metagRoot

F493363

General Info

Members	Datasets	Scaffolds	Average Seq Length
1364	630	2728	132

Family's Representative Sequence

Representative Sequence	3300025295\|Ga0209564_1001502\|Ga0209564_10015023
Length	155
Sequence	MAALLTYDGIGSARSSGDAKEMSMELNLPDVIAEVSAAFARYEKALTTNDTAVLGELFRNDPRTIRYGMGENLYGYDEIQAFRGARSPVGLMRRIERTVITSYGRDTAVASTLFYRDNAPGKVGRQMQTWIRFPEGWHIVAASVSVIDDPQKKAE

Samples

	Sample ID	Description	Type	Environment
1	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
4	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
5	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
6	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
7	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
8	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
9	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
10	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
11	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
12	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
13	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
14	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
15	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
16	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
17	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
25	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
26	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
27	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
28	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
34	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
35	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
36	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
37	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
40	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
41	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
42	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
43	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
44	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
45	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
46	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
47	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
48	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
49	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
50	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
53	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
54	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
55	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
56	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
57	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
58	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
59	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
60	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
61	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
64	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
65	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
66	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
67	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
68	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
69	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
70	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
71	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
72	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
73	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
74	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
75	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
76	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
77	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
78	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
79	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
80	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
81	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
82	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
83	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
84	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
86	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
87	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
88	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
89	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
90	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
91	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
93	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
94	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
95	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
96	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
97	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
98	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
99	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
100	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
101	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
102	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
103	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
104	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
105	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
106	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
107	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
108	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
109	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
110	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
111	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
112	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
113	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
114	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
115	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
116	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
117	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
118	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
119	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
120	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
121	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
122	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
123	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
124	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
125	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
126	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
127	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
128	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
129	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
130	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
131	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
137	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
198	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
199	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
200	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
202	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
203	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
206	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
207	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
208	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
209	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
210	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
211	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
212	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
213	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
214	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
215	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
216	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
217	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
218	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
219	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
220	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
221	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
222	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
223	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
224	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
225	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
226	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
227	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
228	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
229	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
230	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
231	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
232	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
233	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
234	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
235	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
236	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
237	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
238	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
239	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
240	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
241	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
242	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
243	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
244	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
245	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
246	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
247	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
248	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
249	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
250	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
251	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
252	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
253	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
254	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
255	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
256	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
257	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
258	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
259	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
260	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
261	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
262	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
263	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
264	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
265	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
266	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
267	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
268	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
269	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
270	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
271	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
272	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
273	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
274	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
275	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
276	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
277	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
278	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
279	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
280	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
281	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
282	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
283	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
284	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
285	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
286	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
287	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
288	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
289	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
290	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
291	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
292	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
293	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
294	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
295	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
296	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
297	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
298	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
299	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
300	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
301	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
302	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
303	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
304	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
305	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
306	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
307	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
308	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
309	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
310	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
311	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
312	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
313	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
314	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
315	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
316	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
317	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
318	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
319	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
320	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
321	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
322	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
323	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
324	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
325	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
326	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
327	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
328	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
329	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
330	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
331	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
332	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
333	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
334	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
335	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
336	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
337	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
338	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
339	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
340	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
341	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
342	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
343	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
344	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
345	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
346	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
347	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
348	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
349	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
350	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
351	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
352	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
353	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
354	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
355	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
356	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
357	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
358	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
359	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
360	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
361	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
362	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
363	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
364	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
365	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
366	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
367	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
368	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
369	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
370	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
371	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
372	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
373	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
374	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
375	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
376	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
377	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
378	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
379	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
380	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
381	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
382	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
383	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
384	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
385	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
386	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
387	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
388	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
389	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
390	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
391	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
392	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
393	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
394	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
395	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
396	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
397	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
398	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
399	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
400	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
401	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
402	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
403	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
404	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
405	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
406	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
407	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
408	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
409	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
410	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
411	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
412	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
413	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
414	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
415	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
416	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
417	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
418	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
419	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
420	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
421	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
422	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
423	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
424	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
425	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
426	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
427	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
428	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
429	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
430	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
431	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
432	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
433	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
434	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
435	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
436	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
437	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
438	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
439	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
440	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
441	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
442	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
443	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
444	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
445	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
446	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
447	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
448	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
449	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
450	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
451	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
452	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
453	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
454	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
455	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
456	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
457	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
458	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
459	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
460	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
461	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
462	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
463	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
464	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
465	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
466	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
467	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
468	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
469	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
470	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
471	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
472	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
473	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
474	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
475	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
476	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
477	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
478	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
479	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
480	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
481	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
482	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
483	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
484	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
485	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
486	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
487	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
488	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
489	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
490	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
491	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
492	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
493	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
494	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
495	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
496	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
497	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
498	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
499	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
500	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
501	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
502	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
503	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
504	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
505	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
506	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
507	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
508	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
509	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
510	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
511	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
512	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
513	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
514	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
515	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
516	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
517	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
518	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
519	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
520	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
521	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
522	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
523	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
524	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
525	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
526	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
527	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
528	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
529	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
530	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
531	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
532	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
533	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
534	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
535	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
536	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
537	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
538	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
539	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
540	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
541	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
542	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
543	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
544	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
545	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
546	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
547	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
548	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
549	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
550	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
551	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
552	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
553	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
554	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
555	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
556	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
557	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
558	2922368715
559	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
560	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
561	2922425934
562	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
563	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
564	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
565	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
566	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
567	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
568	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
569	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
570	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
571	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
572	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
573	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
574	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
575	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
576	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
577	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
578	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
579	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
580	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
581	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
582	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
583	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
584	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
585	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
586	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
587	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
588	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
589	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
590	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
591	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
592	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
593	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
594	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
595	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
596	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
597	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
598	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
599	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
600	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
601	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
602	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
603	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
604	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
605	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
606	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
607	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
608	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
609	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
610	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
611	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
612	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
613	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
614	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
615	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
616	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
617	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
618	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
619	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
620	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
621	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
622	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
623	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
624	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
625	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
626	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
627	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
628	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
629	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
630	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	89.13
Metatranscriptomes	0.15
Isolates	10.72

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.6
Nodule	7.84
Rhizoplane	8.28
Rhizosphere	55.13
Stem	0
Stem Tuber	0
Unclassified	0.15

