F493372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1365 | 529 | 1365 | 60 |
Family's Representative Sequence
| Representative Sequence | 3300047469|Ga0495673_0232990|Ga0495673_0232990_379_594 |
| Length | 71 |
| Sequence | MAGTRFEESPAMAVPKRKTSPSRRNMRRSHHALAPNSFVDDKETGELKRPHHVDLKTGMYKGRQVLTPKED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 221 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 222 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 238 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 246 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 256 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 257 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 288 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 292 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 293 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 294 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 295 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 296 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 297 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 298 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 304 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 306 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 307 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 308 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 309 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 310 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 311 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 312 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 313 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 314 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 315 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 316 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 317 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 320 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 321 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 391 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 392 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 393 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 394 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 395 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 396 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 399 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 400 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 401 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 410 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 411 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 412 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 413 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 414 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 442 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 443 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 446 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 447 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 448 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 449 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 450 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 451 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 452 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 454 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 455 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 458 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 459 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 460 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 461 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 462 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 466 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 467 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 472 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 473 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 474 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 475 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 476 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 478 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 481 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 482 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 484 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 485 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 486 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 489 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 490 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 492 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 493 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 494 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 495 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 497 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 498 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 499 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 500 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 501 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 502 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 505 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 506 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 507 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 508 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 510 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 512 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 513 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 514 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 515 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 516 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 517 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 520 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 521 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 522 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 523 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 524 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 1.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.87 |
| Nodule | 0.37 |
| Rhizoplane | 4.03 |
| Rhizosphere | 74.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000317 | 3300001979 | Bacteria | 20540 |
| 2 | JGI24740J21852_10082774 | 3300001979 | Bacteria | 838 |
| 3 | JGI24740J21852_10101924 | 3300001979 | Bacteria | 730 |
| 4 | JGI24740J21852_10176685 | 3300001979 | Bacteria | 529 |
| 5 | JGI24739J22299_10118348 | 3300001989 | Bacteria | 792 |
| 6 | JGI24737J22298_10246203 | 3300001990 | Bacteria | 528 |
| 7 | JGI24735J21928_10121791 | 3300002067 | Bacteria | 751 |
| 8 | JGI25162J39368_1000199 | 3300002737 | Bacteria | 63139 |
| 9 | JGI25152J39213_1001688 | 3300002773 | Bacteria | 9115 |
| 10 | JGI25152J39213_1003233 | 3300002773 | Bacteria | 5663 |
| 11 | JGI25151J46595_10003651 | 3300003187 | Bacteria | 8395 |
| 12 | JGI25151J46595_10050220 | 3300003187 | Bacteria | 1423 |
| 13 | JGI25165J46597_1000307 | 3300003214 | Bacteria | 59794 |
| 14 | JGI25165J46597_1003183 | 3300003214 | Bacteria | 4322 |
| 15 | JGI25160J50197_1018865 | 3300003354 | Bacteria | 2135 |
| 16 | Ga0055536_1005132 | 3300003781 | Bacteria | 6476 |
| 17 | Ga0055536_1005459 | 3300003781 | Bacteria | 6210 |
| 18 | Ga0055540_1033556 | 3300003792 | Bacteria | 1162 |
| 19 | Ga0055540_1099987 | 3300003792 | Bacteria | 541 |
| 20 | Ga0055531_10001759 | 3300003794 | Bacteria | 15441 |
| 21 | Ga0055531_10033269 | 3300003794 | Bacteria | 1664 |
| 22 | Ga0058692_1001101 | 3300003856 | Bacteria | 10465 |
| 23 | Ga0065704_10809058 | 3300005289 | Bacteria | 522 |
| 24 | Ga0065715_10038113 | 3300005293 | Bacteria | 1338 |
| 25 | Ga0070658_10037406 | 3300005327 | Bacteria | 3913 |
| 26 | Ga0070658_10120646 | 3300005327 | Bacteria | 2178 |
| 27 | Ga0070658_10230339 | 3300005327 | Bacteria | 1568 |
| 28 | Ga0070658_10962084 | 3300005327 | Bacteria | 742 |
| 29 | Ga0070658_11126232 | 3300005327 | Bacteria | 683 |
| 30 | Ga0070658_11245182 | 3300005327 | Bacteria | 647 |
| 31 | Ga0070658_11296796 | 3300005327 | Bacteria | 632 |
| 32 | Ga0070658_11897721 | 3300005327 | Bacteria | 515 |
| 33 | Ga0070676_10117486 | 3300005328 | Bacteria | 1665 |
| 34 | Ga0070676_10201527 | 3300005328 | Bacteria | 1305 |
| 35 | Ga0070683_100239781 | 3300005329 | Bacteria | 1724 |
| 36 | Ga0070683_100501443 | 3300005329 | Bacteria | 1160 |
| 37 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 38 | Ga0070670_100000061 | 3300005331 | Bacteria | 113254 |
| 39 | Ga0070670_100097305 | 3300005331 | Bacteria | 2532 |
| 40 | Ga0070670_100114793 | 3300005331 | Bacteria | 2321 |
| 41 | Ga0070670_100239057 | 3300005331 | Bacteria | 1581 |
| 42 | Ga0070670_100780865 | 3300005331 | Bacteria | 862 |
| 43 | Ga0070670_101031068 | 3300005331 | Bacteria | 749 |
| 44 | Ga0068869_100670951 | 3300005334 | Bacteria | 882 |
| 45 | Ga0070666_10156501 | 3300005335 | Bacteria | 1592 |
| 46 | Ga0070666_10243716 | 3300005335 | Bacteria | 1271 |
| 47 | Ga0070666_10308471 | 3300005335 | Bacteria | 1128 |
| 48 | Ga0070666_10623783 | 3300005335 | Bacteria | 788 |
| 49 | Ga0070666_11486998 | 3300005335 | Bacteria | 507 |
| 50 | Ga0070680_100028910 | 3300005336 | Bacteria | 4449 |
| 51 | Ga0070680_100063220 | 3300005336 | Bacteria | 3031 |
| 52 | Ga0070680_100592280 | 3300005336 | Bacteria | 952 |
| 53 | Ga0070680_100719008 | 3300005336 | Bacteria | 859 |
| 54 | Ga0070682_100201014 | 3300005337 | Bacteria | 1406 |
| 55 | Ga0070682_101284689 | 3300005337 | Bacteria | 621 |
| 56 | Ga0068868_100054268 | 3300005338 | Bacteria | 3158 |
| 57 | Ga0068868_101352203 | 3300005338 | Bacteria | 663 |
| 58 | Ga0070660_100049520 | 3300005339 | Bacteria | 3230 |
| 59 | Ga0070660_100062622 | 3300005339 | Bacteria | 2890 |
| 60 | Ga0070660_100123508 | 3300005339 | Bacteria | 2067 |
| 61 | Ga0070660_100632862 | 3300005339 | Bacteria | 895 |
| 62 | Ga0070691_10006942 | 3300005341 | Bacteria | 5183 |
| 63 | Ga0070691_10468279 | 3300005341 | Bacteria | 723 |
| 64 | Ga0070661_100059856 | 3300005344 | Bacteria | 2794 |
| 65 | Ga0070661_100125177 | 3300005344 | Bacteria | 1927 |
| 66 | Ga0070661_100231753 | 3300005344 | Bacteria | 1419 |
| 67 | Ga0070661_100259299 | 3300005344 | Bacteria | 1344 |
| 68 | Ga0070661_100386980 | 3300005344 | Bacteria | 1103 |
| 69 | Ga0070661_100467090 | 3300005344 | Bacteria | 1006 |
| 70 | Ga0070661_100791305 | 3300005344 | Bacteria | 778 |
| 71 | Ga0070661_101162213 | 3300005344 | Bacteria | 644 |
| 72 | Ga0070661_101436225 | 3300005344 | Bacteria | 581 |
| 73 | Ga0070668_100000097 | 3300005347 | Bacteria | 53800 |
| 74 | Ga0070668_100001398 | 3300005347 | Bacteria | 17348 |
| 75 | Ga0070668_100006261 | 3300005347 | Bacteria | 8813 |
| 76 | Ga0070668_100023971 | 3300005347 | Bacteria | 4620 |
| 77 | Ga0070668_100026662 | 3300005347 | Bacteria | 4386 |
| 78 | Ga0070668_100397774 | 3300005347 | Bacteria | 1176 |
| 79 | Ga0070668_100696881 | 3300005347 | Bacteria | 895 |
| 80 | Ga0070668_100927278 | 3300005347 | Bacteria | 779 |
| 81 | Ga0070669_100007690 | 3300005353 | Bacteria | 7706 |
| 82 | Ga0070669_100052266 | 3300005353 | Bacteria | 2989 |
| 83 | Ga0070669_100069357 | 3300005353 | Bacteria | 2604 |
| 84 | Ga0070669_100100055 | 3300005353 | Bacteria | 2186 |
| 85 | Ga0070669_100308986 | 3300005353 | Bacteria | 1274 |
| 86 | Ga0070669_101586422 | 3300005353 | Bacteria | 570 |
| 87 | Ga0070675_100461172 | 3300005354 | Bacteria | 1141 |
| 88 | Ga0070675_101543746 | 3300005354 | Bacteria | 612 |
| 89 | Ga0070671_100000342 | 3300005355 | Bacteria | 32006 |
| 90 | Ga0070671_100000890 | 3300005355 | Bacteria | 21800 |
| 91 | Ga0070671_100151193 | 3300005355 | Bacteria | 1960 |
| 92 | Ga0070671_100183764 | 3300005355 | Bacteria | 1771 |
| 93 | Ga0070671_100494765 | 3300005355 | Bacteria | 1051 |
| 94 | Ga0070674_101638054 | 3300005356 | Bacteria | 581 |
| 95 | Ga0070688_101292261 | 3300005365 | Bacteria | 589 |
| 96 | Ga0070659_100000206 | 3300005366 | Bacteria | 45867 |
| 97 | Ga0070659_100005903 | 3300005366 | Bacteria | 8821 |
| 98 | Ga0070659_100020949 | 3300005366 | Bacteria | 4972 |
| 99 | Ga0070659_100207804 | 3300005366 | Bacteria | 1613 |
| 100 | Ga0070659_101427097 | 3300005366 | Bacteria | 616 |
| 101 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 102 | Ga0070667_100040040 | 3300005367 | Bacteria | 3929 |
| 103 | Ga0070667_100046049 | 3300005367 | Bacteria | 3668 |
| 104 | Ga0070667_100066504 | 3300005367 | Bacteria | 3063 |
| 105 | Ga0070667_100290300 | 3300005367 | Bacteria | 1470 |
| 106 | Ga0070667_101284997 | 3300005367 | Bacteria | 685 |
| 107 | Ga0070667_101628249 | 3300005367 | Bacteria | 607 |
| 108 | Ga0070705_100212578 | 3300005440 | Bacteria | 1334 |
| 109 | Ga0070708_100093937 | 3300005445 | Bacteria | 2736 |
| 110 | Ga0070708_100141843 | 3300005445 | Bacteria | 2228 |
| 111 | Ga0070708_101623113 | 3300005445 | Bacteria | 602 |
| 112 | Ga0070663_100483486 | 3300005455 | Bacteria | 1025 |
| 113 | Ga0070663_100738339 | 3300005455 | Bacteria | 840 |
| 114 | Ga0070663_100775075 | 3300005455 | Bacteria | 821 |
| 115 | Ga0070663_100991189 | 3300005455 | Bacteria | 730 |
| 116 | Ga0070663_100998649 | 3300005455 | Bacteria | 727 |
| 117 | Ga0070678_100246264 | 3300005456 | Bacteria | 1497 |
| 118 | Ga0070678_100879050 | 3300005456 | Bacteria | 818 |
| 119 | Ga0070662_100079996 | 3300005457 | Bacteria | 2432 |
| 120 | Ga0070662_100161703 | 3300005457 | Bacteria | 1752 |
| 121 | Ga0070662_100255983 | 3300005457 | Bacteria | 1409 |
| 122 | Ga0070662_101323726 | 3300005457 | Bacteria | 620 |
| 123 | Ga0070681_10077685 | 3300005458 | Bacteria | 3277 |
| 124 | Ga0070681_10101301 | 3300005458 | Bacteria | 2825 |
| 125 | Ga0070681_10477736 | 3300005458 | Bacteria | 1159 |
| 126 | Ga0070681_10750034 | 3300005458 | Bacteria | 893 |
| 127 | Ga0070681_10806527 | 3300005458 | Bacteria | 856 |
| 128 | Ga0068867_100243024 | 3300005459 | Bacteria | 1461 |
| 129 | Ga0070706_100530272 | 3300005467 | Bacteria | 1095 |
| 130 | Ga0070707_101049691 | 3300005468 | Bacteria | 780 |
| 131 | Ga0070698_100132761 | 3300005471 | Bacteria | 2444 |
| 132 | Ga0070699_100157214 | 3300005518 | Bacteria | 2012 |
| 133 | Ga0070679_100003462 | 3300005530 | Bacteria | 14454 |
| 134 | Ga0070679_100882651 | 3300005530 | Bacteria | 838 |
| 135 | Ga0070679_101033610 | 3300005530 | Bacteria | 766 |
| 136 | Ga0070679_101115383 | 3300005530 | Bacteria | 734 |
| 137 | Ga0070684_100106711 | 3300005535 | Bacteria | 2508 |
| 138 | Ga0070684_100858679 | 3300005535 | Bacteria | 850 |
| 139 | Ga0070684_102357950 | 3300005535 | Bacteria | 502 |
| 140 | Ga0068853_100007846 | 3300005539 | Bacteria | 8560 |
| 141 | Ga0068853_100028237 | 3300005539 | Bacteria | 4717 |
| 142 | Ga0068853_100177892 | 3300005539 | Bacteria | 1928 |
| 143 | Ga0068853_100296779 | 3300005539 | Bacteria | 1493 |
| 144 | Ga0068853_101012572 | 3300005539 | Bacteria | 800 |
| 145 | Ga0068853_101504580 | 3300005539 | Bacteria | 652 |
| 146 | Ga0068853_101758587 | 3300005539 | Bacteria | 601 |
| 147 | Ga0070672_100309369 | 3300005543 | Bacteria | 1341 |
| 148 | Ga0070672_100969192 | 3300005543 | Bacteria | 753 |
| 149 | Ga0070672_101423668 | 3300005543 | Bacteria | 620 |
| 150 | Ga0070696_100893054 | 3300005546 | Bacteria | 737 |
| 151 | Ga0070693_100138542 | 3300005547 | Bacteria | 1529 |
| 152 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 153 | Ga0070665_100000278 | 3300005548 | Bacteria | 84248 |
| 154 | Ga0070665_100000483 | 3300005548 | Bacteria | 57237 |
| 155 | Ga0070665_100003518 | 3300005548 | Bacteria | 16659 |
| 156 | Ga0070665_100006101 | 3300005548 | Bacteria | 12320 |
| 157 | Ga0070665_100042615 | 3300005548 | Bacteria | 4562 |
| 158 | Ga0070665_100100096 | 3300005548 | Bacteria | 2903 |
| 159 | Ga0070665_100205584 | 3300005548 | Bacteria | 1969 |
| 160 | Ga0070665_100262649 | 3300005548 | Bacteria | 1727 |
| 161 | Ga0070665_100442617 | 3300005548 | Bacteria | 1309 |
| 162 | Ga0070665_100706317 | 3300005548 | Bacteria | 1021 |
| 163 | Ga0070665_101173048 | 3300005548 | Bacteria | 779 |
| 164 | Ga0070665_101617521 | 3300005548 | Bacteria | 656 |
| 165 | Ga0070665_101697412 | 3300005548 | Bacteria | 639 |
| 166 | Ga0070665_102590297 | 3300005548 | Unclassified | 508 |
| 167 | Ga0070704_101214572 | 3300005549 | Bacteria | 688 |
| 168 | Ga0070704_101661965 | 3300005549 | Bacteria | 590 |
| 169 | Ga0068855_100114613 | 3300005563 | Bacteria | 3090 |
| 170 | Ga0068855_100164536 | 3300005563 | Bacteria | 2515 |
| 171 | Ga0068855_100227544 | 3300005563 | Bacteria | 2089 |
| 172 | Ga0068855_100361294 | 3300005563 | Bacteria | 1598 |
| 173 | Ga0068855_100510096 | 3300005563 | Bacteria | 1306 |
| 174 | Ga0068855_100604355 | 3300005563 | Bacteria | 1182 |
| 175 | Ga0068855_100643314 | 3300005563 | Bacteria | 1139 |
| 176 | Ga0068855_100884043 | 3300005563 | Bacteria | 945 |
| 177 | Ga0068855_100903913 | 3300005563 | Bacteria | 932 |
| 178 | Ga0068855_101077840 | 3300005563 | Bacteria | 841 |
| 179 | Ga0070664_100032151 | 3300005564 | Bacteria | 4388 |
| 180 | Ga0070664_100128100 | 3300005564 | Bacteria | 2228 |
| 181 | Ga0070664_100539963 | 3300005564 | Bacteria | 1077 |
| 182 | Ga0070664_102348081 | 3300005564 | Bacteria | 506 |
| 183 | Ga0068857_100008234 | 3300005577 | Bacteria | 9010 |
| 184 | Ga0068857_100310468 | 3300005577 | Bacteria | 1455 |
| 185 | Ga0068857_100513179 | 3300005577 | Bacteria | 1126 |
| 186 | Ga0068857_100596708 | 3300005577 | Bacteria | 1044 |
| 187 | Ga0068857_100745242 | 3300005577 | Bacteria | 933 |
| 188 | Ga0068857_101551255 | 3300005577 | Bacteria | 646 |
| 189 | Ga0068857_102119091 | 3300005577 | Bacteria | 552 |
| 190 | Ga0068854_100011218 | 3300005578 | Bacteria | 5824 |
| 191 | Ga0068854_100216344 | 3300005578 | Bacteria | 1514 |
| 192 | Ga0068854_100696271 | 3300005578 | Bacteria | 877 |
| 193 | Ga0068854_100704745 | 3300005578 | Bacteria | 872 |
| 194 | Ga0068854_101008208 | 3300005578 | Bacteria | 738 |
| 195 | Ga0068856_100017487 | 3300005614 | Bacteria | 6948 |
| 196 | Ga0068856_100036110 | 3300005614 | Bacteria | 4846 |
| 197 | Ga0068856_100118032 | 3300005614 | Bacteria | 2654 |
| 198 | Ga0068856_100242993 | 3300005614 | Bacteria | 1815 |
| 199 | Ga0068856_100641513 | 3300005614 | Bacteria | 1083 |
| 200 | Ga0068856_101010843 | 3300005614 | Bacteria | 850 |
| 201 | Ga0068856_101691569 | 3300005614 | Bacteria | 645 |
| 202 | Ga0068856_102376714 | 3300005614 | Bacteria | 537 |
| 203 | Ga0068852_100019264 | 3300005616 | Bacteria | 5396 |
| 204 | Ga0068852_100073366 | 3300005616 | Bacteria | 3010 |
| 205 | Ga0068852_100131790 | 3300005616 | Bacteria | 2303 |
| 206 | Ga0068852_100144567 | 3300005616 | Bacteria | 2204 |
| 207 | Ga0068852_101508007 | 3300005616 | Bacteria | 695 |
| 208 | Ga0068852_102101990 | 3300005616 | Bacteria | 586 |
| 209 | Ga0068859_100000435 | 3300005617 | Bacteria | 41931 |
| 210 | Ga0068859_100049354 | 3300005617 | Bacteria | 4227 |
| 211 | Ga0068859_100183093 | 3300005617 | Bacteria | 2178 |
| 212 | Ga0068859_100814918 | 3300005617 | Bacteria | 1021 |
| 213 | Ga0068859_101423464 | 3300005617 | Bacteria | 765 |
| 214 | Ga0068859_102776195 | 3300005617 | Bacteria | 538 |
| 215 | Ga0068864_100000115 | 3300005618 | Bacteria | 79542 |
| 216 | Ga0068864_100000786 | 3300005618 | Bacteria | 26635 |
| 217 | Ga0068864_100026445 | 3300005618 | Bacteria | 4894 |
| 218 | Ga0068864_100555600 | 3300005618 | Bacteria | 1110 |
| 219 | Ga0068864_100611800 | 3300005618 | Bacteria | 1058 |
| 220 | Ga0068864_100680565 | 3300005618 | Bacteria | 1004 |
| 221 | Ga0068864_100892398 | 3300005618 | Bacteria | 877 |
| 222 | Ga0068866_10942109 | 3300005718 | Bacteria | 610 |
| 223 | Ga0068861_100155784 | 3300005719 | Bacteria | 1879 |
| 224 | Ga0068861_100400550 | 3300005719 | Bacteria | 1218 |
| 225 | Ga0068861_100627849 | 3300005719 | Bacteria | 990 |
| 226 | Ga0068861_100651681 | 3300005719 | Bacteria | 973 |
| 227 | Ga0068861_100913917 | 3300005719 | Bacteria | 832 |
| 228 | Ga0068851_10012066 | 3300005834 | Bacteria | 4068 |
| 229 | Ga0068851_10014841 | 3300005834 | Bacteria | 3705 |
| 230 | Ga0068851_10616181 | 3300005834 | Bacteria | 662 |
| 231 | Ga0068870_10839108 | 3300005840 | Bacteria | 645 |
| 232 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 233 | Ga0068863_100000392 | 3300005841 | Bacteria | 44421 |
| 234 | Ga0068863_100014231 | 3300005841 | Bacteria | 7665 |
| 235 | Ga0068863_100079690 | 3300005841 | Bacteria | 3101 |
| 236 | Ga0068863_100131031 | 3300005841 | Bacteria | 2394 |
| 237 | Ga0068863_100597867 | 3300005841 | Bacteria | 1092 |
| 238 | Ga0068863_101267707 | 3300005841 | Bacteria | 743 |
| 239 | Ga0068863_102123324 | 3300005841 | Bacteria | 572 |
| 240 | Ga0068858_100000031 | 3300005842 | Bacteria | 143397 |
| 241 | Ga0068858_100003423 | 3300005842 | Bacteria | 15780 |
| 242 | Ga0068858_100004211 | 3300005842 | Bacteria | 14164 |
| 243 | Ga0068858_100275097 | 3300005842 | Bacteria | 1603 |
| 244 | Ga0068858_100639209 | 3300005842 | Bacteria | 1034 |
| 245 | Ga0068860_100000128 | 3300005843 | Bacteria | 122731 |
| 246 | Ga0068860_100000145 | 3300005843 | Bacteria | 115830 |
| 247 | Ga0068860_100045797 | 3300005843 | Bacteria | 4171 |
| 248 | Ga0068860_100108311 | 3300005843 | Bacteria | 2656 |
| 249 | Ga0068860_101369569 | 3300005843 | Bacteria | 729 |
| 250 | Ga0068860_101726844 | 3300005843 | Bacteria | 648 |
| 251 | Ga0068862_100001627 | 3300005844 | Bacteria | 20442 |
| 252 | Ga0068862_100007701 | 3300005844 | Bacteria | 8910 |
| 253 | Ga0068862_100022748 | 3300005844 | Bacteria | 5245 |
| 254 | Ga0068862_100063108 | 3300005844 | Bacteria | 3188 |
| 255 | Ga0068862_100063168 | 3300005844 | Bacteria | 3186 |
| 256 | Ga0068862_100272019 | 3300005844 | Bacteria | 1550 |
| 257 | Ga0068862_100719416 | 3300005844 | Bacteria | 969 |
| 258 | Ga0068862_100835632 | 3300005844 | Bacteria | 902 |
| 259 | Ga0081540_1003960 | 3300005983 | Bacteria | 11507 |
| 260 | Ga0070717_11305739 | 3300006028 | Bacteria | 660 |
| 261 | Ga0075365_10374786 | 3300006038 | Bacteria | 1004 |
| 262 | Ga0075368_10002625 | 3300006042 | Bacteria | 5901 |
| 263 | Ga0075368_10007666 | 3300006042 | Bacteria | 3816 |
| 264 | Ga0075368_10088106 | 3300006042 | Bacteria | 1268 |
| 265 | Ga0075368_10281896 | 3300006042 | Bacteria | 714 |
| 266 | Ga0075363_100026589 | 3300006048 | Bacteria | 2961 |
| 267 | Ga0075363_100032636 | 3300006048 | Bacteria | 2706 |
| 268 | Ga0075363_100047395 | 3300006048 | Bacteria | 2282 |
| 269 | Ga0075363_100378161 | 3300006048 | Bacteria | 830 |
| 270 | Ga0075363_100856113 | 3300006048 | Bacteria | 555 |
| 271 | Ga0075364_10003475 | 3300006051 | Bacteria | 8968 |
| 272 | Ga0075364_10053598 | 3300006051 | Bacteria | 2636 |
| 273 | Ga0075364_10143115 | 3300006051 | Bacteria | 1609 |
| 274 | Ga0075364_10218379 | 3300006051 | Bacteria | 1293 |
| 275 | Ga0075364_10723759 | 3300006051 | Bacteria | 679 |
| 276 | Ga0070712_100207331 | 3300006175 | Bacteria | 1544 |
| 277 | Ga0070712_100926124 | 3300006175 | Bacteria | 752 |
| 278 | Ga0075362_10009435 | 3300006177 | Bacteria | 3774 |
| 279 | Ga0075362_10062334 | 3300006177 | Bacteria | 1689 |
| 280 | Ga0075367_10005360 | 3300006178 | Bacteria | 6357 |
