0496126_0058965_1209_1391 60
897 3300049569 Ga0501032_0467633 Ga0501032_0467633_101_283 60
898 3300049570 Ga0501033_0222417 Ga0501033_0222417_758_940 60
899 3300049570 Ga0501033_0351065 Ga0501033_0351065_666_848 60
900 3300049570 Ga0501033_0655231 Ga0501033_0655231_188_370 60
901 3300049571 Ga0501034_0017349 Ga0501034_0017349_3050_3232 60
902 3300049571 Ga0501034_0168950 Ga0501034_0168950_1175_1357 60
903 3300049571 Ga0501034_1491997 Ga0501034_1491997_328_510 60
904 3300049574 Ga0501038_0685285 Ga0501038_0685285_113_295 60
905 3300049579 Ga0501043_0321652 Ga0501043_0321652_23_205 60
906 3300049579 Ga0501043_0969052 Ga0501043_0969052_404_586 60
907 3300049581 Ga0501047_0005360 Ga0501047_0005360_8888_9070 60
908 3300049581 Ga0501047_0015925 Ga0501047_0015925_1479_1661 60
909 3300049582 Ga0501048_0441810 Ga0501048_0441810_22_204 60
910 3300049586 Ga0501070_0535013 Ga0501070_0535013_732_914 60
911 3300049588 Ga0501072_1560675 Ga0501072_1560675_170_352 60
912 3300049589 Ga0501073_0107948 Ga0501073_0107948_181_363 60
913 3300049589 Ga0501073_0242720 Ga0501073_0242720_131_313 60
914 3300049590 Ga0501074_0437778 Ga0501074_0437778_276_458 60
915 3300049593 Ga0501077_0652508 Ga0501077_0652508_373_555 60
916 3300049822 Ga0501035_0040735 Ga0501035_0040735_3351_3533 60
917 3300049822 Ga0501035_0055251 Ga0501035_0055251_2249_2431 60
918 3300049823 Ga0501044_0191921 Ga0501044_0191921_697_879 60
919 3300049823 Ga0501044_0270849 Ga0501044_0270849_1052_1234 60
920 3300049823 Ga0501044_0406439 Ga0501044_0406439_812_994 60
921 3300049823 Ga0501044_0757498 Ga0501044_0757498_579_761 60
922 3300049823 Ga0501044_1452874 Ga0501044_1452874_53_235 60
923 3300050489 nmdc:mga03683_14575_c1 nmdc:mga03683_14575_c1_1390_1572 60
924 3300050490 nmdc:mga03n38_626595_c1 nmdc:mga03n38_626595_c1_197_433 60
925 3300050490 nmdc:mga03n38_72384_c1 nmdc:mga03n38_72384_c1_341_523 60
926 3300050492 nmdc:mga0yw44_197941_c1 nmdc:mga0yw44_197941_c1_852_1034 60
927 3300050494 nmdc:mga06z11_455553_c1 nmdc:mga06z11_455553_c1_129_311 60
928 3300050494 nmdc:mga06z11_810645_c1 nmdc:mga06z11_810645_c1_187_369 60
929 3300050495 nmdc:mga04h51_111221_c1 nmdc:mga04h51_111221_c1_197_379 60
930 3300050496 nmdc:mga07m45_201028_c1 nmdc:mga07m45_201028_c1_70_252 60
931 3300053077 Ga0495601_0259792 Ga0495601_0259792_604_792 60
932 3300053080 Ga0500635_0000302 Ga0500635_0000302_11535_11717 60
933 3300053086 Ga0500578_0270703 Ga0500578_0270703_289_471 60
934 3300053087 Ga0500643_132126 Ga0500643_132126_283_465 60
935 3300053087 Ga0500643_138299 Ga0500643_138299_399_581 60
936 3300053090 Ga0500646_0158878 Ga0500646_0158878_387_569 60
937 3300053092 Ga0500583_0068270 Ga0500583_0068270_962_1144 60
938 3300053093 Ga0500651_0038819 Ga0500651_0038819_2132_2314 60
939 3300053094 Ga0500566_0075858 Ga0500566_0075858_900_1082 60
940 3300053096 Ga0500641_0000513 Ga0500641_0000513_8541_8723 60
941 3300053096 Ga0500641_0001354 Ga0500641_0001354_5812_5994 60
942 3300053096 Ga0500641_0123532 Ga0500641_0123532_176_358 60
943 3300053096 Ga0500641_0317682 Ga0500641_0317682_192_374 60
944 3300053102 Ga0500554_044660 Ga0500554_044660_873_1055 60
945 3300053103 Ga0500555_008578 Ga0500555_008578_574_756 60
946 3300053103 Ga0500555_022840 Ga0500555_022840_909_1091 60
947 3300053104 Ga0500556_0000944 Ga0500556_0000944_11807_11989 60
948 3300053104 Ga0500556_0188512 Ga0500556_0188512_576_758 60
949 3300053105 Ga0500557_124052 Ga0500557_124052_546_728 60
950 3300053108 Ga0500562_000464 Ga0500562_000464_7335_7517 60
951 3300053108 Ga0500562_002035 Ga0500562_002035_653_835 60
952 3300053108 Ga0500562_003673 Ga0500562_003673_1709_1891 60
953 3300053109 Ga0500569_001963 Ga0500569_001963_2561_2743 60