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0209564_1001502	3300025295	Bacteria	23414
2	JGI24739J22299_10059095	3300001989	Bacteria	1215
3	JGI24737J22298_10107397	3300001990	Bacteria	826
4	JGI25406J46586_10000471	3300003203	Bacteria	18790
5	JGI25165J46597_1004300	3300003214	Bacteria	3114
6	JGI25153J46596_10002109	3300003215	Bacteria	11645
7	JGI25153J46596_10004526	3300003215	Bacteria	7477
8	JGI25153J46596_10012156	3300003215	Bacteria	3741
9	JGI25153J46596_10012608	3300003215	Bacteria	3630
10	JGI25153J46596_10019440	3300003215	Bacteria	2603
11	JGI25153J46596_10033696	3300003215	Bacteria	1686
12	rootL2_10152192	3300003322	Bacteria	1037
13	JGI25160J50197_1002305	3300003354	Bacteria	8949
14	JGI25160J50197_1005985	3300003354	Bacteria	4991
15	JGI25160J50197_1069486	3300003354	Bacteria	676
16	JGI25404J52841_10003282	3300003659	Bacteria	3179
17	JGI25404J52841_10013133	3300003659	Bacteria	1796
18	Ga0055542_1021136	3300003762	Bacteria	943
19	Ga0055529_1041736	3300003763	Bacteria	555
20	Ga0055526_1102453	3300003771	Bacteria	523
21	Ga0055543_1003281	3300004625	Bacteria	4867
22	Ga0065165_1005102	3300005262	Bacteria	7628
23	Ga0065165_1005218	3300005262	Bacteria	7467
24	Ga0065165_1017149	3300005262	Bacteria	2681
25	Ga0065165_1084117	3300005262	Bacteria	821
26	Ga0070658_10323677	3300005327	Bacteria	1317
27	Ga0070676_10551990	3300005328	Bacteria	825
28	Ga0070676_10926436	3300005328	Bacteria	650
29	Ga0070676_11501219	3300005328	Bacteria	519
30	Ga0070683_100064508	3300005329	Bacteria	3410
31	Ga0070683_100566307	3300005329	Bacteria	1087
32	Ga0070683_101449514	3300005329	Bacteria	660
33	Ga0070670_100011429	3300005331	Bacteria	7594
34	Ga0070670_100345357	3300005331	Bacteria	1307
35	Ga0070670_100393402	3300005331	Bacteria	1223
36	Ga0070670_100860305	3300005331	Bacteria	821
37	Ga0068869_100257708	3300005334	Bacteria	1395
38	Ga0068869_100676711	3300005334	Bacteria	878
39	Ga0068869_101774167	3300005334	Bacteria	552
40	Ga0070666_10192653	3300005335	Bacteria	1433
41	Ga0070682_100201028	3300005337	Bacteria	1406
42	Ga0070682_100239564	3300005337	Bacteria	1301
43	Ga0070682_101581020	3300005337	Bacteria	566
44	Ga0068868_100099635	3300005338	Bacteria	2351
45	Ga0068868_100151059	3300005338	Bacteria	1912
46	Ga0068868_100195092	3300005338	Bacteria	1685
47	Ga0068868_100491395	3300005338	Bacteria	1074
48	Ga0070660_101166424	3300005339	Bacteria	653
49	Ga0070689_101253802	3300005340	Bacteria	667
50	Ga0070689_101540265	3300005340	Bacteria	603
51	Ga0070661_100121780	3300005344	Bacteria	1955
52	Ga0070661_100184713	3300005344	Bacteria	1588
53	Ga0070661_100187572	3300005344	Bacteria	1576
54	Ga0070661_100522894	3300005344	Bacteria	952
55	Ga0070661_100727301	3300005344	Bacteria	810
56	Ga0070668_100185882	3300005347	Bacteria	1699
57	Ga0070668_101487857	3300005347	Bacteria	619
58	Ga0070668_101674580	3300005347	Bacteria	584
59	Ga0070669_101209666	3300005353	Bacteria	653
60	Ga0070671_100031378	3300005355	Bacteria	4389
61	Ga0070671_100540044	3300005355	Bacteria	1005
62	Ga0070671_101082222	3300005355	Bacteria	704
63	Ga0070671_101544203	3300005355	Bacteria	588
64	Ga0070674_100402510	3300005356	Bacteria	1119
65	Ga0070674_100428820	3300005356	Bacteria	1087
66	Ga0070674_100798735	3300005356	Bacteria	815
67	Ga0070673_100057045	3300005364	Bacteria	3084
68	Ga0070673_100932837	3300005364	Bacteria	806
69	Ga0070659_101572745	3300005366	Bacteria	587
70	Ga0070667_100137923	3300005367	Bacteria	2133
71	Ga0070667_100483623	3300005367	Bacteria	1134
72	Ga0070667_100547350	3300005367	Bacteria	1064
73	Ga0070667_101375005	3300005367	Bacteria	662
74	Ga0070714_100835310	3300005435	Bacteria	893
75	Ga0070713_100009559	3300005436	Bacteria	6952
76	Ga0070713_101118060	3300005436	Bacteria	762
77	Ga0070710_10121805	3300005437	Bacteria	1580
78	Ga0070711_100018328	3300005439	Bacteria	4466
79	Ga0070705_101139710	3300005440	Bacteria	640
80	Ga0070700_100872293	3300005441	Bacteria	731
81	Ga0070694_100746877	3300005444	Bacteria	799
82	Ga0070663_100017505	3300005455	Bacteria	4679
83	Ga0070663_100073084	3300005455	Bacteria	2501
84	Ga0070663_100092931	3300005455	Bacteria	2238
85	Ga0070663_100248215	3300005455	Bacteria	1408
86	Ga0070663_100680591	3300005455	Bacteria	873
87	Ga0070663_100975680	3300005455	Bacteria	736
88	Ga0070663_101386373	3300005455	Bacteria	622
89	Ga0070678_100007756	3300005456	Bacteria	6383
90	Ga0070678_100073133	3300005456	Bacteria	2572
91	Ga0070678_100302941	3300005456	Bacteria	1359
92	Ga0070678_100641673	3300005456	Bacteria	952
93	Ga0070662_100298862	3300005457	Bacteria	1307
94	Ga0070662_100426806	3300005457	Bacteria	1097
95	Ga0068867_100524791	3300005459	Bacteria	1022
96	Ga0070679_100690370	3300005530	Bacteria	963
97	Ga0070679_101526298	3300005530	Bacteria	615
98	Ga0070684_100448775	3300005535	Bacteria	1192
99	Ga0070684_100669512	3300005535	Bacteria	967
100	Ga0070684_102353286	3300005535	Bacteria	502
101	Ga0068853_100245557	3300005539	Bacteria	1642
102	Ga0068853_100460315	3300005539	Bacteria	1197
103	Ga0068853_100745633	3300005539	Bacteria	936
104	Ga0068853_100769573	3300005539	Bacteria	921
105	Ga0070672_100295624	3300005543	Bacteria	1372
106	Ga0070672_100460642	3300005543	Bacteria	1096
107	Ga0070672_101704484	3300005543	Bacteria	566
108	Ga0070686_101235177	3300005544	Bacteria	622
109	Ga0070696_100548727	3300005546	Bacteria	926
110	Ga0070693_100351749	3300005547	Bacteria	1008
111	Ga0070693_100638587	3300005547	Bacteria	773
112	Ga0070665_100074278	3300005548	Bacteria	3406
113	Ga0070665_100101028	3300005548	Bacteria	2888
114	Ga0070665_100154053	3300005548	Bacteria	2300
115	Ga0070665_100206615	3300005548	Bacteria	1964
116	Ga0070665_100229279	3300005548	Bacteria	1857
117	Ga0070665_100984466	3300005548	Bacteria	856
118	Ga0070665_101141528	3300005548	Bacteria	790
119	Ga0070704_100353610	3300005549	Bacteria	1241
120	Ga0068855_100514850	3300005563	Bacteria	1299
121	Ga0068855_100610204	3300005563	Bacteria	1176
122	Ga0068855_101086517	3300005563	Bacteria	837
123	Ga0070664_100035841	3300005564	Bacteria	4166
124	Ga0070664_100265625	3300005564	Bacteria	1545
125	Ga0070664_100659794	3300005564	Bacteria	972
126	Ga0070664_100872873	3300005564	Bacteria	843
127	Ga0070664_100891584	3300005564	Bacteria	834
128	Ga0068857_100047852	3300005577	Bacteria	3798
129	Ga0068857_100186695	3300005577	Bacteria	1887
130	Ga0068854_100044727	3300005578	Bacteria	3145
131	Ga0068854_100243577	3300005578	Bacteria	1433
132	Ga0068854_100959772	3300005578	Bacteria	755
133	Ga0068856_100185768	3300005614	Bacteria	2092
134	Ga0068856_100601928	3300005614	Bacteria	1120
135	Ga0068856_101134651	3300005614	Bacteria	799
136	Ga0068856_102117265	3300005614	Bacteria	572
137	Ga0070702_100236904	3300005615	Bacteria	1230
138	Ga0070702_100420990	3300005615	Bacteria	961
139	Ga0068852_100680547	3300005616	Bacteria	1038
140	Ga0068852_101494407	3300005616	Bacteria	698
141	Ga0068852_102233990	3300005616	Bacteria	568
142	Ga0068859_100495828	3300005617	Bacteria	1316
143	Ga0068859_101773298	3300005617	Bacteria	682
144	Ga0068864_100461916	3300005618	Bacteria	1216
145	Ga0068864_101583706	3300005618	Bacteria	659
146	Ga0068864_102603186	3300005618	Bacteria	512
147	Ga0068861_100291002	3300005719	Bacteria	1410
148	Ga0068861_101274488	3300005719	Bacteria	714
149	Ga0068861_101596406	3300005719	Bacteria	642
150	Ga0068851_10469213	3300005834	Bacteria	751
151	Ga0068870_10382314	3300005840	Bacteria	911
152	Ga0068870_10464212	3300005840	Bacteria	837
153	Ga0068863_100231450	3300005841	Bacteria	1783
154	Ga0068863_100461369	3300005841	Bacteria	1248
155	Ga0068863_100659984	3300005841	Bacteria	1038
156	Ga0068863_101429539	3300005841	Bacteria	700
157	Ga0068863_101728670	3300005841	Bacteria	635
158	Ga0068863_101903644	3300005841	Bacteria	605
159	Ga0068858_100573156	3300005842	Bacteria	1094
160	Ga0068858_100644849	3300005842	Bacteria	1029
161	Ga0068860_100172485	3300005843	Bacteria	2089
162	Ga0068860_101088076	3300005843	Bacteria	818
163	Ga0068860_101732429	3300005843	Bacteria	647
164	Ga0068862_100385747	3300005844	Bacteria	1308
165	Ga0068862_100515092	3300005844	Bacteria	1137
166	Ga0081455_10006198	3300005937	Bacteria	12894
167	Ga0081538_10071652	3300005981	Bacteria	1905
168	Ga0081540_1009916	3300005983	Bacteria	6498
169	Ga0081540_1049936	3300005983	Bacteria	2082
170	Ga0081540_1080207	3300005983	Bacteria	1472
171	Ga0081539_10000048	3300005985	Bacteria	272906
172	Ga0070717_10006987	3300006028	Bacteria	8350
173	Ga0070717_10157315	3300006028	Bacteria	1970
174	Ga0070717_11166894	3300006028	Bacteria	701
175	Ga0075365_10008364	3300006038	Bacteria	5867
176	Ga0075365_10016090	3300006038	Bacteria	4540
177	Ga0075365_10034988	3300006038	Bacteria	3248
178	Ga0075365_10058946	3300006038	Bacteria	2557
179	Ga0075365_10116577	3300006038	Bacteria	1839
180	Ga0075365_10232706	3300006038	Bacteria	1294
181	Ga0075365_10434856	3300006038	Bacteria	926
182	Ga0075365_10517378	3300006038	Bacteria	844
183	Ga0075365_10819873	3300006038	Bacteria	656
184	Ga0075365_10830510	3300006038	Bacteria	652
185	Ga0075368_10029965	3300006042	Bacteria	2105
186	Ga0075368_10187372	3300006042	Bacteria	873
187	Ga0075368_10249077	3300006042	Bacteria	759
188	Ga0075363_100004096	3300006048	Bacteria	6319
189	Ga0075363_100016122	3300006048	Bacteria	3686
190	Ga0075363_100022049	3300006048	Bacteria	3216
191	Ga0075363_100286506	3300006048	Bacteria	954
192	Ga0075363_100482569	3300006048	Bacteria	735
193	Ga0075364_10062021	3300006051	Bacteria	2453
194	Ga0075364_10213307	3300006051	Bacteria	1309
195	Ga0070716_100235720	3300006173	Bacteria	1238
196	Ga0070712_100035265	3300006175	Bacteria	3396
197	Ga0070712_100202927	3300006175	Bacteria	1559
198	Ga0070712_100278242	3300006175	Bacteria	1347
199	Ga0075362_10164050	3300006177	Bacteria	1071
200	Ga0075362_10186328	3300006177	Bacteria	1007
201	Ga0075362_10532309	3300006177	Bacteria	603
202	Ga0075362_10709998	3300006177	Bacteria	525
203	Ga0075367_10055136	3300006178	Bacteria	2358
204	Ga0075367_10176811	3300006178	Bacteria	1330
205	Ga0075367_10239255	3300006178	Bacteria	1137
206	Ga0075367_10282236	3300006178	Bacteria	1044
207	Ga0075367_10359031	3300006178	Bacteria	920
208	Ga0075367_10438165	3300006178	Bacteria	828
209	Ga0075367_10565733	3300006178	Bacteria	722
210	Ga0075369_10016661	3300006186	Bacteria	2968
211	Ga0075369_10019679	3300006186	Bacteria	2758
212	Ga0075369_10096190	3300006186	Bacteria	1325
213	Ga0075369_10130166	3300006186	Bacteria	1143
214	Ga0075369_10208365	3300006186	Bacteria	903
215	Ga0075369_10270483	3300006186	Bacteria	791
216	Ga0075366_10096060	3300006195	Bacteria	1777
217	Ga0075366_10132280	3300006195	Bacteria	1506
218	Ga0075366_10531377	3300006195	Bacteria	728
219	Ga0075366_10829088	3300006195	Bacteria	575
220	Ga0097621_100168105	3300006237	Bacteria	1889
221	Ga0097621_100872720	3300006237	Bacteria	837
222	Ga0097621_101013421	3300006237	Bacteria	777
223	Ga0075370_10048587	3300006353	Bacteria	2404
224	Ga0075370_10062739	3300006353	Bacteria	2118
225	Ga0075370_10186532	3300006353	Bacteria	1221
226	Ga0075370_10312963	3300006353	Bacteria	935
227	Ga0075370_10368924	3300006353	Bacteria	859
228	Ga0075370_10711629	3300006353	Bacteria	611
229	Ga0075428_100035501	3300006844	Bacteria	5496
230	Ga0075431_100564108	3300006847	Bacteria	1125
231	Ga0075434_100517548	3300006871	Bacteria	1213
232	Ga0075434_101741203	3300006871	Bacteria	631
233	Ga0075429_100196677	3300006880	Bacteria	1766
234	Ga0068865_100189089	3300006881	Bacteria	1591
235	Ga0097620_100495818	3300006931	Bacteria	1316
236	Ga0097620_101361044	3300006931	Bacteria	783
237	Ga0097620_101773156	3300006931	Bacteria	682
238	Ga0099824_1004372	3300006942	Bacteria	20372
239	Ga0075435_100627002	3300007076	Bacteria	933
240	Ga0099794_10092432	3300007265	Bacteria	1503
241	Ga0099795_10443388	3300007788	Bacteria	597
242	Ga0105250_10221201	3300009092	Bacteria	803
243	Ga0105240_10082785	3300009093	Bacteria	3940
244	Ga0105240_11208433	3300009093	Bacteria	800
245	Ga0111539_10195880	3300009094	Bacteria	2357
246	Ga0105245_10294658	3300009098	Bacteria	1590
247	Ga0105245_10789137	3300009098	Bacteria	987
248	Ga0105245_10845745	3300009098	Bacteria	955
249	Ga0105245_11539178	3300009098	Bacteria	716
250	Ga0105245_12419437	3300009098	Bacteria	579
251	Ga0105247_10112667	3300009101	Bacteria	1753
252	Ga0105247_10186958	3300009101	Bacteria	1385
253	Ga0105247_10309158	3300009101	Bacteria	1099
254	Ga0105247_10361775	3300009101	Bacteria	1023
255	Ga0105247_10535569	3300009101	Bacteria	859
256	Ga0105247_10635243	3300009101	Bacteria	796
257	Ga0105247_10693874	3300009101	Bacteria	765
258	Ga0105247_10820317	3300009101	Bacteria	711
259	Ga0105247_10977268	3300009101	Bacteria	659
260	Ga0114129_10219007	3300009147	Bacteria	2569
261	Ga0105243_10316303	3300009148	Bacteria	1421
262	Ga0105243_10538091	3300009148	Bacteria	1114
263	Ga0105243_10706845	3300009148	Bacteria	983
264	Ga0105243_11634814	3300009148	Bacteria	672
265	Ga0105243_12095654	3300009148	Bacteria	601
266	Ga0105241_10051632	3300009174	Bacteria	3137
267	Ga0105241_10202057	3300009174	Bacteria	1660
268	Ga0105241_10920922	3300009174	Bacteria	813
269	Ga0105241_11397638	3300009174	Bacteria	670
270	Ga0105242_10684760	3300009176	Bacteria	1001
271	Ga0105242_10793180	3300009176	Bacteria	937
272	Ga0105242_11981181	3300009176	Bacteria	624
273	Ga0105248_10147688	3300009177	Bacteria	2653
274	Ga0105248_10257011	3300009177	Bacteria	1966
275	Ga0105248_10324260	3300009177	Bacteria	1735
276	Ga0105248_10350579	3300009177	Bacteria	1662
277	Ga0105237_10299195	3300009545	Bacteria	1612
278	Ga0105237_10450644	3300009545	Bacteria	1293
279	Ga0105237_10603620	3300009545	Bacteria	1105
280	Ga0105237_12145048	3300009545	Bacteria	568
281	Ga0105238_10153932	3300009551	Bacteria	2274
282	Ga0105238_10377269	3300009551	Bacteria	1409
283	Ga0105238_10717255	3300009551	Bacteria	1012
284	Ga0105238_10730019	3300009551	Bacteria	1004
285	Ga0105238_10781053	3300009551	Bacteria	970
286	Ga0105249_10555639	3300009553	Bacteria	1199
287	Ga0105249_10944427	3300009553	Bacteria	930
288	Ga0105239_10099895	3300010375	Bacteria	3209
289	Ga0105239_10140445	3300010375	Bacteria	2691
290	Ga0105239_10523619	3300010375	Bacteria	1349
291	Ga0105239_10576603	3300010375	Bacteria	1282
292	Ga0105239_10623443	3300010375	Bacteria	1231
293	Ga0105239_10780281	3300010375	Bacteria	1094
294	Ga0105239_12003635	3300010375	Bacteria	672
295	Ga0105239_12021693	3300010375	Bacteria	669
296	Ga0105246_10122720	3300011119	Bacteria	1928
297	Ga0105246_10169521	3300011119	Bacteria	1670
298	Ga0105246_10177751	3300011119	Bacteria	1636
299	Ga0105246_10697911	3300011119	Bacteria	889
300	Ga0105246_12554600	3300011119	Bacteria	504
301	Ga0157370_11059395	3300013104	Bacteria	733
302	Ga0157370_11324092	3300013104	Bacteria	649
303	Ga0157369_10004320	3300013105	Bacteria	16785
304	Ga0157369_10022623	3300013105	Bacteria	7010
305	Ga0157374_10233980	3300013296	Bacteria	1805
306	Ga0157374_11217972	3300013296	Bacteria	774
307	Ga0157374_11368191	3300013296	Bacteria	730
308	Ga0157378_10252048	3300013297	Bacteria	1690
309	Ga0157378_10551762	3300013297	Bacteria	1158
310	Ga0157378_11279120	3300013297	Bacteria	774
311	Ga0157378_11490480	3300013297	Bacteria	721
312	Ga0157378_11499037	3300013297	Bacteria	719
313	Ga0163162_10165537	3300013306	Bacteria	2334
314	Ga0163162_10539665	3300013306	Bacteria	1295
315	Ga0163162_11353375	3300013306	Bacteria	810
316	Ga0157372_10136529	3300013307	Bacteria	2825
317	Ga0157372_10671603	3300013307	Bacteria	1206
318	Ga0157375_10139166	3300013308	Bacteria	2553
319	Ga0157375_10139464	3300013308	Bacteria	2551
320	Ga0157375_10410236	3300013308	Bacteria	1521
321	Ga0157375_10989443	3300013308	Bacteria	981
322	Ga0157375_11408203	3300013308	Bacteria	821
323	Ga0157375_12283837	3300013308	Bacteria	645
324	Ga0163163_10233843	3300014325	Bacteria	1887
325	Ga0163163_10253768	3300014325	Bacteria	1809
326	Ga0163163_10725536	3300014325	Bacteria	1057
327	Ga0163163_12044153	3300014325	Bacteria	633
328	Ga0157380_10358113	3300014326	Bacteria	1368
329	Ga0157380_10777441	3300014326	Bacteria	972
330	Ga0157380_10872932	3300014326	Bacteria	923
331	Ga0157380_11148223	3300014326	Bacteria	818
332	Ga0157380_13071445	3300014326	Bacteria	532