| 281 | Ga0075367_10068389 | 3300006178 | Bacteria | 2131 |
| 282 | Ga0075367_10218474 | 3300006178 | Bacteria | 1192 |
| 283 | Ga0075367_10306281 | 3300006178 | Bacteria | 1000 |
| 284 | Ga0075367_10882675 | 3300006178 | Bacteria | 570 |
| 285 | Ga0075367_11045080 | 3300006178 | Bacteria | 522 |
| 286 | Ga0075369_10009705 | 3300006186 | Bacteria | 3747 |
| 287 | Ga0075369_10101645 | 3300006186 | Bacteria | 1290 |
| 288 | Ga0075369_10283175 | 3300006186 | Bacteria | 772 |
| 289 | Ga0075369_10424721 | 3300006186 | Bacteria | 628 |
| 290 | Ga0075369_10486736 | 3300006186 | Bacteria | 586 |
| 291 | Ga0075366_10022416 | 3300006195 | Bacteria | 3674 |
| 292 | Ga0075366_10030071 | 3300006195 | Bacteria | 3192 |
| 293 | Ga0075366_10375640 | 3300006195 | Bacteria | 874 |
| 294 | Ga0075366_10837511 | 3300006195 | Bacteria | 572 |
| 295 | Ga0075366_10986023 | 3300006195 | Bacteria | 525 |
| 296 | Ga0097621_100309224 | 3300006237 | Bacteria | 1398 |
| 297 | Ga0097621_100910367 | 3300006237 | Bacteria | 820 |
| 298 | Ga0075370_10005219 | 3300006353 | Bacteria | 6426 |
| 299 | Ga0075370_10013637 | 3300006353 | Bacteria | 4325 |
| 300 | Ga0075370_10039168 | 3300006353 | Bacteria | 2670 |
| 301 | Ga0075370_10337651 | 3300006353 | Bacteria | 899 |
| 302 | Ga0075370_10394678 | 3300006353 | Bacteria | 830 |
| 303 | Ga0075370_10700728 | 3300006353 | Bacteria | 616 |
| 304 | Ga0075370_10707771 | 3300006353 | Bacteria | 612 |
| 305 | Ga0075370_10708620 | 3300006353 | Bacteria | 612 |
| 306 | Ga0068871_100383643 | 3300006358 | Bacteria | 1249 |
| 307 | Ga0068871_100892381 | 3300006358 | Bacteria | 824 |
| 308 | Ga0075433_11145322 | 3300006852 | Bacteria | 676 |
| 309 | Ga0068865_100004059 | 3300006881 | Bacteria | 8794 |
| 310 | Ga0097620_100000435 | 3300006931 | Bacteria | 41931 |
| 311 | Ga0097620_100049353 | 3300006931 | Bacteria | 4227 |
| 312 | Ga0097620_100183098 | 3300006931 | Bacteria | 2178 |
| 313 | Ga0097620_100814973 | 3300006931 | Bacteria | 1021 |
| 314 | Ga0097620_101423286 | 3300006931 | Bacteria | 765 |
| 315 | Ga0097620_102775686 | 3300006931 | Bacteria | 538 |
| 316 | Ga0079104_1030697 | 3300006946 | Bacteria | 1339 |
| 317 | Ga0099826_10000704 | 3300006948 | Bacteria | 17489 |
| 318 | Ga0099826_10014270 | 3300006948 | Bacteria | 5999 |
| 319 | Ga0105251_10212891 | 3300009011 | Bacteria | 870 |
| 320 | Ga0105251_10536935 | 3300009011 | Bacteria | 550 |
| 321 | Ga0105244_10194446 | 3300009036 | Bacteria | 958 |
| 322 | Ga0105250_10006718 | 3300009092 | Bacteria | 4998 |
| 323 | Ga0105240_10043434 | 3300009093 | Bacteria | 5719 |
| 324 | Ga0105240_10073611 | 3300009093 | Bacteria | 4218 |
| 325 | Ga0105240_10076980 | 3300009093 | Bacteria | 4111 |
| 326 | Ga0105240_10081004 | 3300009093 | Bacteria | 3991 |
| 327 | Ga0105240_10104804 | 3300009093 | Bacteria | 3434 |
| 328 | Ga0105240_11361855 | 3300009093 | Bacteria | 747 |
| 329 | Ga0105240_12454470 | 3300009093 | Bacteria | 539 |
| 330 | Ga0105245_11822568 | 3300009098 | Bacteria | 661 |
| 331 | Ga0105245_11950873 | 3300009098 | Bacteria | 640 |
| 332 | Ga0105247_10168493 | 3300009101 | Bacteria | 1455 |
| 333 | Ga0105247_10515003 | 3300009101 | Bacteria | 874 |
| 334 | Ga0114129_12232847 | 3300009147 | Bacteria | 658 |
| 335 | Ga0105243_10009275 | 3300009148 | Bacteria | 7510 |
| 336 | Ga0105243_10559294 | 3300009148 | Bacteria | 1094 |
| 337 | Ga0105243_11202764 | 3300009148 | Bacteria | 771 |
| 338 | Ga0105241_10519968 | 3300009174 | Bacteria | 1064 |
| 339 | Ga0105241_10863091 | 3300009174 | Bacteria | 838 |
| 340 | Ga0105241_11400609 | 3300009174 | Bacteria | 669 |
| 341 | Ga0105241_11610100 | 3300009174 | Bacteria | 628 |
| 342 | Ga0105242_10055341 | 3300009176 | Bacteria | 3245 |
| 343 | Ga0105242_10399698 | 3300009176 | Bacteria | 1282 |
| 344 | Ga0105242_13164752 | 3300009176 | Bacteria | 511 |
| 345 | Ga0105248_10007787 | 3300009177 | Bacteria | 11756 |
| 346 | Ga0105248_10038574 | 3300009177 | Bacteria | 5347 |
| 347 | Ga0105248_10041310 | 3300009177 | Bacteria | 5170 |
| 348 | Ga0105248_10082220 | 3300009177 | Bacteria | 3621 |
| 349 | Ga0105248_10102723 | 3300009177 | Bacteria | 3222 |
| 350 | Ga0105248_10286371 | 3300009177 | Bacteria | 1855 |
| 351 | Ga0105248_10543159 | 3300009177 | Bacteria | 1311 |
| 352 | Ga0105248_10626607 | 3300009177 | Bacteria | 1213 |
| 353 | Ga0105248_11541333 | 3300009177 | Bacteria | 753 |
| 354 | Ga0105237_10214516 | 3300009545 | Bacteria | 1925 |
| 355 | Ga0105237_11020032 | 3300009545 | Bacteria | 834 |
| 356 | Ga0105238_10026734 | 3300009551 | Bacteria | 5882 |
| 357 | Ga0105238_10087665 | 3300009551 | Bacteria | 3099 |
| 358 | Ga0105238_10191222 | 3300009551 | Bacteria | 2023 |
| 359 | Ga0105238_10345589 | 3300009551 | Bacteria | 1476 |
| 360 | Ga0105238_10367629 | 3300009551 | Bacteria | 1428 |
| 361 | Ga0105238_11067770 | 3300009551 | Bacteria | 829 |
| 362 | Ga0105238_11394847 | 3300009551 | Bacteria | 728 |
| 363 | Ga0105238_12188600 | 3300009551 | Bacteria | 588 |
| 364 | Ga0105238_12604913 | 3300009551 | Bacteria | 542 |
| 365 | Ga0105249_10000410 | 3300009553 | Bacteria | 41122 |
| 366 | Ga0105249_10115487 | 3300009553 | Bacteria | 2543 |
| 367 | Ga0105249_11108098 | 3300009553 | Bacteria | 862 |
| 368 | Ga0105249_12274578 | 3300009553 | Bacteria | 615 |
| 369 | Ga0105239_10288771 | 3300010375 | Bacteria | 1847 |
| 370 | Ga0105239_10464722 | 3300010375 | Bacteria | 1436 |
| 371 | Ga0105239_11367739 | 3300010375 | Bacteria | 817 |
| 372 | Ga0105239_12009977 | 3300010375 | Bacteria | 671 |
| 373 | Ga0105239_12651460 | 3300010375 | Bacteria | 585 |
| 374 | Ga0105246_10073748 | 3300011119 | Bacteria | 2410 |
| 375 | Ga0105246_10456512 | 3300011119 | Bacteria | 1075 |
| 376 | Ga0157373_10008653 | 3300013100 | Bacteria | 7550 |
| 377 | Ga0157371_10000004 | 3300013102 | Bacteria | 512593 |
| 378 | Ga0157371_10032519 | 3300013102 | Bacteria | 3753 |
| 379 | Ga0157371_10205940 | 3300013102 | Bacteria | 1411 |
| 380 | Ga0157371_10504488 | 3300013102 | Bacteria | 894 |
| 381 | Ga0157370_10001047 | 3300013104 | Bacteria | 34825 |
| 382 | Ga0157370_10026878 | 3300013104 | Bacteria | 5678 |
| 383 | Ga0157370_10169243 | 3300013104 | Bacteria | 2031 |
| 384 | Ga0157370_10198035 | 3300013104 | Bacteria | 1864 |
| 385 | Ga0157370_10218409 | 3300013104 | Bacteria | 1766 |
| 386 | Ga0157370_10244147 | 3300013104 | Bacteria | 1661 |
| 387 | Ga0157370_11741633 | 3300013104 | Bacteria | 559 |
| 388 | Ga0157369_10291159 | 3300013105 | Bacteria | 1700 |
| 389 | Ga0157369_10295251 | 3300013105 | Bacteria | 1686 |
| 390 | Ga0157369_11019070 | 3300013105 | Bacteria | 847 |
| 391 | Ga0157374_10174233 | 3300013296 | Bacteria | 2100 |
| 392 | Ga0157374_10471786 | 3300013296 | Bacteria | 1257 |
| 393 | Ga0157378_10757173 | 3300013297 | Bacteria | 994 |
| 394 | Ga0157378_11139770 | 3300013297 | Bacteria | 818 |
| 395 | Ga0163162_10027619 | 3300013306 | Bacteria | 5613 |
| 396 | Ga0163162_10063898 | 3300013306 | Bacteria | 3725 |
| 397 | Ga0163162_10619135 | 3300013306 | Bacteria | 1208 |
| 398 | Ga0163162_10710773 | 3300013306 | Bacteria | 1126 |
| 399 | Ga0163162_12092666 | 3300013306 | Bacteria | 649 |
| 400 | Ga0157372_10056762 | 3300013307 | Bacteria | 4375 |
| 401 | Ga0157372_10286129 | 3300013307 | Bacteria | 1917 |
| 402 | Ga0157372_11097531 | 3300013307 | Bacteria | 921 |
| 403 | Ga0157372_11248851 | 3300013307 | Bacteria | 858 |
| 404 | Ga0157372_11388633 | 3300013307 | Bacteria | 810 |
| 405 | Ga0157372_11527146 | 3300013307 | Bacteria | 769 |
| 406 | Ga0157375_11989773 | 3300013308 | Bacteria | 691 |
| 407 | Ga0163163_10033603 | 3300014325 | Bacteria | 4963 |
| 408 | Ga0163163_10072795 | 3300014325 | Bacteria | 3426 |
| 409 | Ga0163163_10313723 | 3300014325 | Bacteria | 1621 |
| 410 | Ga0163163_11233002 | 3300014325 | Bacteria | 810 |
| 411 | Ga0163163_11558363 | 3300014325 | Bacteria | 722 |
| 412 | Ga0163163_13014387 | 3300014325 | Bacteria | 525 |
| 413 | Ga0157380_10952059 | 3300014326 | Bacteria | 889 |
| 414 | Ga0157380_11914231 | 3300014326 | Bacteria | 654 |
| 415 | Ga0182008_10269253 | 3300014497 | Bacteria | 883 |
| 416 | Ga0157377_11208318 | 3300014745 | Bacteria | 586 |
| 417 | Ga0157379_10007276 | 3300014968 | Bacteria | 9581 |
| 418 | Ga0157379_10080776 | 3300014968 | Bacteria | 2913 |
| 419 | Ga0157379_10187762 | 3300014968 | Bacteria | 1868 |
| 420 | Ga0157379_10359470 | 3300014968 | Bacteria | 1334 |
| 421 | Ga0157379_10482129 | 3300014968 | Bacteria | 1148 |
| 422 | Ga0157379_11119088 | 3300014968 | Bacteria | 755 |
| 423 | Ga0157376_10470617 | 3300014969 | Bacteria | 1229 |
| 424 | Ga0157376_10519222 | 3300014969 | Bacteria | 1174 |
| 425 | Ga0157376_10792822 | 3300014969 | Bacteria | 959 |
| 426 | Ga0182006_1131262 | 3300015261 | Bacteria | 862 |
| 427 | Ga0182005_1004873 | 3300015265 | Bacteria | 4265 |
| 428 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 429 | Ga0163161_10344065 | 3300017792 | Bacteria | 1184 |
| 430 | Ga0163161_11364776 | 3300017792 | Bacteria | 618 |
| 431 | Ga0206355_1455122 | 3300020076 | Bacteria | 524 |
| 432 | Ga0206354_10432311 | 3300020081 | Bacteria | 532 |
| 433 | Ga0213876_10006256 | 3300021384 | Bacteria | 6494 |
| 434 | Ga0213876_10035545 | 3300021384 | Bacteria | 2628 |
| 435 | Ga0209563_103803 | 3300025230 | Bacteria | 3030 |
| 436 | Ga0209437_100182 | 3300025233 | Bacteria | 130514 |
| 437 | Ga0209437_115842 | 3300025233 | Bacteria | 1023 |
| 438 | Ga0207425_1029390 | 3300025245 | Bacteria | 1108 |
| 439 | Ga0207425_1041137 | 3300025245 | Bacteria | 880 |
| 440 | Ga0207425_1062936 | 3300025245 | Bacteria | 651 |
| 441 | Ga0209026_1009684 | 3300025250 | Bacteria | 1866 |
| 442 | Ga0209026_1054154 | 3300025250 | Bacteria | 569 |
| 443 | Ga0209026_1062172 | 3300025250 | Bacteria | 524 |
| 444 | Ga0209677_100265 | 3300025253 | Bacteria | 35526 |
| 445 | Ga0209148_1026954 | 3300025254 | Bacteria | 888 |
| 446 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 447 | Ga0209129_1004912 | 3300025258 | Bacteria | 4987 |
| 448 | Ga0209233_1000231 | 3300025261 | Bacteria | 97534 |
| 449 | Ga0209233_1000255 | 3300025261 | Bacteria | 82230 |
| 450 | Ga0209233_1072761 | 3300025261 | Bacteria | 631 |
| 451 | Ga0209565_1000641 | 3300025263 | Bacteria | 22666 |
| 452 | Ga0209455_1016011 | 3300025272 | Bacteria | 1626 |
| 453 | Ga0209455_1017988 | 3300025272 | Bacteria | 1463 |
| 454 | Ga0209673_1000523 | 3300025273 | Bacteria | 62816 |
| 455 | Ga0209673_1021682 | 3300025273 | Bacteria | 2239 |
| 456 | Ga0209673_1074035 | 3300025273 | Bacteria | 801 |
| 457 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 458 | Ga0209676_1000061 | 3300025292 | Bacteria | 332674 |
| 459 | Ga0209676_1000679 | 3300025292 | Bacteria | 48245 |
| 460 | Ga0209025_1000553 | 3300025294 | Bacteria | 69760 |
| 461 | Ga0209025_1003440 | 3300025294 | Bacteria | 14990 |
| 462 | Ga0209025_1042265 | 3300025294 | Bacteria | 1939 |
| 463 | Ga0209564_1033319 | 3300025295 | Bacteria | 1534 |
| 464 | Ga0209758_1050577 | 3300025297 | Bacteria | 1456 |
| 465 | Ga0209758_1066324 | 3300025297 | Bacteria | 1160 |
| 466 | Ga0209050_1013814 | 3300025298 | Bacteria | 3547 |
| 467 | Ga0209050_1014339 | 3300025298 | Bacteria | 3424 |
| 468 | Ga0209050_1017660 | 3300025298 | Bacteria | 2825 |
| 469 | Ga0209050_1062943 | 3300025298 | Bacteria | 867 |
| 470 | Ga0209050_1078881 | 3300025298 | Bacteria | 707 |
| 471 | Ga0209256_1002428 | 3300025299 | Bacteria | 15246 |
| 472 | Ga0209256_1006344 | 3300025299 | Bacteria | 6309 |
| 473 | Ga0209256_1012333 | 3300025299 | Bacteria | 3292 |
| 474 | Ga0209256_1079385 | 3300025299 | Bacteria | 720 |
| 475 | Ga0207426_1000798 | 3300025302 | Bacteria | 34125 |
| 476 | Ga0209051_1014576 | 3300025303 | Bacteria | 3660 |
| 477 | Ga0209051_1027659 | 3300025303 | Bacteria | 2255 |
| 478 | Ga0209051_1028291 | 3300025303 | Bacteria | 2216 |
| 479 | Ga0209051_1029985 | 3300025303 | Bacteria | 2119 |
| 480 | Ga0209257_1000199 | 3300025304 | Bacteria | 148045 |
| 481 | Ga0209257_1000944 | 3300025304 | Bacteria | 40166 |
| 482 | Ga0209257_1047759 | 3300025304 | Bacteria | 1229 |
| 483 | Ga0207656_10042169 | 3300025321 | Bacteria | 1941 |
| 484 | Ga0207656_10077523 | 3300025321 | Bacteria | 1488 |
| 485 | Ga0207656_10507384 | 3300025321 | Bacteria | 612 |
| 486 | Ga0207696_1034957 | 3300025711 | Bacteria | 1498 |
| 487 | Ga0207710_10192911 | 3300025900 | Bacteria | 1003 |
| 488 | Ga0207710_10224133 | 3300025900 | Bacteria | 934 |
| 489 | Ga0207680_10109945 | 3300025903 | Bacteria | 1786 |
| 490 | Ga0207680_10310106 | 3300025903 | Bacteria | 1101 |
| 491 | Ga0207680_10314530 | 3300025903 | Bacteria | 1094 |
| 492 | Ga0207680_10618778 | 3300025903 | Bacteria | 775 |
| 493 | Ga0207647_10320327 | 3300025904 | Bacteria | 881 |
| 494 | Ga0207645_10171016 | 3300025907 | Bacteria | 1424 |
| 495 | Ga0207643_10960303 | 3300025908 | Bacteria | 553 |
| 496 | Ga0207705_10007993 | 3300025909 | Bacteria | 7759 |
| 497 | Ga0207705_10089421 | 3300025909 | Bacteria | 2254 |
| 498 | Ga0207705_10098335 | 3300025909 | Bacteria | 2150 |
| 499 | Ga0207705_10214787 | 3300025909 | Bacteria | 1459 |
| 500 | Ga0207705_10428991 | 3300025909 | Bacteria | 1024 |
| 501 | Ga0207705_10819447 | 3300025909 | Bacteria | 722 |
| 502 | Ga0207654_10329634 | 3300025911 | Bacteria | 1046 |
| 503 | Ga0207654_10602770 | 3300025911 | Bacteria | 784 |
| 504 | Ga0207654_10829254 | 3300025911 | Bacteria | 669 |
| 505 | Ga0207654_11338738 | 3300025911 | Bacteria | 522 |
| 506 | Ga0207654_11365928 | 3300025911 | Bacteria | 517 |
| 507 | Ga0207707_10016260 | 3300025912 | Bacteria | 6490 |
| 508 | Ga0207707_10050471 | 3300025912 | Bacteria | 3624 |
| 509 | Ga0207707_10202302 | 3300025912 | Bacteria | 1731 |
| 510 | Ga0207707_10561843 | 3300025912 | Bacteria | 969 |
| 511 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 512 | Ga0207695_10001670 | 3300025913 | Bacteria | 35733 |
| 513 | Ga0207695_10001727 | 3300025913 | Bacteria | 34901 |
| 514 | Ga0207695_10015061 | 3300025913 | Bacteria | 9122 |
| 515 | Ga0207695_10018020 | 3300025913 | Bacteria | 8176 |
| 516 | Ga0207695_10021597 | 3300025913 | Bacteria | 7340 |
| 517 | Ga0207695_10952896 | 3300025913 | Bacteria | 738 |
| 518 | Ga0207695_11213074 | 3300025913 | Bacteria | 635 |
| 519 | Ga0207695_11313748 | 3300025913 | Bacteria | 604 |
| 520 | Ga0207695_11755744 | 3300025913 | Bacteria | 502 |
| 521 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 522 | Ga0207671_10102970 | 3300025914 | Bacteria | 2164 |
| 523 | Ga0207671_10247897 | 3300025914 | Bacteria | 1400 |
| 524 | Ga0207671_10512235 | 3300025914 | Bacteria | 957 |
| 525 | Ga0207693_10238977 | 3300025915 | Bacteria | 1426 |
| 526 | Ga0207663_10524440 | 3300025916 | Bacteria | 923 |
| 527 | Ga0207660_10111031 | 3300025917 | Bacteria | 2063 |
| 528 | Ga0207660_10129788 | 3300025917 | Bacteria | 1917 |
| 529 | Ga0207660_10495248 | 3300025917 | Bacteria | 991 |
| 530 | Ga0207660_11279587 | 3300025917 | Bacteria | 596 |
| 531 | Ga0207657_10012251 | 3300025919 | Bacteria | 8472 |
| 532 | Ga0207657_10023890 | 3300025919 | Bacteria | 5677 |
| 533 | Ga0207657_10120748 | 3300025919 | Bacteria | 2156 |
| 534 | Ga0207657_10157456 | 3300025919 | Bacteria | 1846 |
| 535 | Ga0207657_10626768 | 3300025919 | Bacteria | 838 |
| 536 | Ga0207649_10090983 | 3300025920 | Bacteria | 1998 |
| 537 | Ga0207649_10108801 | 3300025920 | Bacteria | 1848 |
| 538 | Ga0207649_10128000 | 3300025920 | Bacteria | 1721 |
| 539 | Ga0207649_10449557 | 3300025920 | Bacteria | 972 |
| 540 | Ga0207649_10571109 | 3300025920 | Bacteria | 867 |
| 541 | Ga0207649_10892428 | 3300025920 | Bacteria | 697 |
| 542 | Ga0207652_10024709 | 3300025921 | Bacteria | 4987 |
| 543 | Ga0207652_10592795 | 3300025921 | Bacteria | 994 |
| 544 | Ga0207646_10489633 | 3300025922 | Bacteria | 1108 |
| 545 | Ga0207681_10069475 | 3300025923 | Bacteria | 2450 |
| 546 | Ga0207681_10106943 | 3300025923 | Bacteria | 2028 |
| 547 | Ga0207681_11272991 | 3300025923 | Bacteria | 618 |
| 548 | Ga0207694_10051518 | 3300025924 | Bacteria | 3190 |
| 549 | Ga0207694_10180029 | 3300025924 | Bacteria | 1714 |
| 550 | Ga0207694_10635561 | 3300025924 | Bacteria | 899 |
| 551 | Ga0207694_10661738 | 3300025924 | Bacteria | 880 |
| 552 | Ga0207694_10681830 | 3300025924 | Bacteria | 866 |
| 553 | Ga0207694_11307309 | 3300025924 | Bacteria | 613 |
| 554 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 555 | Ga0207650_10000630 | 3300025925 | Bacteria | 28133 |
| 556 | Ga0207650_10019108 | 3300025925 | Bacteria | 4815 |
| 557 | Ga0207650_10023019 | 3300025925 | Bacteria | 4415 |
| 558 | Ga0207650_10190641 | 3300025925 | Bacteria | 1638 |
| 559 | Ga0207659_10681360 | 3300025926 | Bacteria | 880 |
| 560 | Ga0207687_10168182 | 3300025927 | Bacteria | 1688 |
| 561 | Ga0207687_11292381 | 3300025927 | Bacteria | 627 |
| 562 | Ga0207687_11345682 | 3300025927 | Bacteria | 614 |
| 563 | Ga0207700_10774928 | 3300025928 | Bacteria | 857 |
| 564 | Ga0207644_10002578 | 3300025931 | Bacteria | 11664 |
| 565 | Ga0207644_10088031 | 3300025931 | Bacteria | 2309 |
| 566 | Ga0207644_10203056 | 3300025931 | Bacteria | 1564 |
| 567 | Ga0207644_10516404 | 3300025931 | Bacteria | 986 |
| 568 | Ga0207644_10677595 | 3300025931 | Bacteria | 859 |
| 569 | Ga0207690_10000129 | 3300025932 | Bacteria | 62350 |
| 570 | Ga0207690_10325308 | 3300025932 | Bacteria | 1210 |
| 571 | Ga0207690_10514721 | 3300025932 | Bacteria | 969 |
| 572 | Ga0207690_10895278 | 3300025932 | Bacteria | 736 |
| 573 | Ga0207690_11293884 | 3300025932 | Bacteria | 609 |
| 574 | Ga0207706_10032271 | 3300025933 | Bacteria | 4664 |
| 575 | Ga0207706_10145037 | 3300025933 | Bacteria | 2088 |
| 576 | Ga0207706_10433526 | 3300025933 | Bacteria | 1138 |
| 577 | Ga0207706_10491611 | 3300025933 | Bacteria | 1060 |
| 578 | Ga0207706_11090220 | 3300025933 | Bacteria | 668 |
| 579 | Ga0207686_10025144 | 3300025934 | Bacteria | 3459 |
| 580 | Ga0207709_10024990 | 3300025935 | Bacteria | 3417 |
| 581 | Ga0207709_11412384 | 3300025935 | Bacteria | 576 |
| 582 | Ga0207704_10000400 | 3300025938 | Bacteria | 19733 |
| 583 | Ga0207691_10538486 | 3300025940 | Bacteria | 990 |
| 584 | Ga0207711_10000887 | 3300025941 | Bacteria | 28843 |
| 585 | Ga0207711_10022877 | 3300025941 | Bacteria | 5231 |
| 586 | Ga0207711_10024435 | 3300025941 | Bacteria | 5063 |
| 587 | Ga0207711_10034735 | 3300025941 | Bacteria | 4271 |
| 588 | Ga0207711_10035994 | 3300025941 | Bacteria | 4199 |
| 589 | Ga0207711_10057489 | 3300025941 | Bacteria | 3344 |
| 590 | Ga0207711_10106029 | 3300025941 | Bacteria | 2493 |
| 591 | Ga0207711_10256278 | 3300025941 | Bacteria | 1607 |
| 592 | Ga0207711_10849418 | 3300025941 | Bacteria | 849 |
| 593 | Ga0207711_10901018 | 3300025941 | Bacteria | 822 |
| 594 | Ga0207661_10153261 | 3300025944 | Bacteria | 1994 |
| 595 | Ga0207661_11015844 | 3300025944 | Bacteria | 764 |
| 596 | Ga0207661_11223831 | 3300025944 | Bacteria | 691 |
| 597 | Ga0207661_11609772 | 3300025944 | Bacteria | 594 |
| 598 | Ga0207679_10035890 | 3300025945 | Bacteria | 3511 |
| 599 | Ga0207679_10107222 | 3300025945 | Bacteria | 2198 |
| 600 | Ga0207679_10159436 | 3300025945 | Bacteria | 1845 |
| 601 | Ga0207667_10043300 | 3300025949 | Bacteria | 4778 |
| 602 | Ga0207667_10067953 | 3300025949 | Bacteria | 3712 |
| 603 | Ga0207667_10110987 | 3300025949 | Bacteria | 2828 |
| 604 | Ga0207667_10180291 | 3300025949 | Bacteria | 2169 |
| 605 | Ga0207667_10340351 | 3300025949 | Bacteria | 1531 |
| 606 | Ga0207667_10459767 | 3300025949 | Bacteria | 1293 |
| 607 | Ga0207667_10473609 | 3300025949 | Bacteria | 1271 |
| 608 | Ga0207667_10803398 | 3300025949 | Bacteria | 937 |
| 609 | Ga0207667_11317066 | 3300025949 | Bacteria | 698 |
| 610 | Ga0207667_11558665 | 3300025949 | Bacteria | 630 |
| 611 | Ga0207651_11073139 | 3300025960 | Bacteria | 721 |
| 612 | Ga0207712_10001004 | 3300025961 | Bacteria | 20092 |
| 613 | Ga0207712_11270817 | 3300025961 | Bacteria | 657 |
| 614 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 615 | Ga0207668_10000507 | 3300025972 | Bacteria | 24393 |
| 616 | Ga0207668_10001494 | 3300025972 | Bacteria | 13660 |
| 617 | Ga0207668_10005956 | 3300025972 | Bacteria | 7185 |
| 618 | Ga0207668_10010307 | 3300025972 | Bacteria | 5644 |
| 619 | Ga0207668_10045259 | 3300025972 | Bacteria | 3000 |
| 620 | Ga0207668_10140712 | 3300025972 | Bacteria | 1855 |
| 621 | Ga0207668_10499171 | 3300025972 | Bacteria | 1046 |
| 622 | Ga0207668_10850330 | 3300025972 | Bacteria | 810 |
| 623 | Ga0207668_11267022 | 3300025972 | Bacteria | 663 |
| 624 | Ga0207640_10120452 | 3300025981 | Bacteria | 1879 |
| 625 | Ga0207640_10538390 | 3300025981 | Bacteria | 979 |
| 626 | Ga0207640_10717762 | 3300025981 | Bacteria | 859 |
| 627 | Ga0207640_10720827 | 3300025981 | Bacteria | 857 |
| 628 | Ga0207640_11353579 | 3300025981 | Bacteria | 637 |
| 629 | Ga0207640_11513818 | 3300025981 | Bacteria | 603 |
| 630 | Ga0207658_10000209 | 3300025986 | Bacteria | 61041 |
| 631 | Ga0207658_10013446 | 3300025986 | Bacteria | 5590 |
| 632 | Ga0207658_10019362 | 3300025986 | Bacteria | 4707 |
| 633 | Ga0207658_10063310 | 3300025986 | Bacteria | 2771 |
| 634 | Ga0207658_10237459 | 3300025986 | Bacteria | 1542 |
| 635 | Ga0207658_10238788 | 3300025986 | Bacteria | 1538 |
| 636 | Ga0207658_11287886 | 3300025986 | Bacteria | 668 |
| 637 | Ga0207677_10083680 | 3300026023 | Bacteria | 2297 |
| 638 | Ga0207677_10484827 | 3300026023 | Bacteria | 1066 |
| 639 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 640 | Ga0207703_10039636 | 3300026035 | Bacteria | 3765 |
| 641 | Ga0207703_10300534 | 3300026035 | Bacteria | 1464 |
| 642 | Ga0207703_10595679 | 3300026035 | Bacteria | 1045 |
| 643 | Ga0207703_10664568 | 3300026035 | Bacteria | 989 |
| 644 | Ga0207639_10010574 | 3300026041 | Bacteria | 6393 |
| 645 | Ga0207639_10025186 | 3300026041 | Bacteria | 4313 |
| 646 | Ga0207639_10109120 | 3300026041 | Bacteria | 2251 |
| 647 | Ga0207639_10260073 | 3300026041 | Bacteria | 1518 |
| 648 | Ga0207639_10355587 | 3300026041 | Bacteria | 1309 |
| 649 | Ga0207639_10601572 | 3300026041 | Bacteria | 1014 |
| 650 | Ga0207639_10903399 | 3300026041 | Bacteria | 825 |
| 651 | Ga0207639_11070835 | 3300026041 | Bacteria | 756 |
| 652 | Ga0207639_11391678 | 3300026041 | Bacteria | 658 |
| 653 | Ga0207639_11684718 | 3300026041 | Bacteria | 594 |
| 654 | Ga0207678_10128637 | 3300026067 | Bacteria | 2160 |
| 655 | Ga0207678_10157011 | 3300026067 | Bacteria | 1942 |
| 656 | Ga0207678_10353395 | 3300026067 | Bacteria | 1267 |
| 657 | Ga0207678_10874277 | 3300026067 | Bacteria | 794 |
| 658 | Ga0207678_10918614 | 3300026067 | Bacteria | 774 |
| 659 | Ga0207678_11388116 | 3300026067 | Bacteria | 621 |
| 660 | Ga0207708_11789061 | 3300026075 | Bacteria | 539 |
| 661 | Ga0207702_10020911 | 3300026078 | Bacteria | 5416 |
| 662 | Ga0207702_10105414 | 3300026078 | Bacteria | 2497 |
| 663 | Ga0207702_10160682 | 3300026078 | Bacteria | 2051 |
| 664 | Ga0207702_10270259 | 3300026078 | Bacteria | 1603 |
| 665 | Ga0207702_10535492 | 3300026078 | Bacteria | 1144 |
| 666 | Ga0207702_11030032 | 3300026078 | Bacteria | 817 |
| 667 | Ga0207702_11390768 | 3300026078 | Bacteria | 696 |
| 668 | Ga0207702_11535613 | 3300026078 | Bacteria | 659 |
| 669 | Ga0207702_12396472 | 3300026078 | Bacteria | 515 |
| 670 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 671 | Ga0207641_10000341 | 3300026088 | Bacteria | 56155 |