954 3300053111 Ga0500572_264183 Ga0500572_264183_185_367 60
955 3300053119 Ga0500595_004249 Ga0500595_004249_1025_1207 60
956 3300053121 Ga0500607_093214 Ga0500607_093214_746_928 60
957 3300053121 Ga0500607_130368 Ga0500607_130368_858_1040 60
958 3300053122 Ga0500608_000573 Ga0500608_000573_3545_3727 60
959 3300053123 Ga0500614_002131 Ga0500614_002131_900_1082 60
960 3300053130 Ga0500642_0106206 Ga0500642_0106206_403_585 60
961 3300053133 Ga0500655_053593 Ga0500655_053593_14_196 60
962 3300053136 Ga0500559_0012527 Ga0500559_0012527_2170_2352 60
963 3300053136 Ga0500559_0284235 Ga0500559_0284235_70_252 60
964 3300053139 Ga0500568_0056872 Ga0500568_0056872_1294_1476 60
965 3300053139 Ga0500568_0068224 Ga0500568_0068224_915_1097 60
966 3300053148 Ga0500590_130785 Ga0500590_130785_452_634 60
967 3300053150 Ga0500603_059463 Ga0500603_059463_321_503 60
968 3300053153 Ga0500616_0056412 Ga0500616_0056412_1688_1870 60
969 3300053153 Ga0500616_0068784 Ga0500616_0068784_1377_1559 60
970 3300053154 Ga0500619_008319 Ga0500619_008319_234_416 60
971 3300053155 Ga0500620_153731 Ga0500620_153731_296_478 60
972 3300053156 Ga0500622_0037145 Ga0500622_0037145_177_359 60
973 3300053156 Ga0500622_0104173 Ga0500622_0104173_72_254 60
974 3300053157 Ga0500624_003662 Ga0500624_003662_179_361 60
975 3300053160 Ga0500633_0076085 Ga0500633_0076085_342_539 60
976 3300053162 Ga0500638_045794 Ga0500638_045794_549_731 60
977 3300053177 Ga0500636_0008358 Ga0500636_0008358_606_788 60
978 3300053177 Ga0500636_0353667 Ga0500636_0353667_226_408 60
979 3300053178 Ga0500637_0187831 Ga0500637_0187831_49_231 60
980 3300053178 Ga0500637_0384570 Ga0500637_0384570_515_697 60
981 3300053728 Ga0500657_220977 Ga0500657_220977_203_385 60
982 3300053729 Ga0500625_015994 Ga0500625_015994_2505_2687 60
983 3300053730 Ga0500645_002978 Ga0500645_002978_6631_6813 60
984 3300053730 Ga0500645_059370 Ga0500645_059370_386_568 60
985 3300053735 Ga0500596_000489 Ga0500596_000489_2146_2328 60
986 3300059477 Ga0587084_128359 Ga0587084_128359_104_286 60
987 3300059506 Ga0587085_102438 Ga0587085_102438_55_237 60
988 3300059639 Ga0587062_063902 Ga0587062_063902_326_508 60
989 3300059639 Ga0587062_096072 Ga0587062_096072_51_233 60
990 3300059645 Ga0587076_200370 Ga0587076_200370_133_315 60
991 3300060353 Ga0501082_1074369 Ga0501082_1074369_171_353 60
992 3300061719 Ga0466962_0618384 Ga0466962_0618384_96_278 60
993 3300001979 JGI24740J21852_10000317 JGI24740J21852_100003179 61
994 3300001979 JGI24740J21852_10176685 JGI24740J21852_101766852 61
995 3300001989 JGI24739J22299_10118348 JGI24739J22299_101183482 61
996 3300002737 JGI25162J39368_1000199 JGI25162J39368_10001999 61
997 3300002773 JGI25152J39213_1001688 JGI25152J39213_10016884 61
998 3300002773 JGI25152J39213_1003233 JGI25152J39213_10032331 61
999 3300003187 JGI25151J46595_10003651 JGI25151J46595_100036514 61
1000 3300003187 JGI25151J46595_10050220 JGI25151J46595_100502202 61
1001 3300003214 JGI25165J46597_1000307 JGI25165J46597_100030740 61
1002 3300003214 JGI25165J46597_1003183 JGI25165J46597_10031833 61
1003 3300003354 JGI25160J50197_1018865 JGI25160J50197_10188653 61
1004 3300003792 Ga0055540_1033556 Ga0055540_10335563 61
1005 3300003792 Ga0055540_1099987 Ga0055540_10999871 61
1006 3300003856 Ga0058692_1001101 Ga0058692_10011017 61
1007 3300005289 Ga0065704_10809058 Ga0065704_108090581 61
1008 3300005328 Ga0070676_10117486 Ga0070676_101174861 61
1009 3300005331 Ga0070670_100000061 Ga0070670_10000006181 61
1010 3300005331 Ga0070670_100780865 Ga0070670_1007808652 61
1011 3300005335 Ga0070666_10243716 Ga0070666_102437163 61
1012 3300005338 Ga0068868_101352203 Ga0068868_1013522032 61