333	Ga0182008_10535130	3300014497	Bacteria	649
334	Ga0157377_10062731	3300014745	Bacteria	2127
335	Ga0157377_10325418	3300014745	Bacteria	1023
336	Ga0157379_10051438	3300014968	Bacteria	3680
337	Ga0157379_10257408	3300014968	Bacteria	1585
338	Ga0157379_10269584	3300014968	Bacteria	1548
339	Ga0157379_10513974	3300014968	Bacteria	1111
340	Ga0157379_11196365	3300014968	Bacteria	731
341	Ga0157376_10079124	3300014969	Bacteria	2817
342	Ga0157376_10138263	3300014969	Bacteria	2182
343	Ga0157376_10499571	3300014969	Bacteria	1195
344	Ga0157376_10561841	3300014969	Bacteria	1131
345	Ga0182007_10100642	3300015262	Bacteria	957
346	Ga0163161_10639697	3300017792	Bacteria	880
347	Ga0163161_10767641	3300017792	Bacteria	808
348	Ga0163161_11267521	3300017792	Bacteria	640
349	Ga0214544_1000003	3300021320	Bacteria	643752
350	Ga0214542_1000003	3300021321	Bacteria	435700
351	Ga0214545_1000004	3300021324	Bacteria	453352
352	Ga0214543_1000007	3300021327	Bacteria	414744
353	Ga0213876_10011887	3300021384	Bacteria	4640
354	Ga0209677_101261	3300025253	Bacteria	11366
355	Ga0209148_1000351	3300025254	Bacteria	59739
356	Ga0209233_1021434	3300025261	Bacteria	1673
357	Ga0209455_1014217	3300025272	Bacteria	1811
358	Ga0209564_1003721	3300025295	Bacteria	9997
359	Ga0209564_1039844	3300025295	Bacteria	1284
360	Ga0209564_1069980	3300025295	Bacteria	735
361	Ga0209758_1000015	3300025297	Bacteria	851943
362	Ga0209758_1000224	3300025297	Bacteria	121530
363	Ga0209758_1001252	3300025297	Bacteria	31479
364	Ga0209758_1005621	3300025297	Bacteria	9519
365	Ga0209758_1008757	3300025297	Bacteria	6457
366	Ga0209758_1016184	3300025297	Bacteria	3803
367	Ga0209758_1041708	3300025297	Bacteria	1711
368	Ga0209758_1051205	3300025297	Bacteria	1439
369	Ga0209256_1006394	3300025299	Bacteria	6263
370	Ga0209256_1021765	3300025299	Bacteria	1958
371	Ga0207426_1000585	3300025302	Bacteria	48529
372	Ga0207426_1000940	3300025302	Bacteria	28937
373	Ga0207426_1026409	3300025302	Bacteria	1945
374	Ga0207426_1036866	3300025302	Bacteria	1551
375	Ga0207426_1145433	3300025302	Bacteria	558
376	Ga0209051_1038528	3300025303	Bacteria	1738
377	Ga0209051_1096052	3300025303	Bacteria	810
378	Ga0209257_1011507	3300025304	Bacteria	4249
379	Ga0209257_1052589	3300025304	Bacteria	1143
380	Ga0209257_1108854	3300025304	Bacteria	664
381	Ga0207656_10427326	3300025321	Bacteria	668
382	Ga0207692_10056327	3300025898	Bacteria	2016
383	Ga0207692_10505185	3300025898	Bacteria	768
384	Ga0207642_10108830	3300025899	Bacteria	1407
385	Ga0207642_10491829	3300025899	Bacteria	750
386	Ga0207710_10102991	3300025900	Bacteria	1348
387	Ga0207710_10177880	3300025900	Bacteria	1042
388	Ga0207710_10546796	3300025900	Bacteria	603
389	Ga0207710_10572675	3300025900	Unclassified	589
390	Ga0207688_10064254	3300025901	Bacteria	2071
391	Ga0207688_10164085	3300025901	Bacteria	1318
392	Ga0207680_10051139	3300025903	Bacteria	2470
393	Ga0207647_10009677	3300025904	Bacteria	6841
394	Ga0207647_10404909	3300025904	Bacteria	768
395	Ga0207645_10620149	3300025907	Bacteria	735
396	Ga0207643_10304438	3300025908	Bacteria	992
397	Ga0207643_10577868	3300025908	Bacteria	722
398	Ga0207643_10911634	3300025908	Bacteria	569
399	Ga0207705_10202576	3300025909	Bacteria	1504
400	Ga0207705_10206374	3300025909	Bacteria	1490
401	Ga0207654_10224444	3300025911	Bacteria	1248
402	Ga0207654_10255535	3300025911	Bacteria	1176
403	Ga0207695_10000065	3300025913	Bacteria	336949
404	Ga0207695_10006231	3300025913	Bacteria	15536
405	Ga0207695_11617149	3300025913	Bacteria	528
406	Ga0207671_10032832	3300025914	Bacteria	3863
407	Ga0207671_10307294	3300025914	Bacteria	1253
408	Ga0207693_10161835	3300025915	Bacteria	1761
409	Ga0207693_10217833	3300025915	Bacteria	1500
410	Ga0207693_11143746	3300025915	Bacteria	589
411	Ga0207663_10308747	3300025916	Bacteria	1184
412	Ga0207657_11122235	3300025919	Bacteria	600
413	Ga0207649_10058590	3300025920	Bacteria	2412
414	Ga0207649_10309148	3300025920	Bacteria	1158
415	Ga0207649_10398927	3300025920	Bacteria	1029
416	Ga0207646_10317547	3300025922	Bacteria	1408
417	Ga0207694_10199982	3300025924	Bacteria	1626
418	Ga0207694_10670619	3300025924	Bacteria	874
419	Ga0207694_10823877	3300025924	Bacteria	784
420	Ga0207650_10018826	3300025925	Bacteria	4850
421	Ga0207650_10368292	3300025925	Bacteria	1185
422	Ga0207650_10616519	3300025925	Bacteria	913
423	Ga0207659_10407116	3300025926	Bacteria	1139
424	Ga0207659_10608124	3300025926	Bacteria	932
425	Ga0207659_10827817	3300025926	Bacteria	795
426	Ga0207687_10222274	3300025927	Bacteria	1487
427	Ga0207687_10478174	3300025927	Bacteria	1037
428	Ga0207700_10048893	3300025928	Bacteria	3143
429	Ga0207700_10407898	3300025928	Bacteria	1192
430	Ga0207700_10473039	3300025928	Bacteria	1107
431	Ga0207664_10507941	3300025929	Bacteria	1080
432	Ga0207664_10525378	3300025929	Bacteria	1061
433	Ga0207664_10884278	3300025929	Bacteria	802
434	Ga0207644_10113633	3300025931	Bacteria	2051
435	Ga0207644_10645991	3300025931	Bacteria	880
436	Ga0207644_10906849	3300025931	Bacteria	739
437	Ga0207690_10092577	3300025932	Bacteria	2140
438	Ga0207706_10058020	3300025933	Bacteria	3410
439	Ga0207706_10088497	3300025933	Bacteria	2722
440	Ga0207706_10199534	3300025933	Bacteria	1755
441	Ga0207706_10965388	3300025933	Bacteria	717
442	Ga0207686_10200590	3300025934	Bacteria	1429
443	Ga0207686_10339839	3300025934	Bacteria	1127
444	Ga0207686_10392658	3300025934	Bacteria	1055
445	Ga0207709_10412369	3300025935	Bacteria	1035
446	Ga0207709_10466908	3300025935	Bacteria	978
447	Ga0207709_10611304	3300025935	Bacteria	864
448	Ga0207709_10789934	3300025935	Bacteria	765
449	Ga0207709_11174121	3300025935	Bacteria	632
450	Ga0207670_10775186	3300025936	Bacteria	798
451	Ga0207669_10057403	3300025937	Bacteria	2370
452	Ga0207669_10192274	3300025937	Bacteria	1473
453	Ga0207669_10278632	3300025937	Bacteria	1260
454	Ga0207669_10718802	3300025937	Bacteria	822
455	Ga0207704_10210591	3300025938	Bacteria	1430
456	Ga0207704_11457358	3300025938	Bacteria	587
457	Ga0207704_11842255	3300025938	Bacteria	520
458	Ga0207665_10085996	3300025939	Bacteria	2171
459	Ga0207665_10396643	3300025939	Bacteria	1050
460	Ga0207691_10071549	3300025940	Bacteria	3129
461	Ga0207691_10241584	3300025940	Bacteria	1561
462	Ga0207691_10460511	3300025940	Bacteria	1082
463	Ga0207711_10144371	3300025941	Bacteria	2143
464	Ga0207711_10757877	3300025941	Bacteria	905
465	Ga0207711_10984661	3300025941	Bacteria	782
466	Ga0207711_11196291	3300025941	Bacteria	702
467	Ga0207711_11215725	3300025941	Bacteria	695
468	Ga0207689_10022943	3300025942	Bacteria	5242
469	Ga0207689_10133195	3300025942	Bacteria	2046
470	Ga0207689_10475336	3300025942	Bacteria	1046
471	Ga0207661_10041316	3300025944	Bacteria	3630
472	Ga0207679_10128808	3300025945	Bacteria	2027
473	Ga0207679_10236463	3300025945	Bacteria	1545
474	Ga0207679_10733887	3300025945	Bacteria	898
475	Ga0207679_10821973	3300025945	Bacteria	848
476	Ga0207667_10412937	3300025949	Bacteria	1374
477	Ga0207667_10483324	3300025949	Bacteria	1257
478	Ga0207667_11261217	3300025949	Bacteria	717
479	Ga0207651_11558566	3300025960	Bacteria	595
480	Ga0207712_10719451	3300025961	Bacteria	873
481	Ga0207668_10148920	3300025972	Bacteria	1809
482	Ga0207668_10700264	3300025972	Bacteria	890
483	Ga0207640_10153256	3300025981	Bacteria	1696
484	Ga0207640_10376774	3300025981	Bacteria	1149
485	Ga0207658_10346286	3300025986	Bacteria	1293
486	Ga0207658_10461212	3300025986	Bacteria	1126
487	Ga0207658_10770796	3300025986	Bacteria	872
488	Ga0207658_11290342	3300025986	Bacteria	668
489	Ga0207677_10035278	3300026023	Bacteria	3247
490	Ga0207677_10281135	3300026023	Bacteria	1366
491	Ga0207677_10365177	3300026023	Bacteria	1214
492	Ga0207703_10106660	3300026035	Bacteria	2383
493	Ga0207703_10500089	3300026035	Bacteria	1141
494	Ga0207639_10251736	3300026041	Bacteria	1541
495	Ga0207639_10259075	3300026041	Bacteria	1520
496	Ga0207639_10274784	3300026041	Bacteria	1479
497	Ga0207639_10313444	3300026041	Bacteria	1391
498	Ga0207639_10592335	3300026041	Bacteria	1022
499	Ga0207639_10991743	3300026041	Bacteria	787
500	Ga0207639_11328415	3300026041	Bacteria	675
501	Ga0207678_10018636	3300026067	Bacteria	6093
502	Ga0207678_10020185	3300026067	Bacteria	5850
503	Ga0207678_10142597	3300026067	Bacteria	2045
504	Ga0207678_10212911	3300026067	Bacteria	1653
505	Ga0207678_10269047	3300026067	Bacteria	1461
506	Ga0207708_10847955	3300026075	Bacteria	789
507	Ga0207702_10058449	3300026078	Bacteria	3282
508	Ga0207702_10344388	3300026078	Bacteria	1424
509	Ga0207702_12155622	3300026078	Bacteria	546
510	Ga0207641_10447747	3300026088	Bacteria	1247
511	Ga0207641_10570058	3300026088	Bacteria	1106
512	Ga0207641_10648249	3300026088	Bacteria	1037
513	Ga0207641_10771139	3300026088	Bacteria	950
514	Ga0207641_10860860	3300026088	Bacteria	899
515	Ga0207641_11038300	3300026088	Bacteria	817
516	Ga0207648_11357206	3300026089	Bacteria	668
517	Ga0207676_10093444	3300026095	Bacteria	2476
518	Ga0207676_11586538	3300026095	Bacteria	652
519	Ga0207674_10056686	3300026116	Bacteria	3977
520	Ga0207674_11572834	3300026116	Bacteria	626
521	Ga0207675_100037771	3300026118	Bacteria	4505
522	Ga0207675_101034997	3300026118	Bacteria	840
523	Ga0207683_10014763	3300026121	Bacteria	6649
524	Ga0207683_10074094	3300026121	Bacteria	3012
525	Ga0207683_10105864	3300026121	Bacteria	2514
526	Ga0207683_10150996	3300026121	Bacteria	2096
527	Ga0207683_10503259	3300026121	Bacteria	1119
528	Ga0207698_10174202	3300026142	Bacteria	1898
529	Ga0207698_10226645	3300026142	Bacteria	1693
530	Ga0207698_10456304	3300026142	Bacteria	1235
531	Ga0207698_11128448	3300026142	Bacteria	797
532	Ga0207698_11637854	3300026142	Bacteria	659
533	Ga0209389_1000029	3300027296	Bacteria	140337
534	Ga0209589_1000012	3300027357	Bacteria	229451
535	Ga0209589_1000013	3300027357	Bacteria	229273
536	Ga0209489_100013	3300027361	Bacteria	229831
537	Ga0209588_1134544	3300027671	Bacteria	787
538	Ga0209813_10136549	3300027866	Bacteria	867
539	Ga0207428_10214669	3300027907	Bacteria	1444
540	Ga0268266_10001689	3300028379	Bacteria	25367
541	Ga0268266_10049213	3300028379	Bacteria	3614
542	Ga0268266_10325509	3300028379	Bacteria	1439
543	Ga0268266_10829874	3300028379	Bacteria	893
544	Ga0268266_10972830	3300028379	Bacteria	821
545	Ga0268266_11026346	3300028379	Bacteria	798
546	Ga0268266_11255106	3300028379	Bacteria	716
547	Ga0268266_11688696	3300028379	Bacteria	608
548	Ga0268264_10053334	3300028381	Bacteria	3373
549	Ga0268264_10245389	3300028381	Bacteria	1661
550	Ga0307517_10000766	3300028786	Bacteria	55210
551	Ga0307517_10399555	3300028786	Bacteria	728
552	Ga0307517_10538929	3300028786	Bacteria	586
553	Ga0307515_10015099	3300028794	Bacteria	14254
554	Ga0307515_10187396	3300028794	Bacteria	1993
555	Ga0307515_10257456	3300028794	Bacteria	1487
556	Ga0307513_10610092	3300031456	Bacteria	800
557	Ga0307408_100260122	3300031548	Bacteria	1436
558	Ga0307408_101357047	3300031548	Bacteria	668
559	Ga0307508_10011103	3300031616	Bacteria	8236
560	Ga0307508_10143377	3300031616	Bacteria	1992
561	Ga0307508_10277340	3300031616	Bacteria	1270
562	Ga0316579_10167088	3300031691	Bacteria	1063
563	Ga0316576_10658508	3300031727	Unclassified	761
564	Ga0316578_10017660	3300031728	Bacteria	3888
565	Ga0307516_10287161	3300031730	Bacteria	1325
566	Ga0307516_10360375	3300031730	Bacteria	1118
567	Ga0307405_11253843	3300031731	Bacteria	643
568	Ga0307413_10345325	3300031824	Bacteria	1146
569	Ga0307412_10039435	3300031911	Bacteria	3049
570	Ga0307412_10380251	3300031911	Bacteria	1143
571	Ga0307412_11365880	3300031911	Bacteria	640
572	Ga0307412_11672015	3300031911	Bacteria	583
573	Ga0307416_100706666	3300032002	Bacteria	1098
574	Ga0307416_102561928	3300032002	Bacteria	608
575	Ga0307414_10351525	3300032004	Bacteria	1265
576	Ga0307411_10634843	3300032005	Bacteria	923
577	Ga0307411_11883438	3300032005	Bacteria	556
578	Ga0307415_100968648	3300032126	Bacteria	789
579	Ga0316583_10028879	3300032133	Bacteria	1978
580	Ga0316585_10027397	3300032137	Bacteria	1778
581	Ga0307510_10062487	3300033180	Bacteria	3805
582	Ga0307510_10197798	3300033180	Bacteria	1549
583	Ga0307510_10594249	3300033180	Bacteria	558
584	Ga0373932_0014478	3300035112	Bacteria	1984
585	Ga0373941_0398083	3300035115	Bacteria	569
586	Ga0373945_0344439	3300035116	Bacteria	645
587	Ga0373956_0056582	3300035119	Bacteria	1771
588	Ga0373943_0077107	3300035170	Bacteria	1701
589	Ga0373946_0113867	3300035171	Bacteria	1227
590	Ga0316574_0004898	3300035398	Bacteria	7091
591	Ga0373931_0108009	3300035691	Bacteria	1574
592	Ga0373931_0247654	3300035691	Bacteria	1082
593	Ga0373931_0339225	3300035691	Bacteria	938
594	Ga0373931_0523087	3300035691	Bacteria	768
595	Ga0373931_0876656	3300035691	Bacteria	602
596	Ga0373935_0153560	3300035692	Bacteria	1564
597	Ga0373935_0550593	3300035692	Bacteria	841
598	Ga0373927_0057267	3300035695	Bacteria	2520
599	Ga0373927_0148266	3300035695	Bacteria	1536
600	Ga0373933_0157749	3300035724	Bacteria	1440
601	Ga0373947_0047357	3300035725	Bacteria	2576
602	Ga0372808_009417	3300036459	Bacteria	1365
603	Ga0316582_0042903	3300036647	Bacteria	2836
604	Ga0316584_0002434	3300036712	Bacteria	11775
605	Ga0373925_0067683	3300037068	Bacteria	2694
606	Ga0373925_0722242	3300037068	Bacteria	821
607	Ga0395899_0116835	3300037312	Bacteria	1914
608	Ga0395900_0026692	3300037418	Bacteria	5912
609	Ga0395900_0422393	3300037418	Bacteria	1294
610	Ga0395905_0002607	3300037471	Bacteria	19855
611	Ga0395901_0103536	3300038443	Bacteria	2986
612	Ga0395901_0104412	3300038443	Bacteria	2974
613	Ga0395901_0260447	3300038443	Bacteria	1805
614	Ga0395901_1454837	3300038443	Bacteria	642
615	Ga0436365_0009345	3300039437	Bacteria	1277
616	Ga0436365_0696068	3300039437	Bacteria	2266
617	Ga0436365_1649999	3300039437	Bacteria	974
618	Ga0436360_0176982	3300039438	Bacteria	1021
619	Ga0436360_1351962	3300039438	Bacteria	921
620	Ga0436361_0710311	3300039447	Bacteria	860
621	Ga0439465_0081475	3300041413	Bacteria	1098
622	Ga0451789_0022620	3300041443	Bacteria	645
623	Ga0451789_0077145	3300041443	Bacteria	812
624	Ga0451793_1274753	3300041452	Bacteria	835
625	Ga0451797_1136496	3300041453	Bacteria	521
626	Ga0451800_0786426	3300041459	Bacteria	601
627	Ga0451833_0649754	3300041491	Bacteria	521
628	Ga0451853_0959802	3300041512	Bacteria	1508
629	Ga0451853_1950833	3300041512	Bacteria	503
630	Ga0439459_0012940	3300042438	Bacteria	1494
631	Ga0466969_0023436	3300044656	Bacteria	3182
632	Ga0466972_0000048	3300044658	Bacteria	119165
633	Ga0466972_0010654	3300044658	Bacteria	4613
634	Ga0466972_0326184	3300044658	Bacteria	718
635	Ga0466965_0273032	3300044683	Bacteria	911
636	Ga0466965_0472223	3300044683	Bacteria	701
637	Ga0466966_0000238	3300044684	Bacteria	36401
638	Ga0466961_0000044	3300044693	Bacteria	76071
639	Ga0466961_0127007	3300044693	Bacteria	1599
640	Ga0466961_0691331	3300044693	Bacteria	611
641	Ga0466963_0091744	3300044694	Bacteria	2069
642	Ga0466963_0306300	3300044694	Bacteria	1117
643	Ga0466964_0554666	3300044706	Bacteria	624
644	Ga0466971_0094701	3300044719	Bacteria	1369
645	Ga0466968_0004386	3300044735	Bacteria	5269
646	Ga0466968_0368275	3300044735	Bacteria	700
647	Ga0466970_0337411	3300044765	Bacteria	854
648	Ga0466957_0033689	3300044842	Bacteria	3074
649	Ga0466957_0488587	3300044842	Bacteria	852
650	Ga0466960_0043829	3300044901	Bacteria	2130
651	Ga0466960_0068756	3300044901	Bacteria	1758
652	Ga0466960_0607387	3300044901	Bacteria	650
653	Ga0466959_0000963	3300045049	Bacteria	17121
654	Ga0466959_0014545	3300045049	Bacteria	5724
655	Ga0466967_0029200	3300045976	Bacteria	4613
656	Ga0466967_0328054	3300045976	Bacteria	1477
657	Ga0466967_0436532	3300045976	Bacteria	1278
658	Ga0495592_0062171	3300046454	Bacteria	2742
659	Ga0495592_0145202	3300046454	Bacteria	1646
660	Ga0495603_0010858	3300046455	Bacteria	5525
661	Ga0495603_0030986	3300046455	Bacteria	3220
662	Ga0495603_0260992	3300046455	Bacteria	997
663	Ga0495590_0094731	3300046457	Bacteria	1058
664	Ga0495629_0001706	3300046459	Bacteria	17249
665	Ga0495629_0290806	3300046459	Bacteria	1120
666	Ga0495638_0040121	3300046460	Bacteria	2967
667	Ga0495641_0286419	3300046461	Bacteria	742
668	Ga0495651_0001544	3300046462	Bacteria	17788
669	Ga0495651_0025096	3300046462	Bacteria	4638