| 672 | Ga0207641_10017703 | 3300026088 | Bacteria | 5836 |
| 673 | Ga0207641_10241261 | 3300026088 | Bacteria | 1684 |
| 674 | Ga0207641_10377996 | 3300026088 | Bacteria | 1356 |
| 675 | Ga0207641_11101932 | 3300026088 | Bacteria | 792 |
| 676 | Ga0207648_10014268 | 3300026089 | Bacteria | 7345 |
| 677 | Ga0207648_11500664 | 3300026089 | Bacteria | 634 |
| 678 | Ga0207648_12061243 | 3300026089 | Bacteria | 532 |
| 679 | Ga0207676_10000255 | 3300026095 | Bacteria | 46136 |
| 680 | Ga0207676_10000797 | 3300026095 | Bacteria | 24574 |
| 681 | Ga0207676_10005948 | 3300026095 | Bacteria | 8607 |
| 682 | Ga0207676_10417656 | 3300026095 | Bacteria | 1257 |
| 683 | Ga0207676_10671535 | 3300026095 | Bacteria | 1001 |
| 684 | Ga0207676_11445148 | 3300026095 | Bacteria | 684 |
| 685 | Ga0207676_12038615 | 3300026095 | Bacteria | 572 |
| 686 | Ga0207674_10009842 | 3300026116 | Bacteria | 10885 |
| 687 | Ga0207674_10082106 | 3300026116 | Bacteria | 3225 |
| 688 | Ga0207674_10242139 | 3300026116 | Bacteria | 1751 |
| 689 | Ga0207674_10439688 | 3300026116 | Bacteria | 1261 |
| 690 | Ga0207674_10717466 | 3300026116 | Bacteria | 965 |
| 691 | Ga0207674_12109269 | 3300026116 | Bacteria | 528 |
| 692 | Ga0207675_100070063 | 3300026118 | Bacteria | 3277 |
| 693 | Ga0207675_100156670 | 3300026118 | Bacteria | 2170 |
| 694 | Ga0207675_100536319 | 3300026118 | Bacteria | 1168 |
| 695 | Ga0207675_100625164 | 3300026118 | Bacteria | 1081 |
| 696 | Ga0207683_10189655 | 3300026121 | Bacteria | 1866 |
| 697 | Ga0207683_10472003 | 3300026121 | Bacteria | 1157 |
| 698 | Ga0207683_11446344 | 3300026121 | Bacteria | 635 |
| 699 | Ga0207683_11710728 | 3300026121 | Bacteria | 578 |
| 700 | Ga0207698_10070086 | 3300026142 | Bacteria | 2776 |
| 701 | Ga0207698_10100302 | 3300026142 | Bacteria | 2398 |
| 702 | Ga0207698_10291534 | 3300026142 | Bacteria | 1514 |
| 703 | Ga0207698_10602913 | 3300026142 | Bacteria | 1083 |
| 704 | Ga0207698_11110804 | 3300026142 | Bacteria | 803 |
| 705 | Ga0207698_11319785 | 3300026142 | Bacteria | 736 |
| 706 | Ga0207698_11549291 | 3300026142 | Bacteria | 678 |
| 707 | Ga0207698_11691079 | 3300026142 | Bacteria | 648 |
| 708 | Ga0207698_12060132 | 3300026142 | Bacteria | 584 |
| 709 | Ga0207698_12118962 | 3300026142 | Bacteria | 576 |
| 710 | Ga0207698_12588170 | 3300026142 | Bacteria | 517 |
| 711 | Ga0209281_1023777 | 3300027111 | Bacteria | 1158 |
| 712 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 713 | Ga0209371_1000753 | 3300027312 | Bacteria | 27006 |
| 714 | Ga0209983_1113472 | 3300027665 | Bacteria | 616 |
| 715 | Ga0209282_1000849 | 3300027666 | Bacteria | 15779 |
| 716 | Ga0209966_1072905 | 3300027695 | Bacteria | 754 |
| 717 | Ga0209813_10088886 | 3300027866 | Bacteria | 1034 |
| 718 | Ga0209813_10147252 | 3300027866 | Bacteria | 841 |
| 719 | Ga0209813_10303949 | 3300027866 | Bacteria | 620 |
| 720 | Ga0209813_10337275 | 3300027866 | Bacteria | 594 |
| 721 | Ga0207428_10417551 | 3300027907 | Bacteria | 981 |
| 722 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 723 | Ga0268266_10000792 | 3300028379 | Bacteria | 42146 |
| 724 | Ga0268266_10001340 | 3300028379 | Bacteria | 29786 |
| 725 | Ga0268266_10018885 | 3300028379 | Bacteria | 5873 |
| 726 | Ga0268266_10096119 | 3300028379 | Bacteria | 2603 |
| 727 | Ga0268266_10161086 | 3300028379 | Bacteria | 2030 |
| 728 | Ga0268266_10728634 | 3300028379 | Bacteria | 956 |
| 729 | Ga0268266_10731974 | 3300028379 | Bacteria | 954 |
| 730 | Ga0268266_10740575 | 3300028379 | Bacteria | 948 |
| 731 | Ga0268266_11562466 | 3300028379 | Unclassified | 635 |
| 732 | Ga0268266_11607616 | 3300028379 | Bacteria | 625 |
| 733 | Ga0268265_10004003 | 3300028380 | Bacteria | 10375 |
| 734 | Ga0268265_10005054 | 3300028380 | Bacteria | 9055 |
| 735 | Ga0268265_10016564 | 3300028380 | Bacteria | 5067 |
| 736 | Ga0268265_10044261 | 3300028380 | Bacteria | 3314 |
| 737 | Ga0268265_10096703 | 3300028380 | Bacteria | 2374 |
| 738 | Ga0268265_10450092 | 3300028380 | Bacteria | 1202 |
| 739 | Ga0268265_11537479 | 3300028380 | Bacteria | 669 |
| 740 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 741 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 742 | Ga0268264_10016967 | 3300028381 | Bacteria | 5961 |
| 743 | Ga0268264_10028586 | 3300028381 | Bacteria | 4561 |
| 744 | Ga0265319_1157264 | 3300028563 | Bacteria | 703 |
| 745 | Ga0265334_10134763 | 3300028573 | Bacteria | 877 |
| 746 | Ga0265318_10002680 | 3300028577 | Bacteria | 9349 |
| 747 | Ga0307517_10000497 | 3300028786 | Bacteria | 67390 |
| 748 | Ga0307517_10082691 | 3300028786 | Bacteria | 2723 |
| 749 | Ga0307517_10488538 | 3300028786 | Bacteria | 629 |
| 750 | Ga0307517_10602099 | 3300028786 | Bacteria | 541 |
| 751 | Ga0307515_10054933 | 3300028794 | Bacteria | 5833 |
| 752 | Ga0307515_10066345 | 3300028794 | Bacteria | 5002 |
| 753 | Ga0307515_10627394 | 3300028794 | Bacteria | 686 |
| 754 | Ga0307515_10925088 | 3300028794 | Bacteria | 505 |
| 755 | Ga0265338_10018457 | 3300028800 | Bacteria | 7466 |
| 756 | Ga0265338_10044345 | 3300028800 | Bacteria | 4108 |
| 757 | Ga0265338_10083238 | 3300028800 | Bacteria | 2677 |
| 758 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 759 | Ga0268256_1003130 | 3300030500 | Bacteria | 7711 |
| 760 | Ga0307511_10014914 | 3300030521 | Bacteria | 7543 |
| 761 | Ga0316183_1171265 | 3300030742 | Bacteria | 504 |
| 762 | Ga0316183_1208086 | 3300030742 | Bacteria | 514 |
| 763 | Ga0316182_1361217 | 3300030745 | Bacteria | 905 |
| 764 | Ga0316182_1451093 | 3300030745 | Bacteria | 620 |
| 765 | Ga0265760_10086106 | 3300031090 | Bacteria | 978 |
| 766 | Ga0265330_10035499 | 3300031235 | Bacteria | 2224 |
| 767 | Ga0265330_10239705 | 3300031235 | Unclassified | 765 |
| 768 | Ga0265332_10052946 | 3300031238 | Bacteria | 1742 |
| 769 | Ga0265320_10051193 | 3300031240 | Bacteria | 2005 |
| 770 | Ga0265325_10002041 | 3300031241 | Bacteria | 13873 |
| 771 | Ga0265329_10024932 | 3300031242 | Bacteria | 1982 |
| 772 | Ga0265340_10095632 | 3300031247 | Bacteria | 1385 |
| 773 | Ga0265339_10003193 | 3300031249 | Bacteria | 11505 |
| 774 | Ga0265331_10017136 | 3300031250 | Bacteria | 3785 |
| 775 | Ga0265331_10319527 | 3300031250 | Unclassified | 695 |
| 776 | Ga0265327_10018935 | 3300031251 | Bacteria | 4249 |
| 777 | Ga0265327_10083111 | 3300031251 | Bacteria | 1577 |
| 778 | Ga0265316_10008753 | 3300031344 | Bacteria | 9358 |
| 779 | Ga0265316_10498578 | 3300031344 | Bacteria | 870 |
| 780 | Ga0307513_10000448 | 3300031456 | Bacteria | 59427 |
| 781 | Ga0307513_10009333 | 3300031456 | Bacteria | 12420 |
| 782 | Ga0307513_10507243 | 3300031456 | Bacteria | 923 |
| 783 | Ga0307513_10659130 | 3300031456 | Bacteria | 753 |
| 784 | Ga0307513_10990635 | 3300031456 | Bacteria | 550 |
| 785 | Ga0307408_100350310 | 3300031548 | Bacteria | 1253 |
| 786 | Ga0307408_101020152 | 3300031548 | Bacteria | 763 |
| 787 | Ga0307408_101460613 | 3300031548 | Bacteria | 645 |
| 788 | Ga0307408_101841299 | 3300031548 | Bacteria | 579 |
| 789 | Ga0265313_10000070 | 3300031595 | Bacteria | 99384 |
| 790 | Ga0265313_10004088 | 3300031595 | Bacteria | 11369 |
| 791 | Ga0265313_10007724 | 3300031595 | Bacteria | 7281 |
| 792 | Ga0307508_10404734 | 3300031616 | Bacteria | 956 |
| 793 | Ga0316575_10049055 | 3300031665 | Bacteria | 1680 |
| 794 | Ga0316579_10499764 | 3300031691 | Bacteria | 588 |
| 795 | Ga0265314_10011207 | 3300031711 | Bacteria | 7422 |
| 796 | Ga0265314_10034101 | 3300031711 | Bacteria | 3723 |
| 797 | Ga0265314_10104086 | 3300031711 | Bacteria | 1818 |
| 798 | Ga0265314_10380713 | 3300031711 | Bacteria | 768 |
| 799 | Ga0265314_10384211 | 3300031711 | Unclassified | 763 |
| 800 | Ga0265342_10243688 | 3300031712 | Bacteria | 961 |
| 801 | Ga0316578_10586102 | 3300031728 | Bacteria | 654 |
| 802 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 803 | Ga0307405_10215905 | 3300031731 | Bacteria | 1404 |
| 804 | Ga0307405_12161306 | 3300031731 | Bacteria | 500 |
| 805 | Ga0307413_10118701 | 3300031824 | Bacteria | 1786 |
| 806 | Ga0307413_10240404 | 3300031824 | Bacteria | 1336 |
| 807 | Ga0307413_10352999 | 3300031824 | Bacteria | 1135 |
| 808 | Ga0307413_10744247 | 3300031824 | Bacteria | 819 |
| 809 | Ga0307410_10151226 | 3300031852 | Bacteria | 1728 |
| 810 | Ga0307410_10407000 | 3300031852 | Bacteria | 1100 |
| 811 | Ga0307410_10506159 | 3300031852 | Bacteria | 994 |
| 812 | Ga0307410_11603655 | 3300031852 | Bacteria | 575 |
| 813 | Ga0307410_11866437 | 3300031852 | Bacteria | 534 |
| 814 | Ga0307410_12148422 | 3300031852 | Bacteria | 500 |
| 815 | Ga0326468_10100846 | 3300031889 | Bacteria | 532 |
| 816 | Ga0307406_10000538 | 3300031901 | Bacteria | 21814 |
| 817 | Ga0307406_10040954 | 3300031901 | Bacteria | 2884 |
| 818 | Ga0307406_10379229 | 3300031901 | Bacteria | 1114 |
| 819 | Ga0307406_10381357 | 3300031901 | Bacteria | 1111 |
| 820 | Ga0307406_10668542 | 3300031901 | Bacteria | 864 |
| 821 | Ga0307406_10838192 | 3300031901 | Bacteria | 778 |
| 822 | Ga0307406_11075264 | 3300031901 | Bacteria | 693 |
| 823 | Ga0307407_10024120 | 3300031903 | Bacteria | 3184 |
| 824 | Ga0307407_10065509 | 3300031903 | Bacteria | 2139 |
| 825 | Ga0307407_10342875 | 3300031903 | Bacteria | 1055 |
| 826 | Ga0307407_10413171 | 3300031903 | Bacteria | 971 |
| 827 | Ga0307407_10690478 | 3300031903 | Bacteria | 768 |
| 828 | Ga0307407_10843521 | 3300031903 | Bacteria | 700 |
| 829 | Ga0307407_11544024 | 3300031903 | Bacteria | 526 |
| 830 | Ga0307412_10361128 | 3300031911 | Bacteria | 1169 |
| 831 | Ga0307412_10483439 | 3300031911 | Bacteria | 1027 |
| 832 | Ga0307412_10581406 | 3300031911 | Bacteria | 945 |
| 833 | Ga0307412_11077282 | 3300031911 | Bacteria | 714 |
| 834 | Ga0307412_11282944 | 3300031911 | Bacteria | 659 |
| 835 | Ga0307412_11625459 | 3300031911 | Bacteria | 590 |
| 836 | Ga0307409_100076722 | 3300031995 | Bacteria | 2681 |
| 837 | Ga0307409_100245719 | 3300031995 | Bacteria | 1632 |
| 838 | Ga0307409_100582796 | 3300031995 | Bacteria | 1103 |
| 839 | Ga0307409_101132224 | 3300031995 | Bacteria | 804 |
| 840 | Ga0307409_101749516 | 3300031995 | Bacteria | 650 |
| 841 | Ga0307416_100077132 | 3300032002 | Bacteria | 2797 |
| 842 | Ga0307416_100684930 | 3300032002 | Bacteria | 1113 |
| 843 | Ga0307416_101109960 | 3300032002 | Bacteria | 896 |
| 844 | Ga0307416_102102398 | 3300032002 | Bacteria | 666 |
| 845 | Ga0307416_103540377 | 3300032002 | Bacteria | 522 |
| 846 | Ga0307414_10033620 | 3300032004 | Bacteria | 3391 |
| 847 | Ga0307414_10061652 | 3300032004 | Bacteria | 2657 |
| 848 | Ga0307414_10080583 | 3300032004 | Bacteria | 2381 |
| 849 | Ga0307414_10144786 | 3300032004 | Bacteria | 1865 |
| 850 | Ga0307414_10387252 | 3300032004 | Bacteria | 1210 |
| 851 | Ga0307414_10467870 | 3300032004 | Bacteria | 1109 |
| 852 | Ga0307414_10646652 | 3300032004 | Bacteria | 953 |
| 853 | Ga0307414_10682392 | 3300032004 | Bacteria | 928 |
| 854 | Ga0307414_10868743 | 3300032004 | Bacteria | 825 |
| 855 | Ga0307414_10924834 | 3300032004 | Bacteria | 800 |
| 856 | Ga0307414_10986504 | 3300032004 | Bacteria | 775 |
| 857 | Ga0307414_11207139 | 3300032004 | Bacteria | 700 |
| 858 | Ga0307414_11253991 | 3300032004 | Bacteria | 687 |
| 859 | Ga0307414_11374641 | 3300032004 | Bacteria | 656 |
| 860 | Ga0307414_11626754 | 3300032004 | Bacteria | 602 |
| 861 | Ga0307411_10056123 | 3300032005 | Bacteria | 2594 |
| 862 | Ga0307411_10216913 | 3300032005 | Bacteria | 1481 |
| 863 | Ga0307411_10299717 | 3300032005 | Bacteria | 1288 |
| 864 | Ga0307411_10475053 | 3300032005 | Bacteria | 1051 |
| 865 | Ga0307411_10488055 | 3300032005 | Bacteria | 1039 |
| 866 | Ga0307411_10884389 | 3300032005 | Bacteria | 793 |
| 867 | Ga0307411_11786241 | 3300032005 | Bacteria | 570 |
| 868 | Ga0307411_11854707 | 3300032005 | Bacteria | 560 |
| 869 | Ga0307415_100077652 | 3300032126 | Bacteria | 2358 |
| 870 | Ga0307415_100445461 | 3300032126 | Bacteria | 1118 |
| 871 | Ga0307415_100634423 | 3300032126 | Bacteria | 955 |
| 872 | Ga0307415_101022557 | 3300032126 | Bacteria | 769 |
| 873 | Ga0307415_101377245 | 3300032126 | Bacteria | 671 |
| 874 | Ga0307510_10013265 | 3300033180 | Bacteria | 9772 |
| 875 | Ga0373948_0056544 | 3300034817 | Bacteria | 853 |
| 876 | Ga0373938_0011096 | 3300034957 | Bacteria | 1669 |
| 877 | Ga0373926_0053000 | 3300035083 | Bacteria | 1467 |
| 878 | Ga0373928_0135085 | 3300035084 | Bacteria | 672 |
| 879 | Ga0373934_0057302 | 3300035086 | Bacteria | 1550 |
| 880 | Ga0373944_0011172 | 3300035089 | Bacteria | 2457 |
| 881 | Ga0373949_0176121 | 3300035090 | Bacteria | 631 |
| 882 | Ga0373936_0000998 | 3300035113 | Bacteria | 10090 |
| 883 | Ga0373936_0288322 | 3300035113 | Bacteria | 739 |
| 884 | Ga0373936_0423306 | 3300035113 | Bacteria | 613 |
| 885 | Ga0373939_0055238 | 3300035114 | Bacteria | 1246 |
| 886 | Ga0373941_0296226 | 3300035115 | Bacteria | 644 |
| 887 | Ga0373953_0064809 | 3300035117 | Bacteria | 1499 |
| 888 | Ga0373954_0028925 | 3300035118 | Bacteria | 2550 |
| 889 | Ga0373956_0030070 | 3300035119 | Bacteria | 2372 |
| 890 | Ga0373957_0341548 | 3300035120 | Bacteria | 638 |
| 891 | Ga0373960_0183253 | 3300035121 | Bacteria | 732 |
| 892 | Ga0373943_0012285 | 3300035170 | Bacteria | 3853 |
| 893 | Ga0373943_0035963 | 3300035170 | Bacteria | 2370 |
| 894 | Ga0373946_0358210 | 3300035171 | Bacteria | 730 |
| 895 | Ga0373955_0041670 | 3300035172 | Bacteria | 2462 |
| 896 | Ga0373942_0027587 | 3300035207 | Bacteria | 1479 |
| 897 | Ga0373942_0088421 | 3300035207 | Bacteria | 930 |
| 898 | Ga0373962_0248339 | 3300035242 | Bacteria | 617 |
| 899 | Ga0373924_0053116 | 3300035410 | Bacteria | 1683 |
| 900 | Ga0373931_0615884 | 3300035691 | Bacteria | 711 |
| 901 | Ga0373931_1206254 | 3300035691 | Bacteria | 518 |
| 902 | Ga0373935_0296207 | 3300035692 | Bacteria | 1142 |
| 903 | Ga0373927_0001126 | 3300035695 | Bacteria | 20271 |
| 904 | Ga0373933_0001765 | 3300035724 | Bacteria | 12526 |
| 905 | Ga0373947_0643298 | 3300035725 | Bacteria | 723 |
| 906 | Ga0373937_0006878 | 3300036401 | Bacteria | 9815 |
| 907 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 908 | Ga0373925_0001803 | 3300037068 | Bacteria | 17861 |
| 909 | Ga0373925_1495618 | 3300037068 | Bacteria | 553 |
| 910 | Ga0373925_1784479 | 3300037068 | Bacteria | 502 |
| 911 | Ga0395899_0041622 | 3300037312 | Bacteria | 3432 |
| 912 | Ga0395899_0206782 | 3300037312 | Bacteria | 1366 |
| 913 | Ga0395899_0919648 | 3300037312 | Bacteria | 532 |
| 914 | Ga0395900_0334425 | 3300037418 | Bacteria | 1491 |
| 915 | Ga0395900_0339027 | 3300037418 | Bacteria | 1479 |
| 916 | Ga0395900_0889358 | 3300037418 | Bacteria | 814 |
| 917 | Ga0395900_0962807 | 3300037418 | Bacteria | 774 |
| 918 | Ga0395900_1156084 | 3300037418 | Bacteria | 690 |
| 919 | Ga0395898_0069290 | 3300037466 | Bacteria | 3412 |
| 920 | Ga0395898_0087345 | 3300037466 | Bacteria | 3004 |
| 921 | Ga0395898_1518276 | 3300037466 | Bacteria | 595 |
| 922 | Ga0395905_0009297 | 3300037471 | Bacteria | 9615 |
| 923 | Ga0395905_0104518 | 3300037471 | Bacteria | 2659 |
| 924 | Ga0395905_0170538 | 3300037471 | Bacteria | 2044 |
| 925 | Ga0395905_1217762 | 3300037471 | Bacteria | 656 |
| 926 | Ga0436364_0183155 | 3300037853 | Bacteria | 1096 |
| 927 | Ga0436364_0610524 | 3300037853 | Bacteria | 571 |
| 928 | Ga0436364_0824263 | 3300037853 | Unclassified | 515 |
| 929 | Ga0395901_0149762 | 3300038443 | Bacteria | 2452 |
| 930 | Ga0395901_0471972 | 3300038443 | Bacteria | 1281 |
| 931 | Ga0395901_0989624 | 3300038443 | Bacteria | 817 |
| 932 | Ga0395901_1329362 | 3300038443 | Bacteria | 679 |
| 933 | Ga0436365_0029920 | 3300039437 | Bacteria | 3132 |
| 934 | Ga0436365_0073009 | 3300039437 | Bacteria | 818 |
| 935 | Ga0436365_0306093 | 3300039437 | Bacteria | 1457 |
| 936 | Ga0436365_1750735 | 3300039437 | Bacteria | 3537 |
| 937 | Ga0436365_1837953 | 3300039437 | Bacteria | 2874 |
| 938 | Ga0436360_0227752 | 3300039438 | Bacteria | 1200 |
| 939 | Ga0436361_0835775 | 3300039447 | Bacteria | 1822 |
| 940 | Ga0436363_1484678 | 3300039450 | Bacteria | 503 |
| 941 | Ga0436362_0149703 | 3300039453 | Bacteria | 1048 |
| 942 | Ga0436362_0297190 | 3300039453 | Bacteria | 734 |
| 943 | Ga0436362_1022103 | 3300039453 | Bacteria | 705 |
| 944 | Ga0439461_0155082 | 3300041410 | Bacteria | 594 |
| 945 | Ga0439466_0206085 | 3300041411 | Bacteria | 598 |
| 946 | Ga0439465_0014311 | 3300041413 | Bacteria | 2473 |
| 947 | Ga0451793_0361570 | 3300041452 | Bacteria | 514 |
| 948 | Ga0451793_1900854 | 3300041452 | Bacteria | 1003 |
| 949 | Ga0451793_1926393 | 3300041452 | Bacteria | 587 |
| 950 | Ga0451795_0925728 | 3300041456 | Bacteria | 768 |
| 951 | Ga0451795_1551248 | 3300041456 | Bacteria | 808 |
| 952 | Ga0451798_0838824 | 3300041458 | Bacteria | 599 |
| 953 | Ga0451800_0464072 | 3300041459 | Bacteria | 583 |
| 954 | Ga0451802_1476308 | 3300041460 | Bacteria | 801 |
| 955 | Ga0451805_005031 | 3300041461 | Bacteria | 534 |
| 956 | Ga0451807_0142193 | 3300041486 | Bacteria | 1125 |
| 957 | Ga0451837_1073011 | 3300041494 | Bacteria | 1145 |
| 958 | Ga0451839_0183986 | 3300041496 | Bacteria | 578 |
| 959 | Ga0451849_0020168 | 3300041505 | Bacteria | 828 |
| 960 | Ga0451843_1308798 | 3300041509 | Bacteria | 690 |
| 961 | Ga0451853_1702220 | 3300041512 | Bacteria | 565 |
| 962 | Ga0451853_3393834 | 3300041512 | Bacteria | 644 |
| 963 | Ga0451853_4061060 | 3300041512 | Bacteria | 1222 |
| 964 | Ga0439442_050511 | 3300042002 | Bacteria | 877 |
| 965 | Ga0439445_0032864 | 3300042004 | Bacteria | 1354 |
| 966 | Ga0439445_0179473 | 3300042004 | Bacteria | 622 |
| 967 | Ga0439432_158478 | 3300042006 | Bacteria | 663 |
| 968 | Ga0439455_0011348 | 3300042012 | Bacteria | 1977 |
| 969 | Ga0439462_0105014 | 3300042015 | Bacteria | 780 |
| 970 | Ga0439458_0091866 | 3300042157 | Bacteria | 782 |
| 971 | Ga0439434_0233390 | 3300042435 | Bacteria | 626 |
| 972 | Ga0439459_0015574 | 3300042438 | Bacteria | 1395 |
| 973 | Ga0466966_0064946 | 3300044684 | Bacteria | 2296 |
| 974 | Ga0466961_0119483 | 3300044693 | Bacteria | 1655 |
| 975 | Ga0466970_0170236 | 3300044765 | Bacteria | 1207 |
| 976 | Ga0466957_1387097 | 3300044842 | Bacteria | 511 |
| 977 | Ga0466959_0195141 | 3300045049 | Bacteria | 1411 |
| 978 | Ga0466958_0445342 | 3300045836 | Bacteria | 838 |
| 979 | Ga0466958_0524950 | 3300045836 | Bacteria | 769 |
| 980 | Ga0495592_0124849 | 3300046454 | Bacteria | 1807 |
| 981 | Ga0495592_0166268 | 3300046454 | Bacteria | 1514 |
| 982 | Ga0495590_0261925 | 3300046457 | Bacteria | 645 |
| 983 | Ga0495629_0038896 | 3300046459 | Bacteria | 3349 |
| 984 | Ga0495629_0047462 | 3300046459 | Bacteria | 3012 |
| 985 | Ga0495629_0467504 | 3300046459 | Unclassified | 853 |
| 986 | Ga0495651_0161486 | 3300046462 | Bacteria | 1605 |
| 987 | Ga0495653_0218391 | 3300046463 | Bacteria | 1283 |
| 988 | Ga0495650_0040709 | 3300046471 | Bacteria | 1992 |
| 989 | Ga0495580_0820505 | 3300046472 | Bacteria | 602 |
| 990 | Ga0495639_0329567 | 3300046475 | Unclassified | 764 |
| 991 | Ga0495662_0027078 | 3300046476 | Bacteria | 2769 |
| 992 | Ga0495664_0144213 | 3300046477 | Bacteria | 1444 |
| 993 | Ga0495585_0112411 | 3300046492 | Bacteria | 1447 |
| 994 | Ga0495585_0119277 | 3300046492 | Bacteria | 1397 |
| 995 | Ga0495585_0313985 | 3300046492 | Bacteria | 768 |
| 996 | Ga0495607_0460828 | 3300046501 | Bacteria | 569 |
| 997 | Ga0495583_0127457 | 3300046506 | Bacteria | 1067 |
| 998 | Ga0495606_0009975 | 3300046507 | Bacteria | 7944 |
| 999 | Ga0495608_0126446 | 3300046511 | Bacteria | 1637 |
| 1000 | Ga0495610_0000530 | 3300046512 | Bacteria | 38418 |
| 1001 | Ga0495610_0047010 | 3300046512 | Bacteria | 2125 |
| 1002 | Ga0495618_0737711 | 3300046514 | Bacteria | 577 |
| 1003 | Ga0495618_0895405 | 3300046514 | Bacteria | 512 |
| 1004 | Ga0495620_0062173 | 3300046515 | Bacteria | 1551 |
| 1005 | Ga0495628_0134207 | 3300046516 | Bacteria | 1893 |
| 1006 | Ga0495628_0408110 | 3300046516 | Bacteria | 991 |
| 1007 | Ga0495628_0966973 | 3300046516 | Bacteria | 587 |
| 1008 | Ga0495630_1125977 | 3300046517 | Bacteria | 595 |
| 1009 | Ga0495631_0200675 | 3300046518 | Bacteria | 853 |
| 1010 | Ga0495643_0009536 | 3300046522 | Bacteria | 6029 |
| 1011 | Ga0495643_0091285 | 3300046522 | Bacteria | 1571 |
| 1012 | Ga0495644_0294987 | 3300046523 | Bacteria | 634 |
| 1013 | Ga0495648_0173144 | 3300046524 | Bacteria | 1104 |
| 1014 | Ga0495648_0425133 | 3300046524 | Bacteria | 587 |
| 1015 | Ga0495642_0003852 | 3300046528 | Bacteria | 5880 |
| 1016 | Ga0495654_0169882 | 3300046530 | Bacteria | 951 |
| 1017 | Ga0495640_0132628 | 3300046533 | Bacteria | 1611 |
| 1018 | Ga0495587_0452180 | 3300046536 | Bacteria | 712 |
| 1019 | Ga0495609_0171090 | 3300046538 | Bacteria | 917 |
| 1020 | Ga0495621_0142166 | 3300046539 | Bacteria | 940 |
| 1021 | Ga0495597_0001737 | 3300046542 | Bacteria | 15014 |
| 1022 | Ga0495622_0036577 | 3300046557 | Bacteria | 2288 |
| 1023 | Ga0495633_0065587 | 3300046558 | Bacteria | 1696 |
| 1024 | Ga0495667_0544642 | 3300046559 | Bacteria | 725 |
| 1025 | Ga0495668_0116616 | 3300046616 | Bacteria | 1460 |
| 1026 | Ga0495668_0697987 | 3300046616 | Bacteria | 561 |
| 1027 | Ga0495611_0001817 | 3300046648 | Bacteria | 10230 |
| 1028 | Ga0495611_0266435 | 3300046648 | Bacteria | 793 |
| 1029 | Ga0495625_0016679 | 3300046660 | Bacteria | 5770 |
| 1030 | Ga0495625_0049278 | 3300046660 | Bacteria | 3029 |
| 1031 | Ga0495635_0056822 | 3300046663 | Bacteria | 2694 |
| 1032 | Ga0495635_0915246 | 3300046663 | Bacteria | 561 |
| 1033 | Ga0495659_0223139 | 3300046664 | Bacteria | 779 |
| 1034 | Ga0495588_0005383 | 3300046674 | Bacteria | 5692 |
| 1035 | Ga0495588_0071865 | 3300046674 | Bacteria | 1800 |
| 1036 | Ga0495657_0152288 | 3300046675 | Bacteria | 1435 |
| 1037 | Ga0495657_0466685 | 3300046675 | Bacteria | 738 |
| 1038 | Ga0495658_0067764 | 3300046683 | Bacteria | 2065 |
| 1039 | Ga0495669_0000114 | 3300046684 | Bacteria | 52644 |
| 1040 | Ga0495669_0000375 | 3300046684 | Bacteria | 22695 |
| 1041 | Ga0495669_0020657 | 3300046684 | Bacteria | 2852 |
| 1042 | Ga0495669_0210846 | 3300046684 | Bacteria | 930 |
| 1043 | Ga0495669_0255651 | 3300046684 | Bacteria | 841 |
| 1044 | Ga0495613_0016976 | 3300046689 | Bacteria | 5418 |
| 1045 | Ga0495613_0342822 | 3300046689 | Bacteria | 1028 |
| 1046 | Ga0495624_0064980 | 3300046690 | Bacteria | 2280 |
| 1047 | Ga0495624_0082628 | 3300046690 | Bacteria | 1988 |
| 1048 | Ga0495624_0286422 | 3300046690 | Bacteria | 994 |
| 1049 | Ga0495671_0130573 | 3300046692 | Bacteria | 1225 |
| 1050 | Ga0495600_0204355 | 3300046809 | Bacteria | 1267 |
| 1051 | Ga0495600_0308639 | 3300046809 | Bacteria | 997 |
| 1052 | Ga0495604_0022630 | 3300047317 | Bacteria | 5018 |
| 1053 | Ga0495636_0417144 | 3300047318 | Bacteria | 641 |
| 1054 | Ga0495672_0069043 | 3300047320 | Bacteria | 2007 |
| 1055 | Ga0495676_0627109 | 3300047321 | Bacteria | 699 |
| 1056 | Ga0495680_1101131 | 3300047322 | Bacteria | 502 |
| 1057 | Ga0495683_0459000 | 3300047323 | Bacteria | 522 |
| 1058 | Ga0495687_021229 | 3300047443 | Bacteria | 3147 |
| 1059 | Ga0495675_0353251 | 3300047444 | Bacteria | 864 |
| 1060 | Ga0495677_0014060 | 3300047445 | Bacteria | 2914 |
| 1061 | Ga0495677_0019944 | 3300047445 | Bacteria | 2430 |
| 1062 | Ga0495677_0303681 | 3300047445 | Bacteria | 628 |