1013 3300005341 Ga0070691_10468279 Ga0070691_104682791 61
1014 3300005347 Ga0070668_100696881 Ga0070668_1006968812 61
1015 3300005347 Ga0070668_100927278 Ga0070668_1009272782 61
1016 3300005353 Ga0070669_100052266 Ga0070669_1000522662 61
1017 3300005353 Ga0070669_100069357 Ga0070669_1000693574 61
1018 3300005353 Ga0070669_100308986 Ga0070669_1003089862 61
1019 3300005354 Ga0070675_100461172 Ga0070675_1004611722 61
1020 3300005355 Ga0070671_100183764 Ga0070671_1001837642 61
1021 3300005356 Ga0070674_101638054 Ga0070674_1016380541 61
1022 3300005366 Ga0070659_100207804 Ga0070659_1002078041 61
1023 3300005366 Ga0070659_101427097 Ga0070659_1014270972 61
1024 3300005367 Ga0070667_100040040 Ga0070667_1000400403 61
1025 3300005440 Ga0070705_100212578 Ga0070705_1002125781 61
1026 3300005445 Ga0070708_100141843 Ga0070708_1001418432 61
1027 3300005455 Ga0070663_100483486 Ga0070663_1004834862 61
1028 3300005455 Ga0070663_100991189 Ga0070663_1009911891 61
1029 3300005456 Ga0070678_100879050 Ga0070678_1008790501 61
1030 3300005457 Ga0070662_100255983 Ga0070662_1002559833 61
1031 3300005457 Ga0070662_101323726 Ga0070662_1013237261 61
1032 3300005467 Ga0070706_100530272 Ga0070706_1005302722 61
1033 3300005468 Ga0070707_101049691 Ga0070707_1010496912 61
1034 3300005471 Ga0070698_100132761 Ga0070698_1001327614 61
1035 3300005518 Ga0070699_100157214 Ga0070699_1001572142 61
1036 3300005530 Ga0070679_101033610 Ga0070679_1010336102 61
1037 3300005539 Ga0068853_101012572 Ga0068853_1010125722 61
1038 3300005539 Ga0068853_101758587 Ga0068853_1017585872 61
1039 3300005543 Ga0070672_100309369 Ga0070672_1003093692 61
1040 3300005543 Ga0070672_100969192 Ga0070672_1009691922 61
1041 3300005548 Ga0070665_100003518 Ga0070665_10000351817 61
1042 3300005548 Ga0070665_100006101 Ga0070665_1000061018 61
1043 3300005548 Ga0070665_100262649 Ga0070665_1002626493 61
1044 3300005548 Ga0070665_102590297 Ga0070665_1025902972 61
1045 3300005549 Ga0070704_101214572 Ga0070704_1012145722 61
1046 3300005563 Ga0068855_100884043 Ga0068855_1008840431 61
1047 3300005563 Ga0068855_101077840 Ga0068855_1010778402 61
1048 3300005577 Ga0068857_100513179 Ga0068857_1005131791 61
1049 3300005577 Ga0068857_100745242 Ga0068857_1007452421 61
1050 3300005578 Ga0068854_100216344 Ga0068854_1002163442 61
1051 3300005578 Ga0068854_100696271 Ga0068854_1006962712 61
1052 3300005614 Ga0068856_100036110 Ga0068856_1000361104 61
1053 3300005614 Ga0068856_100118032 Ga0068856_1001180321 61
1054 3300005616 Ga0068852_100131790 Ga0068852_1001317903 61
1055 3300005617 Ga0068859_102776195 Ga0068859_1027761952 61
1056 3300005618 Ga0068864_100611800 Ga0068864_1006118002 61
1057 3300005719 Ga0068861_100155784 Ga0068861_1001557843 61
1058 3300005834 Ga0068851_10012066 Ga0068851_100120665 61
1059 3300005844 Ga0068862_100719416 Ga0068862_1007194162 61
1060 3300006038 Ga0075365_10374786 Ga0075365_103747862 61
1061 3300006042 Ga0075368_10007666 Ga0075368_100076662 61
1062 3300006048 Ga0075363_100032636 Ga0075363_1000326362 61
1063 3300006051 Ga0075364_10053598 Ga0075364_100535982 61
1064 3300006051 Ga0075364_10143115 Ga0075364_101431152 61
1065 3300006051 Ga0075364_10218379 Ga0075364_102183792 61
1066 3300006051 Ga0075364_10723759 Ga0075364_107237592 61
1067 3300006175 Ga0070712_100207331 Ga0070712_1002073313 61
1068 3300006177 Ga0075362_10062334 Ga0075362_100623342 61
1069 3300006178 Ga0075367_10068389 Ga0075367_100683893 61
1070 3300006178 Ga0075367_10218474 Ga0075367_102184742 61
1071 3300006178 Ga0075367_10306281 Ga0075367_103062811 61
1072 3300006178 Ga0075367_11045080 Ga0075367_110450801 61
1073 3300006186 Ga0075369_10009705 Ga0075369_100097052 61
1074 3300006186 Ga0075369_10101645 Ga0075369_101016452 61
1075 3300006186 Ga0075369_10424721 Ga0075369_104247212 61
1076 3300006195 Ga0075366_10837511 Ga0075366_108375112 61
1077 3300006195 Ga0075366_10986023 Ga0075366_109860232 61
1078 3300006353 Ga0075370_10005219 Ga0075370_100052197 61
1079 3300006353 Ga0075370_10039168 Ga0075370_100391684 61
1080 3300006353 Ga0075370_10394678 Ga0075370_103946782 61
1081 3300006353 Ga0075370_10707771 Ga0075370_107077711 61
1082 3300006852 Ga0075433_11145322 Ga0075433_111453222 61
1083 3300006931 Ga0097620_102775686 Ga0097620_1027756862 61
1084 3300006948 Ga0099826_10000704 Ga0099826_1000070418 61
1085 3300006948 Ga0099826_10014270 Ga0099826_100142706 61
1086 3300009011 Ga0105251_10212891 Ga0105251_102128912 61
1087 3300009011 Ga0105251_10536935 Ga0105251_105369352 61
1088 3300009036 Ga0105244_10194446 Ga0105244_101944462 61
1089 3300009092 Ga0105250_10006718 Ga0105250_100067183 61
1090 3300009098 Ga0105245_11950873 Ga0105245_119508731 61
1091 3300009147 Ga0114129_12232847 Ga0114129_122328472 61
1092 3300009148 Ga0105243_10009275 Ga0105243_100092753 61
1093 3300009148 Ga0105243_10559294 Ga0105243_105592942 61
1094 3300009148 Ga0105243_11202764 Ga0105243_112027642 61
1095 3300009174 Ga0105241_10519968 Ga0105241_105199682 61
1096 3300009176 Ga0105242_10399698 Ga0105242_103996982 61
1097 3300009551 Ga0105238_10345589 Ga0105238_103455892 61
1098 3300009553 Ga0105249_11108098 Ga0105249_111080982 61
1099 3300009553 Ga0105249_12274578 Ga0105249_122745781 61
1100 3300011119 Ga0105246_10073748 Ga0105246_100737483 61
1101 3300011119 Ga0105246_10456512 Ga0105246_104565122 61
1102 3300013100 Ga0157373_10008653 Ga0157373_100086535 61
1103 3300013102 Ga0157371_10000004 Ga0157371_1000000451 61
1104 3300013104 Ga0157370_10001047 Ga0157370_1000104733 61
1105 3300013307 Ga0157372_11388633 Ga0157372_113886331 61
1106 3300013308 Ga0157375_11989773 Ga0157375_119897732 61
1107 3300014968 Ga0157379_10359470 Ga0157379_103594702 61
1108 3300015261 Ga0182006_1131262 Ga0182006_11312621 61
1109 3300015265 Ga0182005_1004873 Ga0182005_10048732 61
1110 3300025230 Ga0209563_103803 Ga0209563_1038033 61
1111 3300025233 Ga0209437_100182 Ga0209437_10018238 61
1112 3300025233 Ga0209437_115842 Ga0209437_1158422 61
1113 3300025245 Ga0207425_1029390 Ga0207425_10293902 61
1114 3300025245 Ga0207425_1041137 Ga0207425_10411372 61
1115 3300025245 Ga0207425_1062936 Ga0207425_10629362 61
1116 3300025250 Ga0209026_1054154 Ga0209026_10541541 61
1117 3300025250 Ga0209026_1062172 Ga0209026_10621721 61
1118 3300025253 Ga0209677_100265 Ga0209677_1002654 61
1119 3300025258 Ga0209129_1000050 Ga0209129_1000050198 61
1120 3300025258 Ga0209129_1004912 Ga0209129_10049123 61
1121 3300025261 Ga0209233_1000231 Ga0209233_100023177 61
1122 3300025261 Ga0209233_1000255 Ga0209233_100025569 61
1123 3300025272 Ga0209455_1016011 Ga0209455_10160112 61
1124 3300025273 Ga0209673_1021682 Ga0209673_10216822 61
1125 3300025273 Ga0209673_1074035 Ga0209673_10740352 61
1126 3300025294 Ga0209025_1000553 Ga0209025_100055332 61
1127 3300025294 Ga0209025_1003440 Ga0209025_10034408 61
1128 3300025294 Ga0209025_1042265 Ga0209025_10422652 61
1129 3300025295 Ga0209564_1033319 Ga0209564_10333193 61
1130 3300025297 Ga0209758_1050577 Ga0209758_10505772 61
1131 3300025297 Ga0209758_1066324 Ga0209758_10663243 61
1132 3300025298 Ga0209050_1078881 Ga0209050_10788812 61
1133 3300025299 Ga0209256_1006344 Ga0209256_10063448 61
1134 3300025299 Ga0209256_1079385 Ga0209256_10793851 61
1135 3300025302 Ga0207426_1000798 Ga0207426_10007987 61
1136 3300025303 Ga0209051_1027659 Ga0209051_10276593 61
1137 3300025303 Ga0209051_1028291 Ga0209051_10282913 61
1138 3300025303 Ga0209051_1029985 Ga0209051_10299852 61
1139 3300025321 Ga0207656_10042169 Ga0207656_100421693 61
1140 3300025900 Ga0207710_10192911 Ga0207710_101929112 61
1141 3300025903 Ga0207680_10310106 Ga0207680_103101062 61
1142 3300025903 Ga0207680_10314530 Ga0207680_103145302 61
1143 3300025913 Ga0207695_10000044 Ga0207695_10000044363 61
1144 3300025914 Ga0207671_10000043 Ga0207671_10000043125 61
1145 3300025915 Ga0207693_10238977 Ga0207693_102389773 61
1146 3300025922 Ga0207646_10489633 Ga0207646_104896332 61
1147 3300025923 Ga0207681_10106943 Ga0207681_101069432 61
1148 3300025923 Ga0207681_11272991 Ga0207681_112729912 61
1149 3300025924 Ga0207694_10180029 Ga0207694_101800294 61
1150 3300025925 Ga0207650_10000630 Ga0207650_100006305 61
1151 3300025928 Ga0207700_10774928 Ga0207700_107749282 61
1152 3300025931 Ga0207644_10203056 Ga0207644_102030562 61
1153 3300025931 Ga0207644_10516404 Ga0207644_105164041 61
1154 3300025932 Ga0207690_10325308 Ga0207690_103253083 61
1155 3300025933 Ga0207706_10491611 Ga0207706_104916112 61
1156 3300025933 Ga0207706_11090220 Ga0207706_110902201 61
1157 3300025935 Ga0207709_10024990 Ga0207709_100249903 61
1158 3300025935 Ga0207709_11412384 Ga0207709_114123841 61
1159 3300025940 Ga0207691_10538486 Ga0207691_105384862 61
1160 3300025941 Ga0207711_10256278 Ga0207711_102562783 61
1161 3300025941 Ga0207711_10849418 Ga0207711_108494182 61
1162 3300025949 Ga0207667_10340351 Ga0207667_103403512 61
1163 3300025961 Ga0207712_11270817 Ga0207712_112708171 61
1164 3300025972 Ga0207668_10140712 Ga0207668_101407123 61
1165 3300025972 Ga0207668_10499171 Ga0207668_104991712 61
1166 3300025972 Ga0207668_10850330 Ga0207668_108503301 61
1167 3300025981 Ga0207640_10717762 Ga0207640_107177622 61
1168 3300025981 Ga0207640_11513818 Ga0207640_115138181 61
1169 3300025986 Ga0207658_10237459 Ga0207658_102374592 61
1170 3300025986 Ga0207658_11287886 Ga0207658_112878862 61
1171 3300026035 Ga0207703_10300534 Ga0207703_103005342 61
1172 3300026041 Ga0207639_10601572 Ga0207639_106015722 61
1173 3300026041 Ga0207639_11391678 Ga0207639_113916782 61
1174 3300026067 Ga0207678_10918614 Ga0207678_109186141 61
1175 3300026067 Ga0207678_11388116 Ga0207678_113881161 61
1176 3300026078 Ga0207702_10020911 Ga0207702_100209114 61
1177 3300026078 Ga0207702_10105414 Ga0207702_101054141 61
1178 3300026095 Ga0207676_11445148 Ga0207676_114451482 61
1179 3300026116 Ga0207674_12109269 Ga0207674_121092692 61
1180 3300026118 Ga0207675_100156670 Ga0207675_1001566703 61
1181 3300026121 Ga0207683_10472003 Ga0207683_104720032 61
1182 3300026121 Ga0207683_11710728 Ga0207683_117107281 61
1183 3300026142 Ga0207698_10100302 Ga0207698_101003023 61
1184 3300027312 Ga0209371_1000009 Ga0209371_1000009943 61
1185 3300027312 Ga0209371_1000753 Ga0209371_10007534 61
1186 3300027666 Ga0209282_1000849 Ga0209282_100084914 61
1187 3300027866 Ga0209813_10088886 Ga0209813_100888862 61
1188 3300027907 Ga0207428_10417551 Ga0207428_104175512 61
1189 3300028379 Ga0268266_10018885 Ga0268266_100188853 61
1190 3300028379 Ga0268266_10731974 Ga0268266_107319742 61
1191 3300028379 Ga0268266_11562466 Ga0268266_115624661 61
1192 3300028379 Ga0268266_11607616 Ga0268266_116076162 61
1193 3300028563 Ga0265319_1157264 Ga0265319_11572641 61
1194 3300028794 Ga0307515_10925088 Ga0307515_109250882 61
1195 3300030500 Ga0268256_1000010 Ga0268256_1000010942 61
1196 3300030500 Ga0268256_1003130 Ga0268256_10031301 61
1197 3300030745 Ga0316182_1361217 Ga0316182_13612172 61
1198 3300031728 Ga0316578_10586102 Ga0316578_105861022 61
1199 3300031901 Ga0307406_11075264 Ga0307406_110752641 61
1200 3300031911 Ga0307412_11282944 Ga0307412_112829441 61