670	Ga0495651_0082115	3300046462	Bacteria	2432
671	Ga0495651_0101207	3300046462	Bacteria	2145
672	Ga0495653_0032374	3300046463	Bacteria	4152
673	Ga0495653_0151366	3300046463	Bacteria	1620
674	Ga0495605_0142857	3300046474	Bacteria	1073
675	Ga0495639_0136070	3300046475	Bacteria	1179
676	Ga0495662_0620193	3300046476	Bacteria	529
677	Ga0495664_0160941	3300046477	Bacteria	1362
678	Ga0495584_0229000	3300046491	Bacteria	945
679	Ga0495584_0270156	3300046491	Bacteria	864
680	Ga0495584_0270764	3300046491	Bacteria	863
681	Ga0495585_0160887	3300046492	Bacteria	1165
682	Ga0495594_0380267	3300046499	Bacteria	804
683	Ga0495594_0394781	3300046499	Bacteria	787
684	Ga0495596_0117806	3300046500	Bacteria	1031
685	Ga0495596_0184570	3300046500	Bacteria	811
686	Ga0495607_0015021	3300046501	Bacteria	5030
687	Ga0495607_0182808	3300046501	Bacteria	1050
688	Ga0495583_0047523	3300046506	Bacteria	1973
689	Ga0495583_0151468	3300046506	Bacteria	961
690	Ga0495583_0353751	3300046506	Bacteria	579
691	Ga0495606_0000265	3300046507	Bacteria	92526
692	Ga0495606_0024523	3300046507	Bacteria	4343
693	Ga0495606_0083776	3300046507	Bacteria	1976
694	Ga0495606_0207764	3300046507	Bacteria	1111
695	Ga0495606_0258300	3300046507	Bacteria	963
696	Ga0495606_0376913	3300046507	Bacteria	745
697	Ga0495606_0442864	3300046507	Bacteria	667
698	Ga0495606_0524323	3300046507	Bacteria	594
699	Ga0495606_0540475	3300046507	Bacteria	582
700	Ga0495608_0051185	3300046511	Bacteria	2738
701	Ga0495610_0044299	3300046512	Bacteria	2209
702	Ga0495616_0035279	3300046513	Bacteria	2590
703	Ga0495616_0052289	3300046513	Bacteria	2034
704	Ga0495616_0426631	3300046513	Bacteria	541
705	Ga0495616_0439047	3300046513	Bacteria	530
706	Ga0495618_0053997	3300046514	Bacteria	2541
707	Ga0495618_0269236	3300046514	Bacteria	1065
708	Ga0495620_0034205	3300046515	Bacteria	2299
709	Ga0495620_0337826	3300046515	Bacteria	571
710	Ga0495620_0349856	3300046515	Bacteria	560
711	Ga0495628_0568136	3300046516	Bacteria	813
712	Ga0495630_0120640	3300046517	Bacteria	1989
713	Ga0495631_0049709	3300046518	Bacteria	1835
714	Ga0495631_0313164	3300046518	Bacteria	668
715	Ga0495632_0021540	3300046519	Bacteria	3472
716	Ga0495637_0052184	3300046520	Bacteria	1708
717	Ga0495637_0295169	3300046520	Bacteria	576
718	Ga0495643_0073732	3300046522	Bacteria	1788
719	Ga0495643_0106527	3300046522	Bacteria	1430
720	Ga0495643_0218390	3300046522	Bacteria	906
721	Ga0495644_0082636	3300046523	Bacteria	1211
722	Ga0495648_0000271	3300046524	Bacteria	58164
723	Ga0495648_0094741	3300046524	Bacteria	1662
724	Ga0495666_0227162	3300046526	Bacteria	854
725	Ga0495666_0230369	3300046526	Bacteria	847
726	Ga0495642_0278658	3300046528	Bacteria	732
727	Ga0495652_0017477	3300046529	Bacteria	6399
728	Ga0495652_0977696	3300046529	Bacteria	555
729	Ga0495654_0039417	3300046530	Bacteria	2358
730	Ga0495654_0142502	3300046530	Bacteria	1067
731	Ga0495665_0216353	3300046531	Bacteria	991
732	Ga0495665_0618776	3300046531	Bacteria	540
733	Ga0495640_0013425	3300046533	Bacteria	6223
734	Ga0495587_0011668	3300046536	Bacteria	5562
735	Ga0495587_0209178	3300046536	Bacteria	1102
736	Ga0495609_0222188	3300046538	Bacteria	784
737	Ga0495597_0074831	3300046542	Bacteria	1454
738	Ga0495597_0123892	3300046542	Bacteria	1076
739	Ga0495645_0613562	3300046543	Bacteria	668
740	Ga0495622_0019048	3300046557	Bacteria	3197
741	Ga0495622_0029421	3300046557	Bacteria	2566
742	Ga0495622_0066421	3300046557	Bacteria	1667
743	Ga0495622_0081069	3300046557	Bacteria	1493
744	Ga0495667_0061802	3300046559	Bacteria	2455
745	Ga0495667_0832082	3300046559	Bacteria	568
746	Ga0495656_0123726	3300046615	Bacteria	1224
747	Ga0495668_0088178	3300046616	Bacteria	1701
748	Ga0495668_0105952	3300046616	Bacteria	1538
749	Ga0495668_0114351	3300046616	Bacteria	1476
750	Ga0495668_0229702	3300046616	Bacteria	1016
751	Ga0495668_0231650	3300046616	Bacteria	1011
752	Ga0495634_0026354	3300046642	Bacteria	4058
753	Ga0495611_0142259	3300046648	Bacteria	1120
754	Ga0495625_0040142	3300046660	Bacteria	3416
755	Ga0495625_0077037	3300046660	Bacteria	2330
756	Ga0495625_0087934	3300046660	Bacteria	2153
757	Ga0495625_0361808	3300046660	Bacteria	914
758	Ga0495625_0410102	3300046660	Bacteria	845
759	Ga0495625_0748953	3300046660	Bacteria	573
760	Ga0495625_0916328	3300046660	Bacteria	501
761	Ga0495635_0005005	3300046663	Bacteria	9223
762	Ga0495635_0047785	3300046663	Bacteria	2950
763	Ga0495635_0087734	3300046663	Bacteria	2129
764	Ga0495661_0009639	3300046665	Bacteria	6617
765	Ga0495661_0105817	3300046665	Bacteria	1575
766	Ga0495661_0346756	3300046665	Bacteria	732
767	Ga0495588_0021656	3300046674	Bacteria	3170
768	Ga0495588_0072735	3300046674	Bacteria	1789
769	Ga0495588_0282369	3300046674	Bacteria	875
770	Ga0495588_0429069	3300046674	Bacteria	694
771	Ga0495588_0602579	3300046674	Bacteria	575
772	Ga0495657_0011193	3300046675	Bacteria	6720
773	Ga0495657_0390485	3300046675	Bacteria	820
774	Ga0495623_0696319	3300046679	Bacteria	521
775	Ga0495646_0026171	3300046680	Bacteria	3665
776	Ga0495646_0086143	3300046680	Bacteria	1822
777	Ga0495646_0200774	3300046680	Bacteria	1086
778	Ga0495647_0412386	3300046681	Bacteria	621
779	Ga0495658_0936822	3300046683	Bacteria	553
780	Ga0495669_0543966	3300046684	Bacteria	565
781	Ga0495613_0184208	3300046689	Bacteria	1478
782	Ga0495613_0243674	3300046689	Bacteria	1256
783	Ga0495624_0221022	3300046690	Bacteria	1148
784	Ga0495624_0416058	3300046690	Bacteria	806
785	Ga0495670_0027112	3300046691	Bacteria	2836
786	Ga0495670_0190727	3300046691	Bacteria	1084
787	Ga0495671_0040770	3300046692	Bacteria	2340
788	Ga0495671_0274871	3300046692	Bacteria	812
789	Ga0495649_0119298	3300046694	Bacteria	1395
790	Ga0495649_0408257	3300046694	Bacteria	681
791	Ga0495649_0440662	3300046694	Bacteria	651
792	Ga0495600_0005160	3300046809	Bacteria	7853
793	Ga0495660_0477791	3300046810	Bacteria	535
794	Ga0495581_0682240	3300047315	Bacteria	593
795	Ga0495604_0005037	3300047317	Bacteria	10460
796	Ga0495604_0033791	3300047317	Bacteria	4047
797	Ga0495604_0357018	3300047317	Bacteria	970
798	Ga0495636_0378447	3300047318	Bacteria	672
799	Ga0495674_0341851	3300047319	Bacteria	1216
800	Ga0495674_0770515	3300047319	Bacteria	750
801	Ga0495672_0006198	3300047320	Bacteria	9324
802	Ga0495672_0030505	3300047320	Bacteria	3380
803	Ga0495676_0020537	3300047321	Bacteria	5792
804	Ga0495676_0157123	3300047321	Bacteria	1612
805	Ga0495680_0004426	3300047322	Bacteria	13424
806	Ga0495680_0415211	3300047322	Bacteria	927
807	Ga0495687_152767	3300047443	Bacteria	787
808	Ga0495677_0296469	3300047445	Bacteria	636
809	Ga0495673_0104582	3300047469	Bacteria	1140
810	Ga0495673_0129864	3300047469	Bacteria	991
811	Ga0495673_0209716	3300047469	Bacteria	725
812	Ga0495684_0979293	3300047471	Bacteria	539
813	Ga0495686_0078441	3300047472	Bacteria	2021
814	Ga0495686_0204141	3300047472	Bacteria	1132
815	Ga0495686_0362517	3300047472	Bacteria	785
816	Ga0495593_0121948	3300047673	Bacteria	1326
817	Ga0495602_0053428	3300048088	Bacteria	3578
818	Ga0495602_0596190	3300048088	Bacteria	760
819	Ga0495614_0189049	3300048089	Bacteria	929
820	Ga0495614_0274502	3300048089	Bacteria	775
821	Ga0495614_0621489	3300048089	Bacteria	520
822	Ga0495615_0044274	3300048090	Bacteria	1123
823	Ga0495626_0040243	3300048091	Bacteria	2209
824	Ga0495626_0240717	3300048091	Bacteria	729
825	Ga0496100_0014294	3300048903	Bacteria	4606
826	Ga0496100_0150948	3300048903	Bacteria	1657
827	Ga0496100_0171021	3300048903	Bacteria	1565
828	Ga0496100_0390376	3300048903	Bacteria	1058
829	Ga0496100_0393404	3300048903	Bacteria	1054
830	Ga0496101_0020764	3300048904	Bacteria	4504
831	Ga0496101_0080313	3300048904	Bacteria	2409
832	Ga0496101_0153230	3300048904	Bacteria	1764
833	Ga0496101_0331603	3300048904	Bacteria	1194
834	Ga0496101_0408908	3300048904	Bacteria	1069
835	Ga0496101_0658394	3300048904	Bacteria	827
836	Ga0496101_0969643	3300048904	Bacteria	669
837	Ga0496102_0005804	3300048905	Bacteria	10496
838	Ga0496102_0026579	3300048905	Bacteria	5165
839	Ga0496102_0055189	3300048905	Bacteria	3623
840	Ga0496102_0066766	3300048905	Bacteria	3297
841	Ga0496102_0104917	3300048905	Bacteria	2629
842	Ga0496102_0428736	3300048905	Bacteria	1242
843	Ga0496102_0607129	3300048905	Bacteria	1017
844	Ga0496102_1437018	3300048905	Bacteria	609
845	Ga0496103_0017638	3300048906	Bacteria	4273
846	Ga0496103_0023140	3300048906	Bacteria	3746
847	Ga0496103_0639611	3300048906	Bacteria	676
848	Ga0496103_0678191	3300048906	Bacteria	654
849	Ga0496103_0824199	3300048906	Bacteria	584
850	Ga0496104_0005123	3300048907	Bacteria	11439
851	Ga0496104_0023685	3300048907	Bacteria	5646
852	Ga0496104_0121874	3300048907	Bacteria	2504
853	Ga0496104_0210024	3300048907	Bacteria	1858
854	Ga0496104_0321731	3300048907	Bacteria	1459
855	Ga0496104_0779498	3300048907	Bacteria	863
856	Ga0496105_0032125	3300048908	Bacteria	4306
857	Ga0496105_0064838	3300048908	Bacteria	3014
858	Ga0496105_0072514	3300048908	Bacteria	2845
859	Ga0496105_0204988	3300048908	Bacteria	1609
860	Ga0496105_0222744	3300048908	Bacteria	1535
861	Ga0496105_0259275	3300048908	Bacteria	1406
862	Ga0496105_0400525	3300048908	Bacteria	1089
863	Ga0496105_0585216	3300048908	Bacteria	868
864	Ga0496105_1017271	3300048908	Bacteria	619
865	Ga0496106_0127411	3300048909	Bacteria	1994
866	Ga0496106_0143521	3300048909	Bacteria	1879
867	Ga0496106_0560628	3300048909	Bacteria	916
868	Ga0496106_0670917	3300048909	Bacteria	827
869	Ga0496106_0817914	3300048909	Bacteria	738
870	Ga0496107_0016390	3300048910	Bacteria	5202
871	Ga0496107_0087075	3300048910	Bacteria	2281
872	Ga0496107_0110453	3300048910	Bacteria	2020
873	Ga0496107_0436740	3300048910	Bacteria	973
874	Ga0496107_0638539	3300048910	Bacteria	785
875	Ga0496107_0832720	3300048910	Bacteria	675
876	Ga0496107_0834368	3300048910	Bacteria	674
877	Ga0496107_1065541	3300048910	Bacteria	585
878	Ga0496108_0036917	3300048911	Bacteria	4067
879	Ga0496108_0079765	3300048911	Bacteria	2771
880	Ga0496108_0226771	3300048911	Bacteria	1624
881	Ga0496108_0458606	3300048911	Bacteria	1113
882	Ga0496108_0538609	3300048911	Bacteria	1019
883	Ga0496108_0807052	3300048911	Bacteria	809
884	Ga0496109_0003393	3300048912	Bacteria	13328
885	Ga0496109_0016364	3300048912	Bacteria	6482
886	Ga0496109_0044712	3300048912	Bacteria	4018
887	Ga0496109_0538528	3300048912	Bacteria	1101
888	Ga0496109_0708526	3300048912	Bacteria	944
889	Ga0496110_0054498	3300048913	Bacteria	3517
890	Ga0496110_0075072	3300048913	Bacteria	3003
891	Ga0496110_0164716	3300048913	Bacteria	2010
892	Ga0496110_0312819	3300048913	Bacteria	1430
893	Ga0496110_0347168	3300048913	Bacteria	1352
894	Ga0496110_0419037	3300048913	Bacteria	1221
895	Ga0496110_0447636	3300048913	Bacteria	1177
896	Ga0496110_0825454	3300048913	Bacteria	832
897	Ga0496110_1203953	3300048913	Bacteria	666
898	Ga0496110_1911559	3300048913	Bacteria	503
899	Ga0496111_0025067	3300048914	Bacteria	4206
900	Ga0496111_0045889	3300048914	Bacteria	3145
901	Ga0496111_0110551	3300048914	Bacteria	2024
902	Ga0496111_0157208	3300048914	Bacteria	1687
903	Ga0496111_0207114	3300048914	Bacteria	1457
904	Ga0496111_0697490	3300048914	Bacteria	739
905	Ga0496112_0000019	3300048915	Bacteria	185531
906	Ga0496112_0007111	3300048915	Bacteria	9898
907	Ga0496112_0085267	3300048915	Bacteria	3125
908	Ga0496112_0132000	3300048915	Bacteria	2468
909	Ga0496112_0483814	3300048915	Bacteria	1174
910	Ga0496112_0495490	3300048915	Bacteria	1157
911	Ga0496112_0528401	3300048915	Bacteria	1114
912	Ga0496113_0053179	3300048916	Bacteria	3027
913	Ga0496113_0084008	3300048916	Bacteria	2444
914	Ga0496113_0099452	3300048916	Bacteria	2253
915	Ga0496113_0137241	3300048916	Bacteria	1922
916	Ga0496113_0284519	3300048916	Bacteria	1322
917	Ga0496113_0874105	3300048916	Bacteria	712
918	Ga0496114_0016833	3300048917	Bacteria	5896
919	Ga0496114_0068352	3300048917	Bacteria	2982
920	Ga0496114_0202380	3300048917	Bacteria	1739
921	Ga0496114_0524981	3300048917	Bacteria	1047
922	Ga0496114_0991273	3300048917	Bacteria	723
923	Ga0496114_1148301	3300048917	Bacteria	662
924	Ga0496114_1195440	3300048917	Bacteria	646
925	Ga0496115_0001776	3300048918	Bacteria	15451
926	Ga0496115_0073507	3300048918	Bacteria	2775
927	Ga0496115_0078574	3300048918	Bacteria	2684
928	Ga0496115_0083251	3300048918	Bacteria	2608
929	Ga0496115_0117743	3300048918	Bacteria	2185
930	Ga0496115_0219550	3300048918	Bacteria	1569
931	Ga0496115_0548264	3300048918	Bacteria	924
932	Ga0496116_0002417	3300048919	Bacteria	19673
933	Ga0496116_0106778	3300048919	Bacteria	1656
934	Ga0496117_0018002	3300048920	Bacteria	5878
935	Ga0496117_0078336	3300048920	Bacteria	2182
936	Ga0496117_0112792	3300048920	Bacteria	1690
937	Ga0496117_0116375	3300048920	Bacteria	1652
938	Ga0496117_0195063	3300048920	Bacteria	1149
939	Ga0496117_0222397	3300048920	Bacteria	1050
940	Ga0496117_0233951	3300048920	Bacteria	1013
941	Ga0496118_0045553	3300048921	Bacteria	3422
942	Ga0496118_0085974	3300048921	Bacteria	2187
943	Ga0496118_0089356	3300048921	Bacteria	2127
944	Ga0496118_0096570	3300048921	Bacteria	2013
945	Ga0496118_0161291	3300048921	Bacteria	1386
946	Ga0496118_0180026	3300048921	Bacteria	1278
947	Ga0496118_0225650	3300048921	Bacteria	1086
948	Ga0496118_0307672	3300048921	Bacteria	867
949	Ga0496118_0507268	3300048921	Bacteria	598
950	Ga0496119_0008930	3300048922	Bacteria	8707
951	Ga0496119_0153169	3300048922	Bacteria	1233
952	Ga0496119_0167779	3300048922	Bacteria	1162
953	Ga0496119_0171782	3300048922	Bacteria	1144
954	Ga0496119_0221780	3300048922	Bacteria	967
955	Ga0496120_0009949	3300048923	Bacteria	6690
956	Ga0496120_0034261	3300048923	Bacteria	3044
957	Ga0496120_0145457	3300048923	Bacteria	1198
958	Ga0496120_0211638	3300048923	Bacteria	932
959	Ga0496121_0010594	3300048924	Bacteria	10360
960	Ga0496121_0012632	3300048924	Bacteria	9174
961	Ga0496121_0034308	3300048924	Bacteria	4569
962	Ga0496121_0040104	3300048924	Bacteria	4112
963	Ga0496121_0092016	3300048924	Bacteria	2365
964	Ga0496121_0094722	3300048924	Bacteria	2322
965	Ga0496121_0097846	3300048924	Bacteria	2272
966	Ga0496121_0108816	3300048924	Bacteria	2119
967	Ga0496121_0127379	3300048924	Bacteria	1912
968	Ga0496121_0158850	3300048924	Bacteria	1655
969	Ga0496121_0187009	3300048924	Bacteria	1489
970	Ga0496121_0194505	3300048924	Bacteria	1451
971	Ga0496121_0229930	3300048924	Bacteria	1299
972	Ga0496121_0248711	3300048924	Bacteria	1234
973	Ga0496121_0341332	3300048924	Bacteria	1001
974	Ga0496121_0356527	3300048924	Bacteria	972
975	Ga0496121_0464400	3300048924	Bacteria	812
976	Ga0496121_0570364	3300048924	Bacteria	704
977	Ga0496121_0579626	3300048924	Bacteria	696
978	Ga0496122_0038591	3300048925	Bacteria	3823
979	Ga0496122_0066741	3300048925	Bacteria	2596
980	Ga0496122_0088899	3300048925	Bacteria	2115
981	Ga0496123_0038299	3300048926	Bacteria	3372
982	Ga0496123_0054922	3300048926	Bacteria	2617
983	Ga0496123_0055591	3300048926	Bacteria	2595
984	Ga0496123_0115347	3300048926	Bacteria	1524
985	Ga0496124_0037061	3300048927	Bacteria	4245
986	Ga0496124_0117422	3300048927	Bacteria	2131
987	Ga0496124_0180321	3300048927	Bacteria	1626
988	Ga0496124_0248315	3300048927	Bacteria	1318
989	Ga0496124_0268079	3300048927	Bacteria	1252
990	Ga0496124_0321210	3300048927	Bacteria	1108
991	Ga0496125_0000048	3300048928	Bacteria	290651
992	Ga0496125_0003042	3300048928	Bacteria	20965
993	Ga0496125_0006677	3300048928	Bacteria	12417
994	Ga0496125_0020421	3300048928	Bacteria	6217
995	Ga0496125_0047989	3300048928	Bacteria	3565
996	Ga0496125_0175667	3300048928	Bacteria	1433
997	Ga0496125_0182044	3300048928	Bacteria	1399
998	Ga0496125_0344499	3300048928	Bacteria	893
999	Ga0496125_0453930	3300048928	Bacteria	733
1000	Ga0496126_0017022	3300048929	Bacteria	7253
1001	Ga0496126_0029441	3300048929	Bacteria	5217
1002	Ga0496126_0034784	3300048929	Bacteria	4727
1003	Ga0496126_0043359	3300048929	Bacteria	4150
1004	Ga0496126_0047232	3300048929	Bacteria	3942
1005	Ga0496126_0069413	3300048929	Bacteria	3143
1006	Ga0496126_0162689	3300048929	Bacteria	1906
1007	Ga0496126_0181593	3300048929	Bacteria	1787
1008	Ga0496126_0211829	3300048929	Bacteria	1631
1009	Ga0496126_0223591	3300048929	Bacteria	1580
1010	Ga0496126_0422648	3300048929	Bacteria	1077