| 1063 | Ga0495685_172539 | 3300047447 | Bacteria | 698 |
| 1064 | Ga0495673_0232990 | 3300047469 | Bacteria | 678 |
| 1065 | Ga0495681_0002425 | 3300047470 | Bacteria | 13322 |
| 1066 | Ga0495681_0317634 | 3300047470 | Bacteria | 599 |
| 1067 | Ga0495684_0437837 | 3300047471 | Bacteria | 911 |
| 1068 | Ga0495684_0688114 | 3300047471 | Bacteria | 680 |
| 1069 | Ga0495684_1044394 | 3300047471 | Bacteria | 516 |
| 1070 | Ga0495686_0003490 | 3300047472 | Bacteria | 13592 |
| 1071 | Ga0495686_0160588 | 3300047472 | Bacteria | 1313 |
| 1072 | Ga0495593_0019427 | 3300047673 | Bacteria | 3810 |
| 1073 | Ga0495602_0210122 | 3300048088 | Bacteria | 1478 |
| 1074 | Ga0495602_0336494 | 3300048088 | Bacteria | 1093 |
| 1075 | Ga0495615_0106747 | 3300048090 | Bacteria | 797 |
| 1076 | Ga0496100_0713875 | 3300048903 | Bacteria | 783 |
| 1077 | Ga0496100_0770290 | 3300048903 | Bacteria | 753 |
| 1078 | Ga0496100_1043367 | 3300048903 | Bacteria | 644 |
| 1079 | Ga0496100_1600379 | 3300048903 | Bacteria | 515 |
| 1080 | Ga0496101_0043794 | 3300048904 | Bacteria | 3200 |
| 1081 | Ga0496101_0540884 | 3300048904 | Bacteria | 921 |
| 1082 | Ga0496101_0958343 | 3300048904 | Bacteria | 673 |
| 1083 | Ga0496101_1307025 | 3300048904 | Bacteria | 567 |
| 1084 | Ga0496102_0000034 | 3300048905 | Bacteria | 213826 |
| 1085 | Ga0496102_0031117 | 3300048905 | Bacteria | 4784 |
| 1086 | Ga0496102_0193636 | 3300048905 | Bacteria | 1916 |
| 1087 | Ga0496102_0344473 | 3300048905 | Bacteria | 1403 |
| 1088 | Ga0496102_0859348 | 3300048905 | Bacteria | 829 |
| 1089 | Ga0496103_0000026 | 3300048906 | Bacteria | 213826 |
| 1090 | Ga0496103_0396937 | 3300048906 | Bacteria | 886 |
| 1091 | Ga0496103_0863148 | 3300048906 | Bacteria | 569 |
| 1092 | Ga0496104_0205507 | 3300048907 | Bacteria | 1881 |
| 1093 | Ga0496104_0499506 | 3300048907 | Bacteria | 1128 |
| 1094 | Ga0496105_0646552 | 3300048908 | Bacteria | 816 |
| 1095 | Ga0496106_0407120 | 3300048909 | Bacteria | 1093 |
| 1096 | Ga0496107_0168265 | 3300048910 | Bacteria | 1626 |
| 1097 | Ga0496107_0315776 | 3300048910 | Bacteria | 1163 |
| 1098 | Ga0496107_0346416 | 3300048910 | Bacteria | 1106 |
| 1099 | Ga0496108_0252642 | 3300048911 | Bacteria | 1534 |
| 1100 | Ga0496108_0451166 | 3300048911 | Bacteria | 1123 |
| 1101 | Ga0496108_1313230 | 3300048911 | Bacteria | 608 |
| 1102 | Ga0496109_0021464 | 3300048912 | Bacteria | 5710 |
| 1103 | Ga0496109_0456005 | 3300048912 | Bacteria | 1207 |
| 1104 | Ga0496109_0638925 | 3300048912 | Bacteria | 1001 |
| 1105 | Ga0496109_0884690 | 3300048912 | Bacteria | 831 |
| 1106 | Ga0496110_0094902 | 3300048913 | Bacteria | 2671 |
| 1107 | Ga0496110_0504435 | 3300048913 | Bacteria | 1101 |
| 1108 | Ga0496111_0330750 | 3300048914 | Bacteria | 1128 |
| 1109 | Ga0496111_0379999 | 3300048914 | Bacteria | 1045 |
| 1110 | Ga0496111_0554619 | 3300048914 | Bacteria | 843 |
| 1111 | Ga0496112_0077655 | 3300048915 | Bacteria | 3284 |
| 1112 | Ga0496112_0204968 | 3300048915 | Bacteria | 1930 |
| 1113 | Ga0496112_1398908 | 3300048915 | Bacteria | 614 |
| 1114 | Ga0496112_1519189 | 3300048915 | Bacteria | 583 |
| 1115 | Ga0496113_0143794 | 3300048916 | Bacteria | 1878 |
| 1116 | Ga0496113_0181414 | 3300048916 | Bacteria | 1669 |
| 1117 | Ga0496113_1174131 | 3300048916 | Bacteria | 600 |
| 1118 | Ga0496115_0160335 | 3300048918 | Bacteria | 1858 |
| 1119 | Ga0496115_0570284 | 3300048918 | Bacteria | 903 |
| 1120 | Ga0496115_0899614 | 3300048918 | Bacteria | 683 |
| 1121 | Ga0496116_0002308 | 3300048919 | Bacteria | 20225 |
| 1122 | Ga0496116_0080690 | 3300048919 | Bacteria | 2019 |
| 1123 | Ga0496116_0270728 | 3300048919 | Bacteria | 830 |
| 1124 | Ga0496116_0334329 | 3300048919 | Bacteria | 702 |
| 1125 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 1126 | Ga0496117_0000072 | 3300048920 | Bacteria | 238366 |
| 1127 | Ga0496117_0019825 | 3300048920 | Bacteria | 5507 |
| 1128 | Ga0496117_0104602 | 3300048920 | Bacteria | 1781 |
| 1129 | Ga0496117_0179655 | 3300048920 | Bacteria | 1218 |
| 1130 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 1131 | Ga0496118_0001144 | 3300048921 | Bacteria | 40942 |
| 1132 | Ga0496118_0071304 | 3300048921 | Bacteria | 2502 |
| 1133 | Ga0496119_0009454 | 3300048922 | Bacteria | 8364 |
| 1134 | Ga0496119_0020857 | 3300048922 | Bacteria | 4756 |
| 1135 | Ga0496119_0036947 | 3300048922 | Bacteria | 3180 |
| 1136 | Ga0496119_0038724 | 3300048922 | Bacteria | 3076 |
| 1137 | Ga0496119_0050737 | 3300048922 | Bacteria | 2554 |
| 1138 | Ga0496120_0000897 | 3300048923 | Bacteria | 41807 |
| 1139 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 1140 | Ga0496121_0054257 | 3300048924 | Bacteria | 3351 |
| 1141 | Ga0496121_0319213 | 3300048924 | Bacteria | 1046 |
| 1142 | Ga0496121_0369749 | 3300048924 | Bacteria | 949 |
| 1143 | Ga0496121_0539712 | 3300048924 | Bacteria | 732 |
| 1144 | Ga0496121_0685436 | 3300048924 | Bacteria | 619 |
| 1145 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 1146 | Ga0496122_0005325 | 3300048925 | Bacteria | 15380 |
| 1147 | Ga0496122_0010228 | 3300048925 | Bacteria | 9721 |
| 1148 | Ga0496122_0077402 | 3300048925 | Bacteria | 2336 |
| 1149 | Ga0496122_0186794 | 3300048925 | Bacteria | 1228 |
| 1150 | Ga0496122_0507641 | 3300048925 | Bacteria | 584 |
| 1151 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 1152 | Ga0496123_0000539 | 3300048926 | Bacteria | 65166 |
| 1153 | Ga0496123_0048548 | 3300048926 | Bacteria | 2855 |
| 1154 | Ga0496123_0069298 | 3300048926 | Bacteria | 2215 |
| 1155 | Ga0496124_0000061 | 3300048927 | Bacteria | 238225 |
| 1156 | Ga0496124_0000855 | 3300048927 | Bacteria | 49698 |
| 1157 | Ga0496124_0040338 | 3300048927 | Bacteria | 4039 |
| 1158 | Ga0496124_0044707 | 3300048927 | Bacteria | 3798 |
| 1159 | Ga0496124_0106630 | 3300048927 | Bacteria | 2262 |
| 1160 | Ga0496124_0435032 | 3300048927 | Bacteria | 899 |
| 1161 | Ga0496124_0629884 | 3300048927 | Bacteria | 692 |
| 1162 | Ga0496124_0894558 | 3300048927 | Bacteria | 539 |
| 1163 | Ga0496125_0068486 | 3300048928 | Bacteria | 2792 |
| 1164 | Ga0496126_0026844 | 3300048929 | Bacteria | 5514 |
| 1165 | Ga0496126_0058965 | 3300048929 | Bacteria | 3459 |
| 1166 | Ga0496126_0063284 | 3300048929 | Bacteria | 3316 |
| 1167 | Ga0496126_0072053 | 3300048929 | Bacteria | 3074 |
| 1168 | Ga0496126_0564777 | 3300048929 | Bacteria | 901 |
| 1169 | Ga0496126_1229169 | 3300048929 | Bacteria | 549 |
| 1170 | Ga0501310_031570 | 3300049130 | Bacteria | 706 |
| 1171 | Ga0501307_044598 | 3300049162 | Bacteria | 652 |
| 1172 | Ga0495678_030444 | 3300049459 | Bacteria | 2258 |
| 1173 | Ga0501311_095454 | 3300049527 | Bacteria | 521 |
| 1174 | Ga0501312_087508 | 3300049528 | Bacteria | 571 |
| 1175 | Ga0501315_091535 | 3300049531 | Bacteria | 528 |
| 1176 | Ga0501316_072603 | 3300049532 | Bacteria | 523 |
| 1177 | Ga0501317_070626 | 3300049533 | Bacteria | 589 |
| 1178 | Ga0501320_069732 | 3300049536 | Bacteria | 507 |
| 1179 | Ga0501321_040259 | 3300049537 | Bacteria | 655 |
| 1180 | Ga0501323_070654 | 3300049539 | Bacteria | 558 |
| 1181 | Ga0501333_022213 | 3300049549 | Bacteria | 511 |
| 1182 | Ga0501336_026000 | 3300049552 | Bacteria | 555 |
| 1183 | Ga0501340_025454 | 3300049556 | Bacteria | 516 |
| 1184 | Ga0501032_0467633 | 3300049569 | Bacteria | 807 |
| 1185 | Ga0501033_0000741 | 3300049570 | Bacteria | 29982 |
| 1186 | Ga0501033_0222417 | 3300049570 | Bacteria | 1343 |
| 1187 | Ga0501033_0279467 | 3300049570 | Bacteria | 1179 |
| 1188 | Ga0501033_0351065 | 3300049570 | Bacteria | 1033 |
| 1189 | Ga0501033_0655231 | 3300049570 | Bacteria | 717 |
| 1190 | Ga0501034_0001360 | 3300049571 | Bacteria | 33027 |
| 1191 | Ga0501034_0017349 | 3300049571 | Bacteria | 7384 |
| 1192 | Ga0501034_0036387 | 3300049571 | Bacteria | 4987 |
| 1193 | Ga0501034_0168950 | 3300049571 | Bacteria | 2155 |
| 1194 | Ga0501034_0273907 | 3300049571 | Bacteria | 1628 |
| 1195 | Ga0501034_0356313 | 3300049571 | Bacteria | 1391 |
| 1196 | Ga0501034_0409635 | 3300049571 | Bacteria | 1278 |
| 1197 | Ga0501034_0917453 | 3300049571 | Bacteria | 763 |
| 1198 | Ga0501034_1491997 | 3300049571 | Bacteria | 550 |
| 1199 | Ga0501038_0685285 | 3300049574 | Bacteria | 769 |
| 1200 | Ga0501043_0321652 | 3300049579 | Bacteria | 1179 |
| 1201 | Ga0501043_0969052 | 3300049579 | Bacteria | 607 |
| 1202 | Ga0501047_0005360 | 3300049581 | Bacteria | 12051 |
| 1203 | Ga0501047_0015925 | 3300049581 | Bacteria | 7168 |
| 1204 | Ga0501047_0112286 | 3300049581 | Bacteria | 2607 |
| 1205 | Ga0501047_0503412 | 3300049581 | Bacteria | 1038 |
| 1206 | Ga0501048_0441810 | 3300049582 | Bacteria | 931 |
| 1207 | Ga0501067_0174629 | 3300049583 | Bacteria | 1197 |
| 1208 | Ga0501070_0079969 | 3300049586 | Bacteria | 2705 |
| 1209 | Ga0501070_0535013 | 3300049586 | Bacteria | 939 |
| 1210 | Ga0501072_1560675 | 3300049588 | Bacteria | 509 |
| 1211 | Ga0501073_0107948 | 3300049589 | Bacteria | 1932 |
| 1212 | Ga0501073_0242720 | 3300049589 | Bacteria | 1244 |
| 1213 | Ga0501073_1146747 | 3300049589 | Bacteria | 534 |
| 1214 | Ga0501074_0437778 | 3300049590 | Bacteria | 927 |
| 1215 | Ga0501077_0652508 | 3300049593 | Bacteria | 676 |
| 1216 | Ga0501217_117316 | 3300049661 | Bacteria | 770 |
| 1217 | Ga0501217_260318 | 3300049661 | Bacteria | 562 |
| 1218 | Ga0501223_122000 | 3300049663 | Bacteria | 551 |
| 1219 | Ga0501233_181258 | 3300049668 | Bacteria | 603 |
| 1220 | Ga0501235_217132 | 3300049669 | Bacteria | 523 |
| 1221 | Ga0501239_071890 | 3300049672 | Bacteria | 540 |
| 1222 | Ga0501240_024707 | 3300049673 | Bacteria | 928 |
| 1223 | Ga0501242_086216 | 3300049674 | Bacteria | 510 |
| 1224 | Ga0501243_021746 | 3300049675 | Bacteria | 1060 |
| 1225 | Ga0501247_035849 | 3300049677 | Bacteria | 694 |
| 1226 | Ga0501251_091380 | 3300049681 | Bacteria | 547 |
| 1227 | Ga0501257_146522 | 3300049686 | Bacteria | 648 |
| 1228 | Ga0501225_0306999 | 3300049705 | Bacteria | 538 |
| 1229 | Ga0501229_048652 | 3300049706 | Bacteria | 621 |
| 1230 | Ga0501234_026341 | 3300049707 | Bacteria | 934 |
| 1231 | Ga0501080_1026561 | 3300049742 | Bacteria | 714 |
| 1232 | Ga0501083_0519070 | 3300049744 | Bacteria | 775 |
| 1233 | Ga0501241_136699 | 3300049758 | Bacteria | 556 |
| 1234 | Ga0501264_044832 | 3300049761 | Bacteria | 554 |
| 1235 | Ga0501267_015401 | 3300049764 | Bacteria | 809 |
| 1236 | Ga0501267_019969 | 3300049764 | Bacteria | 734 |
| 1237 | Ga0501268_026257 | 3300049765 | Bacteria | 1028 |
| 1238 | Ga0501268_162885 | 3300049765 | Bacteria | 521 |
| 1239 | Ga0501272_065843 | 3300049769 | Bacteria | 524 |
| 1240 | Ga0501273_041434 | 3300049770 | Bacteria | 682 |
| 1241 | Ga0501035_0004335 | 3300049822 | Bacteria | 13467 |
| 1242 | Ga0501035_0037612 | 3300049822 | Bacteria | 4382 |
| 1243 | Ga0501035_0040735 | 3300049822 | Bacteria | 4196 |
| 1244 | Ga0501035_0055251 | 3300049822 | Bacteria | 3545 |
| 1245 | Ga0501044_0191921 | 3300049823 | Bacteria | 2005 |
| 1246 | Ga0501044_0270849 | 3300049823 | Bacteria | 1634 |
| 1247 | Ga0501044_0373120 | 3300049823 | Bacteria | 1343 |
| 1248 | Ga0501044_0406439 | 3300049823 | Bacteria | 1273 |
| 1249 | Ga0501044_0757498 | 3300049823 | Bacteria | 853 |
| 1250 | Ga0501044_1452874 | 3300049823 | Bacteria | 551 |
| 1251 | Ga0501204_071374 | 3300049850 | Bacteria | 573 |
| 1252 | Ga0501212_044071 | 3300049851 | Bacteria | 744 |
| 1253 | nmdc:mga03683_14575_c1 | 3300050489 | Bacteria | 2912 |
| 1254 | nmdc:mga03683_263655_c1 | 3300050489 | Bacteria | 802 |
| 1255 | nmdc:mga03683_95267_c1 | 3300050489 | Bacteria | 1303 |
| 1256 | nmdc:mga03n38_453666_c1 | 3300050490 | Bacteria | 714 |
| 1257 | nmdc:mga03n38_626595_c1 | 3300050490 | Bacteria | 615 |
| 1258 | nmdc:mga03n38_72384_c1 | 3300050490 | Bacteria | 1598 |
| 1259 | nmdc:mga00v17_838_c1 | 3300050491 | Bacteria | 16681 |
| 1260 | nmdc:mga00v17_98091_c1 | 3300050491 | Bacteria | 1847 |
| 1261 | nmdc:mga0yw44_197941_c1 | 3300050492 | Bacteria | 1326 |
| 1262 | nmdc:mga0yw44_3160_c1 | 3300050492 | Bacteria | 7230 |
| 1263 | nmdc:mga0yw44_803420_c1 | 3300050492 | Bacteria | 639 |
| 1264 | nmdc:mga0k408_466200_c1 | 3300050493 | Bacteria | 750 |
| 1265 | nmdc:mga0k408_894208_c1 | 3300050493 | Bacteria | 515 |
| 1266 | nmdc:mga06z11_455553_c1 | 3300050494 | Bacteria | 773 |
| 1267 | nmdc:mga06z11_545393_c1 | 3300050494 | Bacteria | 704 |
| 1268 | nmdc:mga06z11_549185_c1 | 3300050494 | Bacteria | 701 |
| 1269 | nmdc:mga06z11_810645_c1 | 3300050494 | Bacteria | 570 |
| 1270 | nmdc:mga06z11_978283_c1 | 3300050494 | Bacteria | 516 |
| 1271 | nmdc:mga04h51_111221_c1 | 3300050495 | Bacteria | 1010 |
| 1272 | nmdc:mga04h51_389572_c1 | 3300050495 | Bacteria | 582 |
| 1273 | nmdc:mga04h51_51802_c1 | 3300050495 | Bacteria | 1381 |
| 1274 | nmdc:mga07m45_140770_c1 | 3300050496 | Bacteria | 1397 |
| 1275 | nmdc:mga07m45_156640_c1 | 3300050496 | Bacteria | 1322 |
| 1276 | nmdc:mga07m45_201028_c1 | 3300050496 | Bacteria | 1159 |
| 1277 | nmdc:mga07m45_592194_c1 | 3300050496 | Bacteria | 640 |
| 1278 | nmdc:mga0sz30_268_c1 | 3300050516 | Bacteria | 19941 |
| 1279 | Ga0495601_0045173 | 3300053077 | Bacteria | 2769 |
| 1280 | Ga0495601_0259792 | 3300053077 | Bacteria | 1134 |
| 1281 | Ga0495601_0472317 | 3300053077 | Bacteria | 810 |
| 1282 | Ga0500635_0000302 | 3300053080 | Bacteria | 17373 |
| 1283 | Ga0495595_0110042 | 3300053084 | Bacteria | 1335 |
| 1284 | Ga0495619_0045254 | 3300053085 | Bacteria | 2891 |
| 1285 | Ga0495619_0245844 | 3300053085 | Bacteria | 1240 |
| 1286 | Ga0500578_0270703 | 3300053086 | Bacteria | 1016 |
| 1287 | Ga0500643_114283 | 3300053087 | Bacteria | 728 |
| 1288 | Ga0500643_132126 | 3300053087 | Bacteria | 671 |
| 1289 | Ga0500643_138299 | 3300053087 | Bacteria | 654 |
| 1290 | Ga0500644_0504222 | 3300053088 | Bacteria | 533 |
| 1291 | Ga0500646_0158878 | 3300053090 | Bacteria | 753 |
| 1292 | Ga0500583_0068270 | 3300053092 | Bacteria | 1695 |
| 1293 | Ga0500651_0038819 | 3300053093 | Bacteria | 2999 |
| 1294 | Ga0500566_0075858 | 3300053094 | Bacteria | 1880 |
| 1295 | Ga0500641_0000513 | 3300053096 | Bacteria | 13949 |
| 1296 | Ga0500641_0001354 | 3300053096 | Bacteria | 8713 |
| 1297 | Ga0500641_0123532 | 3300053096 | Bacteria | 1116 |
| 1298 | Ga0500641_0317682 | 3300053096 | Bacteria | 635 |
| 1299 | Ga0500554_044660 | 3300053102 | Bacteria | 1374 |
| 1300 | Ga0500555_008578 | 3300053103 | Bacteria | 2915 |
| 1301 | Ga0500555_022840 | 3300053103 | Bacteria | 1795 |
| 1302 | Ga0500556_0000944 | 3300053104 | Bacteria | 15720 |
| 1303 | Ga0500556_0188512 | 3300053104 | Bacteria | 815 |
| 1304 | Ga0500557_124052 | 3300053105 | Bacteria | 857 |
| 1305 | Ga0500560_266297 | 3300053107 | Bacteria | 527 |
| 1306 | Ga0500562_000464 | 3300053108 | Bacteria | 9836 |
| 1307 | Ga0500562_002035 | 3300053108 | Bacteria | 5064 |
| 1308 | Ga0500562_003673 | 3300053108 | Bacteria | 3855 |
| 1309 | Ga0500569_001963 | 3300053109 | Bacteria | 3987 |
| 1310 | Ga0500572_001459 | 3300053111 | Bacteria | 6456 |
| 1311 | Ga0500572_264183 | 3300053111 | Bacteria | 558 |
| 1312 | Ga0500595_004249 | 3300053119 | Bacteria | 6464 |
| 1313 | Ga0500607_093214 | 3300053121 | Bacteria | 1511 |
| 1314 | Ga0500607_130368 | 3300053121 | Bacteria | 1200 |
| 1315 | Ga0500608_000573 | 3300053122 | Bacteria | 13643 |
| 1316 | Ga0500614_002131 | 3300053123 | Bacteria | 4514 |
| 1317 | Ga0500614_075922 | 3300053123 | Bacteria | 932 |
| 1318 | Ga0500642_0106206 | 3300053130 | Bacteria | 1309 |
| 1319 | Ga0500655_053593 | 3300053133 | Bacteria | 806 |
| 1320 | Ga0500559_0003926 | 3300053136 | Bacteria | 7179 |
| 1321 | Ga0500559_0012527 | 3300053136 | Bacteria | 3601 |
| 1322 | Ga0500559_0284235 | 3300053136 | Bacteria | 778 |
| 1323 | Ga0500561_0001340 | 3300053137 | Bacteria | 4005 |
| 1324 | Ga0500568_0056872 | 3300053139 | Bacteria | 1523 |
| 1325 | Ga0500568_0068224 | 3300053139 | Bacteria | 1365 |
| 1326 | Ga0500573_0504641 | 3300053140 | Bacteria | 546 |
| 1327 | Ga0500577_0267177 | 3300053142 | Bacteria | 744 |
| 1328 | Ga0500590_000122 | 3300053148 | Bacteria | 21279 |
| 1329 | Ga0500590_130785 | 3300053148 | Bacteria | 1161 |
| 1330 | Ga0500603_059463 | 3300053150 | Bacteria | 1065 |
| 1331 | Ga0500604_0000092 | 3300053151 | Bacteria | 28708 |
| 1332 | Ga0500604_0283855 | 3300053151 | Bacteria | 574 |
| 1333 | Ga0500616_0056412 | 3300053153 | Bacteria | 2050 |
| 1334 | Ga0500616_0068784 | 3300053153 | Bacteria | 1812 |
| 1335 | Ga0500619_008319 | 3300053154 | Bacteria | 2512 |
| 1336 | Ga0500620_153731 | 3300053155 | Bacteria | 800 |
| 1337 | Ga0500622_0037145 | 3300053156 | Bacteria | 2545 |
| 1338 | Ga0500622_0104173 | 3300053156 | Bacteria | 1393 |
| 1339 | Ga0500624_000595 | 3300053157 | Bacteria | 9879 |
| 1340 | Ga0500624_003662 | 3300053157 | Bacteria | 2013 |
| 1341 | Ga0500624_031755 | 3300053157 | Bacteria | 911 |
| 1342 | Ga0500633_0076085 | 3300053160 | Bacteria | 1207 |
| 1343 | Ga0500634_0001711 | 3300053161 | Bacteria | 8755 |
| 1344 | Ga0500634_0002130 | 3300053161 | Bacteria | 8203 |
| 1345 | Ga0500638_045794 | 3300053162 | Bacteria | 2122 |
| 1346 | Ga0500636_0000094 | 3300053177 | Bacteria | 44967 |
| 1347 | Ga0500636_0001328 | 3300053177 | Bacteria | 13421 |
| 1348 | Ga0500636_0008358 | 3300053177 | Bacteria | 6004 |
| 1349 | Ga0500636_0330724 | 3300053177 | Bacteria | 736 |
| 1350 | Ga0500636_0353667 | 3300053177 | Bacteria | 700 |
| 1351 | Ga0500637_0187831 | 3300053178 | Bacteria | 1181 |
| 1352 | Ga0500637_0384570 | 3300053178 | Bacteria | 734 |
| 1353 | Ga0500657_220977 | 3300053728 | Bacteria | 601 |
| 1354 | Ga0500625_015994 | 3300053729 | Bacteria | 3489 |
| 1355 | Ga0500645_002978 | 3300053730 | Bacteria | 7180 |
| 1356 | Ga0500645_059370 | 3300053730 | Bacteria | 1107 |
| 1357 | Ga0500596_000489 | 3300053735 | Bacteria | 7420 |
| 1358 | Ga0587084_128359 | 3300059477 | Bacteria | 540 |
| 1359 | Ga0587085_102438 | 3300059506 | Bacteria | 606 |
| 1360 | Ga0587062_063902 | 3300059639 | Bacteria | 652 |
| 1361 | Ga0587062_096072 | 3300059639 | Bacteria | 571 |
| 1362 | Ga0587076_200370 | 3300059645 | Bacteria | 513 |
| 1363 | Ga0501082_1074369 | 3300060353 | Bacteria | 704 |
| 1364 | Ga0466962_0163736 | 3300061719 | Bacteria | 1082 |
| 1365 | Ga0466962_0618384 | 3300061719 | Bacteria | 553 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1003960 | Ga0081540_10039606 | 55 |
| 2 | 3300005445 | Ga0070708_100093937 | Ga0070708_1000939373 | 56 |
| 3 | 3300005841 | Ga0068863_102123324 | Ga0068863_1021233242 | 56 |
| 4 | 3300006175 | Ga0070712_100926124 | Ga0070712_1009261242 | 56 |
| 5 | 3300025913 | Ga0207695_10952896 | Ga0207695_109528962 | 56 |
| 6 | 3300001979 | JGI24740J21852_10101924 | JGI24740J21852_101019241 | 59 |
| 7 | 3300005327 | Ga0070658_10962084 | Ga0070658_109620842 | 59 |
| 8 | 3300005337 | Ga0070682_101284689 | Ga0070682_1012846891 | 59 |
| 9 | 3300005339 | Ga0070660_100123508 | Ga0070660_1001235082 | 59 |
| 10 | 3300005344 | Ga0070661_100259299 | Ga0070661_1002592992 | 59 |
| 11 | 3300005355 | Ga0070671_100000890 | Ga0070671_1000008907 | 59 |
| 12 | 3300005458 | Ga0070681_10477736 | Ga0070681_104777362 | 59 |
| 13 | 3300005458 | Ga0070681_10750034 | Ga0070681_107500342 | 59 |
| 14 | 3300005539 | Ga0068853_100007846 | Ga0068853_1000078467 | 59 |
| 15 | 3300005543 | Ga0070672_101423668 | Ga0070672_1014236682 | 59 |
| 16 | 3300005548 | Ga0070665_101173048 | Ga0070665_1011730482 | 59 |
| 17 | 3300005577 | Ga0068857_101551255 | Ga0068857_1015512552 | 59 |
| 18 | 3300005614 | Ga0068856_101691569 | Ga0068856_1016915692 | 59 |
| 19 | 3300005616 | Ga0068852_102101990 | Ga0068852_1021019902 | 59 |
| 20 | 3300006048 | Ga0075363_100856113 | Ga0075363_1008561132 | 59 |
| 21 | 3300009174 | Ga0105241_11610100 | Ga0105241_116101002 | 59 |
| 22 | 3300009545 | Ga0105237_10214516 | Ga0105237_102145163 | 59 |
| 23 | 3300009551 | Ga0105238_12604913 | Ga0105238_126049132 | 59 |
| 24 | 3300010375 | Ga0105239_12651460 | Ga0105239_126514602 | 59 |
| 25 | 3300013104 | Ga0157370_10169243 | Ga0157370_101692432 | 59 |
| 26 | 3300013104 | Ga0157370_11741633 | Ga0157370_117416331 | 59 |
| 27 | 3300013307 | Ga0157372_11527146 | Ga0157372_115271462 | 59 |
| 28 | 3300021384 | Ga0213876_10006256 | Ga0213876_100062564 | 59 |
| 29 | 3300025904 | Ga0207647_10320327 | Ga0207647_103203272 | 59 |
| 30 | 3300025909 | Ga0207705_10214787 | Ga0207705_102147872 | 59 |
| 31 | 3300025911 | Ga0207654_11365928 | Ga0207654_113659282 | 59 |
| 32 | 3300025912 | Ga0207707_10561843 | Ga0207707_105618432 | 59 |
| 33 | 3300025914 | Ga0207671_10512235 | Ga0207671_105122352 | 59 |
| 34 | 3300025919 | Ga0207657_10157456 | Ga0207657_101574562 | 59 |
| 35 | 3300025920 | Ga0207649_10449557 | Ga0207649_104495572 | 59 |
| 36 | 3300025924 | Ga0207694_10681830 | Ga0207694_106818302 | 59 |
| 37 | 3300026041 | Ga0207639_10010574 | Ga0207639_100105747 | 59 |
| 38 | 3300026078 | Ga0207702_11030032 | Ga0207702_110300322 | 59 |
| 39 | 3300026078 | Ga0207702_12396472 | Ga0207702_123964722 | 59 |
| 40 | 3300028379 | Ga0268266_10740575 | Ga0268266_107405752 | 59 |
| 41 | 3300028577 | Ga0265318_10002680 | Ga0265318_100026805 | 59 |
| 42 | 3300028794 | Ga0307515_10627394 | Ga0307515_106273941 | 59 |
| 43 | 3300030742 | Ga0316183_1208086 | Ga0316183_12080861 | 59 |
| 44 | 3300030745 | Ga0316182_1451093 | Ga0316182_14510931 | 59 |
| 45 | 3300031235 | Ga0265330_10239705 | Ga0265330_102397052 | 59 |
| 46 | 3300031240 | Ga0265320_10051193 | Ga0265320_100511932 | 59 |
| 47 | 3300031250 | Ga0265331_10017136 | Ga0265331_100171365 | 59 |
| 48 | 3300031250 | Ga0265331_10319527 | Ga0265331_103195272 | 59 |
| 49 | 3300031344 | Ga0265316_10498578 | Ga0265316_104985782 | 59 |
| 50 | 3300031456 | Ga0307513_10990635 | Ga0307513_109906352 | 59 |
| 51 | 3300031548 | Ga0307408_101020152 | Ga0307408_1010201522 | 59 |
| 52 | 3300031548 | Ga0307408_101460613 | Ga0307408_1014606131 | 59 |
| 53 | 3300031548 | Ga0307408_101841299 | Ga0307408_1018412992 | 59 |
| 54 | 3300031595 | Ga0265313_10004088 | Ga0265313_100040885 | 59 |
| 55 | 3300031595 | Ga0265313_10007724 | Ga0265313_1000772410 | 59 |
| 56 | 3300031665 | Ga0316575_10049055 | Ga0316575_100490551 | 59 |
| 57 | 3300031691 | Ga0316579_10499764 | Ga0316579_104997641 | 59 |
| 58 | 3300031711 | Ga0265314_10011207 | Ga0265314_100112077 | 59 |
| 59 | 3300031711 | Ga0265314_10034101 | Ga0265314_100341013 | 59 |
| 60 | 3300031711 | Ga0265314_10384211 | Ga0265314_103842112 | 59 |
| 61 | 3300031731 | Ga0307405_12161306 | Ga0307405_121613062 | 59 |
| 62 | 3300031824 | Ga0307413_10118701 | Ga0307413_101187012 | 59 |
| 63 | 3300031824 | Ga0307413_10240404 | Ga0307413_102404042 | 59 |
| 64 | 3300031824 | Ga0307413_10352999 | Ga0307413_103529992 | 59 |
| 65 | 3300031824 | Ga0307413_10744247 | Ga0307413_107442472 | 59 |
| 66 | 3300031852 | Ga0307410_10151226 | Ga0307410_101512262 | 59 |
| 67 | 3300031852 | Ga0307410_10407000 | Ga0307410_104070002 | 59 |
| 68 | 3300031852 | Ga0307410_10506159 | Ga0307410_105061592 | 59 |
| 69 | 3300031852 | Ga0307410_11603655 | Ga0307410_116036551 | 59 |
| 70 | 3300031852 | Ga0307410_11866437 | Ga0307410_118664371 | 59 |
| 71 | 3300031852 | Ga0307410_12148422 | Ga0307410_121484221 | 59 |
| 72 | 3300031901 | Ga0307406_10379229 | Ga0307406_103792292 | 59 |
| 73 | 3300031901 | Ga0307406_10381357 | Ga0307406_103813572 | 59 |
| 74 | 3300031901 | Ga0307406_10838192 | Ga0307406_108381922 | 59 |