1201 3300031995 Ga0307409_100582796 Ga0307409_1005827961 61
1202 3300032004 Ga0307414_10080583 Ga0307414_100805834 61
1203 3300032004 Ga0307414_11374641 Ga0307414_113746412 61
1204 3300035086 Ga0373934_0057302 Ga0373934_0057302_906_1094 61
1205 3300035113 Ga0373936_0288322 Ga0373936_0288322_537_725 61
1206 3300035117 Ga0373953_0064809 Ga0373953_0064809_115_303 61
1207 3300035118 Ga0373954_0028925 Ga0373954_0028925_375_563 61
1208 3300035119 Ga0373956_0030070 Ga0373956_0030070_1679_1867 61
1209 3300035120 Ga0373957_0341548 Ga0373957_0341548_428_616 61
1210 3300035172 Ga0373955_0041670 Ga0373955_0041670_692_880 61
1211 3300035410 Ga0373924_0053116 Ga0373924_0053116_1376_1564 61
1212 3300035724 Ga0373933_0001765 Ga0373933_0001765_6928_7116 61
1213 3300036401 Ga0373937_0006878 Ga0373937_0006878_1211_1399 61
1214 3300037068 Ga0373925_1784479 Ga0373925_1784479_278_463 61
1215 3300037853 Ga0436364_0610524 Ga0436364_0610524_243_440 61
1216 3300039437 Ga0436365_1837953 Ga0436365_1837953_1431_1616 61
1217 3300039447 Ga0436361_0835775 Ga0436361_0835775_824_1009 61
1218 3300039450 Ga0436363_1484678 Ga0436363_1484678_161_349 61
1219 3300039453 Ga0436362_0149703 Ga0436362_0149703_73_261 61
1220 3300039453 Ga0436362_0297190 Ga0436362_0297190_54_242 61
1221 3300039453 Ga0436362_1022103 Ga0436362_1022103_170_358 61
1222 3300041452 Ga0451793_1900854 Ga0451793_1900854_567_752 61
1223 3300041456 Ga0451795_1551248 Ga0451795_1551248_514_699 61
1224 3300041461 Ga0451805_005031 Ga0451805_005031_39_224 61
1225 3300041486 Ga0451807_0142193 Ga0451807_0142193_568_753 61
1226 3300041494 Ga0451837_1073011 Ga0451837_1073011_829_1014 61
1227 3300041496 Ga0451839_0183986 Ga0451839_0183986_238_423 61
1228 3300041512 Ga0451853_1702220 Ga0451853_1702220_201_389 61
1229 3300041512 Ga0451853_4061060 Ga0451853_4061060_638_823 61
1230 3300042012 Ga0439455_0011348 Ga0439455_0011348_1618_1803 61
1231 3300042015 Ga0439462_0105014 Ga0439462_0105014_494_679 61
1232 3300042157 Ga0439458_0091866 Ga0439458_0091866_506_703 61
1233 3300042435 Ga0439434_0233390 Ga0439434_0233390_145_330 61
1234 3300042438 Ga0439459_0015574 Ga0439459_0015574_900_1097 61
1235 3300046454 Ga0495592_0124849 Ga0495592_0124849_1178_1363 61
1236 3300046454 Ga0495592_0166268 Ga0495592_0166268_753_941 61
1237 3300046459 Ga0495629_0038896 Ga0495629_0038896_2082_2267 61
1238 3300046462 Ga0495651_0161486 Ga0495651_0161486_530_715 61
1239 3300046463 Ga0495653_0218391 Ga0495653_0218391_231_416 61
1240 3300046471 Ga0495650_0040709 Ga0495650_0040709_791_976 61
1241 3300046476 Ga0495662_0027078 Ga0495662_0027078_556_741 61
1242 3300046477 Ga0495664_0144213 Ga0495664_0144213_231_416 61
1243 3300046492 Ga0495585_0112411 Ga0495585_0112411_17_202 61
1244 3300046507 Ga0495606_0009975 Ga0495606_0009975_4104_4289 61
1245 3300046511 Ga0495608_0126446 Ga0495608_0126446_644_832 61
1246 3300046512 Ga0495610_0000530 Ga0495610_0000530_8739_8924 61
1247 3300046514 Ga0495618_0737711 Ga0495618_0737711_227_415 61
1248 3300046514 Ga0495618_0895405 Ga0495618_0895405_308_493 61
1249 3300046516 Ga0495628_0134207 Ga0495628_0134207_1105_1290 61
1250 3300046516 Ga0495628_0408110 Ga0495628_0408110_122_310 61
1251 3300046522 Ga0495643_0091285 Ga0495643_0091285_465_650 61
1252 3300046524 Ga0495648_0173144 Ga0495648_0173144_112_297 61
1253 3300046533 Ga0495640_0132628 Ga0495640_0132628_14_202 61
1254 3300046536 Ga0495587_0452180 Ga0495587_0452180_63_251 61
1255 3300046558 Ga0495633_0065587 Ga0495633_0065587_1040_1225 61
1256 3300046559 Ga0495667_0544642 Ga0495667_0544642_348_536 61
1257 3300046663 Ga0495635_0056822 Ga0495635_0056822_299_484 61
1258 3300046674 Ga0495588_0005383 Ga0495588_0005383_3505_3690 61
1259 3300046674 Ga0495588_0071865 Ga0495588_0071865_605_790 61
1260 3300046675 Ga0495657_0152288 Ga0495657_0152288_812_997 61
1261 3300046689 Ga0495613_0342822 Ga0495613_0342822_731_919 61
1262 3300046690 Ga0495624_0286422 Ga0495624_0286422_316_501 61
1263 3300046692 Ga0495671_0130573 Ga0495671_0130573_1013_1198 61
1264 3300046809 Ga0495600_0204355 Ga0495600_0204355_518_703 61
1265 3300047317 Ga0495604_0022630 Ga0495604_0022630_3825_4010 61
1266 3300047321 Ga0495676_0627109 Ga0495676_0627109_465_650 61
1267 3300047470 Ga0495681_0002425 Ga0495681_0002425_6610_6795 61
1268 3300047471 Ga0495684_0437837 Ga0495684_0437837_247_432 61
1269 3300047471 Ga0495684_0688114 Ga0495684_0688114_351_539 61
1270 3300047472 Ga0495686_0003490 Ga0495686_0003490_10612_10797 61
1271 3300047472 Ga0495686_0160588 Ga0495686_0160588_279_464 61
1272 3300048088 Ga0495602_0210122 Ga0495602_0210122_950_1138 61
1273 3300048903 Ga0496100_0770290 Ga0496100_0770290_107_292 61
1274 3300048904 Ga0496101_0540884 Ga0496101_0540884_686_871 61
1275 3300048904 Ga0496101_1307025 Ga0496101_1307025_230_421 61
1276 3300048905 Ga0496102_0859348 Ga0496102_0859348_184_369 61
1277 3300048906 Ga0496103_0863148 Ga0496103_0863148_111_296 61
1278 3300048907 Ga0496104_0205507 Ga0496104_0205507_183_368 61
1279 3300048909 Ga0496106_0407120 Ga0496106_0407120_572_757 61
1280 3300048910 Ga0496107_0168265 Ga0496107_0168265_1387_1575 61
1281 3300048911 Ga0496108_1313230 Ga0496108_1313230_19_204 61
1282 3300048912 Ga0496109_0456005 Ga0496109_0456005_68_253 61
1283 3300048912 Ga0496109_0884690 Ga0496109_0884690_514_699 61
1284 3300048913 Ga0496110_0504435 Ga0496110_0504435_558_743 61
1285 3300048914 Ga0496111_0330750 Ga0496111_0330750_605_790 61
1286 3300048915 Ga0496112_0204968 Ga0496112_0204968_1308_1493 61
1287 3300048916 Ga0496113_0181414 Ga0496113_0181414_503_688 61
1288 3300048919 Ga0496116_0080690 Ga0496116_0080690_1410_1595 61
1289 3300048919 Ga0496116_0334329 Ga0496116_0334329_46_231 61
1290 3300048920 Ga0496117_0000002 Ga0496117_0000002_2430050_2430235 61
1291 3300048920 Ga0496117_0104602 Ga0496117_0104602_765_950 61
1292 3300048920 Ga0496117_0179655 Ga0496117_0179655_775_960 61
1293 3300048921 Ga0496118_0001144 Ga0496118_0001144_9875_10060 61
1294 3300048922 Ga0496119_0020857 Ga0496119_0020857_3857_4042 61
1295 3300048922 Ga0496119_0038724 Ga0496119_0038724_1585_1770 61
1296 3300048922 Ga0496119_0050737 Ga0496119_0050737_938_1123 61
1297 3300048923 Ga0496120_0000897 Ga0496120_0000897_9900_10085 61
1298 3300048924 Ga0496121_0054257 Ga0496121_0054257_1917_2102 61
1299 3300048924 Ga0496121_0319213 Ga0496121_0319213_48_233 61
1300 3300048925 Ga0496122_0000001 Ga0496122_0000001_1774058_1774243 61
1301 3300048925 Ga0496122_0005325 Ga0496122_0005325_2837_3022 61
1302 3300048925 Ga0496122_0077402 Ga0496122_0077402_1106_1291 61
1303 3300048925 Ga0496122_0186794 Ga0496122_0186794_637_822 61
1304 3300048925 Ga0496122_0507641 Ga0496122_0507641_121_306 61
1305 3300048926 Ga0496123_0000001 Ga0496123_0000001_1777789_1777974 61
1306 3300048926 Ga0496123_0048548 Ga0496123_0048548_278_463 61
1307 3300048926 Ga0496123_0069298 Ga0496123_0069298_1922_2107 61
1308 3300048927 Ga0496124_0000855 Ga0496124_0000855_47812_47997 61
1309 3300048927 Ga0496124_0040338 Ga0496124_0040338_48_233 61
1310 3300048927 Ga0496124_0044707 Ga0496124_0044707_3458_3643 61
1311 3300048927 Ga0496124_0106630 Ga0496124_0106630_413_598 61
1312 3300048927 Ga0496124_0435032 Ga0496124_0435032_312_497 61
1313 3300048927 Ga0496124_0629884 Ga0496124_0629884_217_402 61
1314 3300048928 Ga0496125_0068486 Ga0496125_0068486_1358_1543 61
1315 3300048929 Ga0496126_0063284 Ga0496126_0063284_2032_2217 61
1316 3300048929 Ga0496126_0072053 Ga0496126_0072053_722_907 61
1317 3300048929 Ga0496126_1229169 Ga0496126_1229169_303_488 61
1318 3300049459 Ga0495678_030444 Ga0495678_030444_780_965 61
1319 3300049570 Ga0501033_0000741 Ga0501033_0000741_27207_27392 61
1320 3300049571 Ga0501034_0356313 Ga0501034_0356313_845_1033 61
1321 3300049581 Ga0501047_0112286 Ga0501047_0112286_1840_2028 61
1322 3300049583 Ga0501067_0174629 Ga0501067_0174629_103_288 61
1323 3300049586 Ga0501070_0079969 Ga0501070_0079969_77_262 61
1324 3300049589 Ga0501073_1146747 Ga0501073_1146747_153_341 61
1325 3300049742 Ga0501080_1026561 Ga0501080_1026561_281_469 61
1326 3300049822 Ga0501035_0004335 Ga0501035_0004335_10836_11021 61
1327 3300049823 Ga0501044_0373120 Ga0501044_0373120_938_1126 61
1328 3300050489 nmdc:mga03683_263655_c1 nmdc:mga03683_263655_c1_238_435 61
1329 3300050489 nmdc:mga03683_95267_c1 nmdc:mga03683_95267_c1_584_769 61
1330 3300050490 nmdc:mga03n38_453666_c1 nmdc:mga03n38_453666_c1_474_659 61
1331 3300050491 nmdc:mga00v17_838_c1 nmdc:mga00v17_838_c1_16228_16413 61
1332 3300050491 nmdc:mga00v17_98091_c1 nmdc:mga00v17_98091_c1_1641_1826 61
1333 3300050492 nmdc:mga0yw44_3160_c1 nmdc:mga0yw44_3160_c1_6714_6899 61
1334 3300050492 nmdc:mga0yw44_803420_c1 nmdc:mga0yw44_803420_c1_84_269 61
1335 3300050493 nmdc:mga0k408_466200_c1 nmdc:mga0k408_466200_c1_184_369 61
1336 3300050493 nmdc:mga0k408_894208_c1 nmdc:mga0k408_894208_c1_105_302 61
1337 3300050494 nmdc:mga06z11_545393_c1 nmdc:mga06z11_545393_c1_377_562 61
1338 3300050494 nmdc:mga06z11_549185_c1 nmdc:mga06z11_549185_c1_82_267 61
1339 3300050494 nmdc:mga06z11_978283_c1 nmdc:mga06z11_978283_c1_22_207 61
1340 3300050495 nmdc:mga04h51_389572_c1 nmdc:mga04h51_389572_c1_19_216 61
1341 3300050495 nmdc:mga04h51_51802_c1 nmdc:mga04h51_51802_c1_805_990 61
1342 3300050496 nmdc:mga07m45_140770_c1 nmdc:mga07m45_140770_c1_347_532 61
1343 3300050496 nmdc:mga07m45_156640_c1 nmdc:mga07m45_156640_c1_449_634 61
1344 3300050496 nmdc:mga07m45_592194_c1 nmdc:mga07m45_592194_c1_336_533 61
1345 3300050516 nmdc:mga0sz30_268_c1 nmdc:mga0sz30_268_c1_16487_16672 61
1346 3300053077 Ga0495601_0045173 Ga0495601_0045173_1302_1490 61
1347 3300053077 Ga0495601_0472317 Ga0495601_0472317_147_332 61
1348 3300053084 Ga0495595_0110042 Ga0495595_0110042_506_694 61
1349 3300053085 Ga0495619_0045254 Ga0495619_0045254_91_279 61
1350 3300053085 Ga0495619_0245844 Ga0495619_0245844_600_785 61
1351 3300053087 Ga0500643_114283 Ga0500643_114283_423_608 61
1352 3300053088 Ga0500644_0504222 Ga0500644_0504222_110_295 61
1353 3300053107 Ga0500560_266297 Ga0500560_266297_14_199 61
1354 3300053111 Ga0500572_001459 Ga0500572_001459_5645_5830 61
1355 3300053123 Ga0500614_075922 Ga0500614_075922_366_551 61
1356 3300053136 Ga0500559_0003926 Ga0500559_0003926_3200_3385 61
1357 3300053137 Ga0500561_0001340 Ga0500561_0001340_211_396 61
1358 3300053148 Ga0500590_000122 Ga0500590_000122_12221_12406 61
1359 3300053157 Ga0500624_000595 Ga0500624_000595_9494_9679 61
1360 3300053157 Ga0500624_031755 Ga0500624_031755_246_431 61
1361 3300053161 Ga0500634_0001711 Ga0500634_0001711_3194_3379 61
1362 3300053161 Ga0500634_0002130 Ga0500634_0002130_3872_4057 61
1363 3300053177 Ga0500636_0000094 Ga0500636_0000094_25366_25551 61
1364 3300053177 Ga0500636_0001328 Ga0500636_0001328_4018_4203 61
1365 3300053177 Ga0500636_0330724 Ga0500636_0330724_538_723 61

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01783

Ribosomal_L32p

Ribosomal L32p protein family

13

68

0.98

Feature Viewer

pLDDT pTM Quality
81.79 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map