1011	Ga0496126_0684102	3300048929	Bacteria	799
1012	Ga0501032_0081480	3300049569	Bacteria	2153
1013	Ga0501032_0588554	3300049569	Bacteria	708
1014	Ga0501033_0144289	3300049570	Bacteria	1720
1015	Ga0501034_0814607	3300049571	Bacteria	826
1016	Ga0501036_0081113	3300049572	Bacteria	2742
1017	Ga0501036_0457287	3300049572	Bacteria	1063
1018	Ga0501036_0829157	3300049572	Bacteria	761
1019	Ga0501037_0156424	3300049573	Bacteria	1627
1020	Ga0501037_0287897	3300049573	Bacteria	1143
1021	Ga0501038_0164546	3300049574	Bacteria	1800
1022	Ga0501038_0194316	3300049574	Bacteria	1631
1023	Ga0501039_0188371	3300049575	Bacteria	1623
1024	Ga0501039_0257474	3300049575	Bacteria	1372
1025	Ga0501039_1534360	3300049575	Bacteria	512
1026	Ga0501041_0405601	3300049577	Bacteria	864
1027	Ga0501041_0462577	3300049577	Bacteria	806
1028	Ga0501043_0046733	3300049579	Bacteria	3405
1029	Ga0501046_0381162	3300049580	Bacteria	1021
1030	Ga0501047_0097387	3300049581	Bacteria	2820
1031	Ga0501067_0085865	3300049583	Bacteria	1746
1032	Ga0501068_0253609	3300049584	Bacteria	1122
1033	Ga0501069_0080634	3300049585	Bacteria	1833
1034	Ga0501070_0228399	3300049586	Bacteria	1525
1035	Ga0501070_0444724	3300049586	Bacteria	1045
1036	Ga0501071_0187016	3300049587	Bacteria	1553
1037	Ga0501072_1363393	3300049588	Bacteria	549
1038	Ga0501073_0735050	3300049589	Bacteria	681
1039	Ga0501076_0060824	3300049592	Bacteria	3006
1040	Ga0501077_0963213	3300049593	Bacteria	549
1041	Ga0501080_0897183	3300049742	Bacteria	773
1042	Ga0501081_0457034	3300049743	Bacteria	949
1043	Ga0501083_0028328	3300049744	Bacteria	3861
1044	Ga0501044_0134829	3300049823	Bacteria	2461
1045	nmdc:mga03683_104307_c1	3300050489	Bacteria	1248
1046	nmdc:mga03683_255510_c1	3300050489	Bacteria	815
1047	nmdc:mga03n38_137077_c1	3300050490	Bacteria	1219
1048	nmdc:mga03n38_1883_c1	3300050490	Bacteria	6276
1049	nmdc:mga03n38_203028_c1	3300050490	Bacteria	1027
1050	nmdc:mga00v17_1000892_c1	3300050491	Bacteria	526
1051	nmdc:mga00v17_359133_c1	3300050491	Bacteria	947
1052	nmdc:mga00v17_708665_c1	3300050491	Bacteria	645
1053	nmdc:mga00v17_84923_c1	3300050491	Bacteria	1982
1054	nmdc:mga0yw44_18568_c2	3300050492	Bacteria	1540
1055	nmdc:mga0yw44_313931_c1	3300050492	Bacteria	1052
1056	nmdc:mga0yw44_337136_c1	3300050492	Bacteria	1014
1057	nmdc:mga0yw44_3382_c1	3300050492	Bacteria	7076
1058	nmdc:mga0yw44_362508_c1	3300050492	Bacteria	977
1059	nmdc:mga0yw44_375263_c1	3300050492	Bacteria	960
1060	nmdc:mga0yw44_466441_c1	3300050492	Bacteria	856
1061	nmdc:mga0yw44_529471_c1	3300050492	Bacteria	800
1062	nmdc:mga0yw44_683343_c1	3300050492	Bacteria	697
1063	nmdc:mga0yw44_701340_c1	3300050492	Bacteria	688
1064	nmdc:mga0yw44_745644_c1	3300050492	Bacteria	665
1065	nmdc:mga0yw44_9374_c1	3300050492	Bacteria	4944
1066	nmdc:mga0k408_156806_c1	3300050493	Bacteria	1356
1067	nmdc:mga0k408_164999_c1	3300050493	Bacteria	1320
1068	nmdc:mga0k408_223863_c1	3300050493	Bacteria	1123
1069	nmdc:mga06z11_22599_c1	3300050494	Bacteria	2940
1070	nmdc:mga06z11_249668_c1	3300050494	Bacteria	1044
1071	nmdc:mga06z11_25364_c1	3300050494	Bacteria	2809
1072	nmdc:mga06z11_309328_c1	3300050494	Bacteria	941
1073	nmdc:mga06z11_369844_c1	3300050494	Bacteria	860
1074	nmdc:mga04h51_159673_c1	3300050495	Bacteria	867
1075	nmdc:mga07m45_125838_c1	3300050496	Bacteria	1482
1076	nmdc:mga07m45_25542_c1	3300050496	Bacteria	2685
1077	nmdc:mga07m45_266476_c1	3300050496	Bacteria	996
1078	nmdc:mga07m45_38587_c1	3300050496	Bacteria	2665
1079	nmdc:mga07m45_49067_c1	3300050496	Bacteria	2375
1080	nmdc:mga07m45_793143_c1	3300050496	Bacteria	543
1081	nmdc:mga07m45_826783_c1	3300050496	Bacteria	530
1082	nmdc:mga05p37_87990_c1	3300050507	Bacteria	3829
1083	nmdc:mga09592_191516_c1	3300050508	Bacteria	1770
1084	nmdc:mga06r32_442363_c1	3300050510	Bacteria	1280
1085	nmdc:mga08y16_673317_c1	3300050511	Bacteria	1037
1086	nmdc:mga0n895_1045631_c1	3300050512	Bacteria	796
1087	nmdc:mga0n895_211832_c1	3300050512	Bacteria	1968
1088	nmdc:mga0rr50_1296553_c1	3300050513	Bacteria	618
1089	nmdc:mga0sz30_183523_c1	3300050516	Bacteria	929
1090	nmdc:mga0sz30_213354_c1	3300050516	Bacteria	858
1091	nmdc:mga0sz30_214572_c1	3300050516	Bacteria	855
1092	nmdc:mga0sz30_224289_c1	3300050516	Bacteria	836
1093	Ga0495612_0203509	3300053078	Bacteria	874
1094	Ga0500610_0347785	3300053079	Bacteria	629
1095	Ga0500635_0057292	3300053080	Bacteria	1350
1096	Ga0500635_0273514	3300053080	Bacteria	664
1097	Ga0495655_0025819	3300053083	Bacteria	1378
1098	Ga0495655_0092324	3300053083	Bacteria	884
1099	Ga0495655_0152959	3300053083	Bacteria	727
1100	Ga0495655_0228646	3300053083	Bacteria	618
1101	Ga0495655_0240234	3300053083	Bacteria	606
1102	Ga0495595_0005730	3300053084	Bacteria	5029
1103	Ga0495595_0069371	3300053084	Bacteria	1664
1104	Ga0495595_0209998	3300053084	Bacteria	970
1105	Ga0495595_0625209	3300053084	Bacteria	551
1106	Ga0495619_0010200	3300053085	Bacteria	5918
1107	Ga0495619_0051676	3300053085	Bacteria	2716
1108	Ga0495619_0192067	3300053085	Bacteria	1413
1109	Ga0495619_0251197	3300053085	Bacteria	1225
1110	Ga0495619_0624652	3300053085	Bacteria	736
1111	Ga0500578_0630483	3300053086	Bacteria	585
1112	Ga0500643_000091	3300053087	Bacteria	93825
1113	Ga0500644_0176203	3300053088	Bacteria	872
1114	Ga0500581_082960	3300053089	Bacteria	1597
1115	Ga0500646_0005304	3300053090	Bacteria	3260
1116	Ga0500646_0061494	3300053090	Bacteria	1106
1117	Ga0500647_0054230	3300053091	Bacteria	1929
1118	Ga0500583_0107679	3300053092	Bacteria	1370
1119	Ga0500583_0606931	3300053092	Bacteria	502
1120	Ga0500651_0034237	3300053093	Bacteria	3202
1121	Ga0500651_0049381	3300053093	Bacteria	2642
1122	Ga0500651_0140194	3300053093	Bacteria	1458
1123	Ga0500651_0447463	3300053093	Bacteria	719
1124	Ga0500566_0000199	3300053094	Bacteria	31473
1125	Ga0500566_0000762	3300053094	Bacteria	18172
1126	Ga0500566_0005554	3300053094	Bacteria	7494
1127	Ga0500566_0099732	3300053094	Bacteria	1594
1128	Ga0500640_179129	3300053095	Bacteria	770
1129	Ga0500641_0014432	3300053096	Bacteria	2916
1130	Ga0500641_0020604	3300053096	Bacteria	2504
1131	Ga0500641_0121609	3300053096	Bacteria	1125
1132	Ga0500641_0171676	3300053096	Bacteria	933
1133	Ga0500650_0020737	3300053098	Bacteria	2888
1134	Ga0500554_001286	3300053102	Bacteria	4865
1135	Ga0500554_018352	3300053102	Bacteria	1887
1136	Ga0500554_138381	3300053102	Bacteria	823
1137	Ga0500555_006418	3300053103	Bacteria	3340
1138	Ga0500555_142396	3300053103	Bacteria	590
1139	Ga0500556_0000091	3300053104	Bacteria	83564
1140	Ga0500556_0042714	3300053104	Bacteria	1605
1141	Ga0500562_051861	3300053108	Bacteria	1098
1142	Ga0500569_004982	3300053109	Bacteria	2827
1143	Ga0500569_155835	3300053109	Bacteria	772
1144	Ga0500572_032629	3300053111	Bacteria	1463
1145	Ga0500591_084627	3300053115	Bacteria	1401
1146	Ga0500592_011004	3300053116	Bacteria	1445
1147	Ga0500592_023516	3300053116	Bacteria	993
1148	Ga0500593_053885	3300053117	Bacteria	1781
1149	Ga0500595_001153	3300053119	Bacteria	14657
1150	Ga0500595_002247	3300053119	Bacteria	9783
1151	Ga0500595_004559	3300053119	Bacteria	6186
1152	Ga0500595_034375	3300053119	Bacteria	1677
1153	Ga0500595_101186	3300053119	Bacteria	825
1154	Ga0500608_016679	3300053122	Bacteria	3322
1155	Ga0500614_246152	3300053123	Bacteria	557
1156	Ga0500618_008566	3300053125	Bacteria	2846
1157	Ga0500621_177219	3300053126	Bacteria	776
1158	Ga0500626_185150	3300053128	Bacteria	835
1159	Ga0500642_0000046	3300053130	Bacteria	82391
1160	Ga0500642_0007209	3300053130	Bacteria	3721
1161	Ga0500642_0037039	3300053130	Bacteria	2082
1162	Ga0500652_000293	3300053131	Bacteria	18339
1163	Ga0500655_031174	3300053133	Bacteria	1028
1164	Ga0500559_0000803	3300053136	Bacteria	20545
1165	Ga0500559_0199032	3300053136	Bacteria	944
1166	Ga0500568_0000167	3300053139	Bacteria	56971
1167	Ga0500573_0471349	3300053140	Bacteria	575
1168	Ga0500577_0049530	3300053142	Bacteria	1571
1169	Ga0500577_0072648	3300053142	Bacteria	1352
1170	Ga0500577_0339062	3300053142	Bacteria	657
1171	Ga0500579_202606	3300053143	Bacteria	730
1172	Ga0500586_000631	3300053145	Bacteria	7153
1173	Ga0500589_212916	3300053147	Bacteria	733
1174	Ga0500590_025663	3300053148	Bacteria	3060
1175	Ga0500590_158740	3300053148	Bacteria	1010
1176	Ga0500590_184390	3300053148	Bacteria	902
1177	Ga0500603_008203	3300053150	Bacteria	2311
1178	Ga0500603_011450	3300053150	Bacteria	2018
1179	Ga0500603_116529	3300053150	Bacteria	806
1180	Ga0500604_0008033	3300053151	Bacteria	2799
1181	Ga0500616_0000059	3300053153	Bacteria	259741
1182	Ga0500616_0000283	3300053153	Bacteria	74456
1183	Ga0500619_247084	3300053154	Bacteria	588
1184	Ga0500620_059039	3300053155	Bacteria	1302
1185	Ga0500622_0007335	3300053156	Bacteria	6272
1186	Ga0500622_0035683	3300053156	Bacteria	2601
1187	Ga0500630_126790	3300053159	Bacteria	1121
1188	Ga0500633_0064368	3300053160	Bacteria	1296
1189	Ga0500634_0036085	3300053161	Bacteria	2692
1190	Ga0500634_0403673	3300053161	Bacteria	504
1191	Ga0500638_066936	3300053162	Bacteria	1721
1192	Ga0500638_166507	3300053162	Bacteria	964
1193	Ga0500639_002046	3300053163	Bacteria	10075
1194	Ga0500636_0010476	3300053177	Bacteria	5410
1195	Ga0500636_0020615	3300053177	Bacteria	3903
1196	Ga0500636_0037394	3300053177	Bacteria	2872
1197	Ga0500636_0156839	3300053177	Bacteria	1245
1198	Ga0500636_0185262	3300053177	Bacteria	1114
1199	Ga0500637_0001064	3300053178	Bacteria	11279
1200	Ga0500637_0001082	3300053178	Bacteria	11204
1201	Ga0500637_0051060	3300053178	Bacteria	2357
1202	Ga0500637_0430981	3300053178	Bacteria	675
1203	Ga0500570_140772	3300053724	Bacteria	888
1204	Ga0500611_020319	3300053727	Bacteria	1252
1205	Ga0500611_023996	3300053727	Bacteria	1193
1206	Ga0500645_006160	3300053730	Bacteria	4310
1207	Ga0500645_020325	3300053730	Bacteria	2059
1208	Ga0500645_023253	3300053730	Bacteria	1900
1209	Ga0500645_182715	3300053730	Bacteria	570
1210	Ga0500601_000421	3300053737	Bacteria	7093
1211	Ga0500601_015476	3300053737	Bacteria	867
1212	Ga0500661_001611	3300055283	Bacteria	4262
1213	Ga0587083_0252617	3300059505	Bacteria	526
1214	Ga0501082_0000379	3300060353	Bacteria	39466
1215	Ga0466962_0328975	3300061719	Bacteria	759
1216	Ga0530510_0801949	3300061734	Bacteria	718
1217	2511399018	2511231028	Bacteria	8046582
1218	2513626163	2513237092	Bacteria	8341956
1219	2513641880	2513237094	Bacteria	8789602
1220	2513647994	2513237095	Bacteria	8976980
1221	2513673012	2513237098	Bacteria	9902361
1222	2513706302	2513237102	Bacteria	7703324
1223	2513873944	2513237139	Bacteria	8737671
1224	2514012918	2513237161	Bacteria	8871253
1225	2517102420	2517093001	Bacteria	9002274
1226	2524435713	2524023205	Bacteria	8918781
1227	2528850368	2528768022	Bacteria	10457665
1228	2603861855	2602042107	Bacteria	6226103
1229	2617351670	2617270735	Bacteria	9163226
1230	2617374161	2617270741	Bacteria	8201522
1231	2728749242	2728368998	Bacteria	8720350
1232	2745079009	2744054633	Bacteria	8678936
1233	2793063131	2791355196	Bacteria	7323613
1234	2805919469	2802429603	Bacteria	8777136
1235	2818237247	2816332527	Bacteria	8933356
1236	2824602544	2824600985	Bacteria	8488197
1237	2824612676	2824609381	Bacteria	8672835
1238	2824624784	2824617872	Bacteria	8814715
1239	2824633656	2824626560	Bacteria	8813858
1240	2824641526	2824635225	Bacteria	8785348
1241	2824652627	2824644064	Bacteria	8743947
1242	2824654490	2824653114	Bacteria	8493680
1243	2824663632	2824661429	Bacteria	9877870
1244	2824674885	2824671348	Bacteria	8369588
1245	2824685484	2824679649	Bacteria	8248951
1246	2824691953	2824687955	Bacteria	8360029
1247	2824700443	2824696289	Bacteria	8335049
1248	2824708478	2824704595	Bacteria	9667483
1249	2824723168	2824714736	Bacteria	8717648
1250	2824732530	2824723954	Bacteria	8758240
1251	2824734837	2824732956	Bacteria	7810675
1252	2824748157	2824746037	Bacteria	7911610
1253	2824757146	2824753945	Bacteria	9787441
1254	2824772085	2824763712	Bacteria	9792355
1255	2824774974	2824773399	Bacteria	8360218
1256	2838129526	2838122688	Bacteria	8803140
1257	2841944427	2841941048	Bacteria	8688029
1258	2841951568	2841949485	Bacteria	8680857
1259	2841964645	2841957949	Bacteria	8652217
1260	2841969204	2841966195	Bacteria	8673214
1261	2841982869	2841974524	Bacteria	8931498
1262	2841991049	2841983080	Bacteria	8395090
1263	2842043914	2842038055	Bacteria	8002051
1264	2842052096	2842045827	Bacteria	8006841
1265	2844321792	2844315083	Bacteria	8138177
1266	2847941722	2847939898	Bacteria	8606328
1267	2849082640	2849076700	Bacteria	7039503
1268	2857511537	2857509624	Bacteria	7472071
1269	2857526025	2857524615	Bacteria	6615449
1270	2874610323	2874604998	Bacteria	7834745
1271	2874636675	2874628541	Bacteria	8630250
1272	2876765010	2876761206	Bacteria	10111113
1273	2876812800	2876808645	Bacteria	8824342
1274	2879101278	2879099564	Bacteria	10442239
1275	2879111643	2879110137	Bacteria	8907982
1276	2881369843	2881364244	Bacteria	7710352
1277	2881672913	2881665667	Bacteria	8175609
1278	2885371427	2885366525	Bacteria	8326213
1279	2885410827	2885409591	Bacteria	9235467
1280	2888379999	2888378607	Bacteria	9652610
1281	2888391075	2888388044	Bacteria	7304136
1282	2888420803	2888419890	Bacteria	7857137
1283	2889035035	2889033259	Bacteria	9099371
1284	2893067702	2893066018	Bacteria	6158120
1285	2903727658	2903727486	Bacteria	8281579
1286	2904716151	2904711408	Bacteria	9771557
1287	2906602852	2906602504	Bacteria	8295279
1288	2906651690	2906643746	Bacteria	8722424
1289	2908776636	2908775508	Bacteria	8092255
1290	2919074124	2919073203	Bacteria	6531949
1291	2922366922	2922361189	Bacteria	7436256
1292	2922378382
1293	2922388578	2922386360	Bacteria	7017218
1294	2922400334	2922393267	Bacteria	8285685
1295	2922433514
1296	2929622519	2929615660	Bacteria	9193770
1297	2929631263	2929624759	Bacteria	9339455
1298	2932786315	2932784394	Bacteria	9704911
1299	2932812610	2932809354	Bacteria	9135765
1300	2932822972	2932818245	Bacteria	9955613
1301	2932829553	2932828146	Bacteria	9745859
1302	2933584402	2933577622	Bacteria	9116884
1303	2935618071	2935616580	Bacteria	9032984
1304	2935641531	2935638405	Bacteria	10015038
1305	2935669411	2935665750	Bacteria	9571747
1306	2935677991	2935675223	Bacteria	9928132
1307	2935693688	2935684952	Bacteria	9590419
1308	2935701770	2935694250	Bacteria	9291695
1309	2935707235	2935703347	Bacteria	10242284
1310	2935717077	2935713505	Bacteria	9608509
1311	2935730089	2935722832	Bacteria	9608746
1312	2935738491	2935732158	Bacteria	9706831
1313	2935750279	2935741537	Bacteria	9707219
1314	2935759873	2935750917	Bacteria	9590372
1315	2935764475	2935760218	Bacteria	9817913
1316	2935772806	2935769743	Bacteria	7878163
1317	2935778058	2935777560	Bacteria	8077691
1318	2935787285	2935785616	Bacteria	7962367
1319	2935795927	2935793552	Bacteria	8012592
1320	2935804385	2935801545	Bacteria	9301974
1321	2935817246	2935810662	Bacteria	9401221
1322	2935831262	2935827899	Bacteria	10038562
1323	2935841871	2935837841	Bacteria	9454360
1324	2935856430	2935855204	Bacteria	9035059
1325	2935871047	2935864058	Bacteria	9784707
1326	2935874544	2935873716	Bacteria	9632195
1327	2935888930	2935883170	Bacteria	7964738
1328	2935994005	2935992306	Bacteria	9802711
1329	2936004984	2936002035	Bacteria	9362176
1330	2936044042	2936037263	Bacteria	9446081
1331	2940565673	2940556831	Bacteria	9590747
1332	2941532323	2941531003	Bacteria	7653939
1333	2941543944	2941538514	Bacteria	9402094
1334	3005509575	3005506211	Bacteria	6943378
1335	3005594172	3005587118	Bacteria	7794411
1336	3005602141	3005594810	Bacteria	8716512
1337	3005717897	3005710791	Bacteria	7622528
1338	3005724929	3005718088	Bacteria	8283608
1339	8006968350	8006964411	Bacteria	8966052
1340	8006985895	8006984368	Bacteria	9651211
1341	8007000283	8006994254	Bacteria	8309700
1342	8016518675	8016511872	Bacteria	9921665
1343	8016526636	8016522445	Bacteria	8156687
1344	8016531721	8016530956	Bacteria	8155261
1345	8016544918	8016539877	Bacteria	8155419
1346	8016557152	8016548790	Bacteria	8155074
1347	8016565501	8016557553	Bacteria	8154380
1348	8016569995	8016566248	Bacteria	8158151
1349	8016582567	8016575299	Bacteria	8154085
1350	8016603131	8016595262	Bacteria	8149947
1351	8016617929	8016613128	Bacteria	8794220
1352	8017057998	8017057580	Bacteria	10023680