| 75 | 3300031903 | Ga0307407_10024120 | Ga0307407_100241203 | 59 |
| 76 | 3300031903 | Ga0307407_10065509 | Ga0307407_100655092 | 59 |
| 77 | 3300031903 | Ga0307407_10342875 | Ga0307407_103428752 | 59 |
| 78 | 3300031903 | Ga0307407_10413171 | Ga0307407_104131712 | 59 |
| 79 | 3300031903 | Ga0307407_10843521 | Ga0307407_108435212 | 59 |
| 80 | 3300031903 | Ga0307407_11544024 | Ga0307407_115440241 | 59 |
| 81 | 3300031911 | Ga0307412_10361128 | Ga0307412_103611282 | 59 |
| 82 | 3300031911 | Ga0307412_10483439 | Ga0307412_104834392 | 59 |
| 83 | 3300031911 | Ga0307412_10581406 | Ga0307412_105814062 | 59 |
| 84 | 3300031911 | Ga0307412_11625459 | Ga0307412_116254592 | 59 |
| 85 | 3300031995 | Ga0307409_100076722 | Ga0307409_1000767223 | 59 |
| 86 | 3300031995 | Ga0307409_100245719 | Ga0307409_1002457193 | 59 |
| 87 | 3300031995 | Ga0307409_101132224 | Ga0307409_1011322242 | 59 |
| 88 | 3300031995 | Ga0307409_101749516 | Ga0307409_1017495162 | 59 |
| 89 | 3300032002 | Ga0307416_100077132 | Ga0307416_1000771323 | 59 |
| 90 | 3300032002 | Ga0307416_100684930 | Ga0307416_1006849302 | 59 |
| 91 | 3300032002 | Ga0307416_101109960 | Ga0307416_1011099601 | 59 |
| 92 | 3300032002 | Ga0307416_102102398 | Ga0307416_1021023982 | 59 |
| 93 | 3300032002 | Ga0307416_103540377 | Ga0307416_1035403771 | 59 |
| 94 | 3300032004 | Ga0307414_10061652 | Ga0307414_100616522 | 59 |
| 95 | 3300032004 | Ga0307414_10144786 | Ga0307414_101447862 | 59 |
| 96 | 3300032004 | Ga0307414_10387252 | Ga0307414_103872523 | 59 |
| 97 | 3300032004 | Ga0307414_10467870 | Ga0307414_104678702 | 59 |
| 98 | 3300032004 | Ga0307414_10682392 | Ga0307414_106823922 | 59 |
| 99 | 3300032004 | Ga0307414_10924834 | Ga0307414_109248342 | 59 |
| 100 | 3300032004 | Ga0307414_11253991 | Ga0307414_112539912 | 59 |
| 101 | 3300032004 | Ga0307414_11626754 | Ga0307414_116267541 | 59 |
| 102 | 3300032005 | Ga0307411_10056123 | Ga0307411_100561232 | 59 |
| 103 | 3300032005 | Ga0307411_10216913 | Ga0307411_102169132 | 59 |
| 104 | 3300032005 | Ga0307411_10299717 | Ga0307411_102997172 | 59 |
| 105 | 3300032005 | Ga0307411_10488055 | Ga0307411_104880552 | 59 |
| 106 | 3300032005 | Ga0307411_11786241 | Ga0307411_117862412 | 59 |
| 107 | 3300032005 | Ga0307411_11854707 | Ga0307411_118547072 | 59 |
| 108 | 3300032126 | Ga0307415_100077652 | Ga0307415_1000776523 | 59 |
| 109 | 3300032126 | Ga0307415_100445461 | Ga0307415_1004454612 | 59 |
| 110 | 3300032126 | Ga0307415_100634423 | Ga0307415_1006344232 | 59 |
| 111 | 3300035170 | Ga0373943_0012285 | Ga0373943_0012285_249_428 | 59 |
| 112 | 3300037068 | Ga0373925_0001803 | Ga0373925_0001803_6429_6608 | 59 |
| 113 | 3300037471 | Ga0395905_0170538 | Ga0395905_0170538_1705_1884 | 59 |
| 114 | 3300037853 | Ga0436364_0824263 | Ga0436364_0824263_138_317 | 59 |
| 115 | 3300041411 | Ga0439466_0206085 | Ga0439466_0206085_342_521 | 59 |
| 116 | 3300041413 | Ga0439465_0014311 | Ga0439465_0014311_2244_2423 | 59 |
| 117 | 3300041452 | Ga0451793_1926393 | Ga0451793_1926393_52_231 | 59 |
| 118 | 3300041458 | Ga0451798_0838824 | Ga0451798_0838824_383_562 | 59 |
| 119 | 3300041459 | Ga0451800_0464072 | Ga0451800_0464072_197_376 | 59 |
| 120 | 3300041460 | Ga0451802_1476308 | Ga0451802_1476308_430_609 | 59 |
| 121 | 3300041509 | Ga0451843_1308798 | Ga0451843_1308798_171_350 | 59 |
| 122 | 3300042002 | Ga0439442_050511 | Ga0439442_050511_533_712 | 59 |
| 123 | 3300042004 | Ga0439445_0032864 | Ga0439445_0032864_440_619 | 59 |
| 124 | 3300042004 | Ga0439445_0179473 | Ga0439445_0179473_49_228 | 59 |
| 125 | 3300044684 | Ga0466966_0064946 | Ga0466966_0064946_1609_1788 | 59 |
| 126 | 3300044693 | Ga0466961_0119483 | Ga0466961_0119483_689_868 | 59 |
| 127 | 3300044765 | Ga0466970_0170236 | Ga0466970_0170236_423_602 | 59 |
| 128 | 3300045049 | Ga0466959_0195141 | Ga0466959_0195141_824_1003 | 59 |
| 129 | 3300045836 | Ga0466958_0445342 | Ga0466958_0445342_184_363 | 59 |
| 130 | 3300046459 | Ga0495629_0467504 | Ga0495629_0467504_329_508 | 59 |
| 131 | 3300046475 | Ga0495639_0329567 | Ga0495639_0329567_284_463 | 59 |
| 132 | 3300046501 | Ga0495607_0460828 | Ga0495607_0460828_43_222 | 59 |
| 133 | 3300046683 | Ga0495658_0067764 | Ga0495658_0067764_641_820 | 59 |
| 134 | 3300046690 | Ga0495624_0082628 | Ga0495624_0082628_882_1061 | 59 |
| 135 | 3300048905 | Ga0496102_0000034 | Ga0496102_0000034_166399_166578 | 59 |
| 136 | 3300048906 | Ga0496103_0000026 | Ga0496103_0000026_166399_166578 | 59 |
| 137 | 3300048908 | Ga0496105_0646552 | Ga0496105_0646552_314_493 | 59 |
| 138 | 3300048911 | Ga0496108_0252642 | Ga0496108_0252642_14_193 | 59 |
| 139 | 3300048912 | Ga0496109_0638925 | Ga0496109_0638925_642_821 | 59 |
| 140 | 3300048919 | Ga0496116_0002308 | Ga0496116_0002308_10486_10665 | 59 |
| 141 | 3300048920 | Ga0496117_0000072 | Ga0496117_0000072_190939_191118 | 59 |
| 142 | 3300048921 | Ga0496118_0000030 | Ga0496118_0000030_47249_47428 | 59 |
| 143 | 3300048922 | Ga0496119_0036947 | Ga0496119_0036947_1401_1580 | 59 |
| 144 | 3300048924 | Ga0496121_0539712 | Ga0496121_0539712_501_680 | 59 |
| 145 | 3300048927 | Ga0496124_0000061 | Ga0496124_0000061_47249_47428 | 59 |
| 146 | 3300048929 | Ga0496126_0026844 | Ga0496126_0026844_1367_1546 | 59 |
| 147 | 3300048929 | Ga0496126_0564777 | Ga0496126_0564777_310_489 | 59 |
| 148 | 3300049130 | Ga0501310_031570 | Ga0501310_031570_291_470 | 59 |
| 149 | 3300049162 | Ga0501307_044598 | Ga0501307_044598_322_501 | 59 |
| 150 | 3300049527 | Ga0501311_095454 | Ga0501311_095454_257_436 | 59 |
| 151 | 3300049528 | Ga0501312_087508 | Ga0501312_087508_157_336 | 59 |
| 152 | 3300049531 | Ga0501315_091535 | Ga0501315_091535_90_269 | 59 |
| 153 | 3300049532 | Ga0501316_072603 | Ga0501316_072603_85_264 | 59 |
| 154 | 3300049533 | Ga0501317_070626 | Ga0501317_070626_347_526 | 59 |
| 155 | 3300049536 | Ga0501320_069732 | Ga0501320_069732_270_449 | 59 |
| 156 | 3300049537 | Ga0501321_040259 | Ga0501321_040259_257_436 | 59 |
| 157 | 3300049539 | Ga0501323_070654 | Ga0501323_070654_246_425 | 59 |
| 158 | 3300049549 | Ga0501333_022213 | Ga0501333_022213_87_266 | 59 |
| 159 | 3300049552 | Ga0501336_026000 | Ga0501336_026000_281_460 | 59 |
| 160 | 3300049556 | Ga0501340_025454 | Ga0501340_025454_239_418 | 59 |
| 161 | 3300049570 | Ga0501033_0279467 | Ga0501033_0279467_348_527 | 59 |
| 162 | 3300049571 | Ga0501034_0001360 | Ga0501034_0001360_61_240 | 59 |
| 163 | 3300049571 | Ga0501034_0036387 | Ga0501034_0036387_1390_1569 | 59 |
| 164 | 3300049571 | Ga0501034_0273907 | Ga0501034_0273907_1434_1613 | 59 |
| 165 | 3300049571 | Ga0501034_0409635 | Ga0501034_0409635_281_460 | 59 |
| 166 | 3300049571 | Ga0501034_0917453 | Ga0501034_0917453_371_550 | 59 |
| 167 | 3300049581 | Ga0501047_0503412 | Ga0501047_0503412_485_664 | 59 |
| 168 | 3300049661 | Ga0501217_117316 | Ga0501217_117316_334_513 | 59 |
| 169 | 3300049661 | Ga0501217_260318 | Ga0501217_260318_246_425 | 59 |
| 170 | 3300049663 | Ga0501223_122000 | Ga0501223_122000_147_326 | 59 |
| 171 | 3300049668 | Ga0501233_181258 | Ga0501233_181258_258_437 | 59 |
| 172 | 3300049669 | Ga0501235_217132 | Ga0501235_217132_95_274 | 59 |
| 173 | 3300049672 | Ga0501239_071890 | Ga0501239_071890_71_250 | 59 |
| 174 | 3300049673 | Ga0501240_024707 | Ga0501240_024707_177_356 | 59 |
| 175 | 3300049674 | Ga0501242_086216 | Ga0501242_086216_283_462 | 59 |
| 176 | 3300049675 | Ga0501243_021746 | Ga0501243_021746_518_697 | 59 |
| 177 | 3300049677 | Ga0501247_035849 | Ga0501247_035849_300_479 | 59 |
| 178 | 3300049681 | Ga0501251_091380 | Ga0501251_091380_73_252 | 59 |
| 179 | 3300049686 | Ga0501257_146522 | Ga0501257_146522_218_397 | 59 |
| 180 | 3300049705 | Ga0501225_0306999 | Ga0501225_0306999_179_358 | 59 |
| 181 | 3300049706 | Ga0501229_048652 | Ga0501229_048652_154_333 | 59 |
| 182 | 3300049707 | Ga0501234_026341 | Ga0501234_026341_604_783 | 59 |
| 183 | 3300049744 | Ga0501083_0519070 | Ga0501083_0519070_150_329 | 59 |
| 184 | 3300049758 | Ga0501241_136699 | Ga0501241_136699_31_210 | 59 |
| 185 | 3300049761 | Ga0501264_044832 | Ga0501264_044832_94_273 | 59 |
| 186 | 3300049764 | Ga0501267_015401 | Ga0501267_015401_551_730 | 59 |
| 187 | 3300049764 | Ga0501267_019969 | Ga0501267_019969_418_597 | 59 |
| 188 | 3300049765 | Ga0501268_026257 | Ga0501268_026257_680_859 | 59 |
| 189 | 3300049765 | Ga0501268_162885 | Ga0501268_162885_26_205 | 59 |
| 190 | 3300049769 | Ga0501272_065843 | Ga0501272_065843_215_394 | 59 |
| 191 | 3300049770 | Ga0501273_041434 | Ga0501273_041434_322_501 | 59 |
| 192 | 3300049822 | Ga0501035_0037612 | Ga0501035_0037612_2602_2781 | 59 |
| 193 | 3300049850 | Ga0501204_071374 | Ga0501204_071374_44_223 | 59 |
| 194 | 3300049851 | Ga0501212_044071 | Ga0501212_044071_247_426 | 59 |
| 195 | 3300053140 | Ga0500573_0504641 | Ga0500573_0504641_192_371 | 59 |
| 196 | 3300053142 | Ga0500577_0267177 | Ga0500577_0267177_136_315 | 59 |
| 197 | 3300053151 | Ga0500604_0000092 | Ga0500604_0000092_11031_11210 | 59 |
| 198 | 3300053151 | Ga0500604_0283855 | Ga0500604_0283855_92_271 | 59 |
| 199 | 3300061719 | Ga0466962_0163736 | Ga0466962_0163736_507_686 | 59 |
| 200 | 3300001979 | JGI24740J21852_10082774 | JGI24740J21852_100827742 | 60 |
| 201 | 3300001990 | JGI24737J22298_10246203 | JGI24737J22298_102462031 | 60 |
| 202 | 3300002067 | JGI24735J21928_10121791 | JGI24735J21928_101217912 | 60 |
| 203 | 3300003781 | Ga0055536_1005132 | Ga0055536_10051327 | 60 |
| 204 | 3300003781 | Ga0055536_1005459 | Ga0055536_10054596 | 60 |
| 205 | 3300003794 | Ga0055531_10001759 | Ga0055531_100017598 | 60 |
| 206 | 3300003794 | Ga0055531_10033269 | Ga0055531_100332692 | 60 |
| 207 | 3300005293 | Ga0065715_10038113 | Ga0065715_100381132 | 60 |
| 208 | 3300005327 | Ga0070658_10037406 | Ga0070658_100374066 | 60 |
| 209 | 3300005327 | Ga0070658_10120646 | Ga0070658_101206463 | 60 |
| 210 | 3300005327 | Ga0070658_10230339 | Ga0070658_102303392 | 60 |
| 211 | 3300005327 | Ga0070658_11126232 | Ga0070658_111262322 | 60 |
| 212 | 3300005327 | Ga0070658_11245182 | Ga0070658_112451821 | 60 |
| 213 | 3300005327 | Ga0070658_11296796 | Ga0070658_112967961 | 60 |
| 214 | 3300005327 | Ga0070658_11897721 | Ga0070658_118977211 | 60 |
| 215 | 3300005328 | Ga0070676_10201527 | Ga0070676_102015272 | 60 |
| 216 | 3300005329 | Ga0070683_100239781 | Ga0070683_1002397812 | 60 |
| 217 | 3300005329 | Ga0070683_100501443 | Ga0070683_1005014432 | 60 |
| 218 | 3300005331 | Ga0070670_100000037 | Ga0070670_10000003779 | 60 |
| 219 | 3300005331 | Ga0070670_100097305 | Ga0070670_1000973052 | 60 |
| 220 | 3300005331 | Ga0070670_100114793 | Ga0070670_1001147931 | 60 |
| 221 | 3300005331 | Ga0070670_100239057 | Ga0070670_1002390572 | 60 |
| 222 | 3300005331 | Ga0070670_101031068 | Ga0070670_1010310682 | 60 |
| 223 | 3300005334 | Ga0068869_100670951 | Ga0068869_1006709512 | 60 |
| 224 | 3300005335 | Ga0070666_10156501 | Ga0070666_101565012 | 60 |
| 225 | 3300005335 | Ga0070666_10308471 | Ga0070666_103084712 | 60 |
| 226 | 3300005335 | Ga0070666_10623783 | Ga0070666_106237832 | 60 |
| 227 | 3300005335 | Ga0070666_11486998 | Ga0070666_114869982 | 60 |
| 228 | 3300005336 | Ga0070680_100028910 | Ga0070680_1000289107 | 60 |
| 229 | 3300005336 | Ga0070680_100063220 | Ga0070680_1000632204 | 60 |
| 230 | 3300005336 | Ga0070680_100592280 | Ga0070680_1005922802 | 60 |
| 231 | 3300005336 | Ga0070680_100719008 | Ga0070680_1007190082 | 60 |
| 232 | 3300005337 | Ga0070682_100201014 | Ga0070682_1002010143 | 60 |
| 233 | 3300005338 | Ga0068868_100054268 | Ga0068868_1000542685 | 60 |
| 234 | 3300005339 | Ga0070660_100049520 | Ga0070660_1000495204 | 60 |
| 235 | 3300005339 | Ga0070660_100062622 | Ga0070660_1000626222 | 60 |
| 236 | 3300005339 | Ga0070660_100632862 | Ga0070660_1006328622 | 60 |
| 237 | 3300005341 | Ga0070691_10006942 | Ga0070691_100069425 | 60 |
| 238 | 3300005344 | Ga0070661_100059856 | Ga0070661_1000598563 | 60 |
| 239 | 3300005344 | Ga0070661_100125177 | Ga0070661_1001251772 | 60 |
| 240 | 3300005344 | Ga0070661_100231753 | Ga0070661_1002317532 | 60 |
| 241 | 3300005344 | Ga0070661_100386980 | Ga0070661_1003869803 | 60 |
| 242 | 3300005344 | Ga0070661_100467090 | Ga0070661_1004670902 | 60 |
| 243 | 3300005344 | Ga0070661_100791305 | Ga0070661_1007913051 | 60 |
| 244 | 3300005344 | Ga0070661_101162213 | Ga0070661_1011622132 | 60 |
| 245 | 3300005344 | Ga0070661_101436225 | Ga0070661_1014362251 | 60 |
| 246 | 3300005347 | Ga0070668_100000097 | Ga0070668_10000009740 | 60 |
| 247 | 3300005347 | Ga0070668_100001398 | Ga0070668_1000013987 | 60 |
| 248 | 3300005347 | Ga0070668_100006261 | Ga0070668_1000062616 | 60 |
| 249 | 3300005347 | Ga0070668_100023971 | Ga0070668_1000239714 | 60 |
| 250 | 3300005347 | Ga0070668_100026662 | Ga0070668_1000266622 | 60 |
| 251 | 3300005347 | Ga0070668_100397774 | Ga0070668_1003977742 | 60 |
| 252 | 3300005353 | Ga0070669_100007690 | Ga0070669_1000076905 | 60 |
| 253 | 3300005353 | Ga0070669_100100055 | Ga0070669_1001000552 | 60 |
| 254 | 3300005353 | Ga0070669_101586422 | Ga0070669_1015864221 | 60 |
| 255 | 3300005354 | Ga0070675_101543746 | Ga0070675_1015437461 | 60 |
| 256 | 3300005355 | Ga0070671_100000342 | Ga0070671_10000034235 | 60 |
| 257 | 3300005355 | Ga0070671_100151193 | Ga0070671_1001511933 | 60 |
| 258 | 3300005355 | Ga0070671_100494765 | Ga0070671_1004947652 | 60 |
| 259 | 3300005365 | Ga0070688_101292261 | Ga0070688_1012922611 | 60 |
| 260 | 3300005366 | Ga0070659_100000206 | Ga0070659_10000020643 | 60 |
| 261 | 3300005366 | Ga0070659_100005903 | Ga0070659_10000590310 | 60 |
| 262 | 3300005366 | Ga0070659_100020949 | Ga0070659_1000209494 | 60 |
| 263 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008379 | 60 |
| 264 | 3300005367 | Ga0070667_100046049 | Ga0070667_1000460492 | 60 |
| 265 | 3300005367 | Ga0070667_100066504 | Ga0070667_1000665042 | 60 |
| 266 | 3300005367 | Ga0070667_100290300 | Ga0070667_1002903001 | 60 |
| 267 | 3300005367 | Ga0070667_101284997 | Ga0070667_1012849972 | 60 |
| 268 | 3300005367 | Ga0070667_101628249 | Ga0070667_1016282491 | 60 |
| 269 | 3300005445 | Ga0070708_101623113 | Ga0070708_1016231131 | 60 |
| 270 | 3300005455 | Ga0070663_100738339 | Ga0070663_1007383392 | 60 |
| 271 | 3300005455 | Ga0070663_100775075 | Ga0070663_1007750751 | 60 |
| 272 | 3300005455 | Ga0070663_100998649 | Ga0070663_1009986492 | 60 |
| 273 | 3300005456 | Ga0070678_100246264 | Ga0070678_1002462641 | 60 |
| 274 | 3300005457 | Ga0070662_100079996 | Ga0070662_1000799962 | 60 |
| 275 | 3300005457 | Ga0070662_100161703 | Ga0070662_1001617032 | 60 |
| 276 | 3300005458 | Ga0070681_10077685 | Ga0070681_100776854 | 60 |
| 277 | 3300005458 | Ga0070681_10101301 | Ga0070681_101013013 | 60 |
| 278 | 3300005458 | Ga0070681_10806527 | Ga0070681_108065271 | 60 |
| 279 | 3300005459 | Ga0068867_100243024 | Ga0068867_1002430242 | 60 |
| 280 | 3300005530 | Ga0070679_100003462 | Ga0070679_10000346210 | 60 |
| 281 | 3300005530 | Ga0070679_100882651 | Ga0070679_1008826512 | 60 |
| 282 | 3300005530 | Ga0070679_101115383 | Ga0070679_1011153831 | 60 |
| 283 | 3300005535 | Ga0070684_100106711 | Ga0070684_1001067113 | 60 |
| 284 | 3300005535 | Ga0070684_100858679 | Ga0070684_1008586792 | 60 |
| 285 | 3300005535 | Ga0070684_102357950 | Ga0070684_1023579502 | 60 |
| 286 | 3300005539 | Ga0068853_100028237 | Ga0068853_1000282372 | 60 |
| 287 | 3300005539 | Ga0068853_100177892 | Ga0068853_1001778923 | 60 |
| 288 | 3300005539 | Ga0068853_100296779 | Ga0068853_1002967792 | 60 |
| 289 | 3300005539 | Ga0068853_101504580 | Ga0068853_1015045801 | 60 |
| 290 | 3300005546 | Ga0070696_100893054 | Ga0070696_1008930541 | 60 |
| 291 | 3300005547 | Ga0070693_100138542 | Ga0070693_1001385422 | 60 |
| 292 | 3300005548 | Ga0070665_100000116 | Ga0070665_10000011669 | 60 |
| 293 | 3300005548 | Ga0070665_100000278 | Ga0070665_10000027817 | 60 |
| 294 | 3300005548 | Ga0070665_100000483 | Ga0070665_10000048315 | 60 |
| 295 | 3300005548 | Ga0070665_100042615 | Ga0070665_1000426151 | 60 |
| 296 | 3300005548 | Ga0070665_100100096 | Ga0070665_1001000962 | 60 |
| 297 | 3300005548 | Ga0070665_100205584 | Ga0070665_1002055843 | 60 |
| 298 | 3300005548 | Ga0070665_100442617 | Ga0070665_1004426172 | 60 |
| 299 | 3300005548 | Ga0070665_100706317 | Ga0070665_1007063172 | 60 |
| 300 | 3300005548 | Ga0070665_101617521 | Ga0070665_1016175212 | 60 |
| 301 | 3300005548 | Ga0070665_101697412 | Ga0070665_1016974122 | 60 |
| 302 | 3300005549 | Ga0070704_101661965 | Ga0070704_1016619651 | 60 |
| 303 | 3300005563 | Ga0068855_100114613 | Ga0068855_1001146132 | 60 |
| 304 | 3300005563 | Ga0068855_100164536 | Ga0068855_1001645363 | 60 |
| 305 | 3300005563 | Ga0068855_100227544 | Ga0068855_1002275442 | 60 |
| 306 | 3300005563 | Ga0068855_100361294 | Ga0068855_1003612942 | 60 |
| 307 | 3300005563 | Ga0068855_100510096 | Ga0068855_1005100962 | 60 |
| 308 | 3300005563 | Ga0068855_100604355 | Ga0068855_1006043552 | 60 |
| 309 | 3300005563 | Ga0068855_100643314 | Ga0068855_1006433142 | 60 |
| 310 | 3300005563 | Ga0068855_100903913 | Ga0068855_1009039132 | 60 |
| 311 | 3300005564 | Ga0070664_100032151 | Ga0070664_1000321512 | 60 |
| 312 | 3300005564 | Ga0070664_100128100 | Ga0070664_1001281002 | 60 |
| 313 | 3300005564 | Ga0070664_100539963 | Ga0070664_1005399632 | 60 |
| 314 | 3300005564 | Ga0070664_102348081 | Ga0070664_1023480811 | 60 |
| 315 | 3300005577 | Ga0068857_100008234 | Ga0068857_1000082342 | 60 |
| 316 | 3300005577 | Ga0068857_100310468 | Ga0068857_1003104682 | 60 |
| 317 | 3300005577 | Ga0068857_100596708 | Ga0068857_1005967082 | 60 |
| 318 | 3300005577 | Ga0068857_102119091 | Ga0068857_1021190911 | 60 |
| 319 | 3300005578 | Ga0068854_100011218 | Ga0068854_1000112182 | 60 |
| 320 | 3300005578 | Ga0068854_100704745 | Ga0068854_1007047452 | 60 |
| 321 | 3300005578 | Ga0068854_101008208 | Ga0068854_1010082082 | 60 |
| 322 | 3300005614 | Ga0068856_100017487 | Ga0068856_1000174873 | 60 |
| 323 | 3300005614 | Ga0068856_100242993 | Ga0068856_1002429933 | 60 |
| 324 | 3300005614 | Ga0068856_100641513 | Ga0068856_1006415133 | 60 |
| 325 | 3300005614 | Ga0068856_101010843 | Ga0068856_1010108432 | 60 |
| 326 | 3300005614 | Ga0068856_102376714 | Ga0068856_1023767141 | 60 |
| 327 | 3300005616 | Ga0068852_100019264 | Ga0068852_1000192644 | 60 |
| 328 | 3300005616 | Ga0068852_100073366 | Ga0068852_1000733663 | 60 |
| 329 | 3300005616 | Ga0068852_100144567 | Ga0068852_1001445671 | 60 |
| 330 | 3300005616 | Ga0068852_101508007 | Ga0068852_1015080072 | 60 |
| 331 | 3300005617 | Ga0068859_100000435 | Ga0068859_10000043534 | 60 |
| 332 | 3300005617 | Ga0068859_100049354 | Ga0068859_1000493542 | 60 |
| 333 | 3300005617 | Ga0068859_100183093 | Ga0068859_1001830932 | 60 |
| 334 | 3300005617 | Ga0068859_100814918 | Ga0068859_1008149182 | 60 |
| 335 | 3300005617 | Ga0068859_101423464 | Ga0068859_1014234642 | 60 |
| 336 | 3300005618 | Ga0068864_100000115 | Ga0068864_10000011525 | 60 |
| 337 | 3300005618 | Ga0068864_100000786 | Ga0068864_10000078614 | 60 |
| 338 | 3300005618 | Ga0068864_100026445 | Ga0068864_1000264452 | 60 |
| 339 | 3300005618 | Ga0068864_100555600 | Ga0068864_1005556002 | 60 |
| 340 | 3300005618 | Ga0068864_100680565 | Ga0068864_1006805652 | 60 |
| 341 | 3300005618 | Ga0068864_100892398 | Ga0068864_1008923982 | 60 |
| 342 | 3300005718 | Ga0068866_10942109 | Ga0068866_109421092 | 60 |
| 343 | 3300005719 | Ga0068861_100400550 | Ga0068861_1004005502 | 60 |
| 344 | 3300005719 | Ga0068861_100627849 | Ga0068861_1006278492 | 60 |
| 345 | 3300005719 | Ga0068861_100651681 | Ga0068861_1006516812 | 60 |
| 346 | 3300005719 | Ga0068861_100913917 | Ga0068861_1009139172 | 60 |
| 347 | 3300005834 | Ga0068851_10014841 | Ga0068851_100148413 | 60 |
| 348 | 3300005834 | Ga0068851_10616181 | Ga0068851_106161811 | 60 |
| 349 | 3300005840 | Ga0068870_10839108 | Ga0068870_108391082 | 60 |
| 350 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007151 | 60 |
| 351 | 3300005841 | Ga0068863_100000392 | Ga0068863_1000003927 | 60 |
| 352 | 3300005841 | Ga0068863_100014231 | Ga0068863_1000142315 | 60 |
| 353 | 3300005841 | Ga0068863_100079690 | Ga0068863_1000796903 | 60 |
| 354 | 3300005841 | Ga0068863_100131031 | Ga0068863_1001310313 | 60 |
| 355 | 3300005841 | Ga0068863_100597867 | Ga0068863_1005978672 | 60 |
| 356 | 3300005841 | Ga0068863_101267707 | Ga0068863_1012677072 | 60 |
| 357 | 3300005842 | Ga0068858_100000031 | Ga0068858_10000003191 | 60 |
| 358 | 3300005842 | Ga0068858_100003423 | Ga0068858_1000034234 | 60 |
| 359 | 3300005842 | Ga0068858_100004211 | Ga0068858_1000042115 | 60 |
| 360 | 3300005842 | Ga0068858_100275097 | Ga0068858_1002750972 | 60 |
| 361 | 3300005842 | Ga0068858_100639209 | Ga0068858_1006392093 | 60 |
| 362 | 3300005843 | Ga0068860_100000128 | Ga0068860_10000012821 | 60 |
| 363 | 3300005843 | Ga0068860_100000145 | Ga0068860_10000014588 | 60 |
| 364 | 3300005843 | Ga0068860_100045797 | Ga0068860_1000457972 | 60 |
| 365 | 3300005843 | Ga0068860_100108311 | Ga0068860_1001083111 | 60 |
| 366 | 3300005843 | Ga0068860_101369569 | Ga0068860_1013695692 | 60 |
| 367 | 3300005843 | Ga0068860_101726844 | Ga0068860_1017268441 | 60 |
| 368 | 3300005844 | Ga0068862_100001627 | Ga0068862_1000016277 | 60 |
| 369 | 3300005844 | Ga0068862_100007701 | Ga0068862_1000077015 | 60 |
| 370 | 3300005844 | Ga0068862_100022748 | Ga0068862_1000227485 | 60 |
| 371 | 3300005844 | Ga0068862_100063108 | Ga0068862_1000631084 | 60 |
| 372 | 3300005844 | Ga0068862_100063168 | Ga0068862_1000631682 | 60 |
| 373 | 3300005844 | Ga0068862_100272019 | Ga0068862_1002720192 | 60 |
| 374 | 3300005844 | Ga0068862_100835632 | Ga0068862_1008356322 | 60 |
| 375 | 3300006028 | Ga0070717_11305739 | Ga0070717_113057392 | 60 |
| 376 | 3300006042 | Ga0075368_10002625 | Ga0075368_100026252 | 60 |
| 377 | 3300006042 | Ga0075368_10088106 | Ga0075368_100881062 | 60 |
| 378 | 3300006042 | Ga0075368_10281896 | Ga0075368_102818961 | 60 |
| 379 | 3300006048 | Ga0075363_100026589 | Ga0075363_1000265894 | 60 |
| 380 | 3300006048 | Ga0075363_100047395 | Ga0075363_1000473952 | 60 |
| 381 | 3300006048 | Ga0075363_100378161 | Ga0075363_1003781611 | 60 |
| 382 | 3300006051 | Ga0075364_10003475 | Ga0075364_100034756 | 60 |
| 383 | 3300006177 | Ga0075362_10009435 | Ga0075362_100094354 | 60 |
| 384 | 3300006178 | Ga0075367_10005360 | Ga0075367_100053606 | 60 |
| 385 | 3300006178 | Ga0075367_10882675 | Ga0075367_108826752 | 60 |
| 386 | 3300006186 | Ga0075369_10283175 | Ga0075369_102831752 | 60 |
| 387 | 3300006186 | Ga0075369_10486736 | Ga0075369_104867362 | 60 |
| 388 | 3300006195 | Ga0075366_10022416 | Ga0075366_100224165 | 60 |
| 389 | 3300006195 | Ga0075366_10030071 | Ga0075366_100300712 | 60 |
| 390 | 3300006195 | Ga0075366_10375640 | Ga0075366_103756402 | 60 |
| 391 | 3300006237 | Ga0097621_100309224 | Ga0097621_1003092243 | 60 |
| 392 | 3300006237 | Ga0097621_100910367 | Ga0097621_1009103671 | 60 |
| 393 | 3300006353 | Ga0075370_10013637 | Ga0075370_100136375 | 60 |
| 394 | 3300006353 | Ga0075370_10337651 | Ga0075370_103376512 | 60 |
| 395 | 3300006353 | Ga0075370_10700728 | Ga0075370_107007281 | 60 |
| 396 | 3300006353 | Ga0075370_10708620 | Ga0075370_107086201 | 60 |
| 397 | 3300006358 | Ga0068871_100383643 | Ga0068871_1003836432 | 60 |
| 398 | 3300006358 | Ga0068871_100892381 | Ga0068871_1008923812 | 60 |
| 399 | 3300006881 | Ga0068865_100004059 | Ga0068865_10000405910 | 60 |