1353	8019531544	8019530166	Bacteria	8155624
1354	8019539988	8019538911	Bacteria	7872763
1355	8019577722	8019576017	Bacteria	10049540
1356	8019595823	8019586578	Bacteria	10212056
1357	8019605937	8019597564	Bacteria	10041141
1358	8019612595	8019608314	Bacteria	10042931
1359	8019652050	8019648815	Bacteria	10014479
1360	8055750970	8055742211	Bacteria	9226248
1361	8056677764	8056673599	Bacteria	7871253
1362	8056688431	8056681323	Bacteria	8472857
1363	8056692771	8056689827	Bacteria	6712655
1364	8056970882	8056967851	Bacteria	9038162
1365	Ga0209564_1001502
1366	JGI24739J22299_10059095
1367	JGI24737J22298_10107397
1368	JGI25406J46586_10000471
1369	JGI25165J46597_1004300
1370	JGI25153J46596_10002109
1371	JGI25153J46596_10004526
1372	JGI25153J46596_10012156
1373	JGI25153J46596_10012608
1374	JGI25153J46596_10019440
1375	JGI25153J46596_10033696
1376	rootL2_10152192
1377	JGI25160J50197_1002305
1378	JGI25160J50197_1005985
1379	JGI25160J50197_1069486
1380	JGI25404J52841_10003282
1381	JGI25404J52841_10013133
1382	Ga0055542_1021136
1383	Ga0055529_1041736
1384	Ga0055526_1102453
1385	Ga0055543_1003281
1386	Ga0065165_1005102
1387	Ga0065165_1005218
1388	Ga0065165_1017149
1389	Ga0065165_1084117
1390	Ga0070658_10323677
1391	Ga0070676_10551990
1392	Ga0070676_10926436
1393	Ga0070676_11501219
1394	Ga0070683_100064508
1395	Ga0070683_100566307
1396	Ga0070683_101449514
1397	Ga0070670_100011429
1398	Ga0070670_100345357
1399	Ga0070670_100393402
1400	Ga0070670_100860305
1401	Ga0068869_100257708
1402	Ga0068869_100676711
1403	Ga0068869_101774167
1404	Ga0070666_10192653
1405	Ga0070682_100201028
1406	Ga0070682_100239564
1407	Ga0070682_101581020
1408	Ga0068868_100099635
1409	Ga0068868_100151059
1410	Ga0068868_100195092
1411	Ga0068868_100491395
1412	Ga0070660_101166424
1413	Ga0070689_101253802
1414	Ga0070689_101540265
1415	Ga0070661_100121780
1416	Ga0070661_100184713
1417	Ga0070661_100187572
1418	Ga0070661_100522894
1419	Ga0070661_100727301
1420	Ga0070668_100185882
1421	Ga0070668_101487857
1422	Ga0070668_101674580
1423	Ga0070669_101209666
1424	Ga0070671_100031378
1425	Ga0070671_100540044
1426	Ga0070671_101082222
1427	Ga0070671_101544203
1428	Ga0070674_100402510
1429	Ga0070674_100428820
1430	Ga0070674_100798735
1431	Ga0070673_100057045
1432	Ga0070673_100932837
1433	Ga0070659_101572745
1434	Ga0070667_100137923
1435	Ga0070667_100483623
1436	Ga0070667_100547350
1437	Ga0070667_101375005
1438	Ga0070714_100835310
1439	Ga0070713_100009559
1440	Ga0070713_101118060
1441	Ga0070710_10121805
1442	Ga0070711_100018328
1443	Ga0070705_101139710
1444	Ga0070700_100872293
1445	Ga0070694_100746877
1446	Ga0070663_100017505
1447	Ga0070663_100073084
1448	Ga0070663_100092931
1449	Ga0070663_100248215
1450	Ga0070663_100680591
1451	Ga0070663_100975680
1452	Ga0070663_101386373
1453	Ga0070678_100007756
1454	Ga0070678_100073133
1455	Ga0070678_100302941
1456	Ga0070678_100641673
1457	Ga0070662_100298862
1458	Ga0070662_100426806
1459	Ga0068867_100524791
1460	Ga0070679_100690370
1461	Ga0070679_101526298
1462	Ga0070684_100448775
1463	Ga0070684_100669512
1464	Ga0070684_102353286
1465	Ga0068853_100245557
1466	Ga0068853_100460315
1467	Ga0068853_100745633
1468	Ga0068853_100769573
1469	Ga0070672_100295624
1470	Ga0070672_100460642
1471	Ga0070672_101704484
1472	Ga0070686_101235177
1473	Ga0070696_100548727
1474	Ga0070693_100351749
1475	Ga0070693_100638587
1476	Ga0070665_100074278
1477	Ga0070665_100101028
1478	Ga0070665_100154053
1479	Ga0070665_100206615
1480	Ga0070665_100229279
1481	Ga0070665_100984466
1482	Ga0070665_101141528
1483	Ga0070704_100353610
1484	Ga0068855_100514850
1485	Ga0068855_100610204
1486	Ga0068855_101086517
1487	Ga0070664_100035841
1488	Ga0070664_100265625
1489	Ga0070664_100659794
1490	Ga0070664_100872873
1491	Ga0070664_100891584
1492	Ga0068857_100047852
1493	Ga0068857_100186695
1494	Ga0068854_100044727
1495	Ga0068854_100243577
1496	Ga0068854_100959772
1497	Ga0068856_100185768
1498	Ga0068856_100601928
1499	Ga0068856_101134651
1500	Ga0068856_102117265
1501	Ga0070702_100236904
1502	Ga0070702_100420990
1503	Ga0068852_100680547
1504	Ga0068852_101494407
1505	Ga0068852_102233990
1506	Ga0068859_100495828
1507	Ga0068859_101773298
1508	Ga0068864_100461916
1509	Ga0068864_101583706
1510	Ga0068864_102603186
1511	Ga0068861_100291002
1512	Ga0068861_101274488
1513	Ga0068861_101596406
1514	Ga0068851_10469213
1515	Ga0068870_10382314
1516	Ga0068870_10464212
1517	Ga0068863_100231450
1518	Ga0068863_100461369
1519	Ga0068863_100659984
1520	Ga0068863_101429539
1521	Ga0068863_101728670
1522	Ga0068863_101903644
1523	Ga0068858_100573156
1524	Ga0068858_100644849
1525	Ga0068860_100172485
1526	Ga0068860_101088076
1527	Ga0068860_101732429
1528	Ga0068862_100385747
1529	Ga0068862_100515092
1530	Ga0081455_10006198
1531	Ga0081538_10071652
1532	Ga0081540_1009916
1533	Ga0081540_1049936
1534	Ga0081540_1080207
1535	Ga0081539_10000048
1536	Ga0070717_10006987
1537	Ga0070717_10157315
1538	Ga0070717_11166894
1539	Ga0075365_10008364
1540	Ga0075365_10016090
1541	Ga0075365_10034988
1542	Ga0075365_10058946
1543	Ga0075365_10116577
1544	Ga0075365_10232706
1545	Ga0075365_10434856
1546	Ga0075365_10517378
1547	Ga0075365_10819873
1548	Ga0075365_10830510
1549	Ga0075368_10029965
1550	Ga0075368_10187372
1551	Ga0075368_10249077
1552	Ga0075363_100004096
1553	Ga0075363_100016122
1554	Ga0075363_100022049
1555	Ga0075363_100286506
1556	Ga0075363_100482569
1557	Ga0075364_10062021
1558	Ga0075364_10213307
1559	Ga0070716_100235720
1560	Ga0070712_100035265
1561	Ga0070712_100202927
1562	Ga0070712_100278242
1563	Ga0075362_10164050
1564	Ga0075362_10186328
1565	Ga0075362_10532309
1566	Ga0075362_10709998
1567	Ga0075367_10055136
1568	Ga0075367_10176811
1569	Ga0075367_10239255
1570	Ga0075367_10282236
1571	Ga0075367_10359031
1572	Ga0075367_10438165
1573	Ga0075367_10565733
1574	Ga0075369_10016661
1575	Ga0075369_10019679
1576	Ga0075369_10096190
1577	Ga0075369_10130166
1578	Ga0075369_10208365
1579	Ga0075369_10270483
1580	Ga0075366_10096060
1581	Ga0075366_10132280
1582	Ga0075366_10531377
1583	Ga0075366_10829088
1584	Ga0097621_100168105
1585	Ga0097621_100872720
1586	Ga0097621_101013421
1587	Ga0075370_10048587
1588	Ga0075370_10062739
1589	Ga0075370_10186532
1590	Ga0075370_10312963
1591	Ga0075370_10368924
1592	Ga0075370_10711629
1593	Ga0075428_100035501
1594	Ga0075431_100564108
1595	Ga0075434_100517548
1596	Ga0075434_101741203
1597	Ga0075429_100196677
1598	Ga0068865_100189089
1599	Ga0097620_100495818
1600	Ga0097620_101361044
1601	Ga0097620_101773156
1602	Ga0099824_1004372
1603	Ga0075435_100627002
1604	Ga0099794_10092432
1605	Ga0099795_10443388
1606	Ga0105250_10221201
1607	Ga0105240_10082785
1608	Ga0105240_11208433
1609	Ga0111539_10195880
1610	Ga0105245_10294658
1611	Ga0105245_10789137
1612	Ga0105245_10845745
1613	Ga0105245_11539178
1614	Ga0105245_12419437
1615	Ga0105247_10112667
1616	Ga0105247_10186958
1617	Ga0105247_10309158
1618	Ga0105247_10361775
1619	Ga0105247_10535569
1620	Ga0105247_10635243
1621	Ga0105247_10693874
1622	Ga0105247_10820317
1623	Ga0105247_10977268
1624	Ga0114129_10219007
1625	Ga0105243_10316303
1626	Ga0105243_10538091
1627	Ga0105243_10706845
1628	Ga0105243_11634814
1629	Ga0105243_12095654
1630	Ga0105241_10051632
1631	Ga0105241_10202057
1632	Ga0105241_10920922
1633	Ga0105241_11397638
1634	Ga0105242_10684760
1635	Ga0105242_10793180
1636	Ga0105242_11981181
1637	Ga0105248_10147688
1638	Ga0105248_10257011
1639	Ga0105248_10324260
1640	Ga0105248_10350579
1641	Ga0105237_10299195
1642	Ga0105237_10450644
1643	Ga0105237_10603620
1644	Ga0105237_12145048
1645	Ga0105238_10153932
1646	Ga0105238_10377269
1647	Ga0105238_10717255
1648	Ga0105238_10730019
1649	Ga0105238_10781053
1650	Ga0105249_10555639
1651	Ga0105249_10944427
1652	Ga0105239_10099895
1653	Ga0105239_10140445
1654	Ga0105239_10523619
1655	Ga0105239_10576603
1656	Ga0105239_10623443
1657	Ga0105239_10780281
1658	Ga0105239_12003635
1659	Ga0105239_12021693
1660	Ga0105246_10122720
1661	Ga0105246_10169521
1662	Ga0105246_10177751
1663	Ga0105246_10697911
1664	Ga0105246_12554600
1665	Ga0157370_11059395
1666	Ga0157370_11324092
1667	Ga0157369_10004320
1668	Ga0157369_10022623
1669	Ga0157374_10233980
1670	Ga0157374_11217972
1671	Ga0157374_11368191
1672	Ga0157378_10252048
1673	Ga0157378_10551762
1674	Ga0157378_11279120
1675	Ga0157378_11490480
1676	Ga0157378_11499037
1677	Ga0163162_10165537
1678	Ga0163162_10539665
1679	Ga0163162_11353375
1680	Ga0157372_10136529
1681	Ga0157372_10671603
1682	Ga0157375_10139166
1683	Ga0157375_10139464
1684	Ga0157375_10410236
1685	Ga0157375_10989443
1686	Ga0157375_11408203
1687	Ga0157375_12283837
1688	Ga0163163_10233843
1689	Ga0163163_10253768
1690	Ga0163163_10725536
1691	Ga0163163_12044153
1692	Ga0157380_10358113
1693	Ga0157380_10777441
1694	Ga0157380_10872932
1695	Ga0157380_11148223
1696	Ga0157380_13071445
1697	Ga0182008_10535130
1698	Ga0157377_10062731
1699	Ga0157377_10325418
1700	Ga0157379_10051438
1701	Ga0157379_10257408
1702	Ga0157379_10269584
1703	Ga0157379_10513974
1704	Ga0157379_11196365
1705	Ga0157376_10079124
1706	Ga0157376_10138263
1707	Ga0157376_10499571
1708	Ga0157376_10561841
1709	Ga0182007_10100642
1710	Ga0163161_10639697
1711	Ga0163161_10767641
1712	Ga0163161_11267521
1713	Ga0214544_1000003
1714	Ga0214542_1000003
1715	Ga0214545_1000004
1716	Ga0214543_1000007
1717	Ga0213876_10011887
1718	Ga0209677_101261
1719	Ga0209148_1000351
1720	Ga0209233_1021434
1721	Ga0209455_1014217
1722	Ga0209564_1003721
1723	Ga0209564_1039844
1724	Ga0209564_1069980
1725	Ga0209758_1000015
1726	Ga0209758_1000224
1727	Ga0209758_1001252
1728	Ga0209758_1005621
1729	Ga0209758_1008757
1730	Ga0209758_1016184
1731	Ga0209758_1041708
1732	Ga0209758_1051205
1733	Ga0209256_1006394
1734	Ga0209256_1021765
1735	Ga0207426_1000585
1736	Ga0207426_1000940
1737	Ga0207426_1026409
1738	Ga0207426_1036866
1739	Ga0207426_1145433
1740	Ga0209051_1038528
1741	Ga0209051_1096052
1742	Ga0209257_1011507
1743	Ga0209257_1052589
1744	Ga0209257_1108854
1745	Ga0207656_10427326
1746	Ga0207692_10056327
1747	Ga0207692_10505185
1748	Ga0207642_10108830
1749	Ga0207642_10491829
1750	Ga0207710_10102991
1751	Ga0207710_10177880
1752	Ga0207710_10546796
1753	Ga0207710_10572675
1754	Ga0207688_10064254
1755	Ga0207688_10164085
1756	Ga0207680_10051139
1757	Ga0207647_10009677
1758	Ga0207647_10404909
1759	Ga0207645_10620149
1760	Ga0207643_10304438
1761	Ga0207643_10577868
1762	Ga0207643_10911634
1763	Ga0207705_10202576
1764	Ga0207705_10206374
1765	Ga0207654_10224444
1766	Ga0207654_10255535
1767	Ga0207695_10000065
1768	Ga0207695_10006231
1769	Ga0207695_11617149
1770	Ga0207671_10032832
1771	Ga0207671_10307294
1772	Ga0207693_10161835
1773	Ga0207693_10217833
1774	Ga0207693_11143746
1775	Ga0207663_10308747
1776	Ga0207657_11122235
1777	Ga0207649_10058590
1778	Ga0207649_10309148
1779	Ga0207649_10398927
1780	Ga0207646_10317547
1781	Ga0207694_10199982
1782	Ga0207694_10670619
1783	Ga0207694_10823877
1784	Ga0207650_10018826
1785	Ga0207650_10368292
1786	Ga0207650_10616519
1787	Ga0207659_10407116
1788	Ga0207659_10608124
1789	Ga0207659_10827817
1790	Ga0207687_10222274
1791	Ga0207687_10478174
1792	Ga0207700_10048893
1793	Ga0207700_10407898
1794	Ga0207700_10473039
1795	Ga0207664_10507941
1796	Ga0207664_10525378
1797	Ga0207664_10884278
1798	Ga0207644_10113633
1799	Ga0207644_10645991
1800	Ga0207644_10906849
1801	Ga0207690_10092577
1802	Ga0207706_10058020
1803	Ga0207706_10088497
1804	Ga0207706_10199534
1805	Ga0207706_10965388
1806	Ga0207686_10200590
1807	Ga0207686_10339839
1808	Ga0207686_10392658
1809	Ga0207709_10412369
1810	Ga0207709_10466908
1811	Ga0207709_10611304
1812	Ga0207709_10789934
1813	Ga0207709_11174121
1814	Ga0207670_10775186
1815	Ga0207669_10057403
1816	Ga0207669_10192274
1817	Ga0207669_10278632
1818	Ga0207669_10718802
1819	Ga0207704_10210591
1820	Ga0207704_11457358
1821	Ga0207704_11842255
1822	Ga0207665_10085996
1823	Ga0207665_10396643
1824	Ga0207691_10071549
1825	Ga0207691_10241584
1826	Ga0207691_10460511
1827	Ga0207711_10144371
1828	Ga0207711_10757877
1829	Ga0207711_10984661
1830	Ga0207711_11196291
1831	Ga0207711_11215725
1832	Ga0207689_10022943
1833	Ga0207689_10133195
1834	Ga0207689_10475336
1835	Ga0207661_10041316
1836	Ga0207679_10128808
1837	Ga0207679_10236463
1838	Ga0207679_10733887
1839	Ga0207679_10821973
1840	Ga0207667_10412937
1841	Ga0207667_10483324
1842	Ga0207667_11261217
1843	Ga0207651_11558566
1844	Ga0207712_10719451
1845	Ga0207668_10148920
1846	Ga0207668_10700264
1847	Ga0207640_10153256
1848	Ga0207640_10376774
1849	Ga0207658_10346286
1850	Ga0207658_10461212
1851	Ga0207658_10770796
1852	Ga0207658_11290342
1853	Ga0207677_10035278
1854	Ga0207677_10281135
1855	Ga0207677_10365177
1856	Ga0207703_10106660
1857	Ga0207703_10500089
1858	Ga0207639_10251736
1859	Ga0207639_10259075
1860	Ga0207639_10274784
1861	Ga0207639_10313444
1862	Ga0207639_10592335
1863	Ga0207639_10991743
1864	Ga0207639_11328415
1865	Ga0207678_10018636
1866	Ga0207678_10020185
1867	Ga0207678_10142597
1868	Ga0207678_10212911
1869	Ga0207678_10269047
1870	Ga0207708_10847955
1871	Ga0207702_10058449
1872	Ga0207702_10344388
1873	Ga0207702_12155622
1874	Ga0207641_10447747
1875	Ga0207641_10570058
1876	Ga0207641_10648249
1877	Ga0207641_10771139
1878	Ga0207641_10860860
1879	Ga0207641_11038300
1880	Ga0207648_11357206
1881	Ga0207676_10093444
1882	Ga0207676_11586538
1883	Ga0207674_10056686
1884	Ga0207674_11572834
1885	Ga0207675_100037771
1886	Ga0207675_101034997
1887	Ga0207683_10014763
1888	Ga0207683_10074094
1889	Ga0207683_10105864
1890	Ga0207683_10150996
1891	Ga0207683_10503259
1892	Ga0207698_10174202
1893	Ga0207698_10226645
1894	Ga0207698_10456304
1895	Ga0207698_11128448
1896	Ga0207698_11637854
1897	Ga0209389_1000029
1898	Ga0209589_1000012
1899	Ga0209589_1000013
1900	Ga0209489_100013
1901	Ga0209588_1134544
1902	Ga0209813_10136549
1903	Ga0207428_10214669
1904	Ga0268266_10001689
1905	Ga0268266_10049213
1906	Ga0268266_10325509
1907	Ga0268266_10829874
1908	Ga0268266_10972830
1909	Ga0268266_11026346
1910	Ga0268266_11255106
1911	Ga0268266_11688696
1912	Ga0268264_10053334
1913	Ga0268264_10245389
1914	Ga0307517_10000766
1915	Ga0307517_10399555
1916	Ga0307517_10538929
1917	Ga0307515_10015099
1918	Ga0307515_10187396
1919	Ga0307515_10257456
1920	Ga0307513_10610092
1921	Ga0307408_100260122
1922	Ga0307408_101357047
1923	Ga0307508_10011103
1924	Ga0307508_10143377
1925	Ga0307508_10277340
1926	Ga0316579_10167088
1927	Ga0316576_10658508
1928	Ga0316578_10017660
1929	Ga0307516_10287161
1930	Ga0307516_10360375
1931	Ga0307405_11253843
1932	Ga0307413_10345325
1933	Ga0307412_10039435
1934	Ga0307412_10380251
1935	Ga0307412_11365880
1936	Ga0307412_11672015
1937	Ga0307416_100706666
1938	Ga0307416_102561928
1939	Ga0307414_10351525
1940	Ga0307411_10634843
1941	Ga0307411_11883438
1942	Ga0307415_100968648
1943	Ga0316583_10028879
1944	Ga0316585_10027397
1945	Ga0307510_10062487
1946	Ga0307510_10197798
1947	Ga0307510_10594249
1948	Ga0373932_0014478
1949	Ga0373941_0398083
1950	Ga0373945_0344439
1951	Ga0373956_0056582
1952	Ga0373943_0077107
1953	Ga0373946_0113867
1954	Ga0316574_0004898
1955	Ga0373931_0108009
1956	Ga0373931_0247654
1957	Ga0373931_0339225
1958	Ga0373931_0523087
1959	Ga0373931_0876656
1960	Ga0373935_0153560
1961	Ga0373935_0550593
1962	Ga0373927_0057267
1963	Ga0373927_0148266
1964	Ga0373933_0157749
1965	Ga0373947_0047357
1966	Ga0372808_009417
1967	Ga0316582_0042903
1968	Ga0316584_0002434
1969	Ga0373925_0067683
1970	Ga0373925_0722242
1971	Ga0395899_0116835
1972	Ga0395900_0026692
1973	Ga0395900_0422393
1974	Ga0395905_0002607
1975	Ga0395901_0103536
1976	Ga0395901_0104412
1977	Ga0395901_0260447
1978	Ga0395901_1454837
1979	Ga0436365_0009345
1980	Ga0436365_0696068
1981	Ga0436365_1649999
1982	Ga0436360_0176982
1983	Ga0436360_1351962
1984	Ga0436361_0710311
1985	Ga0439465_0081475
1986	Ga0451789_0022620
1987	Ga0451789_0077145
1988	Ga0451793_1274753
1989	Ga0451797_1136496
1990	Ga0451800_0786426
1991	Ga0451833_0649754
1992	Ga0451853_0959802
1993	Ga0451853_1950833
1994	Ga0439459_0012940
1995	Ga0466969_0023436
1996	Ga0466972_0000048
1997	Ga0466972_0010654
1998	Ga0466972_0326184
1999	Ga0466965_0273032
2000	Ga0466965_0472223
2001	Ga0466966_0000238