| 400 | 3300006931 | Ga0097620_100000435 | Ga0097620_10000043534 | 60 |
| 401 | 3300006931 | Ga0097620_100049353 | Ga0097620_1000493532 | 60 |
| 402 | 3300006931 | Ga0097620_100183098 | Ga0097620_1001830982 | 60 |
| 403 | 3300006931 | Ga0097620_100814973 | Ga0097620_1008149731 | 60 |
| 404 | 3300006931 | Ga0097620_101423286 | Ga0097620_1014232862 | 60 |
| 405 | 3300006946 | Ga0079104_1030697 | Ga0079104_10306972 | 60 |
| 406 | 3300009093 | Ga0105240_10043434 | Ga0105240_100434346 | 60 |
| 407 | 3300009093 | Ga0105240_10073611 | Ga0105240_100736115 | 60 |
| 408 | 3300009093 | Ga0105240_10076980 | Ga0105240_100769804 | 60 |
| 409 | 3300009093 | Ga0105240_10081004 | Ga0105240_100810044 | 60 |
| 410 | 3300009093 | Ga0105240_10104804 | Ga0105240_101048045 | 60 |
| 411 | 3300009093 | Ga0105240_11361855 | Ga0105240_113618551 | 60 |
| 412 | 3300009093 | Ga0105240_12454470 | Ga0105240_124544702 | 60 |
| 413 | 3300009098 | Ga0105245_11822568 | Ga0105245_118225682 | 60 |
| 414 | 3300009101 | Ga0105247_10168493 | Ga0105247_101684932 | 60 |
| 415 | 3300009101 | Ga0105247_10515003 | Ga0105247_105150032 | 60 |
| 416 | 3300009174 | Ga0105241_10863091 | Ga0105241_108630912 | 60 |
| 417 | 3300009174 | Ga0105241_11400609 | Ga0105241_114006092 | 60 |
| 418 | 3300009176 | Ga0105242_10055341 | Ga0105242_100553414 | 60 |
| 419 | 3300009176 | Ga0105242_13164752 | Ga0105242_131647522 | 60 |
| 420 | 3300009177 | Ga0105248_10007787 | Ga0105248_100077879 | 60 |
| 421 | 3300009177 | Ga0105248_10038574 | Ga0105248_100385742 | 60 |
| 422 | 3300009177 | Ga0105248_10041310 | Ga0105248_100413105 | 60 |
| 423 | 3300009177 | Ga0105248_10082220 | Ga0105248_100822202 | 60 |
| 424 | 3300009177 | Ga0105248_10102723 | Ga0105248_101027231 | 60 |
| 425 | 3300009177 | Ga0105248_10286371 | Ga0105248_102863712 | 60 |
| 426 | 3300009177 | Ga0105248_10543159 | Ga0105248_105431592 | 60 |
| 427 | 3300009177 | Ga0105248_10626607 | Ga0105248_106266072 | 60 |
| 428 | 3300009177 | Ga0105248_11541333 | Ga0105248_115413332 | 60 |
| 429 | 3300009545 | Ga0105237_11020032 | Ga0105237_110200322 | 60 |
| 430 | 3300009551 | Ga0105238_10026734 | Ga0105238_100267346 | 60 |
| 431 | 3300009551 | Ga0105238_10087665 | Ga0105238_100876654 | 60 |
| 432 | 3300009551 | Ga0105238_10191222 | Ga0105238_101912223 | 60 |
| 433 | 3300009551 | Ga0105238_10367629 | Ga0105238_103676293 | 60 |
| 434 | 3300009551 | Ga0105238_11067770 | Ga0105238_110677702 | 60 |
| 435 | 3300009551 | Ga0105238_11394847 | Ga0105238_113948472 | 60 |
| 436 | 3300009551 | Ga0105238_12188600 | Ga0105238_121886001 | 60 |
| 437 | 3300009553 | Ga0105249_10000410 | Ga0105249_1000041044 | 60 |
| 438 | 3300009553 | Ga0105249_10115487 | Ga0105249_101154874 | 60 |
| 439 | 3300010375 | Ga0105239_10288771 | Ga0105239_102887712 | 60 |
| 440 | 3300010375 | Ga0105239_10464722 | Ga0105239_104647222 | 60 |
| 441 | 3300010375 | Ga0105239_11367739 | Ga0105239_113677391 | 60 |
| 442 | 3300010375 | Ga0105239_12009977 | Ga0105239_120099771 | 60 |
| 443 | 3300013102 | Ga0157371_10032519 | Ga0157371_100325192 | 60 |
| 444 | 3300013102 | Ga0157371_10205940 | Ga0157371_102059402 | 60 |
| 445 | 3300013102 | Ga0157371_10504488 | Ga0157371_105044882 | 60 |
| 446 | 3300013104 | Ga0157370_10026878 | Ga0157370_100268784 | 60 |
| 447 | 3300013104 | Ga0157370_10198035 | Ga0157370_101980353 | 60 |
| 448 | 3300013104 | Ga0157370_10218409 | Ga0157370_102184092 | 60 |
| 449 | 3300013104 | Ga0157370_10244147 | Ga0157370_102441471 | 60 |
| 450 | 3300013105 | Ga0157369_10291159 | Ga0157369_102911591 | 60 |
| 451 | 3300013105 | Ga0157369_10295251 | Ga0157369_102952513 | 60 |
| 452 | 3300013105 | Ga0157369_11019070 | Ga0157369_110190702 | 60 |
| 453 | 3300013296 | Ga0157374_10174233 | Ga0157374_101742332 | 60 |
| 454 | 3300013296 | Ga0157374_10471786 | Ga0157374_104717862 | 60 |
| 455 | 3300013297 | Ga0157378_10757173 | Ga0157378_107571732 | 60 |
| 456 | 3300013297 | Ga0157378_11139770 | Ga0157378_111397702 | 60 |
| 457 | 3300013306 | Ga0163162_10027619 | Ga0163162_100276192 | 60 |
| 458 | 3300013306 | Ga0163162_10063898 | Ga0163162_100638982 | 60 |
| 459 | 3300013306 | Ga0163162_10619135 | Ga0163162_106191354 | 60 |
| 460 | 3300013306 | Ga0163162_10710773 | Ga0163162_107107732 | 60 |
| 461 | 3300013306 | Ga0163162_12092666 | Ga0163162_120926662 | 60 |
| 462 | 3300013307 | Ga0157372_10056762 | Ga0157372_100567626 | 60 |
| 463 | 3300013307 | Ga0157372_10286129 | Ga0157372_102861293 | 60 |
| 464 | 3300013307 | Ga0157372_11097531 | Ga0157372_110975312 | 60 |
| 465 | 3300013307 | Ga0157372_11248851 | Ga0157372_112488512 | 60 |
| 466 | 3300014325 | Ga0163163_10033603 | Ga0163163_100336035 | 60 |
| 467 | 3300014325 | Ga0163163_10072795 | Ga0163163_100727955 | 60 |
| 468 | 3300014325 | Ga0163163_10313723 | Ga0163163_103137232 | 60 |
| 469 | 3300014325 | Ga0163163_11233002 | Ga0163163_112330022 | 60 |
| 470 | 3300014325 | Ga0163163_11558363 | Ga0163163_115583632 | 60 |
| 471 | 3300014325 | Ga0163163_13014387 | Ga0163163_130143871 | 60 |
| 472 | 3300014326 | Ga0157380_10952059 | Ga0157380_109520592 | 60 |
| 473 | 3300014326 | Ga0157380_11914231 | Ga0157380_119142312 | 60 |
| 474 | 3300014497 | Ga0182008_10269253 | Ga0182008_102692532 | 60 |
| 475 | 3300014745 | Ga0157377_11208318 | Ga0157377_112083181 | 60 |
| 476 | 3300014968 | Ga0157379_10007276 | Ga0157379_100072766 | 60 |
| 477 | 3300014968 | Ga0157379_10080776 | Ga0157379_100807762 | 60 |
| 478 | 3300014968 | Ga0157379_10187762 | Ga0157379_101877622 | 60 |
| 479 | 3300014968 | Ga0157379_10482129 | Ga0157379_104821292 | 60 |
| 480 | 3300014968 | Ga0157379_11119088 | Ga0157379_111190882 | 60 |
| 481 | 3300014969 | Ga0157376_10470617 | Ga0157376_104706172 | 60 |
| 482 | 3300014969 | Ga0157376_10519222 | Ga0157376_105192222 | 60 |
| 483 | 3300014969 | Ga0157376_10792822 | Ga0157376_107928221 | 60 |
| 484 | 3300015684 | Ga0183365_10002 | Ga0183365_10002255 | 60 |
| 485 | 3300017792 | Ga0163161_10344065 | Ga0163161_103440652 | 60 |
| 486 | 3300017792 | Ga0163161_11364776 | Ga0163161_113647762 | 60 |
| 487 | 3300020076 | Ga0206355_1455122 | Ga0206355_14551221 | 60 |
| 488 | 3300020081 | Ga0206354_10432311 | Ga0206354_104323112 | 60 |
| 489 | 3300021384 | Ga0213876_10035545 | Ga0213876_100355452 | 60 |
| 490 | 3300025250 | Ga0209026_1009684 | Ga0209026_10096844 | 60 |
| 491 | 3300025254 | Ga0209148_1026954 | Ga0209148_10269542 | 60 |
| 492 | 3300025261 | Ga0209233_1072761 | Ga0209233_10727612 | 60 |
| 493 | 3300025263 | Ga0209565_1000641 | Ga0209565_100064119 | 60 |
| 494 | 3300025272 | Ga0209455_1017988 | Ga0209455_10179882 | 60 |
| 495 | 3300025273 | Ga0209673_1000523 | Ga0209673_100052360 | 60 |
| 496 | 3300025292 | Ga0209676_1000057 | Ga0209676_10000575 | 60 |
| 497 | 3300025292 | Ga0209676_1000061 | Ga0209676_1000061165 | 60 |
| 498 | 3300025292 | Ga0209676_1000679 | Ga0209676_10006797 | 60 |
| 499 | 3300025298 | Ga0209050_1013814 | Ga0209050_10138142 | 60 |
| 500 | 3300025298 | Ga0209050_1014339 | Ga0209050_10143394 | 60 |
| 501 | 3300025298 | Ga0209050_1017660 | Ga0209050_10176602 | 60 |
| 502 | 3300025298 | Ga0209050_1062943 | Ga0209050_10629433 | 60 |
| 503 | 3300025299 | Ga0209256_1002428 | Ga0209256_100242810 | 60 |
| 504 | 3300025299 | Ga0209256_1012333 | Ga0209256_10123332 | 60 |
| 505 | 3300025303 | Ga0209051_1014576 | Ga0209051_10145764 | 60 |
| 506 | 3300025304 | Ga0209257_1000199 | Ga0209257_1000199152 | 60 |
| 507 | 3300025304 | Ga0209257_1000944 | Ga0209257_100094415 | 60 |
| 508 | 3300025304 | Ga0209257_1047759 | Ga0209257_10477592 | 60 |
| 509 | 3300025321 | Ga0207656_10077523 | Ga0207656_100775233 | 60 |
| 510 | 3300025321 | Ga0207656_10507384 | Ga0207656_105073842 | 60 |
| 511 | 3300025711 | Ga0207696_1034957 | Ga0207696_10349572 | 60 |
| 512 | 3300025900 | Ga0207710_10224133 | Ga0207710_102241332 | 60 |
| 513 | 3300025903 | Ga0207680_10109945 | Ga0207680_101099452 | 60 |
| 514 | 3300025903 | Ga0207680_10618778 | Ga0207680_106187782 | 60 |
| 515 | 3300025907 | Ga0207645_10171016 | Ga0207645_101710162 | 60 |
| 516 | 3300025908 | Ga0207643_10960303 | Ga0207643_109603031 | 60 |
| 517 | 3300025909 | Ga0207705_10007993 | Ga0207705_100079937 | 60 |
| 518 | 3300025909 | Ga0207705_10089421 | Ga0207705_100894212 | 60 |
| 519 | 3300025909 | Ga0207705_10098335 | Ga0207705_100983353 | 60 |
| 520 | 3300025909 | Ga0207705_10428991 | Ga0207705_104289911 | 60 |
| 521 | 3300025909 | Ga0207705_10819447 | Ga0207705_108194472 | 60 |
| 522 | 3300025911 | Ga0207654_10329634 | Ga0207654_103296341 | 60 |
| 523 | 3300025911 | Ga0207654_10602770 | Ga0207654_106027702 | 60 |
| 524 | 3300025911 | Ga0207654_10829254 | Ga0207654_108292542 | 60 |
| 525 | 3300025911 | Ga0207654_11338738 | Ga0207654_113387382 | 60 |
| 526 | 3300025912 | Ga0207707_10016260 | Ga0207707_100162602 | 60 |
| 527 | 3300025912 | Ga0207707_10050471 | Ga0207707_100504714 | 60 |
| 528 | 3300025912 | Ga0207707_10202302 | Ga0207707_102023023 | 60 |
| 529 | 3300025913 | Ga0207695_10001670 | Ga0207695_1000167033 | 60 |
| 530 | 3300025913 | Ga0207695_10001727 | Ga0207695_1000172737 | 60 |
| 531 | 3300025913 | Ga0207695_10015061 | Ga0207695_1001506110 | 60 |
| 532 | 3300025913 | Ga0207695_10018020 | Ga0207695_100180205 | 60 |
| 533 | 3300025913 | Ga0207695_10021597 | Ga0207695_100215978 | 60 |
| 534 | 3300025913 | Ga0207695_11213074 | Ga0207695_112130742 | 60 |
| 535 | 3300025913 | Ga0207695_11313748 | Ga0207695_113137482 | 60 |
| 536 | 3300025913 | Ga0207695_11755744 | Ga0207695_117557442 | 60 |
| 537 | 3300025914 | Ga0207671_10102970 | Ga0207671_101029703 | 60 |
| 538 | 3300025914 | Ga0207671_10247897 | Ga0207671_102478973 | 60 |
| 539 | 3300025916 | Ga0207663_10524440 | Ga0207663_105244402 | 60 |
| 540 | 3300025917 | Ga0207660_10111031 | Ga0207660_101110313 | 60 |
| 541 | 3300025917 | Ga0207660_10129788 | Ga0207660_101297884 | 60 |
| 542 | 3300025917 | Ga0207660_10495248 | Ga0207660_104952482 | 60 |
| 543 | 3300025917 | Ga0207660_11279587 | Ga0207660_112795871 | 60 |
| 544 | 3300025919 | Ga0207657_10012251 | Ga0207657_1001225110 | 60 |
| 545 | 3300025919 | Ga0207657_10023890 | Ga0207657_100238904 | 60 |
| 546 | 3300025919 | Ga0207657_10120748 | Ga0207657_101207481 | 60 |
| 547 | 3300025919 | Ga0207657_10626768 | Ga0207657_106267682 | 60 |
| 548 | 3300025920 | Ga0207649_10090983 | Ga0207649_100909832 | 60 |
| 549 | 3300025920 | Ga0207649_10108801 | Ga0207649_101088013 | 60 |
| 550 | 3300025920 | Ga0207649_10128000 | Ga0207649_101280002 | 60 |
| 551 | 3300025920 | Ga0207649_10571109 | Ga0207649_105711092 | 60 |
| 552 | 3300025920 | Ga0207649_10892428 | Ga0207649_108924282 | 60 |
| 553 | 3300025921 | Ga0207652_10024709 | Ga0207652_100247091 | 60 |
| 554 | 3300025921 | Ga0207652_10592795 | Ga0207652_105927952 | 60 |
| 555 | 3300025923 | Ga0207681_10069475 | Ga0207681_100694752 | 60 |
| 556 | 3300025924 | Ga0207694_10051518 | Ga0207694_100515183 | 60 |
| 557 | 3300025924 | Ga0207694_10635561 | Ga0207694_106355612 | 60 |
| 558 | 3300025924 | Ga0207694_10661738 | Ga0207694_106617382 | 60 |
| 559 | 3300025924 | Ga0207694_11307309 | Ga0207694_113073092 | 60 |
| 560 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006211 | 60 |
| 561 | 3300025925 | Ga0207650_10019108 | Ga0207650_100191083 | 60 |
| 562 | 3300025925 | Ga0207650_10023019 | Ga0207650_100230195 | 60 |
| 563 | 3300025925 | Ga0207650_10190641 | Ga0207650_101906412 | 60 |
| 564 | 3300025926 | Ga0207659_10681360 | Ga0207659_106813601 | 60 |
| 565 | 3300025927 | Ga0207687_10168182 | Ga0207687_101681821 | 60 |
| 566 | 3300025927 | Ga0207687_11292381 | Ga0207687_112923811 | 60 |
| 567 | 3300025927 | Ga0207687_11345682 | Ga0207687_113456822 | 60 |
| 568 | 3300025931 | Ga0207644_10002578 | Ga0207644_100025789 | 60 |
| 569 | 3300025931 | Ga0207644_10088031 | Ga0207644_100880314 | 60 |
| 570 | 3300025931 | Ga0207644_10677595 | Ga0207644_106775952 | 60 |
| 571 | 3300025932 | Ga0207690_10000129 | Ga0207690_1000012923 | 60 |
| 572 | 3300025932 | Ga0207690_10514721 | Ga0207690_105147212 | 60 |
| 573 | 3300025932 | Ga0207690_10895278 | Ga0207690_108952782 | 60 |
| 574 | 3300025932 | Ga0207690_11293884 | Ga0207690_112938841 | 60 |
| 575 | 3300025933 | Ga0207706_10032271 | Ga0207706_100322715 | 60 |
| 576 | 3300025933 | Ga0207706_10145037 | Ga0207706_101450372 | 60 |
| 577 | 3300025933 | Ga0207706_10433526 | Ga0207706_104335262 | 60 |
| 578 | 3300025934 | Ga0207686_10025144 | Ga0207686_100251444 | 60 |
| 579 | 3300025938 | Ga0207704_10000400 | Ga0207704_100004009 | 60 |
| 580 | 3300025941 | Ga0207711_10000887 | Ga0207711_1000088724 | 60 |
| 581 | 3300025941 | Ga0207711_10022877 | Ga0207711_100228776 | 60 |
| 582 | 3300025941 | Ga0207711_10024435 | Ga0207711_100244352 | 60 |
| 583 | 3300025941 | Ga0207711_10034735 | Ga0207711_100347352 | 60 |
| 584 | 3300025941 | Ga0207711_10035994 | Ga0207711_100359944 | 60 |
| 585 | 3300025941 | Ga0207711_10057489 | Ga0207711_100574892 | 60 |
| 586 | 3300025941 | Ga0207711_10106029 | Ga0207711_101060291 | 60 |
| 587 | 3300025941 | Ga0207711_10901018 | Ga0207711_109010181 | 60 |
| 588 | 3300025944 | Ga0207661_10153261 | Ga0207661_101532612 | 60 |
| 589 | 3300025944 | Ga0207661_11015844 | Ga0207661_110158441 | 60 |
| 590 | 3300025944 | Ga0207661_11223831 | Ga0207661_112238312 | 60 |
| 591 | 3300025944 | Ga0207661_11609772 | Ga0207661_116097722 | 60 |
| 592 | 3300025945 | Ga0207679_10035890 | Ga0207679_100358905 | 60 |
| 593 | 3300025945 | Ga0207679_10107222 | Ga0207679_101072222 | 60 |
| 594 | 3300025945 | Ga0207679_10159436 | Ga0207679_101594365 | 60 |
| 595 | 3300025949 | Ga0207667_10043300 | Ga0207667_100433001 | 60 |
| 596 | 3300025949 | Ga0207667_10067953 | Ga0207667_100679534 | 60 |
| 597 | 3300025949 | Ga0207667_10110987 | Ga0207667_101109873 | 60 |
| 598 | 3300025949 | Ga0207667_10180291 | Ga0207667_101802914 | 60 |
| 599 | 3300025949 | Ga0207667_10459767 | Ga0207667_104597671 | 60 |
| 600 | 3300025949 | Ga0207667_10473609 | Ga0207667_104736092 | 60 |
| 601 | 3300025949 | Ga0207667_10803398 | Ga0207667_108033982 | 60 |
| 602 | 3300025949 | Ga0207667_11317066 | Ga0207667_113170661 | 60 |
| 603 | 3300025949 | Ga0207667_11558665 | Ga0207667_115586651 | 60 |
| 604 | 3300025960 | Ga0207651_11073139 | Ga0207651_110731391 | 60 |
| 605 | 3300025961 | Ga0207712_10001004 | Ga0207712_1000100411 | 60 |
| 606 | 3300025972 | Ga0207668_10000028 | Ga0207668_1000002861 | 60 |
| 607 | 3300025972 | Ga0207668_10000507 | Ga0207668_100005079 | 60 |
| 608 | 3300025972 | Ga0207668_10001494 | Ga0207668_100014947 | 60 |
| 609 | 3300025972 | Ga0207668_10005956 | Ga0207668_100059569 | 60 |
| 610 | 3300025972 | Ga0207668_10010307 | Ga0207668_100103073 | 60 |
| 611 | 3300025972 | Ga0207668_10045259 | Ga0207668_100452594 | 60 |
| 612 | 3300025972 | Ga0207668_11267022 | Ga0207668_112670222 | 60 |
| 613 | 3300025981 | Ga0207640_10120452 | Ga0207640_101204523 | 60 |
| 614 | 3300025981 | Ga0207640_10538390 | Ga0207640_105383902 | 60 |
| 615 | 3300025981 | Ga0207640_10720827 | Ga0207640_107208273 | 60 |
| 616 | 3300025981 | Ga0207640_11353579 | Ga0207640_113535792 | 60 |
| 617 | 3300025986 | Ga0207658_10000209 | Ga0207658_1000020942 | 60 |
| 618 | 3300025986 | Ga0207658_10013446 | Ga0207658_100134463 | 60 |
| 619 | 3300025986 | Ga0207658_10019362 | Ga0207658_100193622 | 60 |
| 620 | 3300025986 | Ga0207658_10063310 | Ga0207658_100633102 | 60 |
| 621 | 3300025986 | Ga0207658_10238788 | Ga0207658_102387883 | 60 |
| 622 | 3300026023 | Ga0207677_10083680 | Ga0207677_100836802 | 60 |
| 623 | 3300026023 | Ga0207677_10484827 | Ga0207677_104848271 | 60 |
| 624 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003896 | 60 |
| 625 | 3300026035 | Ga0207703_10039636 | Ga0207703_100396365 | 60 |
| 626 | 3300026035 | Ga0207703_10595679 | Ga0207703_105956792 | 60 |
| 627 | 3300026035 | Ga0207703_10664568 | Ga0207703_106645681 | 60 |
| 628 | 3300026041 | Ga0207639_10025186 | Ga0207639_100251867 | 60 |
| 629 | 3300026041 | Ga0207639_10109120 | Ga0207639_101091204 | 60 |
| 630 | 3300026041 | Ga0207639_10260073 | Ga0207639_102600732 | 60 |
| 631 | 3300026041 | Ga0207639_10355587 | Ga0207639_103555872 | 60 |
| 632 | 3300026041 | Ga0207639_10903399 | Ga0207639_109033991 | 60 |
| 633 | 3300026041 | Ga0207639_11070835 | Ga0207639_110708351 | 60 |
| 634 | 3300026041 | Ga0207639_11684718 | Ga0207639_116847182 | 60 |
| 635 | 3300026067 | Ga0207678_10128637 | Ga0207678_101286372 | 60 |
| 636 | 3300026067 | Ga0207678_10157011 | Ga0207678_101570112 | 60 |
| 637 | 3300026067 | Ga0207678_10353395 | Ga0207678_103533952 | 60 |
| 638 | 3300026067 | Ga0207678_10874277 | Ga0207678_108742772 | 60 |
| 639 | 3300026075 | Ga0207708_11789061 | Ga0207708_117890611 | 60 |
| 640 | 3300026078 | Ga0207702_10160682 | Ga0207702_101606822 | 60 |
| 641 | 3300026078 | Ga0207702_10270259 | Ga0207702_102702592 | 60 |
| 642 | 3300026078 | Ga0207702_10535492 | Ga0207702_105354921 | 60 |
| 643 | 3300026078 | Ga0207702_11390768 | Ga0207702_113907682 | 60 |
| 644 | 3300026078 | Ga0207702_11535613 | Ga0207702_115356132 | 60 |
| 645 | 3300026088 | Ga0207641_10000012 | Ga0207641_10000012158 | 60 |
| 646 | 3300026088 | Ga0207641_10000341 | Ga0207641_1000034123 | 60 |
| 647 | 3300026088 | Ga0207641_10017703 | Ga0207641_100177034 | 60 |
| 648 | 3300026088 | Ga0207641_10241261 | Ga0207641_102412612 | 60 |
| 649 | 3300026088 | Ga0207641_10377996 | Ga0207641_103779963 | 60 |
| 650 | 3300026088 | Ga0207641_11101932 | Ga0207641_111019321 | 60 |
| 651 | 3300026089 | Ga0207648_10014268 | Ga0207648_100142686 | 60 |
| 652 | 3300026089 | Ga0207648_11500664 | Ga0207648_115006641 | 60 |
| 653 | 3300026089 | Ga0207648_12061243 | Ga0207648_120612431 | 60 |
| 654 | 3300026095 | Ga0207676_10000255 | Ga0207676_1000025521 | 60 |
| 655 | 3300026095 | Ga0207676_10000797 | Ga0207676_1000079715 | 60 |
| 656 | 3300026095 | Ga0207676_10005948 | Ga0207676_100059487 | 60 |
| 657 | 3300026095 | Ga0207676_10417656 | Ga0207676_104176562 | 60 |
| 658 | 3300026095 | Ga0207676_10671535 | Ga0207676_106715352 | 60 |
| 659 | 3300026095 | Ga0207676_12038615 | Ga0207676_120386151 | 60 |
| 660 | 3300026116 | Ga0207674_10009842 | Ga0207674_100098422 | 60 |
| 661 | 3300026116 | Ga0207674_10082106 | Ga0207674_100821062 | 60 |
| 662 | 3300026116 | Ga0207674_10242139 | Ga0207674_102421392 | 60 |
| 663 | 3300026116 | Ga0207674_10439688 | Ga0207674_104396882 | 60 |
| 664 | 3300026116 | Ga0207674_10717466 | Ga0207674_107174662 | 60 |
| 665 | 3300026118 | Ga0207675_100070063 | Ga0207675_1000700634 | 60 |
| 666 | 3300026118 | Ga0207675_100536319 | Ga0207675_1005363192 | 60 |
| 667 | 3300026118 | Ga0207675_100625164 | Ga0207675_1006251641 | 60 |
| 668 | 3300026121 | Ga0207683_10189655 | Ga0207683_101896553 | 60 |
| 669 | 3300026121 | Ga0207683_11446344 | Ga0207683_114463442 | 60 |
| 670 | 3300026142 | Ga0207698_10070086 | Ga0207698_100700864 | 60 |
| 671 | 3300026142 | Ga0207698_10291534 | Ga0207698_102915341 | 60 |
| 672 | 3300026142 | Ga0207698_10602913 | Ga0207698_106029132 | 60 |
| 673 | 3300026142 | Ga0207698_11110804 | Ga0207698_111108041 | 60 |
| 674 | 3300026142 | Ga0207698_11319785 | Ga0207698_113197852 | 60 |
| 675 | 3300026142 | Ga0207698_11549291 | Ga0207698_115492912 | 60 |
| 676 | 3300026142 | Ga0207698_11691079 | Ga0207698_116910792 | 60 |
| 677 | 3300026142 | Ga0207698_12060132 | Ga0207698_120601322 | 60 |
| 678 | 3300026142 | Ga0207698_12118962 | Ga0207698_121189622 | 60 |
| 679 | 3300026142 | Ga0207698_12588170 | Ga0207698_125881701 | 60 |
| 680 | 3300027111 | Ga0209281_1023777 | Ga0209281_10237772 | 60 |
| 681 | 3300027665 | Ga0209983_1113472 | Ga0209983_11134721 | 60 |
| 682 | 3300027695 | Ga0209966_1072905 | Ga0209966_10729052 | 60 |
| 683 | 3300027866 | Ga0209813_10147252 | Ga0209813_101472522 | 60 |
| 684 | 3300027866 | Ga0209813_10303949 | Ga0209813_103039492 | 60 |
| 685 | 3300027866 | Ga0209813_10337275 | Ga0209813_103372751 | 60 |
| 686 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064175 | 60 |
| 687 | 3300028379 | Ga0268266_10000792 | Ga0268266_1000079239 | 60 |
| 688 | 3300028379 | Ga0268266_10001340 | Ga0268266_1000134015 | 60 |
| 689 | 3300028379 | Ga0268266_10096119 | Ga0268266_100961192 | 60 |
| 690 | 3300028379 | Ga0268266_10161086 | Ga0268266_101610862 | 60 |
| 691 | 3300028379 | Ga0268266_10728634 | Ga0268266_107286343 | 60 |
| 692 | 3300028380 | Ga0268265_10004003 | Ga0268265_1000400310 | 60 |
| 693 | 3300028380 | Ga0268265_10005054 | Ga0268265_100050546 | 60 |
| 694 | 3300028380 | Ga0268265_10016564 | Ga0268265_100165644 | 60 |
| 695 | 3300028380 | Ga0268265_10044261 | Ga0268265_100442613 | 60 |
| 696 | 3300028380 | Ga0268265_10096703 | Ga0268265_100967031 | 60 |
| 697 | 3300028380 | Ga0268265_10450092 | Ga0268265_104500922 | 60 |
| 698 | 3300028380 | Ga0268265_11537479 | Ga0268265_115374792 | 60 |
| 699 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046137 | 60 |
| 700 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059231 | 60 |
| 701 | 3300028381 | Ga0268264_10016967 | Ga0268264_100169675 | 60 |
| 702 | 3300028381 | Ga0268264_10028586 | Ga0268264_100285865 | 60 |
| 703 | 3300028573 | Ga0265334_10134763 | Ga0265334_101347632 | 60 |
| 704 | 3300028786 | Ga0307517_10000497 | Ga0307517_1000049721 | 60 |
| 705 | 3300028786 | Ga0307517_10082691 | Ga0307517_100826912 | 60 |
| 706 | 3300028786 | Ga0307517_10488538 | Ga0307517_104885381 | 60 |
| 707 | 3300028786 | Ga0307517_10602099 | Ga0307517_106020992 | 60 |
| 708 | 3300028794 | Ga0307515_10054933 | Ga0307515_100549332 | 60 |
| 709 | 3300028794 | Ga0307515_10066345 | Ga0307515_100663453 | 60 |
| 710 | 3300028800 | Ga0265338_10018457 | Ga0265338_100184575 | 60 |
| 711 | 3300028800 | Ga0265338_10044345 | Ga0265338_100443453 | 60 |
| 712 | 3300028800 | Ga0265338_10083238 | Ga0265338_100832382 | 60 |
| 713 | 3300030521 | Ga0307511_10014914 | Ga0307511_100149145 | 60 |
| 714 | 3300030742 | Ga0316183_1171265 | Ga0316183_11712652 | 60 |
| 715 | 3300031090 | Ga0265760_10086106 | Ga0265760_100861063 | 60 |
| 716 | 3300031235 | Ga0265330_10035499 | Ga0265330_100354994 | 60 |
| 717 | 3300031238 | Ga0265332_10052946 | Ga0265332_100529462 | 60 |
| 718 | 3300031241 | Ga0265325_10002041 | Ga0265325_100020412 | 60 |
| 719 | 3300031242 | Ga0265329_10024932 | Ga0265329_100249324 | 60 |
| 720 | 3300031247 | Ga0265340_10095632 | Ga0265340_100956322 | 60 |
| 721 | 3300031249 | Ga0265339_10003193 | Ga0265339_100031936 | 60 |
| 722 | 3300031251 | Ga0265327_10018935 | Ga0265327_100189355 | 60 |
| 723 | 3300031251 | Ga0265327_10083111 | Ga0265327_100831113 | 60 |
| 724 | 3300031344 | Ga0265316_10008753 | Ga0265316_100087539 | 60 |
| 725 | 3300031456 | Ga0307513_10000448 | Ga0307513_1000044822 | 60 |
| 726 | 3300031456 | Ga0307513_10009333 | Ga0307513_100093337 | 60 |
| 727 | 3300031456 | Ga0307513_10507243 | Ga0307513_105072432 | 60 |
| 728 | 3300031456 | Ga0307513_10659130 | Ga0307513_106591302 | 60 |
| 729 | 3300031548 | Ga0307408_100350310 | Ga0307408_1003503102 | 60 |
| 730 | 3300031595 | Ga0265313_10000070 | Ga0265313_1000007043 | 60 |
| 731 | 3300031616 | Ga0307508_10404734 | Ga0307508_104047341 | 60 |
| 732 | 3300031711 | Ga0265314_10104086 | Ga0265314_101040862 | 60 |
| 733 | 3300031711 | Ga0265314_10380713 | Ga0265314_103807132 | 60 |
| 734 | 3300031712 | Ga0265342_10243688 | Ga0265342_102436882 | 60 |
| 735 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004343 | 60 |
| 736 | 3300031731 | Ga0307405_10215905 | Ga0307405_102159052 | 60 |
| 737 | 3300031889 | Ga0326468_10100846 | Ga0326468_101008461 | 60 |
| 738 | 3300031901 | Ga0307406_10000538 | Ga0307406_100005387 | 60 |
| 739 | 3300031901 | Ga0307406_10040954 | Ga0307406_100409545 | 60 |
| 740 | 3300031901 | Ga0307406_10668542 | Ga0307406_106685422 | 60 |
| 741 | 3300031903 | Ga0307407_10690478 | Ga0307407_106904781 | 60 |
| 742 | 3300031911 | Ga0307412_11077282 | Ga0307412_110772821 | 60 |
| 743 | 3300032004 | Ga0307414_10033620 | Ga0307414_100336203 | 60 |
| 744 | 3300032004 | Ga0307414_10646652 | Ga0307414_106466522 | 60 |
| 745 | 3300032004 | Ga0307414_10868743 | Ga0307414_108687432 | 60 |
| 746 | 3300032004 | Ga0307414_10986504 | Ga0307414_109865041 | 60 |
| 747 | 3300032004 | Ga0307414_11207139 | Ga0307414_112071392 | 60 |
| 748 | 3300032005 | Ga0307411_10475053 | Ga0307411_104750532 | 60 |
| 749 | 3300032005 | Ga0307411_10884389 | Ga0307411_108843892 | 60 |
| 750 | 3300032126 | Ga0307415_101022557 | Ga0307415_1010225571 | 60 |
| 751 | 3300032126 | Ga0307415_101377245 | Ga0307415_1013772452 | 60 |
| 752 | 3300033180 | Ga0307510_10013265 | Ga0307510_100132657 | 60 |
| 753 | 3300034817 | Ga0373948_0056544 | Ga0373948_0056544_485_667 | 60 |
| 754 | 3300034957 | Ga0373938_0011096 | Ga0373938_0011096_455_637 | 60 |
| 755 | 3300035083 | Ga0373926_0053000 | Ga0373926_0053000_1117_1299 | 60 |
| 756 | 3300035084 | Ga0373928_0135085 | Ga0373928_0135085_255_437 | 60 |
| 757 | 3300035089 | Ga0373944_0011172 | Ga0373944_0011172_2226_2408 | 60 |
| 758 | 3300035090 | Ga0373949_0176121 | Ga0373949_0176121_130_312 | 60 |
| 759 | 3300035113 | Ga0373936_0000998 | Ga0373936_0000998_9139_9321 | 60 |
| 760 | 3300035113 | Ga0373936_0423306 | Ga0373936_0423306_90_272 | 60 |
| 761 | 3300035114 | Ga0373939_0055238 | Ga0373939_0055238_337_519 | 60 |
| 762 | 3300035115 | Ga0373941_0296226 | Ga0373941_0296226_197_379 | 60 |
| 763 | 3300035121 | Ga0373960_0183253 | Ga0373960_0183253_224_406 | 60 |
| 764 | 3300035170 | Ga0373943_0035963 | Ga0373943_0035963_247_429 | 60 |
| 765 | 3300035171 | Ga0373946_0358210 | Ga0373946_0358210_58_240 | 60 |
| 766 | 3300035207 | Ga0373942_0027587 | Ga0373942_0027587_493_675 | 60 |
| 767 | 3300035207 | Ga0373942_0088421 | Ga0373942_0088421_486_668 | 60 |
| 768 | 3300035242 | Ga0373962_0248339 | Ga0373962_0248339_233_415 | 60 |
| 769 | 3300035691 | Ga0373931_0615884 | Ga0373931_0615884_458_640 | 60 |
| 770 | 3300035691 | Ga0373931_1206254 | Ga0373931_1206254_98_280 | 60 |
| 771 | 3300035692 | Ga0373935_0296207 | Ga0373935_0296207_282_464 | 60 |
| 772 | 3300035695 | Ga0373927_0001126 | Ga0373927_0001126_16994_17176 | 60 |
| 773 | 3300035725 | Ga0373947_0643298 | Ga0373947_0643298_394_576 | 60 |
| 774 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_4946_5128 | 60 |
| 775 | 3300037068 | Ga0373925_1495618 | Ga0373925_1495618_327_509 | 60 |
| 776 | 3300037312 | Ga0395899_0041622 | Ga0395899_0041622_2379_2561 | 60 |
| 777 | 3300037312 | Ga0395899_0206782 | Ga0395899_0206782_1005_1187 | 60 |
| 778 | 3300037312 | Ga0395899_0919648 | Ga0395899_0919648_301_483 | 60 |
| 779 | 3300037418 | Ga0395900_0334425 | Ga0395900_0334425_921_1103 | 60 |
| 780 | 3300037418 | Ga0395900_0339027 | Ga0395900_0339027_1158_1340 | 60 |
| 781 | 3300037418 | Ga0395900_0889358 | Ga0395900_0889358_245_427 | 60 |
| 782 | 3300037418 | Ga0395900_0962807 | Ga0395900_0962807_388_570 | 60 |
| 783 | 3300037418 | Ga0395900_1156084 | Ga0395900_1156084_446_628 | 60 |
| 784 | 3300037466 | Ga0395898_0069290 | Ga0395898_0069290_425_607 | 60 |
| 785 | 3300037466 | Ga0395898_0087345 | Ga0395898_0087345_114_296 | 60 |
| 786 | 3300037466 | Ga0395898_1518276 | Ga0395898_1518276_24_206 | 60 |
| 787 | 3300037471 | Ga0395905_0009297 | Ga0395905_0009297_4593_4775 | 60 |
| 788 | 3300037471 | Ga0395905_0104518 | Ga0395905_0104518_1744_1926 | 60 |
| 789 | 3300037471 | Ga0395905_1217762 | Ga0395905_1217762_119_301 | 60 |
| 790 | 3300037853 | Ga0436364_0183155 | Ga0436364_0183155_394_576 | 60 |
| 791 | 3300038443 | Ga0395901_0149762 | Ga0395901_0149762_1247_1429 | 60 |
| 792 | 3300038443 | Ga0395901_0471972 | Ga0395901_0471972_815_997 | 60 |
| 793 | 3300038443 | Ga0395901_0989624 | Ga0395901_0989624_83_265 | 60 |
| 794 | 3300038443 | Ga0395901_1329362 | Ga0395901_1329362_243_425 | 60 |
| 795 | 3300039437 | Ga0436365_0029920 | Ga0436365_0029920_2588_2770 | 60 |
| 796 | 3300039437 | Ga0436365_0073009 | Ga0436365_0073009_272_454 | 60 |
| 797 | 3300039437 | Ga0436365_0306093 | Ga0436365_0306093_264_446 | 60 |
| 798 | 3300039437 | Ga0436365_1750735 | Ga0436365_1750735_1531_1713 | 60 |
| 799 | 3300039438 | Ga0436360_0227752 | Ga0436360_0227752_959_1141 | 60 |
| 800 | 3300041410 | Ga0439461_0155082 | Ga0439461_0155082_85_267 | 60 |
| 801 | 3300041452 | Ga0451793_0361570 | Ga0451793_0361570_86_268 | 60 |
| 802 | 3300041456 | Ga0451795_0925728 | Ga0451795_0925728_186_368 | 60 |
| 803 | 3300041505 | Ga0451849_0020168 | Ga0451849_0020168_258_440 | 60 |
| 804 | 3300041512 | Ga0451853_3393834 | Ga0451853_3393834_27_209 | 60 |
| 805 | 3300042006 | Ga0439432_158478 | Ga0439432_158478_350_532 | 60 |
| 806 | 3300044842 | Ga0466957_1387097 | Ga0466957_1387097_80_262 | 60 |
| 807 | 3300045836 | Ga0466958_0524950 | Ga0466958_0524950_43_225 | 60 |
| 808 | 3300046457 | Ga0495590_0261925 | Ga0495590_0261925_174_356 | 60 |
| 809 | 3300046459 | Ga0495629_0047462 | Ga0495629_0047462_449_631 | 60 |
| 810 | 3300046472 | Ga0495580_0820505 | Ga0495580_0820505_355_537 | 60 |
| 811 | 3300046492 | Ga0495585_0119277 | Ga0495585_0119277_582_764 | 60 |
| 812 | 3300046492 | Ga0495585_0313985 | Ga0495585_0313985_155_337 | 60 |
| 813 | 3300046506 | Ga0495583_0127457 | Ga0495583_0127457_337_519 | 60 |
| 814 | 3300046512 | Ga0495610_0047010 | Ga0495610_0047010_1923_2105 | 60 |
| 815 | 3300046515 | Ga0495620_0062173 | Ga0495620_0062173_540_722 | 60 |
| 816 | 3300046516 | Ga0495628_0966973 | Ga0495628_0966973_189_371 | 60 |
| 817 | 3300046517 | Ga0495630_1125977 | Ga0495630_1125977_223_405 | 60 |
| 818 | 3300046518 | Ga0495631_0200675 | Ga0495631_0200675_293_475 | 60 |
| 819 | 3300046522 | Ga0495643_0009536 | Ga0495643_0009536_3493_3675 | 60 |
| 820 | 3300046523 | Ga0495644_0294987 | Ga0495644_0294987_209_391 | 60 |
| 821 | 3300046524 | Ga0495648_0425133 | Ga0495648_0425133_106_288 | 60 |
| 822 | 3300046528 | Ga0495642_0003852 | Ga0495642_0003852_1437_1619 | 60 |
| 823 | 3300046530 | Ga0495654_0169882 | Ga0495654_0169882_37_219 | 60 |
| 824 | 3300046538 | Ga0495609_0171090 | Ga0495609_0171090_286_468 | 60 |
| 825 | 3300046539 | Ga0495621_0142166 | Ga0495621_0142166_658_840 | 60 |
| 826 | 3300046542 | Ga0495597_0001737 | Ga0495597_0001737_4864_5046 | 60 |
| 827 | 3300046557 | Ga0495622_0036577 | Ga0495622_0036577_1276_1458 | 60 |
| 828 | 3300046616 | Ga0495668_0116616 | Ga0495668_0116616_685_867 | 60 |
| 829 | 3300046616 | Ga0495668_0697987 | Ga0495668_0697987_66_248 | 60 |
| 830 | 3300046648 | Ga0495611_0001817 | Ga0495611_0001817_2863_3045 | 60 |
| 831 | 3300046648 | Ga0495611_0266435 | Ga0495611_0266435_469_651 | 60 |
| 832 | 3300046660 | Ga0495625_0016679 | Ga0495625_0016679_3371_3553 | 60 |
| 833 | 3300046660 | Ga0495625_0049278 | Ga0495625_0049278_33_215 | 60 |
| 834 | 3300046663 | Ga0495635_0915246 | Ga0495635_0915246_176_358 | 60 |
| 835 | 3300046664 | Ga0495659_0223139 | Ga0495659_0223139_292_474 | 60 |
| 836 | 3300046675 | Ga0495657_0466685 | Ga0495657_0466685_430_612 | 60 |
| 837 | 3300046684 | Ga0495669_0000114 | Ga0495669_0000114_50270_50452 | 60 |
| 838 | 3300046684 | Ga0495669_0000375 | Ga0495669_0000375_3223_3405 | 60 |
| 839 | 3300046684 | Ga0495669_0020657 | Ga0495669_0020657_1170_1352 | 60 |
| 840 | 3300046684 | Ga0495669_0210846 | Ga0495669_0210846_671_907 | 60 |
| 841 | 3300046684 | Ga0495669_0255651 | Ga0495669_0255651_188_370 | 60 |
| 842 | 3300046689 | Ga0495613_0016976 | Ga0495613_0016976_2144_2326 | 60 |
| 843 | 3300046690 | Ga0495624_0064980 | Ga0495624_0064980_108_290 | 60 |
| 844 | 3300046809 | Ga0495600_0308639 | Ga0495600_0308639_219_401 | 60 |
| 845 | 3300047318 | Ga0495636_0417144 | Ga0495636_0417144_371_553 | 60 |
| 846 | 3300047320 | Ga0495672_0069043 | Ga0495672_0069043_1106_1288 | 60 |
| 847 | 3300047322 | Ga0495680_1101131 | Ga0495680_1101131_290_478 | 60 |
| 848 | 3300047323 | Ga0495683_0459000 | Ga0495683_0459000_59_241 | 60 |
| 849 | 3300047443 | Ga0495687_021229 | Ga0495687_021229_1365_1547 | 60 |
| 850 | 3300047444 | Ga0495675_0353251 | Ga0495675_0353251_512_700 | 60 |
| 851 | 3300047445 | Ga0495677_0014060 | Ga0495677_0014060_899_1081 | 60 |
| 852 | 3300047445 | Ga0495677_0019944 | Ga0495677_0019944_333_515 | 60 |
| 853 | 3300047445 | Ga0495677_0303681 | Ga0495677_0303681_100_282 | 60 |
| 854 | 3300047447 | Ga0495685_172539 | Ga0495685_172539_17_199 | 60 |
| 855 | 3300047469 | Ga0495673_0232990 | Ga0495673_0232990_379_594 | 60 |
| 856 | 3300047470 | Ga0495681_0317634 | Ga0495681_0317634_401_583 | 60 |
| 857 | 3300047471 | Ga0495684_1044394 | Ga0495684_1044394_222_410 | 60 |
| 858 | 3300047673 | Ga0495593_0019427 | Ga0495593_0019427_1487_1669 | 60 |
| 859 | 3300048088 | Ga0495602_0336494 | Ga0495602_0336494_170_352 | 60 |
| 860 | 3300048090 | Ga0495615_0106747 | Ga0495615_0106747_578_760 | 60 |
| 861 | 3300048903 | Ga0496100_0713875 | Ga0496100_0713875_68_250 | 60 |
| 862 | 3300048903 | Ga0496100_1043367 | Ga0496100_1043367_335_517 | 60 |
| 863 | 3300048903 | Ga0496100_1600379 | Ga0496100_1600379_315_497 | 60 |
| 864 | 3300048904 | Ga0496101_0043794 | Ga0496101_0043794_317_499 | 60 |
| 865 | 3300048904 | Ga0496101_0958343 | Ga0496101_0958343_397_579 | 60 |
| 866 | 3300048905 | Ga0496102_0031117 | Ga0496102_0031117_3674_3856 | 60 |
| 867 | 3300048905 | Ga0496102_0193636 | Ga0496102_0193636_362_544 | 60 |
| 868 | 3300048905 | Ga0496102_0344473 | Ga0496102_0344473_132_314 | 60 |
| 869 | 3300048906 | Ga0496103_0396937 | Ga0496103_0396937_240_422 | 60 |
| 870 | 3300048907 | Ga0496104_0499506 | Ga0496104_0499506_300_482 | 60 |
| 871 | 3300048910 | Ga0496107_0315776 | Ga0496107_0315776_392_574 | 60 |
| 872 | 3300048910 | Ga0496107_0346416 | Ga0496107_0346416_237_419 | 60 |
| 873 | 3300048911 | Ga0496108_0451166 | Ga0496108_0451166_278_460 | 60 |
| 874 | 3300048912 | Ga0496109_0021464 | Ga0496109_0021464_104_286 | 60 |
| 875 | 3300048913 | Ga0496110_0094902 | Ga0496110_0094902_2214_2396 | 60 |
| 876 | 3300048914 | Ga0496111_0379999 | Ga0496111_0379999_399_581 | 60 |
| 877 | 3300048914 | Ga0496111_0554619 | Ga0496111_0554619_415_597 | 60 |
| 878 | 3300048915 | Ga0496112_0077655 | Ga0496112_0077655_264_446 | 60 |
| 879 | 3300048915 | Ga0496112_1398908 | Ga0496112_1398908_154_336 | 60 |
| 880 | 3300048915 | Ga0496112_1519189 | Ga0496112_1519189_141_323 | 60 |
| 881 | 3300048916 | Ga0496113_0143794 | Ga0496113_0143794_405_587 | 60 |
| 882 | 3300048916 | Ga0496113_1174131 | Ga0496113_1174131_114_296 | 60 |
| 883 | 3300048918 | Ga0496115_0160335 | Ga0496115_0160335_37_219 | 60 |
| 884 | 3300048918 | Ga0496115_0570284 | Ga0496115_0570284_501_683 | 60 |
| 885 | 3300048918 | Ga0496115_0899614 | Ga0496115_0899614_108_290 | 60 |
| 886 | 3300048919 | Ga0496116_0270728 | Ga0496116_0270728_629_811 | 60 |
| 887 | 3300048920 | Ga0496117_0019825 | Ga0496117_0019825_58_240 | 60 |
| 888 | 3300048921 | Ga0496118_0071304 | Ga0496118_0071304_1063_1245 | 60 |
| 889 | 3300048922 | Ga0496119_0009454 | Ga0496119_0009454_660_842 | 60 |
| 890 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_36969_37151 | 60 |
| 891 | 3300048924 | Ga0496121_0369749 | Ga0496121_0369749_381_563 | 60 |
| 892 | 3300048924 | Ga0496121_0685436 | Ga0496121_0685436_46_228 | 60 |
| 893 | 3300048925 | Ga0496122_0010228 | Ga0496122_0010228_932_1114 | 60 |
| 894 | 3300048926 | Ga0496123_0000539 | Ga0496123_0000539_42727_42909 | 60 |
| 895 | 3300048927 | Ga0496124_0894558 | Ga0496124_0894558_64_246 | 60 |
| 896 | 3300048929 | Ga0496126_0058965 | Ga0496126_0058965_1209_1391 | 60 |
| 897 | 3300049569 | Ga0501032_0467633 | Ga0501032_0467633_101_283 | 60 |
| 898 | 3300049570 | Ga0501033_0222417 | Ga0501033_0222417_758_940 | 60 |
| 899 | 3300049570 | Ga0501033_0351065 | Ga0501033_0351065_666_848 | 60 |
| 900 | 3300049570 | Ga0501033_0655231 | Ga0501033_0655231_188_370 | 60 |
| 901 | 3300049571 | Ga0501034_0017349 | Ga0501034_0017349_3050_3232 | 60 |
| 902 | 3300049571 | Ga0501034_0168950 | Ga0501034_0168950_1175_1357 | 60 |
| 903 | 3300049571 | Ga0501034_1491997 | Ga0501034_1491997_328_510 | 60 |
| 904 | 3300049574 | Ga0501038_0685285 | Ga0501038_0685285_113_295 | 60 |
| 905 | 3300049579 | Ga0501043_0321652 | Ga0501043_0321652_23_205 | 60 |
| 906 | 3300049579 | Ga0501043_0969052 | Ga0501043_0969052_404_586 | 60 |
| 907 | 3300049581 | Ga0501047_0005360 | Ga0501047_0005360_8888_9070 | 60 |
| 908 | 3300049581 | Ga0501047_0015925 | Ga0501047_0015925_1479_1661 | 60 |
| 909 | 3300049582 | Ga0501048_0441810 | Ga0501048_0441810_22_204 | 60 |
| 910 | 3300049586 | Ga0501070_0535013 | Ga0501070_0535013_732_914 | 60 |
| 911 | 3300049588 | Ga0501072_1560675 | Ga0501072_1560675_170_352 | 60 |
| 912 | 3300049589 | Ga0501073_0107948 | Ga0501073_0107948_181_363 | 60 |
| 913 | 3300049589 | Ga0501073_0242720 | Ga0501073_0242720_131_313 | 60 |
| 914 | 3300049590 | Ga0501074_0437778 | Ga0501074_0437778_276_458 | 60 |
| 915 | 3300049593 | Ga0501077_0652508 | Ga0501077_0652508_373_555 | 60 |
| 916 | 3300049822 | Ga0501035_0040735 | Ga0501035_0040735_3351_3533 | 60 |
| 917 | 3300049822 | Ga0501035_0055251 | Ga0501035_0055251_2249_2431 | 60 |
| 918 | 3300049823 | Ga0501044_0191921 | Ga0501044_0191921_697_879 | 60 |
| 919 | 3300049823 | Ga0501044_0270849 | Ga0501044_0270849_1052_1234 | 60 |
| 920 | 3300049823 | Ga0501044_0406439 | Ga0501044_0406439_812_994 | 60 |
| 921 | 3300049823 | Ga0501044_0757498 | Ga0501044_0757498_579_761 | 60 |
| 922 | 3300049823 | Ga0501044_1452874 | Ga0501044_1452874_53_235 | 60 |
| 923 | 3300050489 | nmdc:mga03683_14575_c1 | nmdc:mga03683_14575_c1_1390_1572 | 60 |
| 924 | 3300050490 | nmdc:mga03n38_626595_c1 | nmdc:mga03n38_626595_c1_197_433 | 60 |
| 925 | 3300050490 | nmdc:mga03n38_72384_c1 | nmdc:mga03n38_72384_c1_341_523 | 60 |
| 926 | 3300050492 | nmdc:mga0yw44_197941_c1 | nmdc:mga0yw44_197941_c1_852_1034 | 60 |
| 927 | 3300050494 | nmdc:mga06z11_455553_c1 | nmdc:mga06z11_455553_c1_129_311 | 60 |
| 928 | 3300050494 | nmdc:mga06z11_810645_c1 | nmdc:mga06z11_810645_c1_187_369 | 60 |
| 929 | 3300050495 | nmdc:mga04h51_111221_c1 | nmdc:mga04h51_111221_c1_197_379 | 60 |
| 930 | 3300050496 | nmdc:mga07m45_201028_c1 | nmdc:mga07m45_201028_c1_70_252 | 60 |
| 931 | 3300053077 | Ga0495601_0259792 | Ga0495601_0259792_604_792 | 60 |
| 932 | 3300053080 | Ga0500635_0000302 | Ga0500635_0000302_11535_11717 | 60 |
| 933 | 3300053086 | Ga0500578_0270703 | Ga0500578_0270703_289_471 | 60 |
| 934 | 3300053087 | Ga0500643_132126 | Ga0500643_132126_283_465 | 60 |
| 935 | 3300053087 | Ga0500643_138299 | Ga0500643_138299_399_581 | 60 |
| 936 | 3300053090 | Ga0500646_0158878 | Ga0500646_0158878_387_569 | 60 |
| 937 | 3300053092 | Ga0500583_0068270 | Ga0500583_0068270_962_1144 | 60 |
| 938 | 3300053093 | Ga0500651_0038819 | Ga0500651_0038819_2132_2314 | 60 |
| 939 | 3300053094 | Ga0500566_0075858 | Ga0500566_0075858_900_1082 | 60 |
| 940 | 3300053096 | Ga0500641_0000513 | Ga0500641_0000513_8541_8723 | 60 |
| 941 | 3300053096 | Ga0500641_0001354 | Ga0500641_0001354_5812_5994 | 60 |
| 942 | 3300053096 | Ga0500641_0123532 | Ga0500641_0123532_176_358 | 60 |
| 943 | 3300053096 | Ga0500641_0317682 | Ga0500641_0317682_192_374 | 60 |
| 944 | 3300053102 | Ga0500554_044660 | Ga0500554_044660_873_1055 | 60 |
| 945 | 3300053103 | Ga0500555_008578 | Ga0500555_008578_574_756 | 60 |
| 946 | 3300053103 | Ga0500555_022840 | Ga0500555_022840_909_1091 | 60 |
| 947 | 3300053104 | Ga0500556_0000944 | Ga0500556_0000944_11807_11989 | 60 |
| 948 | 3300053104 | Ga0500556_0188512 | Ga0500556_0188512_576_758 | 60 |
| 949 | 3300053105 | Ga0500557_124052 | Ga0500557_124052_546_728 | 60 |
| 950 | 3300053108 | Ga0500562_000464 | Ga0500562_000464_7335_7517 | 60 |
| 951 | 3300053108 | Ga0500562_002035 | Ga0500562_002035_653_835 | 60 |
| 952 | 3300053108 | Ga0500562_003673 | Ga0500562_003673_1709_1891 | 60 |
| 953 | 3300053109 | Ga0500569_001963 | Ga0500569_001963_2561_2743 | 60 |
| 954 | 3300053111 | Ga0500572_264183 | Ga0500572_264183_185_367 | 60 |
| 955 | 3300053119 | Ga0500595_004249 | Ga0500595_004249_1025_1207 | 60 |
| 956 | 3300053121 | Ga0500607_093214 | Ga0500607_093214_746_928 | 60 |
| 957 | 3300053121 | Ga0500607_130368 | Ga0500607_130368_858_1040 | 60 |
| 958 | 3300053122 | Ga0500608_000573 | Ga0500608_000573_3545_3727 | 60 |
| 959 | 3300053123 | Ga0500614_002131 | Ga0500614_002131_900_1082 | 60 |
| 960 | 3300053130 | Ga0500642_0106206 | Ga0500642_0106206_403_585 | 60 |
| 961 | 3300053133 | Ga0500655_053593 | Ga0500655_053593_14_196 | 60 |
| 962 | 3300053136 | Ga0500559_0012527 | Ga0500559_0012527_2170_2352 | 60 |
| 963 | 3300053136 | Ga0500559_0284235 | Ga0500559_0284235_70_252 | 60 |
| 964 | 3300053139 | Ga0500568_0056872 | Ga0500568_0056872_1294_1476 | 60 |
| 965 | 3300053139 | Ga0500568_0068224 | Ga0500568_0068224_915_1097 | 60 |
| 966 | 3300053148 | Ga0500590_130785 | Ga0500590_130785_452_634 | 60 |
| 967 | 3300053150 | Ga0500603_059463 | Ga0500603_059463_321_503 | 60 |
| 968 | 3300053153 | Ga0500616_0056412 | Ga0500616_0056412_1688_1870 | 60 |
| 969 | 3300053153 | Ga0500616_0068784 | Ga0500616_0068784_1377_1559 | 60 |
| 970 | 3300053154 | Ga0500619_008319 | Ga0500619_008319_234_416 | 60 |
| 971 | 3300053155 | Ga0500620_153731 | Ga0500620_153731_296_478 | 60 |
| 972 | 3300053156 | Ga0500622_0037145 | Ga0500622_0037145_177_359 | 60 |
| 973 | 3300053156 | Ga0500622_0104173 | Ga0500622_0104173_72_254 | 60 |
| 974 | 3300053157 | Ga0500624_003662 | Ga0500624_003662_179_361 | 60 |
| 975 | 3300053160 | Ga0500633_0076085 | Ga0500633_0076085_342_539 | 60 |
| 976 | 3300053162 | Ga0500638_045794 | Ga0500638_045794_549_731 | 60 |
| 977 | 3300053177 | Ga0500636_0008358 | Ga0500636_0008358_606_788 | 60 |
| 978 | 3300053177 | Ga0500636_0353667 | Ga0500636_0353667_226_408 | 60 |
| 979 | 3300053178 | Ga0500637_0187831 | Ga0500637_0187831_49_231 | 60 |
| 980 | 3300053178 | Ga0500637_0384570 | Ga0500637_0384570_515_697 | 60 |
| 981 | 3300053728 | Ga0500657_220977 | Ga0500657_220977_203_385 | 60 |
| 982 | 3300053729 | Ga0500625_015994 | Ga0500625_015994_2505_2687 | 60 |
| 983 | 3300053730 | Ga0500645_002978 | Ga0500645_002978_6631_6813 | 60 |
| 984 | 3300053730 | Ga0500645_059370 | Ga0500645_059370_386_568 | 60 |
| 985 | 3300053735 | Ga0500596_000489 | Ga0500596_000489_2146_2328 | 60 |
| 986 | 3300059477 | Ga0587084_128359 | Ga0587084_128359_104_286 | 60 |
| 987 | 3300059506 | Ga0587085_102438 | Ga0587085_102438_55_237 | 60 |
| 988 | 3300059639 | Ga0587062_063902 | Ga0587062_063902_326_508 | 60 |
| 989 | 3300059639 | Ga0587062_096072 | Ga0587062_096072_51_233 | 60 |
| 990 | 3300059645 | Ga0587076_200370 | Ga0587076_200370_133_315 | 60 |
| 991 | 3300060353 | Ga0501082_1074369 | Ga0501082_1074369_171_353 | 60 |
| 992 | 3300061719 | Ga0466962_0618384 | Ga0466962_0618384_96_278 | 60 |
| 993 | 3300001979 | JGI24740J21852_10000317 | JGI24740J21852_100003179 | 61 |
| 994 | 3300001979 | JGI24740J21852_10176685 | JGI24740J21852_101766852 | 61 |
| 995 | 3300001989 | JGI24739J22299_10118348 | JGI24739J22299_101183482 | 61 |
| 996 | 3300002737 | JGI25162J39368_1000199 | JGI25162J39368_10001999 | 61 |
| 997 | 3300002773 | JGI25152J39213_1001688 | JGI25152J39213_10016884 | 61 |
| 998 | 3300002773 | JGI25152J39213_1003233 | JGI25152J39213_10032331 | 61 |
| 999 | 3300003187 | JGI25151J46595_10003651 | JGI25151J46595_100036514 | 61 |
| 1000 | 3300003187 | JGI25151J46595_10050220 | JGI25151J46595_100502202 | 61 |
| 1001 | 3300003214 | JGI25165J46597_1000307 | JGI25165J46597_100030740 | 61 |
| 1002 | 3300003214 | JGI25165J46597_1003183 | JGI25165J46597_10031833 | 61 |
| 1003 | 3300003354 | JGI25160J50197_1018865 | JGI25160J50197_10188653 | 61 |
| 1004 | 3300003792 | Ga0055540_1033556 | Ga0055540_10335563 | 61 |
| 1005 | 3300003792 | Ga0055540_1099987 | Ga0055540_10999871 | 61 |
| 1006 | 3300003856 | Ga0058692_1001101 | Ga0058692_10011017 | 61 |
| 1007 | 3300005289 | Ga0065704_10809058 | Ga0065704_108090581 | 61 |
| 1008 | 3300005328 | Ga0070676_10117486 | Ga0070676_101174861 | 61 |
| 1009 | 3300005331 | Ga0070670_100000061 | Ga0070670_10000006181 | 61 |
| 1010 | 3300005331 | Ga0070670_100780865 | Ga0070670_1007808652 | 61 |
| 1011 | 3300005335 | Ga0070666_10243716 | Ga0070666_102437163 | 61 |
| 1012 | 3300005338 | Ga0068868_101352203 | Ga0068868_1013522032 | 61 |
| 1013 | 3300005341 | Ga0070691_10468279 | Ga0070691_104682791 | 61 |
| 1014 | 3300005347 | Ga0070668_100696881 | Ga0070668_1006968812 | 61 |
| 1015 | 3300005347 | Ga0070668_100927278 | Ga0070668_1009272782 | 61 |
| 1016 | 3300005353 | Ga0070669_100052266 | Ga0070669_1000522662 | 61 |
| 1017 | 3300005353 | Ga0070669_100069357 | Ga0070669_1000693574 | 61 |
| 1018 | 3300005353 | Ga0070669_100308986 | Ga0070669_1003089862 | 61 |
| 1019 | 3300005354 | Ga0070675_100461172 | Ga0070675_1004611722 | 61 |
| 1020 | 3300005355 | Ga0070671_100183764 | Ga0070671_1001837642 | 61 |
| 1021 | 3300005356 | Ga0070674_101638054 | Ga0070674_1016380541 | 61 |
| 1022 | 3300005366 | Ga0070659_100207804 | Ga0070659_1002078041 | 61 |
| 1023 | 3300005366 | Ga0070659_101427097 | Ga0070659_1014270972 | 61 |
| 1024 | 3300005367 | Ga0070667_100040040 | Ga0070667_1000400403 | 61 |
| 1025 | 3300005440 | Ga0070705_100212578 | Ga0070705_1002125781 | 61 |
| 1026 | 3300005445 | Ga0070708_100141843 | Ga0070708_1001418432 | 61 |
| 1027 | 3300005455 | Ga0070663_100483486 | Ga0070663_1004834862 | 61 |
| 1028 | 3300005455 | Ga0070663_100991189 | Ga0070663_1009911891 | 61 |
| 1029 | 3300005456 | Ga0070678_100879050 | Ga0070678_1008790501 | 61 |
| 1030 | 3300005457 | Ga0070662_100255983 | Ga0070662_1002559833 | 61 |
| 1031 | 3300005457 | Ga0070662_101323726 | Ga0070662_1013237261 | 61 |
| 1032 | 3300005467 | Ga0070706_100530272 | Ga0070706_1005302722 | 61 |
| 1033 | 3300005468 | Ga0070707_101049691 | Ga0070707_1010496912 | 61 |
| 1034 | 3300005471 | Ga0070698_100132761 | Ga0070698_1001327614 | 61 |
| 1035 | 3300005518 | Ga0070699_100157214 | Ga0070699_1001572142 | 61 |
| 1036 | 3300005530 | Ga0070679_101033610 | Ga0070679_1010336102 | 61 |
| 1037 | 3300005539 | Ga0068853_101012572 | Ga0068853_1010125722 | 61 |
| 1038 | 3300005539 | Ga0068853_101758587 | Ga0068853_1017585872 | 61 |
| 1039 | 3300005543 | Ga0070672_100309369 | Ga0070672_1003093692 | 61 |
| 1040 | 3300005543 | Ga0070672_100969192 | Ga0070672_1009691922 | 61 |
| 1041 | 3300005548 | Ga0070665_100003518 | Ga0070665_10000351817 | 61 |
| 1042 | 3300005548 | Ga0070665_100006101 | Ga0070665_1000061018 | 61 |
| 1043 | 3300005548 | Ga0070665_100262649 | Ga0070665_1002626493 | 61 |
| 1044 | 3300005548 | Ga0070665_102590297 | Ga0070665_1025902972 | 61 |
| 1045 | 3300005549 | Ga0070704_101214572 | Ga0070704_1012145722 | 61 |
| 1046 | 3300005563 | Ga0068855_100884043 | Ga0068855_1008840431 | 61 |
| 1047 | 3300005563 | Ga0068855_101077840 | Ga0068855_1010778402 | 61 |
| 1048 | 3300005577 | Ga0068857_100513179 | Ga0068857_1005131791 | 61 |
| 1049 | 3300005577 | Ga0068857_100745242 | Ga0068857_1007452421 | 61 |
| 1050 | 3300005578 | Ga0068854_100216344 | Ga0068854_1002163442 | 61 |