2002	Ga0466961_0000044
2003	Ga0466961_0127007
2004	Ga0466961_0691331
2005	Ga0466963_0091744
2006	Ga0466963_0306300
2007	Ga0466964_0554666
2008	Ga0466971_0094701
2009	Ga0466968_0004386
2010	Ga0466968_0368275
2011	Ga0466970_0337411
2012	Ga0466957_0033689
2013	Ga0466957_0488587
2014	Ga0466960_0043829
2015	Ga0466960_0068756
2016	Ga0466960_0607387
2017	Ga0466959_0000963
2018	Ga0466959_0014545
2019	Ga0466967_0029200
2020	Ga0466967_0328054
2021	Ga0466967_0436532
2022	Ga0495592_0062171
2023	Ga0495592_0145202
2024	Ga0495603_0010858
2025	Ga0495603_0030986
2026	Ga0495603_0260992
2027	Ga0495590_0094731
2028	Ga0495629_0001706
2029	Ga0495629_0290806
2030	Ga0495638_0040121
2031	Ga0495641_0286419
2032	Ga0495651_0001544
2033	Ga0495651_0025096
2034	Ga0495651_0082115
2035	Ga0495651_0101207
2036	Ga0495653_0032374
2037	Ga0495653_0151366
2038	Ga0495605_0142857
2039	Ga0495639_0136070
2040	Ga0495662_0620193
2041	Ga0495664_0160941
2042	Ga0495584_0229000
2043	Ga0495584_0270156
2044	Ga0495584_0270764
2045	Ga0495585_0160887
2046	Ga0495594_0380267
2047	Ga0495594_0394781
2048	Ga0495596_0117806
2049	Ga0495596_0184570
2050	Ga0495607_0015021
2051	Ga0495607_0182808
2052	Ga0495583_0047523
2053	Ga0495583_0151468
2054	Ga0495583_0353751
2055	Ga0495606_0000265
2056	Ga0495606_0024523
2057	Ga0495606_0083776
2058	Ga0495606_0207764
2059	Ga0495606_0258300
2060	Ga0495606_0376913
2061	Ga0495606_0442864
2062	Ga0495606_0524323
2063	Ga0495606_0540475
2064	Ga0495608_0051185
2065	Ga0495610_0044299
2066	Ga0495616_0035279
2067	Ga0495616_0052289
2068	Ga0495616_0426631
2069	Ga0495616_0439047
2070	Ga0495618_0053997
2071	Ga0495618_0269236
2072	Ga0495620_0034205
2073	Ga0495620_0337826
2074	Ga0495620_0349856
2075	Ga0495628_0568136
2076	Ga0495630_0120640
2077	Ga0495631_0049709
2078	Ga0495631_0313164
2079	Ga0495632_0021540
2080	Ga0495637_0052184
2081	Ga0495637_0295169
2082	Ga0495643_0073732
2083	Ga0495643_0106527
2084	Ga0495643_0218390
2085	Ga0495644_0082636
2086	Ga0495648_0000271
2087	Ga0495648_0094741
2088	Ga0495666_0227162
2089	Ga0495666_0230369
2090	Ga0495642_0278658
2091	Ga0495652_0017477
2092	Ga0495652_0977696
2093	Ga0495654_0039417
2094	Ga0495654_0142502
2095	Ga0495665_0216353
2096	Ga0495665_0618776
2097	Ga0495640_0013425
2098	Ga0495587_0011668
2099	Ga0495587_0209178
2100	Ga0495609_0222188
2101	Ga0495597_0074831
2102	Ga0495597_0123892
2103	Ga0495645_0613562
2104	Ga0495622_0019048
2105	Ga0495622_0029421
2106	Ga0495622_0066421
2107	Ga0495622_0081069
2108	Ga0495667_0061802
2109	Ga0495667_0832082
2110	Ga0495656_0123726
2111	Ga0495668_0088178
2112	Ga0495668_0105952
2113	Ga0495668_0114351
2114	Ga0495668_0229702
2115	Ga0495668_0231650
2116	Ga0495634_0026354
2117	Ga0495611_0142259
2118	Ga0495625_0040142
2119	Ga0495625_0077037
2120	Ga0495625_0087934
2121	Ga0495625_0361808
2122	Ga0495625_0410102
2123	Ga0495625_0748953
2124	Ga0495625_0916328
2125	Ga0495635_0005005
2126	Ga0495635_0047785
2127	Ga0495635_0087734
2128	Ga0495661_0009639
2129	Ga0495661_0105817
2130	Ga0495661_0346756
2131	Ga0495588_0021656
2132	Ga0495588_0072735
2133	Ga0495588_0282369
2134	Ga0495588_0429069
2135	Ga0495588_0602579
2136	Ga0495657_0011193
2137	Ga0495657_0390485
2138	Ga0495623_0696319
2139	Ga0495646_0026171
2140	Ga0495646_0086143
2141	Ga0495646_0200774
2142	Ga0495647_0412386
2143	Ga0495658_0936822
2144	Ga0495669_0543966
2145	Ga0495613_0184208
2146	Ga0495613_0243674
2147	Ga0495624_0221022
2148	Ga0495624_0416058
2149	Ga0495670_0027112
2150	Ga0495670_0190727
2151	Ga0495671_0040770
2152	Ga0495671_0274871
2153	Ga0495649_0119298
2154	Ga0495649_0408257
2155	Ga0495649_0440662
2156	Ga0495600_0005160
2157	Ga0495660_0477791
2158	Ga0495581_0682240
2159	Ga0495604_0005037
2160	Ga0495604_0033791
2161	Ga0495604_0357018
2162	Ga0495636_0378447
2163	Ga0495674_0341851
2164	Ga0495674_0770515
2165	Ga0495672_0006198
2166	Ga0495672_0030505
2167	Ga0495676_0020537
2168	Ga0495676_0157123
2169	Ga0495680_0004426
2170	Ga0495680_0415211
2171	Ga0495687_152767
2172	Ga0495677_0296469
2173	Ga0495673_0104582
2174	Ga0495673_0129864
2175	Ga0495673_0209716
2176	Ga0495684_0979293
2177	Ga0495686_0078441
2178	Ga0495686_0204141
2179	Ga0495686_0362517
2180	Ga0495593_0121948
2181	Ga0495602_0053428
2182	Ga0495602_0596190
2183	Ga0495614_0189049
2184	Ga0495614_0274502
2185	Ga0495614_0621489
2186	Ga0495615_0044274
2187	Ga0495626_0040243
2188	Ga0495626_0240717
2189	Ga0496100_0014294
2190	Ga0496100_0150948
2191	Ga0496100_0171021
2192	Ga0496100_0390376
2193	Ga0496100_0393404
2194	Ga0496101_0020764
2195	Ga0496101_0080313
2196	Ga0496101_0153230
2197	Ga0496101_0331603
2198	Ga0496101_0408908
2199	Ga0496101_0658394
2200	Ga0496101_0969643
2201	Ga0496102_0005804
2202	Ga0496102_0026579
2203	Ga0496102_0055189
2204	Ga0496102_0066766
2205	Ga0496102_0104917
2206	Ga0496102_0428736
2207	Ga0496102_0607129
2208	Ga0496102_1437018
2209	Ga0496103_0017638
2210	Ga0496103_0023140
2211	Ga0496103_0639611
2212	Ga0496103_0678191
2213	Ga0496103_0824199
2214	Ga0496104_0005123
2215	Ga0496104_0023685
2216	Ga0496104_0121874
2217	Ga0496104_0210024
2218	Ga0496104_0321731
2219	Ga0496104_0779498
2220	Ga0496105_0032125
2221	Ga0496105_0064838
2222	Ga0496105_0072514
2223	Ga0496105_0204988
2224	Ga0496105_0222744
2225	Ga0496105_0259275
2226	Ga0496105_0400525
2227	Ga0496105_0585216
2228	Ga0496105_1017271
2229	Ga0496106_0127411
2230	Ga0496106_0143521
2231	Ga0496106_0560628
2232	Ga0496106_0670917
2233	Ga0496106_0817914
2234	Ga0496107_0016390
2235	Ga0496107_0087075
2236	Ga0496107_0110453
2237	Ga0496107_0436740
2238	Ga0496107_0638539
2239	Ga0496107_0832720
2240	Ga0496107_0834368
2241	Ga0496107_1065541
2242	Ga0496108_0036917
2243	Ga0496108_0079765
2244	Ga0496108_0226771
2245	Ga0496108_0458606
2246	Ga0496108_0538609
2247	Ga0496108_0807052
2248	Ga0496109_0003393
2249	Ga0496109_0016364
2250	Ga0496109_0044712
2251	Ga0496109_0538528
2252	Ga0496109_0708526
2253	Ga0496110_0054498
2254	Ga0496110_0075072
2255	Ga0496110_0164716
2256	Ga0496110_0312819
2257	Ga0496110_0347168
2258	Ga0496110_0419037
2259	Ga0496110_0447636
2260	Ga0496110_0825454
2261	Ga0496110_1203953
2262	Ga0496110_1911559
2263	Ga0496111_0025067
2264	Ga0496111_0045889
2265	Ga0496111_0110551
2266	Ga0496111_0157208
2267	Ga0496111_0207114
2268	Ga0496111_0697490
2269	Ga0496112_0000019
2270	Ga0496112_0007111
2271	Ga0496112_0085267
2272	Ga0496112_0132000
2273	Ga0496112_0483814
2274	Ga0496112_0495490
2275	Ga0496112_0528401
2276	Ga0496113_0053179
2277	Ga0496113_0084008
2278	Ga0496113_0099452
2279	Ga0496113_0137241
2280	Ga0496113_0284519
2281	Ga0496113_0874105
2282	Ga0496114_0016833
2283	Ga0496114_0068352
2284	Ga0496114_0202380
2285	Ga0496114_0524981
2286	Ga0496114_0991273
2287	Ga0496114_1148301
2288	Ga0496114_1195440
2289	Ga0496115_0001776
2290	Ga0496115_0073507
2291	Ga0496115_0078574
2292	Ga0496115_0083251
2293	Ga0496115_0117743
2294	Ga0496115_0219550
2295	Ga0496115_0548264
2296	Ga0496116_0002417
2297	Ga0496116_0106778
2298	Ga0496117_0018002
2299	Ga0496117_0078336
2300	Ga0496117_0112792
2301	Ga0496117_0116375
2302	Ga0496117_0195063
2303	Ga0496117_0222397
2304	Ga0496117_0233951
2305	Ga0496118_0045553
2306	Ga0496118_0085974
2307	Ga0496118_0089356
2308	Ga0496118_0096570
2309	Ga0496118_0161291
2310	Ga0496118_0180026
2311	Ga0496118_0225650
2312	Ga0496118_0307672
2313	Ga0496118_0507268
2314	Ga0496119_0008930
2315	Ga0496119_0153169
2316	Ga0496119_0167779
2317	Ga0496119_0171782
2318	Ga0496119_0221780
2319	Ga0496120_0009949
2320	Ga0496120_0034261
2321	Ga0496120_0145457
2322	Ga0496120_0211638
2323	Ga0496121_0010594
2324	Ga0496121_0012632
2325	Ga0496121_0034308
2326	Ga0496121_0040104
2327	Ga0496121_0092016
2328	Ga0496121_0094722
2329	Ga0496121_0097846
2330	Ga0496121_0108816
2331	Ga0496121_0127379
2332	Ga0496121_0158850
2333	Ga0496121_0187009
2334	Ga0496121_0194505
2335	Ga0496121_0229930
2336	Ga0496121_0248711
2337	Ga0496121_0341332
2338	Ga0496121_0356527
2339	Ga0496121_0464400
2340	Ga0496121_0570364
2341	Ga0496121_0579626
2342	Ga0496122_0038591
2343	Ga0496122_0066741
2344	Ga0496122_0088899
2345	Ga0496123_0038299
2346	Ga0496123_0054922
2347	Ga0496123_0055591
2348	Ga0496123_0115347
2349	Ga0496124_0037061
2350	Ga0496124_0117422
2351	Ga0496124_0180321
2352	Ga0496124_0248315
2353	Ga0496124_0268079
2354	Ga0496124_0321210
2355	Ga0496125_0000048
2356	Ga0496125_0003042
2357	Ga0496125_0006677
2358	Ga0496125_0020421
2359	Ga0496125_0047989
2360	Ga0496125_0175667
2361	Ga0496125_0182044
2362	Ga0496125_0344499
2363	Ga0496125_0453930
2364	Ga0496126_0017022
2365	Ga0496126_0029441
2366	Ga0496126_0034784
2367	Ga0496126_0043359
2368	Ga0496126_0047232
2369	Ga0496126_0069413
2370	Ga0496126_0162689
2371	Ga0496126_0181593
2372	Ga0496126_0211829
2373	Ga0496126_0223591
2374	Ga0496126_0422648
2375	Ga0496126_0684102
2376	Ga0501032_0081480
2377	Ga0501032_0588554
2378	Ga0501033_0144289
2379	Ga0501034_0814607
2380	Ga0501036_0081113
2381	Ga0501036_0457287
2382	Ga0501036_0829157
2383	Ga0501037_0156424
2384	Ga0501037_0287897
2385	Ga0501038_0164546
2386	Ga0501038_0194316
2387	Ga0501039_0188371
2388	Ga0501039_0257474
2389	Ga0501039_1534360
2390	Ga0501041_0405601
2391	Ga0501041_0462577
2392	Ga0501043_0046733
2393	Ga0501046_0381162
2394	Ga0501047_0097387
2395	Ga0501067_0085865
2396	Ga0501068_0253609
2397	Ga0501069_0080634
2398	Ga0501070_0228399
2399	Ga0501070_0444724
2400	Ga0501071_0187016
2401	Ga0501072_1363393
2402	Ga0501073_0735050
2403	Ga0501076_0060824
2404	Ga0501077_0963213
2405	Ga0501080_0897183
2406	Ga0501081_0457034
2407	Ga0501083_0028328
2408	Ga0501044_0134829
2409	nmdc:mga03683_104307_c1
2410	nmdc:mga03683_255510_c1
2411	nmdc:mga03n38_137077_c1
2412	nmdc:mga03n38_1883_c1
2413	nmdc:mga03n38_203028_c1
2414	nmdc:mga00v17_1000892_c1
2415	nmdc:mga00v17_359133_c1
2416	nmdc:mga00v17_708665_c1
2417	nmdc:mga00v17_84923_c1
2418	nmdc:mga0yw44_18568_c2
2419	nmdc:mga0yw44_313931_c1
2420	nmdc:mga0yw44_337136_c1
2421	nmdc:mga0yw44_3382_c1
2422	nmdc:mga0yw44_362508_c1
2423	nmdc:mga0yw44_375263_c1
2424	nmdc:mga0yw44_466441_c1
2425	nmdc:mga0yw44_529471_c1
2426	nmdc:mga0yw44_683343_c1
2427	nmdc:mga0yw44_701340_c1
2428	nmdc:mga0yw44_745644_c1
2429	nmdc:mga0yw44_9374_c1
2430	nmdc:mga0k408_156806_c1
2431	nmdc:mga0k408_164999_c1
2432	nmdc:mga0k408_223863_c1
2433	nmdc:mga06z11_22599_c1
2434	nmdc:mga06z11_249668_c1
2435	nmdc:mga06z11_25364_c1
2436	nmdc:mga06z11_309328_c1
2437	nmdc:mga06z11_369844_c1
2438	nmdc:mga04h51_159673_c1
2439	nmdc:mga07m45_125838_c1
2440	nmdc:mga07m45_25542_c1
2441	nmdc:mga07m45_266476_c1
2442	nmdc:mga07m45_38587_c1
2443	nmdc:mga07m45_49067_c1
2444	nmdc:mga07m45_793143_c1
2445	nmdc:mga07m45_826783_c1
2446	nmdc:mga05p37_87990_c1
2447	nmdc:mga09592_191516_c1
2448	nmdc:mga06r32_442363_c1
2449	nmdc:mga08y16_673317_c1
2450	nmdc:mga0n895_1045631_c1
2451	nmdc:mga0n895_211832_c1
2452	nmdc:mga0rr50_1296553_c1
2453	nmdc:mga0sz30_183523_c1
2454	nmdc:mga0sz30_213354_c1
2455	nmdc:mga0sz30_214572_c1
2456	nmdc:mga0sz30_224289_c1
2457	Ga0495612_0203509
2458	Ga0500610_0347785
2459	Ga0500635_0057292
2460	Ga0500635_0273514
2461	Ga0495655_0025819
2462	Ga0495655_0092324
2463	Ga0495655_0152959
2464	Ga0495655_0228646
2465	Ga0495655_0240234
2466	Ga0495595_0005730
2467	Ga0495595_0069371
2468	Ga0495595_0209998
2469	Ga0495595_0625209
2470	Ga0495619_0010200
2471	Ga0495619_0051676
2472	Ga0495619_0192067
2473	Ga0495619_0251197
2474	Ga0495619_0624652
2475	Ga0500578_0630483
2476	Ga0500643_000091
2477	Ga0500644_0176203
2478	Ga0500581_082960
2479	Ga0500646_0005304
2480	Ga0500646_0061494
2481	Ga0500647_0054230
2482	Ga0500583_0107679
2483	Ga0500583_0606931
2484	Ga0500651_0034237
2485	Ga0500651_0049381
2486	Ga0500651_0140194
2487	Ga0500651_0447463
2488	Ga0500566_0000199
2489	Ga0500566_0000762
2490	Ga0500566_0005554
2491	Ga0500566_0099732
2492	Ga0500640_179129
2493	Ga0500641_0014432
2494	Ga0500641_0020604
2495	Ga0500641_0121609
2496	Ga0500641_0171676
2497	Ga0500650_0020737
2498	Ga0500554_001286
2499	Ga0500554_018352
2500	Ga0500554_138381
2501	Ga0500555_006418
2502	Ga0500555_142396
2503	Ga0500556_0000091
2504	Ga0500556_0042714
2505	Ga0500562_051861
2506	Ga0500569_004982
2507	Ga0500569_155835
2508	Ga0500572_032629
2509	Ga0500591_084627
2510	Ga0500592_011004
2511	Ga0500592_023516
2512	Ga0500593_053885
2513	Ga0500595_001153
2514	Ga0500595_002247
2515	Ga0500595_004559
2516	Ga0500595_034375
2517	Ga0500595_101186
2518	Ga0500608_016679
2519	Ga0500614_246152
2520	Ga0500618_008566
2521	Ga0500621_177219
2522	Ga0500626_185150
2523	Ga0500642_0000046
2524	Ga0500642_0007209
2525	Ga0500642_0037039
2526	Ga0500652_000293
2527	Ga0500655_031174
2528	Ga0500559_0000803
2529	Ga0500559_0199032
2530	Ga0500568_0000167
2531	Ga0500573_0471349
2532	Ga0500577_0049530
2533	Ga0500577_0072648
2534	Ga0500577_0339062
2535	Ga0500579_202606
2536	Ga0500586_000631
2537	Ga0500589_212916
2538	Ga0500590_025663
2539	Ga0500590_158740
2540	Ga0500590_184390
2541	Ga0500603_008203
2542	Ga0500603_011450
2543	Ga0500603_116529
2544	Ga0500604_0008033
2545	Ga0500616_0000059
2546	Ga0500616_0000283
2547	Ga0500619_247084
2548	Ga0500620_059039
2549	Ga0500622_0007335
2550	Ga0500622_0035683
2551	Ga0500630_126790
2552	Ga0500633_0064368
2553	Ga0500634_0036085
2554	Ga0500634_0403673
2555	Ga0500638_066936
2556	Ga0500638_166507
2557	Ga0500639_002046
2558	Ga0500636_0010476
2559	Ga0500636_0020615
2560	Ga0500636_0037394
2561	Ga0500636_0156839
2562	Ga0500636_0185262
2563	Ga0500637_0001064
2564	Ga0500637_0001082
2565	Ga0500637_0051060
2566	Ga0500637_0430981
2567	Ga0500570_140772
2568	Ga0500611_020319
2569	Ga0500611_023996
2570	Ga0500645_006160
2571	Ga0500645_020325
2572	Ga0500645_023253
2573	Ga0500645_182715
2574	Ga0500601_000421
2575	Ga0500601_015476
2576	Ga0500661_001611
2577	Ga0587083_0252617
2578	Ga0501082_0000379
2579	Ga0466962_0328975
2580	Ga0530510_0801949
2581	2511399018
2582	2513626163
2583	2513641880
2584	2513647994
2585	2513673012
2586	2513706302
2587	2513873944
2588	2514012918
2589	2517102420
2590	2524435713
2591	2528850368
2592	2603861855
2593	2617351670
2594	2617374161
2595	2728749242
2596	2745079009
2597	2793063131
2598	2805919469
2599	2818237247
2600	2824602544
2601	2824612676
2602	2824624784
2603	2824633656
2604	2824641526
2605	2824652627
2606	2824654490
2607	2824663632
2608	2824674885
2609	2824685484
2610	2824691953
2611	2824700443
2612	2824708478
2613	2824723168
2614	2824732530
2615	2824734837
2616	2824748157
2617	2824757146
2618	2824772085
2619	2824774974
2620	2838129526
2621	2841944427
2622	2841951568
2623	2841964645
2624	2841969204
2625	2841982869
2626	2841991049
2627	2842043914
2628	2842052096
2629	2844321792
2630	2847941722
2631	2849082640
2632	2857511537
2633	2857526025
2634	2874610323
2635	2874636675
2636	2876765010
2637	2876812800
2638	2879101278
2639	2879111643
2640	2881369843
2641	2881672913
2642	2885371427
2643	2885410827
2644	2888379999
2645	2888391075
2646	2888420803
2647	2889035035
2648	2893067702
2649	2903727658
2650	2904716151
2651	2906602852
2652	2906651690
2653	2908776636
2654	2919074124
2655	2922366922
2656	2922378382
2657	2922388578
2658	2922400334
2659	2922433514
2660	2929622519
2661	2929631263
2662	2932786315
2663	2932812610
2664	2932822972
2665	2932829553
2666	2933584402
2667	2935618071
2668	2935641531
2669	2935669411
2670	2935677991
2671	2935693688
2672	2935701770
2673	2935707235
2674	2935717077
2675	2935730089
2676	2935738491
2677	2935750279
2678	2935759873
2679	2935764475
2680	2935772806
2681	2935778058
2682	2935787285
2683	2935795927
2684	2935804385
2685	2935817246
2686	2935831262
2687	2935841871
2688	2935856430
2689	2935871047
2690	2935874544
2691	2935888930
2692	2935994005
2693	2936004984
2694	2936044042
2695	2940565673
2696	2941532323
2697	2941543944
2698	3005509575
2699	3005594172
2700	3005602141
2701	3005717897
2702	3005724929
2703	8006968350
2704	8006985895
2705	8007000283
2706	8016518675
2707	8016526636
2708	8016531721
2709	8016544918
2710	8016557152
2711	8016565501
2712	8016569995
2713	8016582567
2714	8016603131
2715	8016617929
2716	8017057998
2717	8019531544
2718	8019539988
2719	8019577722
2720	8019595823
2721	8019605937
2722	8019612595
2723	8019652050
2724	8055750970
2725	8056677764
2726	8056688431
2727	8056692771
2728	8056970882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11533

AtzH-like

24

150

0.98 PF14534

DUF4440

Domain of unknown function (DUF4440)

35

139

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6bju-assembly1.cif.gz_A	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9797	3	126
2rcd-assembly2.cif.gz_C	crystal structure of a protein with unknown function from duf3225 family (eca3500) from pectobacterium atrosepticum scri1043 at 2.32 a resolution	0.9796	3	125
6d63-assembly1.cif.gz_A	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9783	1	126
6bju-assembly1.cif.gz_B	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9782	3	124
6bjt-assembly1.cif.gz_B	the structure of atzh: a little known member of the atrazine breakdown pathway	0.9778	3	127

ID	Description	Score	Start	End	Superfamily
6bjtB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9779	3	127	3.10.450.50
6d63G00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9512	1	126	3.10.450.50
6d63G00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9432	1	126	3.10.450.50
2owpB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9373	1	126	3.10.450.50
6bjtB00	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.9338	3	127	3.10.450.50

ID	Description	Score	Start	End
AF-A0A2W5KBU4-F1-model_v4	Oxalurate catabolism protein HpxZ	0.9903	1	131
AF-A0A509EFP3-F1-model_v4	DUF4440 domain-containing protein	0.9897	1	127
AF-A0A3D9Z1W6-F1-model_v4	Uncharacterized protein DUF3225	0.9869	1	127
AF-A0A378B894-F1-model_v4	Protein of uncharacterized function (DUF3225)	0.9868	13	125
AF-A0A7X2MUS5-F1-model_v4	Oxalurate catabolism protein HpxZ	0.9861	2	87

F493363

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF11533

AtzH-like

AtzH-like

24

150

0.98

PF14534

DUF4440

Domain of unknown function (DUF4440)

35

139

0.73

Structural Annotation

Top 5 Hits

Map