| 1051 | 3300005578 | Ga0068854_100696271 | Ga0068854_1006962712 | 61 |
| 1052 | 3300005614 | Ga0068856_100036110 | Ga0068856_1000361104 | 61 |
| 1053 | 3300005614 | Ga0068856_100118032 | Ga0068856_1001180321 | 61 |
| 1054 | 3300005616 | Ga0068852_100131790 | Ga0068852_1001317903 | 61 |
| 1055 | 3300005617 | Ga0068859_102776195 | Ga0068859_1027761952 | 61 |
| 1056 | 3300005618 | Ga0068864_100611800 | Ga0068864_1006118002 | 61 |
| 1057 | 3300005719 | Ga0068861_100155784 | Ga0068861_1001557843 | 61 |
| 1058 | 3300005834 | Ga0068851_10012066 | Ga0068851_100120665 | 61 |
| 1059 | 3300005844 | Ga0068862_100719416 | Ga0068862_1007194162 | 61 |
| 1060 | 3300006038 | Ga0075365_10374786 | Ga0075365_103747862 | 61 |
| 1061 | 3300006042 | Ga0075368_10007666 | Ga0075368_100076662 | 61 |
| 1062 | 3300006048 | Ga0075363_100032636 | Ga0075363_1000326362 | 61 |
| 1063 | 3300006051 | Ga0075364_10053598 | Ga0075364_100535982 | 61 |
| 1064 | 3300006051 | Ga0075364_10143115 | Ga0075364_101431152 | 61 |
| 1065 | 3300006051 | Ga0075364_10218379 | Ga0075364_102183792 | 61 |
| 1066 | 3300006051 | Ga0075364_10723759 | Ga0075364_107237592 | 61 |
| 1067 | 3300006175 | Ga0070712_100207331 | Ga0070712_1002073313 | 61 |
| 1068 | 3300006177 | Ga0075362_10062334 | Ga0075362_100623342 | 61 |
| 1069 | 3300006178 | Ga0075367_10068389 | Ga0075367_100683893 | 61 |
| 1070 | 3300006178 | Ga0075367_10218474 | Ga0075367_102184742 | 61 |
| 1071 | 3300006178 | Ga0075367_10306281 | Ga0075367_103062811 | 61 |
| 1072 | 3300006178 | Ga0075367_11045080 | Ga0075367_110450801 | 61 |
| 1073 | 3300006186 | Ga0075369_10009705 | Ga0075369_100097052 | 61 |
| 1074 | 3300006186 | Ga0075369_10101645 | Ga0075369_101016452 | 61 |
| 1075 | 3300006186 | Ga0075369_10424721 | Ga0075369_104247212 | 61 |
| 1076 | 3300006195 | Ga0075366_10837511 | Ga0075366_108375112 | 61 |
| 1077 | 3300006195 | Ga0075366_10986023 | Ga0075366_109860232 | 61 |
| 1078 | 3300006353 | Ga0075370_10005219 | Ga0075370_100052197 | 61 |
| 1079 | 3300006353 | Ga0075370_10039168 | Ga0075370_100391684 | 61 |
| 1080 | 3300006353 | Ga0075370_10394678 | Ga0075370_103946782 | 61 |
| 1081 | 3300006353 | Ga0075370_10707771 | Ga0075370_107077711 | 61 |
| 1082 | 3300006852 | Ga0075433_11145322 | Ga0075433_111453222 | 61 |
| 1083 | 3300006931 | Ga0097620_102775686 | Ga0097620_1027756862 | 61 |
| 1084 | 3300006948 | Ga0099826_10000704 | Ga0099826_1000070418 | 61 |
| 1085 | 3300006948 | Ga0099826_10014270 | Ga0099826_100142706 | 61 |
| 1086 | 3300009011 | Ga0105251_10212891 | Ga0105251_102128912 | 61 |
| 1087 | 3300009011 | Ga0105251_10536935 | Ga0105251_105369352 | 61 |
| 1088 | 3300009036 | Ga0105244_10194446 | Ga0105244_101944462 | 61 |
| 1089 | 3300009092 | Ga0105250_10006718 | Ga0105250_100067183 | 61 |
| 1090 | 3300009098 | Ga0105245_11950873 | Ga0105245_119508731 | 61 |
| 1091 | 3300009147 | Ga0114129_12232847 | Ga0114129_122328472 | 61 |
| 1092 | 3300009148 | Ga0105243_10009275 | Ga0105243_100092753 | 61 |
| 1093 | 3300009148 | Ga0105243_10559294 | Ga0105243_105592942 | 61 |
| 1094 | 3300009148 | Ga0105243_11202764 | Ga0105243_112027642 | 61 |
| 1095 | 3300009174 | Ga0105241_10519968 | Ga0105241_105199682 | 61 |
| 1096 | 3300009176 | Ga0105242_10399698 | Ga0105242_103996982 | 61 |
| 1097 | 3300009551 | Ga0105238_10345589 | Ga0105238_103455892 | 61 |
| 1098 | 3300009553 | Ga0105249_11108098 | Ga0105249_111080982 | 61 |
| 1099 | 3300009553 | Ga0105249_12274578 | Ga0105249_122745781 | 61 |
| 1100 | 3300011119 | Ga0105246_10073748 | Ga0105246_100737483 | 61 |
| 1101 | 3300011119 | Ga0105246_10456512 | Ga0105246_104565122 | 61 |
| 1102 | 3300013100 | Ga0157373_10008653 | Ga0157373_100086535 | 61 |
| 1103 | 3300013102 | Ga0157371_10000004 | Ga0157371_1000000451 | 61 |
| 1104 | 3300013104 | Ga0157370_10001047 | Ga0157370_1000104733 | 61 |
| 1105 | 3300013307 | Ga0157372_11388633 | Ga0157372_113886331 | 61 |
| 1106 | 3300013308 | Ga0157375_11989773 | Ga0157375_119897732 | 61 |
| 1107 | 3300014968 | Ga0157379_10359470 | Ga0157379_103594702 | 61 |
| 1108 | 3300015261 | Ga0182006_1131262 | Ga0182006_11312621 | 61 |
| 1109 | 3300015265 | Ga0182005_1004873 | Ga0182005_10048732 | 61 |
| 1110 | 3300025230 | Ga0209563_103803 | Ga0209563_1038033 | 61 |
| 1111 | 3300025233 | Ga0209437_100182 | Ga0209437_10018238 | 61 |
| 1112 | 3300025233 | Ga0209437_115842 | Ga0209437_1158422 | 61 |
| 1113 | 3300025245 | Ga0207425_1029390 | Ga0207425_10293902 | 61 |
| 1114 | 3300025245 | Ga0207425_1041137 | Ga0207425_10411372 | 61 |
| 1115 | 3300025245 | Ga0207425_1062936 | Ga0207425_10629362 | 61 |
| 1116 | 3300025250 | Ga0209026_1054154 | Ga0209026_10541541 | 61 |
| 1117 | 3300025250 | Ga0209026_1062172 | Ga0209026_10621721 | 61 |
| 1118 | 3300025253 | Ga0209677_100265 | Ga0209677_1002654 | 61 |
| 1119 | 3300025258 | Ga0209129_1000050 | Ga0209129_1000050198 | 61 |
| 1120 | 3300025258 | Ga0209129_1004912 | Ga0209129_10049123 | 61 |
| 1121 | 3300025261 | Ga0209233_1000231 | Ga0209233_100023177 | 61 |
| 1122 | 3300025261 | Ga0209233_1000255 | Ga0209233_100025569 | 61 |
| 1123 | 3300025272 | Ga0209455_1016011 | Ga0209455_10160112 | 61 |
| 1124 | 3300025273 | Ga0209673_1021682 | Ga0209673_10216822 | 61 |
| 1125 | 3300025273 | Ga0209673_1074035 | Ga0209673_10740352 | 61 |
| 1126 | 3300025294 | Ga0209025_1000553 | Ga0209025_100055332 | 61 |
| 1127 | 3300025294 | Ga0209025_1003440 | Ga0209025_10034408 | 61 |
| 1128 | 3300025294 | Ga0209025_1042265 | Ga0209025_10422652 | 61 |
| 1129 | 3300025295 | Ga0209564_1033319 | Ga0209564_10333193 | 61 |
| 1130 | 3300025297 | Ga0209758_1050577 | Ga0209758_10505772 | 61 |
| 1131 | 3300025297 | Ga0209758_1066324 | Ga0209758_10663243 | 61 |
| 1132 | 3300025298 | Ga0209050_1078881 | Ga0209050_10788812 | 61 |
| 1133 | 3300025299 | Ga0209256_1006344 | Ga0209256_10063448 | 61 |
| 1134 | 3300025299 | Ga0209256_1079385 | Ga0209256_10793851 | 61 |
| 1135 | 3300025302 | Ga0207426_1000798 | Ga0207426_10007987 | 61 |
| 1136 | 3300025303 | Ga0209051_1027659 | Ga0209051_10276593 | 61 |
| 1137 | 3300025303 | Ga0209051_1028291 | Ga0209051_10282913 | 61 |
| 1138 | 3300025303 | Ga0209051_1029985 | Ga0209051_10299852 | 61 |
| 1139 | 3300025321 | Ga0207656_10042169 | Ga0207656_100421693 | 61 |
| 1140 | 3300025900 | Ga0207710_10192911 | Ga0207710_101929112 | 61 |
| 1141 | 3300025903 | Ga0207680_10310106 | Ga0207680_103101062 | 61 |
| 1142 | 3300025903 | Ga0207680_10314530 | Ga0207680_103145302 | 61 |
| 1143 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044363 | 61 |
| 1144 | 3300025914 | Ga0207671_10000043 | Ga0207671_10000043125 | 61 |
| 1145 | 3300025915 | Ga0207693_10238977 | Ga0207693_102389773 | 61 |
| 1146 | 3300025922 | Ga0207646_10489633 | Ga0207646_104896332 | 61 |
| 1147 | 3300025923 | Ga0207681_10106943 | Ga0207681_101069432 | 61 |
| 1148 | 3300025923 | Ga0207681_11272991 | Ga0207681_112729912 | 61 |
| 1149 | 3300025924 | Ga0207694_10180029 | Ga0207694_101800294 | 61 |
| 1150 | 3300025925 | Ga0207650_10000630 | Ga0207650_100006305 | 61 |
| 1151 | 3300025928 | Ga0207700_10774928 | Ga0207700_107749282 | 61 |
| 1152 | 3300025931 | Ga0207644_10203056 | Ga0207644_102030562 | 61 |
| 1153 | 3300025931 | Ga0207644_10516404 | Ga0207644_105164041 | 61 |
| 1154 | 3300025932 | Ga0207690_10325308 | Ga0207690_103253083 | 61 |
| 1155 | 3300025933 | Ga0207706_10491611 | Ga0207706_104916112 | 61 |
| 1156 | 3300025933 | Ga0207706_11090220 | Ga0207706_110902201 | 61 |
| 1157 | 3300025935 | Ga0207709_10024990 | Ga0207709_100249903 | 61 |
| 1158 | 3300025935 | Ga0207709_11412384 | Ga0207709_114123841 | 61 |
| 1159 | 3300025940 | Ga0207691_10538486 | Ga0207691_105384862 | 61 |
| 1160 | 3300025941 | Ga0207711_10256278 | Ga0207711_102562783 | 61 |
| 1161 | 3300025941 | Ga0207711_10849418 | Ga0207711_108494182 | 61 |
| 1162 | 3300025949 | Ga0207667_10340351 | Ga0207667_103403512 | 61 |
| 1163 | 3300025961 | Ga0207712_11270817 | Ga0207712_112708171 | 61 |
| 1164 | 3300025972 | Ga0207668_10140712 | Ga0207668_101407123 | 61 |
| 1165 | 3300025972 | Ga0207668_10499171 | Ga0207668_104991712 | 61 |
| 1166 | 3300025972 | Ga0207668_10850330 | Ga0207668_108503301 | 61 |
| 1167 | 3300025981 | Ga0207640_10717762 | Ga0207640_107177622 | 61 |
| 1168 | 3300025981 | Ga0207640_11513818 | Ga0207640_115138181 | 61 |
| 1169 | 3300025986 | Ga0207658_10237459 | Ga0207658_102374592 | 61 |
| 1170 | 3300025986 | Ga0207658_11287886 | Ga0207658_112878862 | 61 |
| 1171 | 3300026035 | Ga0207703_10300534 | Ga0207703_103005342 | 61 |
| 1172 | 3300026041 | Ga0207639_10601572 | Ga0207639_106015722 | 61 |
| 1173 | 3300026041 | Ga0207639_11391678 | Ga0207639_113916782 | 61 |
| 1174 | 3300026067 | Ga0207678_10918614 | Ga0207678_109186141 | 61 |
| 1175 | 3300026067 | Ga0207678_11388116 | Ga0207678_113881161 | 61 |
| 1176 | 3300026078 | Ga0207702_10020911 | Ga0207702_100209114 | 61 |
| 1177 | 3300026078 | Ga0207702_10105414 | Ga0207702_101054141 | 61 |
| 1178 | 3300026095 | Ga0207676_11445148 | Ga0207676_114451482 | 61 |
| 1179 | 3300026116 | Ga0207674_12109269 | Ga0207674_121092692 | 61 |
| 1180 | 3300026118 | Ga0207675_100156670 | Ga0207675_1001566703 | 61 |
| 1181 | 3300026121 | Ga0207683_10472003 | Ga0207683_104720032 | 61 |
| 1182 | 3300026121 | Ga0207683_11710728 | Ga0207683_117107281 | 61 |
| 1183 | 3300026142 | Ga0207698_10100302 | Ga0207698_101003023 | 61 |
| 1184 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009943 | 61 |
| 1185 | 3300027312 | Ga0209371_1000753 | Ga0209371_10007534 | 61 |
| 1186 | 3300027666 | Ga0209282_1000849 | Ga0209282_100084914 | 61 |
| 1187 | 3300027866 | Ga0209813_10088886 | Ga0209813_100888862 | 61 |
| 1188 | 3300027907 | Ga0207428_10417551 | Ga0207428_104175512 | 61 |
| 1189 | 3300028379 | Ga0268266_10018885 | Ga0268266_100188853 | 61 |
| 1190 | 3300028379 | Ga0268266_10731974 | Ga0268266_107319742 | 61 |
| 1191 | 3300028379 | Ga0268266_11562466 | Ga0268266_115624661 | 61 |
| 1192 | 3300028379 | Ga0268266_11607616 | Ga0268266_116076162 | 61 |
| 1193 | 3300028563 | Ga0265319_1157264 | Ga0265319_11572641 | 61 |
| 1194 | 3300028794 | Ga0307515_10925088 | Ga0307515_109250882 | 61 |
| 1195 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010942 | 61 |
| 1196 | 3300030500 | Ga0268256_1003130 | Ga0268256_10031301 | 61 |
| 1197 | 3300030745 | Ga0316182_1361217 | Ga0316182_13612172 | 61 |
| 1198 | 3300031728 | Ga0316578_10586102 | Ga0316578_105861022 | 61 |
| 1199 | 3300031901 | Ga0307406_11075264 | Ga0307406_110752641 | 61 |
| 1200 | 3300031911 | Ga0307412_11282944 | Ga0307412_112829441 | 61 |
| 1201 | 3300031995 | Ga0307409_100582796 | Ga0307409_1005827961 | 61 |
| 1202 | 3300032004 | Ga0307414_10080583 | Ga0307414_100805834 | 61 |
| 1203 | 3300032004 | Ga0307414_11374641 | Ga0307414_113746412 | 61 |
| 1204 | 3300035086 | Ga0373934_0057302 | Ga0373934_0057302_906_1094 | 61 |
| 1205 | 3300035113 | Ga0373936_0288322 | Ga0373936_0288322_537_725 | 61 |
| 1206 | 3300035117 | Ga0373953_0064809 | Ga0373953_0064809_115_303 | 61 |
| 1207 | 3300035118 | Ga0373954_0028925 | Ga0373954_0028925_375_563 | 61 |
| 1208 | 3300035119 | Ga0373956_0030070 | Ga0373956_0030070_1679_1867 | 61 |
| 1209 | 3300035120 | Ga0373957_0341548 | Ga0373957_0341548_428_616 | 61 |
| 1210 | 3300035172 | Ga0373955_0041670 | Ga0373955_0041670_692_880 | 61 |
| 1211 | 3300035410 | Ga0373924_0053116 | Ga0373924_0053116_1376_1564 | 61 |
| 1212 | 3300035724 | Ga0373933_0001765 | Ga0373933_0001765_6928_7116 | 61 |
| 1213 | 3300036401 | Ga0373937_0006878 | Ga0373937_0006878_1211_1399 | 61 |
| 1214 | 3300037068 | Ga0373925_1784479 | Ga0373925_1784479_278_463 | 61 |
| 1215 | 3300037853 | Ga0436364_0610524 | Ga0436364_0610524_243_440 | 61 |
| 1216 | 3300039437 | Ga0436365_1837953 | Ga0436365_1837953_1431_1616 | 61 |
| 1217 | 3300039447 | Ga0436361_0835775 | Ga0436361_0835775_824_1009 | 61 |
| 1218 | 3300039450 | Ga0436363_1484678 | Ga0436363_1484678_161_349 | 61 |
| 1219 | 3300039453 | Ga0436362_0149703 | Ga0436362_0149703_73_261 | 61 |
| 1220 | 3300039453 | Ga0436362_0297190 | Ga0436362_0297190_54_242 | 61 |
| 1221 | 3300039453 | Ga0436362_1022103 | Ga0436362_1022103_170_358 | 61 |
| 1222 | 3300041452 | Ga0451793_1900854 | Ga0451793_1900854_567_752 | 61 |
| 1223 | 3300041456 | Ga0451795_1551248 | Ga0451795_1551248_514_699 | 61 |
| 1224 | 3300041461 | Ga0451805_005031 | Ga0451805_005031_39_224 | 61 |
| 1225 | 3300041486 | Ga0451807_0142193 | Ga0451807_0142193_568_753 | 61 |
| 1226 | 3300041494 | Ga0451837_1073011 | Ga0451837_1073011_829_1014 | 61 |
| 1227 | 3300041496 | Ga0451839_0183986 | Ga0451839_0183986_238_423 | 61 |
| 1228 | 3300041512 | Ga0451853_1702220 | Ga0451853_1702220_201_389 | 61 |
| 1229 | 3300041512 | Ga0451853_4061060 | Ga0451853_4061060_638_823 | 61 |
| 1230 | 3300042012 | Ga0439455_0011348 | Ga0439455_0011348_1618_1803 | 61 |
| 1231 | 3300042015 | Ga0439462_0105014 | Ga0439462_0105014_494_679 | 61 |
| 1232 | 3300042157 | Ga0439458_0091866 | Ga0439458_0091866_506_703 | 61 |
| 1233 | 3300042435 | Ga0439434_0233390 | Ga0439434_0233390_145_330 | 61 |
| 1234 | 3300042438 | Ga0439459_0015574 | Ga0439459_0015574_900_1097 | 61 |
| 1235 | 3300046454 | Ga0495592_0124849 | Ga0495592_0124849_1178_1363 | 61 |
| 1236 | 3300046454 | Ga0495592_0166268 | Ga0495592_0166268_753_941 | 61 |
| 1237 | 3300046459 | Ga0495629_0038896 | Ga0495629_0038896_2082_2267 | 61 |
| 1238 | 3300046462 | Ga0495651_0161486 | Ga0495651_0161486_530_715 | 61 |
| 1239 | 3300046463 | Ga0495653_0218391 | Ga0495653_0218391_231_416 | 61 |
| 1240 | 3300046471 | Ga0495650_0040709 | Ga0495650_0040709_791_976 | 61 |
| 1241 | 3300046476 | Ga0495662_0027078 | Ga0495662_0027078_556_741 | 61 |
| 1242 | 3300046477 | Ga0495664_0144213 | Ga0495664_0144213_231_416 | 61 |
| 1243 | 3300046492 | Ga0495585_0112411 | Ga0495585_0112411_17_202 | 61 |
| 1244 | 3300046507 | Ga0495606_0009975 | Ga0495606_0009975_4104_4289 | 61 |
| 1245 | 3300046511 | Ga0495608_0126446 | Ga0495608_0126446_644_832 | 61 |
| 1246 | 3300046512 | Ga0495610_0000530 | Ga0495610_0000530_8739_8924 | 61 |
| 1247 | 3300046514 | Ga0495618_0737711 | Ga0495618_0737711_227_415 | 61 |
| 1248 | 3300046514 | Ga0495618_0895405 | Ga0495618_0895405_308_493 | 61 |
| 1249 | 3300046516 | Ga0495628_0134207 | Ga0495628_0134207_1105_1290 | 61 |
| 1250 | 3300046516 | Ga0495628_0408110 | Ga0495628_0408110_122_310 | 61 |
| 1251 | 3300046522 | Ga0495643_0091285 | Ga0495643_0091285_465_650 | 61 |
| 1252 | 3300046524 | Ga0495648_0173144 | Ga0495648_0173144_112_297 | 61 |
| 1253 | 3300046533 | Ga0495640_0132628 | Ga0495640_0132628_14_202 | 61 |
| 1254 | 3300046536 | Ga0495587_0452180 | Ga0495587_0452180_63_251 | 61 |
| 1255 | 3300046558 | Ga0495633_0065587 | Ga0495633_0065587_1040_1225 | 61 |
| 1256 | 3300046559 | Ga0495667_0544642 | Ga0495667_0544642_348_536 | 61 |
| 1257 | 3300046663 | Ga0495635_0056822 | Ga0495635_0056822_299_484 | 61 |
| 1258 | 3300046674 | Ga0495588_0005383 | Ga0495588_0005383_3505_3690 | 61 |
| 1259 | 3300046674 | Ga0495588_0071865 | Ga0495588_0071865_605_790 | 61 |
| 1260 | 3300046675 | Ga0495657_0152288 | Ga0495657_0152288_812_997 | 61 |
| 1261 | 3300046689 | Ga0495613_0342822 | Ga0495613_0342822_731_919 | 61 |
| 1262 | 3300046690 | Ga0495624_0286422 | Ga0495624_0286422_316_501 | 61 |
| 1263 | 3300046692 | Ga0495671_0130573 | Ga0495671_0130573_1013_1198 | 61 |
| 1264 | 3300046809 | Ga0495600_0204355 | Ga0495600_0204355_518_703 | 61 |
| 1265 | 3300047317 | Ga0495604_0022630 | Ga0495604_0022630_3825_4010 | 61 |
| 1266 | 3300047321 | Ga0495676_0627109 | Ga0495676_0627109_465_650 | 61 |
| 1267 | 3300047470 | Ga0495681_0002425 | Ga0495681_0002425_6610_6795 | 61 |
| 1268 | 3300047471 | Ga0495684_0437837 | Ga0495684_0437837_247_432 | 61 |
| 1269 | 3300047471 | Ga0495684_0688114 | Ga0495684_0688114_351_539 | 61 |
| 1270 | 3300047472 | Ga0495686_0003490 | Ga0495686_0003490_10612_10797 | 61 |
| 1271 | 3300047472 | Ga0495686_0160588 | Ga0495686_0160588_279_464 | 61 |
| 1272 | 3300048088 | Ga0495602_0210122 | Ga0495602_0210122_950_1138 | 61 |
| 1273 | 3300048903 | Ga0496100_0770290 | Ga0496100_0770290_107_292 | 61 |
| 1274 | 3300048904 | Ga0496101_0540884 | Ga0496101_0540884_686_871 | 61 |
| 1275 | 3300048904 | Ga0496101_1307025 | Ga0496101_1307025_230_421 | 61 |
| 1276 | 3300048905 | Ga0496102_0859348 | Ga0496102_0859348_184_369 | 61 |
| 1277 | 3300048906 | Ga0496103_0863148 | Ga0496103_0863148_111_296 | 61 |
| 1278 | 3300048907 | Ga0496104_0205507 | Ga0496104_0205507_183_368 | 61 |
| 1279 | 3300048909 | Ga0496106_0407120 | Ga0496106_0407120_572_757 | 61 |
| 1280 | 3300048910 | Ga0496107_0168265 | Ga0496107_0168265_1387_1575 | 61 |
| 1281 | 3300048911 | Ga0496108_1313230 | Ga0496108_1313230_19_204 | 61 |
| 1282 | 3300048912 | Ga0496109_0456005 | Ga0496109_0456005_68_253 | 61 |
| 1283 | 3300048912 | Ga0496109_0884690 | Ga0496109_0884690_514_699 | 61 |
| 1284 | 3300048913 | Ga0496110_0504435 | Ga0496110_0504435_558_743 | 61 |
| 1285 | 3300048914 | Ga0496111_0330750 | Ga0496111_0330750_605_790 | 61 |
| 1286 | 3300048915 | Ga0496112_0204968 | Ga0496112_0204968_1308_1493 | 61 |
| 1287 | 3300048916 | Ga0496113_0181414 | Ga0496113_0181414_503_688 | 61 |
| 1288 | 3300048919 | Ga0496116_0080690 | Ga0496116_0080690_1410_1595 | 61 |
| 1289 | 3300048919 | Ga0496116_0334329 | Ga0496116_0334329_46_231 | 61 |
| 1290 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_2430050_2430235 | 61 |
| 1291 | 3300048920 | Ga0496117_0104602 | Ga0496117_0104602_765_950 | 61 |
| 1292 | 3300048920 | Ga0496117_0179655 | Ga0496117_0179655_775_960 | 61 |
| 1293 | 3300048921 | Ga0496118_0001144 | Ga0496118_0001144_9875_10060 | 61 |
| 1294 | 3300048922 | Ga0496119_0020857 | Ga0496119_0020857_3857_4042 | 61 |
| 1295 | 3300048922 | Ga0496119_0038724 | Ga0496119_0038724_1585_1770 | 61 |
| 1296 | 3300048922 | Ga0496119_0050737 | Ga0496119_0050737_938_1123 | 61 |
| 1297 | 3300048923 | Ga0496120_0000897 | Ga0496120_0000897_9900_10085 | 61 |
| 1298 | 3300048924 | Ga0496121_0054257 | Ga0496121_0054257_1917_2102 | 61 |
| 1299 | 3300048924 | Ga0496121_0319213 | Ga0496121_0319213_48_233 | 61 |
| 1300 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1774058_1774243 | 61 |
| 1301 | 3300048925 | Ga0496122_0005325 | Ga0496122_0005325_2837_3022 | 61 |
| 1302 | 3300048925 | Ga0496122_0077402 | Ga0496122_0077402_1106_1291 | 61 |
| 1303 | 3300048925 | Ga0496122_0186794 | Ga0496122_0186794_637_822 | 61 |
| 1304 | 3300048925 | Ga0496122_0507641 | Ga0496122_0507641_121_306 | 61 |
| 1305 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1777789_1777974 | 61 |
| 1306 | 3300048926 | Ga0496123_0048548 | Ga0496123_0048548_278_463 | 61 |
| 1307 | 3300048926 | Ga0496123_0069298 | Ga0496123_0069298_1922_2107 | 61 |
| 1308 | 3300048927 | Ga0496124_0000855 | Ga0496124_0000855_47812_47997 | 61 |
| 1309 | 3300048927 | Ga0496124_0040338 | Ga0496124_0040338_48_233 | 61 |
| 1310 | 3300048927 | Ga0496124_0044707 | Ga0496124_0044707_3458_3643 | 61 |
| 1311 | 3300048927 | Ga0496124_0106630 | Ga0496124_0106630_413_598 | 61 |
| 1312 | 3300048927 | Ga0496124_0435032 | Ga0496124_0435032_312_497 | 61 |
| 1313 | 3300048927 | Ga0496124_0629884 | Ga0496124_0629884_217_402 | 61 |
| 1314 | 3300048928 | Ga0496125_0068486 | Ga0496125_0068486_1358_1543 | 61 |
| 1315 | 3300048929 | Ga0496126_0063284 | Ga0496126_0063284_2032_2217 | 61 |
| 1316 | 3300048929 | Ga0496126_0072053 | Ga0496126_0072053_722_907 | 61 |
| 1317 | 3300048929 | Ga0496126_1229169 | Ga0496126_1229169_303_488 | 61 |
| 1318 | 3300049459 | Ga0495678_030444 | Ga0495678_030444_780_965 | 61 |
| 1319 | 3300049570 | Ga0501033_0000741 | Ga0501033_0000741_27207_27392 | 61 |
| 1320 | 3300049571 | Ga0501034_0356313 | Ga0501034_0356313_845_1033 | 61 |
| 1321 | 3300049581 | Ga0501047_0112286 | Ga0501047_0112286_1840_2028 | 61 |
| 1322 | 3300049583 | Ga0501067_0174629 | Ga0501067_0174629_103_288 | 61 |
| 1323 | 3300049586 | Ga0501070_0079969 | Ga0501070_0079969_77_262 | 61 |
| 1324 | 3300049589 | Ga0501073_1146747 | Ga0501073_1146747_153_341 | 61 |
| 1325 | 3300049742 | Ga0501080_1026561 | Ga0501080_1026561_281_469 | 61 |
| 1326 | 3300049822 | Ga0501035_0004335 | Ga0501035_0004335_10836_11021 | 61 |
| 1327 | 3300049823 | Ga0501044_0373120 | Ga0501044_0373120_938_1126 | 61 |
| 1328 | 3300050489 | nmdc:mga03683_263655_c1 | nmdc:mga03683_263655_c1_238_435 | 61 |
| 1329 | 3300050489 | nmdc:mga03683_95267_c1 | nmdc:mga03683_95267_c1_584_769 | 61 |
| 1330 | 3300050490 | nmdc:mga03n38_453666_c1 | nmdc:mga03n38_453666_c1_474_659 | 61 |
| 1331 | 3300050491 | nmdc:mga00v17_838_c1 | nmdc:mga00v17_838_c1_16228_16413 | 61 |
| 1332 | 3300050491 | nmdc:mga00v17_98091_c1 | nmdc:mga00v17_98091_c1_1641_1826 | 61 |
| 1333 | 3300050492 | nmdc:mga0yw44_3160_c1 | nmdc:mga0yw44_3160_c1_6714_6899 | 61 |
| 1334 | 3300050492 | nmdc:mga0yw44_803420_c1 | nmdc:mga0yw44_803420_c1_84_269 | 61 |
| 1335 | 3300050493 | nmdc:mga0k408_466200_c1 | nmdc:mga0k408_466200_c1_184_369 | 61 |
| 1336 | 3300050493 | nmdc:mga0k408_894208_c1 | nmdc:mga0k408_894208_c1_105_302 | 61 |
| 1337 | 3300050494 | nmdc:mga06z11_545393_c1 | nmdc:mga06z11_545393_c1_377_562 | 61 |
| 1338 | 3300050494 | nmdc:mga06z11_549185_c1 | nmdc:mga06z11_549185_c1_82_267 | 61 |
| 1339 | 3300050494 | nmdc:mga06z11_978283_c1 | nmdc:mga06z11_978283_c1_22_207 | 61 |
| 1340 | 3300050495 | nmdc:mga04h51_389572_c1 | nmdc:mga04h51_389572_c1_19_216 | 61 |
| 1341 | 3300050495 | nmdc:mga04h51_51802_c1 | nmdc:mga04h51_51802_c1_805_990 | 61 |
| 1342 | 3300050496 | nmdc:mga07m45_140770_c1 | nmdc:mga07m45_140770_c1_347_532 | 61 |
| 1343 | 3300050496 | nmdc:mga07m45_156640_c1 | nmdc:mga07m45_156640_c1_449_634 | 61 |
| 1344 | 3300050496 | nmdc:mga07m45_592194_c1 | nmdc:mga07m45_592194_c1_336_533 | 61 |
| 1345 | 3300050516 | nmdc:mga0sz30_268_c1 | nmdc:mga0sz30_268_c1_16487_16672 | 61 |
| 1346 | 3300053077 | Ga0495601_0045173 | Ga0495601_0045173_1302_1490 | 61 |
| 1347 | 3300053077 | Ga0495601_0472317 | Ga0495601_0472317_147_332 | 61 |
| 1348 | 3300053084 | Ga0495595_0110042 | Ga0495595_0110042_506_694 | 61 |
| 1349 | 3300053085 | Ga0495619_0045254 | Ga0495619_0045254_91_279 | 61 |
| 1350 | 3300053085 | Ga0495619_0245844 | Ga0495619_0245844_600_785 | 61 |
| 1351 | 3300053087 | Ga0500643_114283 | Ga0500643_114283_423_608 | 61 |
| 1352 | 3300053088 | Ga0500644_0504222 | Ga0500644_0504222_110_295 | 61 |
| 1353 | 3300053107 | Ga0500560_266297 | Ga0500560_266297_14_199 | 61 |
| 1354 | 3300053111 | Ga0500572_001459 | Ga0500572_001459_5645_5830 | 61 |
| 1355 | 3300053123 | Ga0500614_075922 | Ga0500614_075922_366_551 | 61 |
| 1356 | 3300053136 | Ga0500559_0003926 | Ga0500559_0003926_3200_3385 | 61 |
| 1357 | 3300053137 | Ga0500561_0001340 | Ga0500561_0001340_211_396 | 61 |
| 1358 | 3300053148 | Ga0500590_000122 | Ga0500590_000122_12221_12406 | 61 |
| 1359 | 3300053157 | Ga0500624_000595 | Ga0500624_000595_9494_9679 | 61 |
| 1360 | 3300053157 | Ga0500624_031755 | Ga0500624_031755_246_431 | 61 |
| 1361 | 3300053161 | Ga0500634_0001711 | Ga0500634_0001711_3194_3379 | 61 |
| 1362 | 3300053161 | Ga0500634_0002130 | Ga0500634_0002130_3872_4057 | 61 |
| 1363 | 3300053177 | Ga0500636_0000094 | Ga0500636_0000094_25366_25551 | 61 |
| 1364 | 3300053177 | Ga0500636_0001328 | Ga0500636_0001328_4018_4203 | 61 |
| 1365 | 3300053177 | Ga0500636_0330724 | Ga0500636_0330724_538_723 | 61 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar