F493332

General Info

Members Datasets Scaffolds Average Seq Length
1360 691 2720 227

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0148464|Ga0496107_0148464_41_694
Length 217
Sequence MFDLTFTIETENGTTPLTLAIDQAVVAGWTGRDPVARDKHIAELQEMGIAPPASTPIYYRASARRLTMEDSIEFVLIGWQGRTFVGLGSDHTDRKVEGYSVTVSKQMCDKPIASTLWELEEVIDHWDRLILRSYAWIGGKRELYQEGTLDAMLPVLELLKRGFAGGKLPDGCAMFGGTFAAKGGIRPASRFECELEDPVLKRTIRHAYDVTELPVLG

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
81 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
82 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
116 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
117 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
118 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
193 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
261 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
346 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
409 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
410 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
411 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
412 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
413 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
414 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
415 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
418 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
419 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
420 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
421 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
422 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
423 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
424 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
425 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
426 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
427 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
428 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
429 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
430 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
431 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
432 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
433 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
434 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
435 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
436 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
437 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
438 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
439 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
440 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
441 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
444 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
445 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
446 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
449 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
450 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
451 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
452 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
453 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
454 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
459 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
460 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
461 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
462 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
463 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
464 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
465 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
466 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
467 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
468 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
469 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
470 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
471 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
472 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
473 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
474 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
475 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
476 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
477 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
478 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
479 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
480 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
481 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
482 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
483 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
484 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
485 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
486 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
487 2643221651 Afipia sp. Root123D2 Isolate Unclassified
488 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
489 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
490 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
491 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
492 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
493 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
494 2791355199
495 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
496 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
497 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
498 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
499 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
500 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
501 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
502 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
503 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
504 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
505 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
506 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
507 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
508 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
509 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
510 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
511 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
512 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
513 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
514 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
515 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
516 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
517 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
518 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
519 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
520 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
521 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
522 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
523 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
524 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
525 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
526 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
527 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
528 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
529 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
530 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
531 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
532 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
533 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
534 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
535 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
536 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
537 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
538 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
539 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
540 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
541 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
542 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
543 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
544 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
545 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
546 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
547 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
548 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
549 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
550 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
551 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
552 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
553 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
554 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
555 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
556 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
557 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
558 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
559 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
560 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
561 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
562 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
563 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
564 2904699407
565 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
566 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
567 2906610324
568 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
569 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
570 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
571 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
572 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
573 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
574 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
575 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
576 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
577 2922368715
578 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
579 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
580 2922425934
581 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
582 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
583 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
584 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
585 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
586 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
587 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
588 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
589 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
590 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
591 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
592 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
593 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
594 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
595 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
596 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
597 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
598 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
599 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
600 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
601 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
602 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
603 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
604 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
605 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
606 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
607 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
608 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
609 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
610 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
611 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
612 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
613 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
614 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
615 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
616 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
617 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
618 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
619 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
620 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
621 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
622 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
623 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
624 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
625 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
626 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
627 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
628 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
629 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
630 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
631 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
632 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
633 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
634 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
635 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
636 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
637 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
638 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
639 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
640 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
641 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
642 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
643 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
644 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
645 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
646 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
647 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
648 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
649 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
650 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
651 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
652 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
653 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
654 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
655 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
656 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
657 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
658 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
659 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
660 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
661 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
662 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
663 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
664 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
665 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
666 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
667 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
668 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
669 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
670 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
671 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
672 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
673 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
674 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
675 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
676 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
677 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
678 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
679 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
680 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
681 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
682 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
683 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
684 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
685 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
686 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
687 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
688 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
689 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
690 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
691 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.88
Metatranscriptomes 0.07
Isolates 17.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 14.19
Rhizoplane 5.81
Rhizosphere 57.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0148464 3300048910 Bacteria 1734
2 JGI25406J46586_10000214 3300003203 Bacteria 25609
3 JGI25406J46586_10006102 3300003203 Bacteria 5565
4 JGI25160J50197_1003619 3300003354 Bacteria 6865
5 JGI25160J50197_1033878 3300003354 Bacteria 1277
6 Ga0055542_1013907 3300003762 Bacteria 1338
7 Ga0055531_10009410 3300003794 Bacteria 4993
8 Ga0055543_1003833 3300004625 Bacteria 4269
9 Ga0065165_1002074 3300005262 Bacteria 18412
10 Ga0065165_1002220 3300005262 Bacteria 17337
11 Ga0065165_1016908 3300005262 Bacteria 2710
12 Ga0070658_10061837 3300005327 Bacteria 3051
13 Ga0070658_10277390 3300005327 Bacteria 1426
14 Ga0070658_10669119 3300005327 Bacteria 901
15 Ga0070683_100013050 3300005329 Bacteria 7235
16 Ga0070670_100168954 3300005331 Bacteria 1897
17 Ga0070670_100617758 3300005331 Bacteria 971
18 Ga0068869_100146568 3300005334 Bacteria 1827
19 Ga0068869_100587398 3300005334 Bacteria 939
20 Ga0070666_10559044 3300005335 Bacteria 833
21 Ga0070680_100012621 3300005336 Bacteria 6567
22 Ga0070680_100031361 3300005336 Bacteria 4272
23 Ga0068868_100108576 3300005338 Bacteria 2252
24 Ga0070660_100003001 3300005339 Bacteria 11625
25 Ga0070660_100360200 3300005339 Bacteria 1199
26 Ga0070687_100119548 3300005343 Bacteria 1505
27 Ga0070668_100366074 3300005347 Bacteria 1223
28 Ga0070668_100467235 3300005347 Bacteria 1087
29 Ga0070669_100202934 3300005353 Bacteria 1561
30 Ga0070669_100251774 3300005353 Bacteria 1406
31 Ga0070671_100273868 3300005355 Bacteria 1435
32 Ga0070673_100624233 3300005364 Bacteria 985
33 Ga0070688_100284611 3300005365 Bacteria 1189
34 Ga0070688_100292292 3300005365 Bacteria 1175
35 Ga0070659_100167678 3300005366 Bacteria 1797
36 Ga0070659_100200483 3300005366 Bacteria 1642
37 Ga0070659_100406140 3300005366 Bacteria 1150
38 Ga0070667_100859563 3300005367 Bacteria 843
39 Ga0070709_10000203 3300005434 Bacteria 38151
40 Ga0070709_10035659 3300005434 Bacteria 3024
41 Ga0070709_10045651 3300005434 Bacteria 2720
42 Ga0070709_10126394 3300005434 Bacteria 1740
43 Ga0070714_100009406 3300005435 Bacteria 7683
44 Ga0070714_100042351 3300005435 Bacteria 3846
45 Ga0070714_100234407 3300005435 Bacteria 1692
46 Ga0070713_100013461 3300005436 Bacteria 6042
47 Ga0070713_100076397 3300005436 Bacteria 2844
48 Ga0070713_100119176 3300005436 Bacteria 2312
49 Ga0070713_100137195 3300005436 Bacteria 2163
50 Ga0070710_10001622 3300005437 Bacteria 10623
51 Ga0070710_10029445 3300005437 Bacteria 2947
52 Ga0070701_10099464 3300005438 Bacteria 1608
53 Ga0070711_100106196 3300005439 Bacteria 2052
54 Ga0070705_100163366 3300005440 Bacteria 1491
55 Ga0070700_100696001 3300005441 Bacteria 807
56 Ga0070663_100011972 3300005455 Bacteria 5471
57 Ga0070663_100049973 3300005455 Bacteria 2972
58 Ga0070663_100066779 3300005455 Bacteria 2607
59 Ga0070663_100071943 3300005455 Bacteria 2518
60 Ga0070678_100007842 3300005456 Bacteria 6353
61 Ga0070678_100040699 3300005456 Bacteria 3289
62 Ga0070678_100213115 3300005456 Bacteria 1601
63 Ga0070662_100116684 3300005457 Bacteria 2041
64 Ga0070681_10057282 3300005458 Bacteria 3877
65 Ga0070681_10166491 3300005458 Bacteria 2127
66 Ga0070681_10241297 3300005458 Bacteria 1721
67 Ga0068867_100376315 3300005459 Bacteria 1192
68 Ga0070706_100105029 3300005467 Bacteria 2628
69 Ga0070706_100945034 3300005467 Bacteria 796
70 Ga0070707_100088722 3300005468 Bacteria 2992
71 Ga0070707_100299391 3300005468 Bacteria 1563
72 Ga0070698_100338108 3300005471 Bacteria 1437
73 Ga0070679_100014122 3300005530 Bacteria 7659
74 Ga0070679_100019456 3300005530 Bacteria 6601
75 Ga0070679_100070354 3300005530 Bacteria 3491
76 Ga0070679_100112682 3300005530 Bacteria 2706
77 Ga0070679_100135998 3300005530 Bacteria 2439
78 Ga0070679_100564567 3300005530 Bacteria 1082
79 Ga0070679_100769637 3300005530 Bacteria 906
80 Ga0070684_100005044 3300005535 Bacteria 10086
81 Ga0070684_100009975 3300005535 Bacteria 7508
82 Ga0070684_100161538 3300005535 Bacteria 2032
83 Ga0070684_100397672 3300005535 Bacteria 1270
84 Ga0068853_100004408 3300005539 Bacteria 10900
85 Ga0068853_100841864 3300005539 Bacteria 879
86 Ga0068853_100852955 3300005539 Bacteria 874
87 Ga0068853_100886362 3300005539 Bacteria 857
88 Ga0070672_100074296 3300005543 Bacteria 2711
89 Ga0070672_100106450 3300005543 Bacteria 2281
90 Ga0070672_100396874 3300005543 Bacteria 1182
91 Ga0070686_100164062 3300005544 Bacteria 1567
92 Ga0070693_100176930 3300005547 Bacteria 1371
93 Ga0070693_100303737 3300005547 Bacteria 1077
94 Ga0070665_100061335 3300005548 Bacteria 3769
95 Ga0070665_100344735 3300005548 Bacteria 1495
96 Ga0070665_100362326 3300005548 Bacteria 1456
97 Ga0068855_100020164 3300005563 Bacteria 8006
98 Ga0068855_100031608 3300005563 Bacteria 6321
99 Ga0068855_100050152 3300005563 Bacteria 4920
100 Ga0068855_100198629 3300005563 Bacteria 2259
101 Ga0068855_100357095 3300005563 Bacteria 1609
102 Ga0068855_100960747 3300005563 Bacteria 899
103 Ga0070664_100027907 3300005564 Bacteria 4694
104 Ga0070664_100417265 3300005564 Bacteria 1229
105 Ga0068857_100087798 3300005577 Bacteria 2782
106 Ga0068857_100708625 3300005577 Bacteria 957
107 Ga0068856_100001827 3300005614 Bacteria 22255
108 Ga0068856_100094136 3300005614 Bacteria 2982
109 Ga0068856_100503865 3300005614 Bacteria 1232
110 Ga0068856_100695005 3300005614 Bacteria 1037
111 Ga0070702_100115420 3300005615 Bacteria 1672
112 Ga0068852_100194657 3300005616 Bacteria 1915
113 Ga0068852_100199577 3300005616 Bacteria 1892
114 Ga0068852_100224325 3300005616 Bacteria 1788
115 Ga0068852_100785485 3300005616 Bacteria 966
116 Ga0068852_101191711 3300005616 Bacteria 782
117 Ga0068859_100096353 3300005617 Bacteria 3011
118 Ga0068859_101024744 3300005617 Bacteria 907
119 Ga0068864_100050579 3300005618 Bacteria 3577
120 Ga0068864_100054265 3300005618 Bacteria 3459
121 Ga0068864_100217171 3300005618 Bacteria 1763
122 Ga0068866_10189230 3300005718 Bacteria 1222
123 Ga0068863_100187248 3300005841 Bacteria 1988
124 Ga0068863_100674895 3300005841 Bacteria 1026
125 Ga0068858_100146094 3300005842 Bacteria 2221
126 Ga0068858_100147587 3300005842 Bacteria 2209
127 Ga0068858_100214799 3300005842 Bacteria 1821
128 Ga0068858_100217521 3300005842 Bacteria 1809
129 Ga0068858_100519975 3300005842 Bacteria 1151
130 Ga0068858_100849174 3300005842 Bacteria 892
131 Ga0068860_100000081 3300005843 Bacteria 170066
132 Ga0068860_100115374 3300005843 Bacteria 2568
133 Ga0068860_100914621 3300005843 Bacteria 894
134 Ga0068862_100260310 3300005844 Bacteria 1583
135 Ga0081455_10013417 3300005937 Bacteria 8100
136 Ga0081455_10041329 3300005937 Bacteria 4056
137 Ga0081455_10094508 3300005937 Bacteria 2415
138 Ga0081455_10143692 3300005937 Bacteria 1849
139 Ga0081540_1003965 3300005983 Bacteria 11501
140 Ga0081540_1005624 3300005983 Bacteria 9335
141 Ga0081540_1005692 3300005983 Bacteria 9250
142 Ga0081540_1010058 3300005983 Bacteria 6440
143 Ga0081540_1014480 3300005983 Bacteria 5048
144 Ga0081540_1035706 3300005983 Bacteria 2662
145 Ga0081540_1043747 3300005983 Bacteria 2293
146 Ga0081540_1056296 3300005983 Bacteria 1909
147 Ga0081539_10000768 3300005985 Bacteria 63055
148 Ga0081539_10001470 3300005985 Bacteria 39952
149 Ga0081539_10019985 3300005985 Bacteria 4555
150 Ga0081539_10067278 3300005985 Bacteria 1938
151 Ga0081539_10231561 3300005985 Bacteria 834
152 Ga0070717_10076659 3300006028 Bacteria 2799
153 Ga0070717_10146487 3300006028 Bacteria 2040
154 Ga0070717_10376256 3300006028 Bacteria 1273
155 Ga0070717_10908434 3300006028 Bacteria 802
156 Ga0075365_10008428 3300006038 Bacteria 5852
157 Ga0075365_10021294 3300006038 Bacteria 4042
158 Ga0075365_10118150 3300006038 Bacteria 1827
159 Ga0075365_10178734 3300006038 Bacteria 1483
160 Ga0075368_10051146 3300006042 Bacteria 1642
161 Ga0075368_10102549 3300006042 Bacteria 1176
162 Ga0075368_10116397 3300006042 Bacteria 1105
163 Ga0075368_10195298 3300006042 Bacteria 855
164 Ga0075363_100006965 3300006048 Bacteria 5170
165 Ga0075363_100022057 3300006048 Bacteria 3215
166 Ga0075364_10186255 3300006051 Bacteria 1405
167 Ga0070716_100001846 3300006173 Bacteria 9603
168 Ga0070716_100685945 3300006173 Bacteria 781
169 Ga0070712_100006733 3300006175 Bacteria 7144
170 Ga0070712_100024328 3300006175 Bacteria 4012
171 Ga0070712_100044059 3300006175 Bacteria 3075
172 Ga0075362_10068310 3300006177 Bacteria 1618
173 Ga0075367_10029890 3300006178 Bacteria 3120
174 Ga0075369_10052362 3300006186 Bacteria 1769
175 Ga0075366_10056277 3300006195 Bacteria 2336
176 Ga0097621_100341101 3300006237 Bacteria 1331
177 Ga0075370_10103498 3300006353 Bacteria 1649
178 Ga0075370_10142858 3300006353 Bacteria 1400
179 Ga0068871_100078523 3300006358 Bacteria 2729
180 Ga0068871_100687021 3300006358 Bacteria 937
181 Ga0075434_100270509 3300006871 Bacteria 1718
182 Ga0075434_100541799 3300006871 Bacteria 1184
183 Ga0068865_100033651 3300006881 Bacteria 3432
184 Ga0068865_100040328 3300006881 Bacteria 3172
185 Ga0097620_100096353 3300006931 Bacteria 3011
186 Ga0097620_101024770 3300006931 Bacteria 907
187 Ga0099825_1017324 3300006941 Bacteria 5917
188 Ga0099822_1018218 3300006943 Bacteria 7346
189 Ga0099823_1059808 3300006944 Bacteria 2016
190 Ga0075435_100325964 3300007076 Bacteria 1315
191 Ga0099794_10011757 3300007265 Bacteria 3758
192 Ga0099794_10097011 3300007265 Bacteria 1468
193 Ga0099795_10014182 3300007788 Bacteria 2464
194 Ga0099795_10058655 3300007788 Bacteria 1422
195 Ga0099795_10134606 3300007788 Bacteria 1000
196 Ga0105250_10170836 3300009092 Bacteria 910
197 Ga0105240_10026622 3300009093 Bacteria 7589
198 Ga0105240_10034709 3300009093 Bacteria 6503
199 Ga0105240_10055828 3300009093 Bacteria 4944
200 Ga0105240_10125422 3300009093 Bacteria 3086
201 Ga0105240_10145106 3300009093 Bacteria 2833
202 Ga0105240_10460048 3300009093 Bacteria 1422
203 Ga0105240_10817350 3300009093 Bacteria 1008
204 Ga0105240_11124568 3300009093 Bacteria 835
205 Ga0105245_10033125 3300009098 Bacteria 4577
206 Ga0105245_10258800 3300009098 Bacteria 1693
207 Ga0105245_10809687 3300009098 Bacteria 975
208 Ga0105247_10008197 3300009101 Bacteria 6379
209 Ga0105247_10104916 3300009101 Bacteria 1811
210 Ga0105247_10253365 3300009101 Bacteria 1204
211 Ga0105243_10018993 3300009148 Bacteria 5211
212 Ga0105243_10405296 3300009148 Bacteria 1268
213 Ga0105243_10570125 3300009148 Bacteria 1085
214 Ga0105241_10030969 3300009174 Bacteria 4001
215 Ga0105242_10153337 3300009176 Bacteria 2011
216 Ga0105242_10322761 3300009176 Bacteria 1417
217 Ga0105242_10442847 3300009176 Bacteria 1223
218 Ga0105242_10537981 3300009176 Bacteria 1118
219 Ga0105248_10075716 3300009177 Bacteria 3782
220 Ga0105248_10093026 3300009177 Bacteria 3395
221 Ga0105248_10097999 3300009177 Bacteria 3303
222 Ga0105248_10633706 3300009177 Bacteria 1206
223 Ga0105237_10012336 3300009545 Bacteria 9004
224 Ga0105237_10024997 3300009545 Bacteria 6110
225 Ga0105237_10044165 3300009545 Bacteria 4487
226 Ga0105237_10081141 3300009545 Bacteria 3234
227 Ga0105237_10180622 3300009545 Bacteria 2110
228 Ga0105237_10242635 3300009545 Bacteria 1803
229 Ga0105237_10645509 3300009545 Bacteria 1065
230 Ga0105238_10015861 3300009551 Bacteria 7625
231 Ga0105238_10083037 3300009551 Bacteria 3193
232 Ga0105238_10415895 3300009551 Bacteria 1339
233 Ga0105238_10543691 3300009551 Bacteria 1165
234 Ga0105238_10652073 3300009551 Bacteria 1063
235 Ga0105249_10118682 3300009553 Bacteria 2511
236 Ga0099796_10044327 3300010159 Bacteria 1519
237 Ga0105239_10017391 3300010375 Bacteria 7952
238 Ga0105239_10031991 3300010375 Bacteria 5781
239 Ga0105239_10075749 3300010375 Bacteria 3700
240 Ga0105239_10193690 3300010375 Bacteria 2276
241 Ga0105246_10031772 3300011119 Bacteria 3496
242 Ga0105246_10070395 3300011119 Bacteria 2460
243 Ga0105246_10343304 3300011119 Bacteria 1221
244 Ga0157373_10344774 3300013100 Bacteria 1062
245 Ga0157371_10095539 3300013102 Bacteria 2106
246 Ga0157371_10308039 3300013102 Bacteria 1147
247 Ga0157370_10027113 3300013104 Bacteria 5649
248 Ga0157370_10105073 3300013104 Bacteria 2643
249 Ga0157370_10403770 3300013104 Bacteria 1257
250 Ga0157369_10015050 3300013105 Bacteria 8730
251 Ga0157369_10021463 3300013105 Bacteria 7224
252 Ga0157369_10104910 3300013105 Bacteria 3009
253 Ga0157369_10858147 3300013105 Bacteria 932
254 Ga0157374_10070236 3300013296 Bacteria 3299
255 Ga0157374_10684606 3300013296 Bacteria 1038
256 Ga0163162_10138896 3300013306 Bacteria 2542
257 Ga0163162_10237640 3300013306 Bacteria 1952
258 Ga0163162_10303134 3300013306 Bacteria 1730
259 Ga0163162_10337567 3300013306 Bacteria 1639
260 Ga0157372_10402452 3300013307 Bacteria 1595
261 Ga0157372_10439338 3300013307 Bacteria 1521
262 Ga0157375_10079932 3300013308 Bacteria 3306
263 Ga0157375_10390085 3300013308 Bacteria 1559
264 Ga0157375_10637335 3300013308 Bacteria 1223
265 Ga0163163_10072423 3300014325 Bacteria 3435
266 Ga0163163_10109318 3300014325 Bacteria 2792
267 Ga0163163_10238282 3300014325 Bacteria 1869
268 Ga0163163_10291199 3300014325 Bacteria 1685
269 Ga0163163_11126544 3300014325 Bacteria 848
270 Ga0157380_10330482 3300014326 Bacteria 1417
271 Ga0157380_11231924 3300014326 Bacteria 793
272 Ga0182008_10163633 3300014497 Bacteria 1120
273 Ga0157379_10078989 3300014968 Bacteria 2947
274 Ga0157379_10254156 3300014968 Bacteria 1596
275 Ga0157379_10393617 3300014968 Bacteria 1273
276 Ga0157376_10040939 3300014969 Bacteria 3790
277 Ga0157376_10145143 3300014969 Bacteria 2134
278 Ga0163161_10051522 3300017792 Bacteria 2982
279 Ga0163161_10256175 3300017792 Bacteria 1365
280 Ga0206353_11236131 3300020082 Bacteria 795
281 Ga0214544_1001813 3300021320 Bacteria 44864
282 Ga0214544_1029472 3300021320 Bacteria 2020
283 Ga0214544_1032156 3300021320 Bacteria 1663
284 Ga0214542_1001236 3300021321 Bacteria 51849
285 Ga0214542_1029050 3300021321 Bacteria 2310
286 Ga0214542_1040372 3300021321 Bacteria 1200
287 Ga0214542_1040750 3300021321 Bacteria 1181
288 Ga0214545_1000924 3300021324 Bacteria 51830
289 Ga0214545_1023872 3300021324 Bacteria 3911
290 Ga0214543_1003531 3300021327 Bacteria 30263
291 Ga0214543_1025126 3300021327 Bacteria 3507
292 Ga0214543_1035012 3300021327 Bacteria 1674
293 Ga0214543_1041233 3300021327 Bacteria 1200
294 Ga0213873_10028627 3300021358 Bacteria 1367
295 Ga0213876_10001431 3300021384 Bacteria 14868
296 Ga0209563_108847 3300025230 Bacteria 1562
297 Ga0207425_1007829 3300025245 Bacteria 2785
298 Ga0209677_113470 3300025253 Bacteria 1160
299 Ga0209148_1000180 3300025254 Bacteria 124830
300 Ga0209233_1001441 3300025261 Bacteria 9387
301 Ga0209233_1003552 3300025261 Bacteria 5483
302 Ga0209233_1022482 3300025261 Bacteria 1612
303 Ga0209233_1028978 3300025261 Bacteria 1322
304 Ga0209455_1022828 3300025272 Bacteria 1184
305 Ga0209130_1040756 3300025284 Bacteria 896
306 Ga0209564_1000385 3300025295 Bacteria 80273
307 Ga0209564_1011033 3300025295 Bacteria 4087
308 Ga0209758_1000011 3300025297 Bacteria 1049685
309 Ga0209758_1000133 3300025297 Bacteria 182442
310 Ga0209758_1001210 3300025297 Bacteria 32486
311 Ga0209758_1011006 3300025297 Bacteria 5307
312 Ga0209758_1015407 3300025297 Bacteria 3961
313 Ga0209256_1005155 3300025299 Bacteria 7715
314 Ga0209256_1024267 3300025299 Bacteria 1789
315 Ga0209256_1024426 3300025299 Bacteria 1779
316 Ga0207426_1000572 3300025302 Bacteria 49561
317 Ga0207426_1001763 3300025302 Bacteria 16381
318 Ga0207426_1006362 3300025302 Bacteria 5153
319 Ga0207697_10230640 3300025315 Bacteria 817
320 Ga0207656_10141294 3300025321 Bacteria 1135
321 Ga0207692_10010389 3300025898 Bacteria 3921
322 Ga0207692_10012280 3300025898 Bacteria 3674
323 Ga0207692_10156023 3300025898 Bacteria 1311
324 Ga0207692_10265572 3300025898 Bacteria 1033
325 Ga0207642_10064945 3300025899 Bacteria 1713
326 Ga0207642_10217426 3300025899 Bacteria 1066
327 Ga0207710_10050507 3300025900 Bacteria 1866
328 Ga0207688_10013784 3300025901 Bacteria 4393
329 Ga0207688_10027182 3300025901 Bacteria 3147
330 Ga0207680_10322944 3300025903 Bacteria 1080
331 Ga0207647_10256686 3300025904 Bacteria 1002
332 Ga0207685_10032271 3300025905 Bacteria 1883
333 Ga0207685_10077271 3300025905 Bacteria 1367
334 Ga0207699_10004445 3300025906 Bacteria 6706
335 Ga0207699_10021389 3300025906 Bacteria 3485
336 Ga0207699_10021591 3300025906 Bacteria 3473
337 Ga0207699_10029552 3300025906 Bacteria 3057
338 Ga0207699_10149149 3300025906 Bacteria 1545
339 Ga0207699_10204556 3300025906 Bacteria 1340
340 Ga0207645_10064837 3300025907 Bacteria 2334
341 Ga0207643_10062976 3300025908 Bacteria 2120
342 Ga0207705_10051852 3300025909 Bacteria 2953
343 Ga0207684_10082993 3300025910 Bacteria 2729
344 Ga0207654_10040051 3300025911 Bacteria 2639
345 Ga0207654_10362035 3300025911 Bacteria 1001
346 Ga0207707_10002705 3300025912 Bacteria 15850
347 Ga0207707_10173010 3300025912 Bacteria 1887
348 Ga0207707_10200980 3300025912 Bacteria 1738
349 Ga0207695_10000008 3300025913 Bacteria 1058268
350 Ga0207695_10104517 3300025913 Bacteria 2821
351 Ga0207695_10187313 3300025913 Bacteria 1988
352 Ga0207671_10005294 3300025914 Bacteria 11960
353 Ga0207671_10009638 3300025914 Bacteria 8050
354 Ga0207671_10041027 3300025914 Bacteria 3425
355 Ga0207671_10059807 3300025914 Bacteria 2826
356 Ga0207671_10206717 3300025914 Bacteria 1534
357 Ga0207671_10444980 3300025914 Bacteria 1032
358 Ga0207671_10519638 3300025914 Bacteria 949
359 Ga0207693_10004777 3300025915 Bacteria 11394
360 Ga0207693_10006974 3300025915 Bacteria 9332
361 Ga0207693_10014354 3300025915 Bacteria 6372
362 Ga0207693_10015344 3300025915 Bacteria 6148
363 Ga0207693_10053164 3300025915 Bacteria 3178
364 Ga0207693_10136318 3300025915 Bacteria 1930
365 Ga0207693_10346044 3300025915 Bacteria 1163
366 Ga0207663_10002050 3300025916 Bacteria 9597
367 Ga0207663_10033664 3300025916 Bacteria 3055
368 Ga0207663_10221108 3300025916 Bacteria 1378
369 Ga0207660_10006961 3300025917 Bacteria 7324
370 Ga0207660_10033360 3300025917 Bacteria 3561
371 Ga0207660_10274950 3300025917 Bacteria 1335
372 Ga0207662_10085372 3300025918 Bacteria 1933
373 Ga0207657_10006890 3300025919 Bacteria 11724
374 Ga0207657_10034513 3300025919 Bacteria 4547
375 Ga0207649_10263314 3300025920 Bacteria 1247
376 Ga0207652_10001690 3300025921 Bacteria 19300
377 Ga0207652_10065122 3300025921 Bacteria 3155
378 Ga0207652_10090468 3300025921 Bacteria 2689
379 Ga0207652_10101751 3300025921 Bacteria 2538
380 Ga0207652_10117474 3300025921 Bacteria 2363
381 Ga0207652_10236636 3300025921 Bacteria 1646
382 Ga0207652_10502817 3300025921 Bacteria 1091
383 Ga0207646_10053986 3300025922 Bacteria 3595
384 Ga0207681_10611511 3300025923 Bacteria 901
385 Ga0207694_10005031 3300025924 Bacteria 10225
386 Ga0207694_10324194 3300025924 Bacteria 1272
387 Ga0207694_10372001 3300025924 Bacteria 1185
388 Ga0207659_10483071 3300025926 Bacteria 1047
389 Ga0207687_10091412 3300025927 Bacteria 2220
390 Ga0207700_10063585 3300025928 Bacteria 2807
391 Ga0207700_10087847 3300025928 Bacteria 2446
392 Ga0207700_10112570 3300025928 Bacteria 2193
393 Ga0207700_10219058 3300025928 Bacteria 1613
394 Ga0207700_10322788 3300025928 Bacteria 1338
395 Ga0207664_10002721 3300025929 Bacteria 11731
396 Ga0207664_10016371 3300025929 Bacteria 5409
397 Ga0207664_10432638 3300025929 Bacteria 1173
398 Ga0207664_10590784 3300025929 Bacteria 997
399 Ga0207664_10703412 3300025929 Bacteria 909
400 Ga0207644_10076825 3300025931 Bacteria 2458
401 Ga0207690_10503143 3300025932 Bacteria 980
402 Ga0207690_10783159 3300025932 Bacteria 787
403 Ga0207706_10034381 3300025933 Bacteria 4510
404 Ga0207686_10096308 3300025934 Bacteria 1966
405 Ga0207686_10219824 3300025934 Bacteria 1371
406 Ga0207709_10236759 3300025935 Bacteria 1325
407 Ga0207670_10174646 3300025936 Bacteria 1614
408 Ga0207704_10069584 3300025938 Bacteria 2224
409 Ga0207704_10103399 3300025938 Bacteria 1905
410 Ga0207665_10001320 3300025939 Bacteria 16732
411 Ga0207665_10010178 3300025939 Bacteria 6173
412 Ga0207711_10106450 3300025941 Bacteria 2489
413 Ga0207711_10108996 3300025941 Bacteria 2460
414 Ga0207711_10148134 3300025941 Bacteria 2116
415 Ga0207689_10032632 3300025942 Bacteria 4329
416 Ga0207661_10001270 3300025944 Bacteria 16867
417 Ga0207661_10008424 3300025944 Bacteria 7371
418 Ga0207661_10021928 3300025944 Bacteria 4796
419 Ga0207679_10054338 3300025945 Bacteria 2947
420 Ga0207679_10103081 3300025945 Bacteria 2236
421 Ga0207667_10002017 3300025949 Bacteria 25487
422 Ga0207667_10159022 3300025949 Bacteria 2324
423 Ga0207667_10204693 3300025949 Bacteria 2024
424 Ga0207667_10291746 3300025949 Bacteria 1666
425 Ga0207667_10318094 3300025949 Bacteria 1589
426 Ga0207668_10023206 3300025972 Bacteria 3983
427 Ga0207668_10516617 3300025972 Bacteria 1030
428 Ga0207640_10235256 3300025981 Bacteria 1412
429 Ga0207640_10569355 3300025981 Bacteria 955
430 Ga0207658_10395783 3300025986 Bacteria 1213
431 Ga0207658_10491338 3300025986 Bacteria 1092
432 Ga0207677_10014286 3300026023 Bacteria 4632
433 Ga0207677_10094719 3300026023 Bacteria 2180
434 Ga0207703_10057761 3300026035 Bacteria 3165
435 Ga0207703_10590460 3300026035 Bacteria 1050
436 Ga0207639_10014358 3300026041 Bacteria 5569
437 Ga0207639_10194488 3300026041 Bacteria 1735
438 Ga0207678_10013434 3300026067 Bacteria 7187
439 Ga0207678_10043423 3300026067 Bacteria 3890
440 Ga0207678_10044113 3300026067 Bacteria 3858
441 Ga0207678_10056735 3300026067 Bacteria 3371
442 Ga0207678_10133768 3300026067 Bacteria 2115
443 Ga0207702_10002952 3300026078 Bacteria 15870
444 Ga0207702_10273621 3300026078 Bacteria 1594
445 Ga0207702_10377753 3300026078 Bacteria 1362
446 Ga0207702_10600858 3300026078 Bacteria 1079
447 Ga0207702_10830616 3300026078 Bacteria 914
448 Ga0207641_10142070 3300026088 Bacteria 2167
449 Ga0207641_10209060 3300026088 Bacteria 1804
450 Ga0207648_10086612 3300026089 Bacteria 2733
451 Ga0207648_10376351 3300026089 Bacteria 1283
452 Ga0207676_10667987 3300026095 Bacteria 1004
453 Ga0207674_10071396 3300026116 Bacteria 3488
454 Ga0207674_10608841 3300026116 Bacteria 1055
455 Ga0207674_10680628 3300026116 Bacteria 993
456 Ga0207675_100233128 3300026118 Bacteria 1777
457 Ga0207683_10782212 3300026121 Bacteria 886
458 Ga0207698_10045951 3300026142 Bacteria 3293
459 Ga0207698_10121806 3300026142 Bacteria 2209
460 Ga0207698_10218793 3300026142 Bacteria 1719
461 Ga0207698_10913554 3300026142 Bacteria 885
462 Ga0209389_1000001 3300027296 Bacteria 463799
463 Ga0209389_1000115 3300027296 Bacteria 71798
464 Ga0209589_1000014 3300027357 Bacteria 227996
465 Ga0209589_1000033 3300027357 Bacteria 140561
466 Ga0209489_100014 3300027361 Bacteria 227996
467 Ga0209489_100040 3300027361 Bacteria 164986
468 Ga0209489_100612 3300027361 Bacteria 69168
469 Ga0209700_100007 3300027363 Bacteria 454608
470 Ga0209700_100024 3300027363 Bacteria 227996
471 Ga0209179_1004389 3300027512 Bacteria 2123
472 Ga0209588_1006547 3300027671 Bacteria 3391
473 Ga0209588_1039035 3300027671 Bacteria 1531
474 Ga0209813_10120758 3300027866 Bacteria 912
475 Ga0209813_10166207 3300027866 Bacteria 799
476 Ga0268266_10008590 3300028379 Bacteria 9072
477 Ga0268266_10381617 3300028379 Bacteria 1329
478 Ga0268266_10548059 3300028379 Bacteria 1108
479 Ga0268265_10122547 3300028380 Bacteria 2144
480 Ga0268265_10218799 3300028380 Bacteria 1665
481 Ga0268265_10355923 3300028380 Bacteria 1338
482 Ga0268265_10364172 3300028380 Bacteria 1324
483 Ga0268264_10000048 3300028381 Bacteria 334457
484 Ga0268264_10530728 3300028381 Bacteria 1152
485 Ga0265337_1007889 3300028556 Bacteria 3937
486 Ga0265334_10005731 3300028573 Bacteria 5414
487 Ga0265323_10019130 3300028653 Bacteria 2644
488 Ga0265336_10000362 3300028666 Bacteria 29324
489 Ga0307517_10000634 3300028786 Bacteria 60194
490 Ga0307515_10006012 3300028794 Bacteria 24419
491 Ga0265338_10001385 3300028800 Bacteria 39441
492 Ga0307511_10101412 3300030521 Bacteria 1887
493 Ga0265330_10017515 3300031235 Bacteria 3298
494 Ga0265330_10034042 3300031235 Bacteria 2276
495 Ga0265332_10021959 3300031238 Bacteria 2817
496 Ga0265328_10007270 3300031239 Bacteria 4628
497 Ga0265328_10076374 3300031239 Bacteria 1233
498 Ga0265325_10008844 3300031241 Bacteria 5916
499 Ga0265340_10158752 3300031247 Bacteria 1028
500 Ga0265339_10008162 3300031249 Bacteria 6683
501 Ga0265331_10021239 3300031250 Bacteria 3325
502 Ga0265316_10320410 3300031344 Bacteria 1126
503 Ga0307513_10276547 3300031456 Bacteria 1459
504 Ga0307509_10005537 3300031507 Bacteria 17522
505 Ga0307509_10206607 3300031507 Bacteria 1793
506 Ga0307509_10407196 3300031507 Bacteria 1065
507 Ga0307408_101004154 3300031548 Bacteria 769
508 Ga0307508_10000032 3300031616 Bacteria 163293
509 Ga0307508_10372435 3300031616 Bacteria 1019
510 Ga0307508_10432315 3300031616 Bacteria 908
511 Ga0265314_10002560 3300031711 Bacteria 18464
512 Ga0265314_10002580 3300031711 Bacteria 18334
513 Ga0265314_10102344 3300031711 Bacteria 1838
514 Ga0307516_10005934 3300031730 Bacteria 14450
515 Ga0307516_10068507 3300031730 Bacteria 3417
516 Ga0307516_10124641 3300031730 Bacteria 2362
517 Ga0307516_10257667 3300031730 Bacteria 1436
518 Ga0307516_10485636 3300031730 Bacteria 890
519 Ga0307413_10342064 3300031824 Bacteria 1151
520 Ga0307406_10185047 3300031901 Bacteria 1520
521 Ga0307412_10153348 3300031911 Bacteria 1703
522 Ga0307414_10075999 3300032004 Bacteria 2440
523 Ga0307507_10011278 3300033179 Bacteria 11327
524 Ga0307510_10023885 3300033180 Bacteria 7075
525 Ga0307510_10030948 3300033180 Bacteria 6057
526 Ga0307510_10031256 3300033180 Bacteria 6020
527 Ga0307510_10116818 3300033180 Bacteria 2388
528 Ga0307510_10170518 3300033180 Bacteria 1756
529 Ga0307510_10215439 3300033180 Bacteria 1438
530 Ga0315911_1000002 3300033442 Bacteria 926833
531 Ga0373938_0022256 3300034957 Bacteria 1293
532 Ga0373928_0005474 3300035084 Bacteria 2428
533 Ga0373934_0016831 3300035086 Bacteria 2783
534 Ga0373934_0085874 3300035086 Bacteria 1266
535 Ga0373944_0025260 3300035089 Bacteria 1748
536 Ga0373923_0008272 3300035111 Bacteria 3702
537 Ga0373923_0021636 3300035111 Bacteria 2512
538 Ga0373923_0032934 3300035111 Bacteria 2096
539 Ga0373936_0014550 3300035113 Bacteria 3011
540 Ga0373936_0035815 3300035113 Bacteria 1977
541 Ga0373945_0046796 3300035116 Bacteria 1580
542 Ga0373945_0070345 3300035116 Bacteria 1323
543 Ga0373953_0036149 3300035117 Bacteria 1944
544 Ga0373954_0055843 3300035118 Bacteria 1858
545 Ga0373957_0007517 3300035120 Bacteria 3488
546 Ga0373943_0013488 3300035170 Bacteria 3691
547 Ga0373943_0223402 3300035170 Bacteria 1050
548 Ga0373946_0004997 3300035171 Bacteria 4775
549 Ga0373946_0039352 3300035171 Bacteria 1930
550 Ga0373946_0055373 3300035171 Bacteria 1672
551 Ga0373955_0002074 3300035172 Bacteria 8641
552 Ga0373955_0081494 3300035172 Bacteria 1830
553 Ga0373955_0127362 3300035172 Bacteria 1484
554 Ga0373955_0144524 3300035172 Bacteria 1396
555 Ga0373924_0017806 3300035410 Bacteria 2731
556 Ga0373931_0003529 3300035691 Bacteria 7049
557 Ga0373931_0009359 3300035691 Bacteria 4683
558 Ga0373931_0174913 3300035691 Bacteria 1267
559 Ga0373935_0003875 3300035692 Bacteria 8728
560 Ga0373935_0195730 3300035692 Bacteria 1394
561 Ga0373935_0326294 3300035692 Bacteria 1090
562 Ga0373927_0002882 3300035695 Bacteria 12525
563 Ga0373927_0008495 3300035695 Bacteria 6908
564 Ga0373927_0018156 3300035695 Bacteria 4626
565 Ga0373927_0023311 3300035695 Bacteria 4054
566 Ga0373927_0035141 3300035695 Bacteria 3259
567 Ga0373927_0065861 3300035695 Bacteria 2343
568 Ga0373927_0089292 3300035695 Bacteria 2001
569 Ga0373927_0179284 3300035695 Bacteria 1389
570 Ga0373933_0010030 3300035724 Bacteria 5185
571 Ga0373947_0052981 3300035725 Bacteria 2445
572 Ga0373947_0070557 3300035725 Bacteria 2141
573 Ga0373947_0199122 3300035725 Bacteria 1310
574 Ga0373937_0044597 3300036401 Bacteria 4051
575 Ga0373937_0127459 3300036401 Bacteria 2375
576 Ga0373937_0176515 3300036401 Bacteria 2006
577 Ga0373937_0216543 3300036401 Bacteria 1802
578 Ga0373925_0061485 3300037068 Bacteria 2821
579 Ga0373925_0075399 3300037068 Bacteria 2556
580 Ga0373925_0115107 3300037068 Bacteria 2082
581 Ga0373925_0143307 3300037068 Bacteria 1871
582 Ga0373925_0169719 3300037068 Bacteria 1722
583 Ga0373925_0358953 3300037068 Bacteria 1184
584 Ga0395900_0001029 3300037418 Bacteria 35765
585 Ga0395900_0029402 3300037418 Bacteria 5637
586 Ga0395900_0073178 3300037418 Bacteria 3523
587 Ga0395900_0333659 3300037418 Bacteria 1494
588 Ga0395898_0002778 3300037466 Bacteria 20117
589 Ga0395898_0015307 3300037466 Bacteria 7872
590 Ga0395898_0022553 3300037466 Bacteria 6376
591 Ga0395898_0036427 3300037466 Bacteria 4885
592 Ga0395898_0168160 3300037466 Bacteria 2096
593 Ga0395898_0327425 3300037466 Bacteria 1461
594 Ga0395905_0055862 3300037471 Bacteria 3695
595 Ga0395905_0072510 3300037471 Bacteria 3229
596 Ga0395905_0349583 3300037471 Bacteria 1370
597 Ga0395905_0993334 3300037471 Bacteria 742
598 Ga0395901_0099375 3300038443 Bacteria 3051
599 Ga0395901_0465024 3300038443 Bacteria 1292
600 Ga0436365_0297479 3300039437 Bacteria 12092
601 Ga0436365_0692920 3300039437 Bacteria 1319
602 Ga0436365_1332974 3300039437 Bacteria 1487
603 Ga0436360_0431909 3300039438 Bacteria 1782
604 Ga0436360_0504290 3300039438 Bacteria 1089
605 Ga0436360_0991394 3300039438 Bacteria 875
606 Ga0436360_1347011 3300039438 Bacteria 697
607 Ga0436361_0243217 3300039447 Bacteria 1792
608 Ga0436361_0457301 3300039447 Bacteria 800
609 Ga0436361_0555937 3300039447 Bacteria 1238
610 Ga0436363_0130456 3300039450 Bacteria 1092
611 Ga0436363_1017085 3300039450 Bacteria 1616
612 Ga0436362_0299747 3300039453 Bacteria 3630
613 Ga0451847_0293411 3300041503 Bacteria 1016
614 Ga0466969_0010286 3300044656 Bacteria 4963
615 Ga0466969_0055449 3300044656 Bacteria 1939
616 Ga0466972_0002106 3300044658 Bacteria 9768
617 Ga0466965_0199067 3300044683 Bacteria 1062
618 Ga0466966_0000128 3300044684 Bacteria 48511
619 Ga0466966_0053431 3300044684 Bacteria 2563
620 Ga0466966_0194655 3300044684 Bacteria 1228
621 Ga0466966_0230714 3300044684 Bacteria 1117
622 Ga0466961_0000236 3300044693 Bacteria 37237
623 Ga0466963_0305926 3300044694 Bacteria 1118
624 Ga0466963_0413362 3300044694 Bacteria 951
625 Ga0466964_0041479 3300044706 Bacteria 1862
626 Ga0466964_0304968 3300044706 Bacteria 804
627 Ga0466960_0017212 3300044901 Bacteria 3146
628 Ga0466960_0033671 3300044901 Bacteria 2383
629 Ga0466959_0001099 3300045049 Bacteria 16214
630 Ga0466959_0076070 3300045049 Bacteria 2425
631 Ga0466959_0119013 3300045049 Bacteria 1879
632 Ga0466959_0228219 3300045049 Bacteria 1290
633 Ga0466958_0019026 3300045836 Bacteria 3994
634 Ga0466967_0113044 3300045976 Bacteria 2497
635 Ga0466967_0175802 3300045976 Bacteria 2017
636 Ga0466967_0460396 3300045976 Bacteria 1244
637 Ga0495617_098726 3300046452 Bacteria 950
638 Ga0495592_0013200 3300046454 Bacteria 6288
639 Ga0495592_0065398 3300046454 Bacteria 2662
640 Ga0495592_0101197 3300046454 Bacteria 2053
641 Ga0495592_0363510 3300046454 Bacteria 925
642 Ga0495603_0000217 3300046455 Bacteria 29788
643 Ga0495603_0009199 3300046455 Bacteria 5971
644 Ga0495603_0022004 3300046455 Bacteria 3860
645 Ga0495603_0049213 3300046455 Bacteria 2509
646 Ga0495590_0156394 3300046457 Bacteria 827
647 Ga0495629_0000862 3300046459 Bacteria 24478
648 Ga0495629_0021708 3300046459 Bacteria 4580
649 Ga0495629_0030060 3300046459 Bacteria 3852
650 Ga0495629_0153409 3300046459 Bacteria 1601
651 Ga0495629_0167936 3300046459 Bacteria 1523
652 Ga0495629_0540381 3300046459 Bacteria 783
653 Ga0495638_0005277 3300046460 Bacteria 9656
654 Ga0495638_0008841 3300046460 Bacteria 7110
655 Ga0495638_0052200 3300046460 Bacteria 2547
656 Ga0495638_0226002 3300046460 Bacteria 1044
657 Ga0495641_0003672 3300046461 Bacteria 11330
658 Ga0495641_0032216 3300046461 Bacteria 2496
659 Ga0495651_0001756 3300046462 Bacteria 16727
660 Ga0495653_0062866 3300046463 Bacteria 2804
661 Ga0495580_0005364 3300046472 Bacteria 10616
662 Ga0495580_0006588 3300046472 Bacteria 9437
663 Ga0495580_0041543 3300046472 Bacteria 3280
664 Ga0495580_0181880 3300046472 Bacteria 1452
665 Ga0495580_0294261 3300046472 Bacteria 1106
666 Ga0495582_0000990 3300046473 Bacteria 15910
667 Ga0495582_0023883 3300046473 Bacteria 3343
668 Ga0495605_0102522 3300046474 Bacteria 1314
669 Ga0495639_0000544 3300046475 Bacteria 17562
670 Ga0495639_0017690 3300046475 Bacteria 3097
671 Ga0495639_0170585 3300046475 Bacteria 1056
672 Ga0495639_0317297 3300046475 Bacteria 779
673 Ga0495662_0001589 3300046476 Bacteria 11287
674 Ga0495664_0001505 3300046477 Bacteria 12344
675 Ga0495664_0070721 3300046477 Bacteria 2084
676 Ga0495664_0077786 3300046477 Bacteria 1987
677 Ga0495664_0121258 3300046477 Bacteria 1581
678 Ga0495585_0072186 3300046492 Bacteria 1881
679 Ga0495585_0301669 3300046492 Bacteria 787
680 Ga0495594_0000128 3300046499 Bacteria 35750
681 Ga0495607_0204860 3300046501 Bacteria 974
682 Ga0495583_0025356 3300046506 Bacteria 2963
683 Ga0495606_0052648 3300046507 Bacteria 2645
684 Ga0495606_0063466 3300046507 Bacteria 2354
685 Ga0495606_0072414 3300046507 Bacteria 2165
686 Ga0495606_0177070 3300046507 Bacteria 1233
687 Ga0495608_0022212 3300046511 Bacteria 4348
688 Ga0495608_0048299 3300046511 Bacteria 2828
689 Ga0495608_0264012 3300046511 Bacteria 1071
690 Ga0495610_0152922 3300046512 Bacteria 982
691 Ga0495610_0159637 3300046512 Bacteria 954
692 Ga0495616_0037223 3300046513 Bacteria 2505
693 Ga0495616_0068104 3300046513 Bacteria 1729
694 Ga0495618_0112331 3300046514 Bacteria 1745
695 Ga0495618_0226137 3300046514 Bacteria 1179
696 Ga0495620_0019752 3300046515 Bacteria 3306
697 Ga0495628_0017576 3300046516 Bacteria 5949
698 Ga0495628_0039638 3300046516 Bacteria 3767
699 Ga0495628_0112715 3300046516 Bacteria 2091
700 Ga0495628_0113435 3300046516 Bacteria 2083
701 Ga0495628_0133441 3300046516 Bacteria 1898
702 Ga0495630_0036462 3300046517 Bacteria 3676
703 Ga0495630_0668546 3300046517 Bacteria 795
704 Ga0495632_0172967 3300046519 Bacteria 991
705 Ga0495643_0061414 3300046522 Bacteria 1993
706 Ga0495643_0063321 3300046522 Bacteria 1956
707 Ga0495643_0068935 3300046522 Bacteria 1860
708 Ga0495648_0000936 3300046524 Bacteria 30292
709 Ga0495648_0040934 3300046524 Bacteria 2932
710 Ga0495648_0049911 3300046524 Bacteria 2561
711 Ga0495666_0013204 3300046526 Bacteria 4118
712 Ga0495666_0044738 3300046526 Bacteria 2137
713 Ga0495652_0007874 3300046529 Bacteria 9783
714 Ga0495652_0582583 3300046529 Bacteria 765
715 Ga0495654_0030044 3300046530 Bacteria 2767
716 Ga0495640_0002595 3300046533 Bacteria 14526
717 Ga0495640_0027356 3300046533 Bacteria 4113
718 Ga0495640_0036958 3300046533 Bacteria 3448
719 Ga0495640_0073084 3300046533 Bacteria 2296
720 Ga0495640_0115722 3300046533 Bacteria 1747
721 Ga0495587_0018206 3300046536 Bacteria 4357
722 Ga0495645_0035879 3300046543 Bacteria 3615
723 Ga0495645_0085462 3300046543 Bacteria 2258
724 Ga0495645_0092361 3300046543 Bacteria 2161
725 Ga0495645_0119758 3300046543 Bacteria 1854
726 Ga0495622_0019117 3300046557 Bacteria 3190
727 Ga0495622_0020586 3300046557 Bacteria 3072
728 Ga0495622_0028278 3300046557 Bacteria 2618
729 Ga0495622_0164145 3300046557 Bacteria 1001
730 Ga0495622_0294810 3300046557 Bacteria 707
731 Ga0495633_0256519 3300046558 Bacteria 797
732 Ga0495667_0018942 3300046559 Bacteria 4646
733 Ga0495667_0022214 3300046559 Bacteria 4276
734 Ga0495667_0102853 3300046559 Bacteria 1847
735 Ga0495656_0085052 3300046615 Bacteria 1436
736 Ga0495634_0001583 3300046642 Bacteria 19998
737 Ga0495634_0024426 3300046642 Bacteria 4241
738 Ga0495634_0048105 3300046642 Bacteria 2872
739 Ga0495634_0064787 3300046642 Bacteria 2422
740 Ga0495634_0089301 3300046642 Bacteria 2003
741 Ga0495611_0019750 3300046648 Bacteria 2896
742 Ga0495625_0025626 3300046660 Bacteria 4470
743 Ga0495625_0044250 3300046660 Bacteria 3224
744 Ga0495625_0107919 3300046660 Bacteria 1905
745 Ga0495635_0000436 3300046663 Bacteria 26341
746 Ga0495635_0015088 3300046663 Bacteria 5404
747 Ga0495635_0016639 3300046663 Bacteria 5137
748 Ga0495635_0026390 3300046663 Bacteria 4042
749 Ga0495635_0028565 3300046663 Bacteria 3877
750 Ga0495661_0030247 3300046665 Bacteria 3450
751 Ga0495661_0123407 3300046665 Bacteria 1428
752 Ga0495661_0201703 3300046665 Bacteria 1041
753 Ga0495588_0002049 3300046674 Bacteria 8621
754 Ga0495588_0016129 3300046674 Bacteria 3607
755 Ga0495588_0042317 3300046674 Bacteria 2329
756 Ga0495588_0131830 3300046674 Bacteria 1318
757 Ga0495657_0016639 3300046675 Bacteria 5354
758 Ga0495599_0010784 3300046678 Bacteria 5599
759 Ga0495599_0034169 3300046678 Bacteria 3195
760 Ga0495623_0015025 3300046679 Bacteria 5005
761 Ga0495623_0027993 3300046679 Bacteria 3628
762 Ga0495646_0001905 3300046680 Bacteria 12540
763 Ga0495646_0055522 3300046680 Bacteria 2378
764 Ga0495646_0070638 3300046680 Bacteria 2056
765 Ga0495647_0000394 3300046681 Bacteria 12460
766 Ga0495647_0061944 3300046681 Bacteria 1478
767 Ga0495647_0079400 3300046681 Bacteria 1328
768 Ga0495658_0018051 3300046683 Bacteria 3660
769 Ga0495658_0405146 3300046683 Bacteria 870
770 Ga0495669_0009622 3300046684 Bacteria 4078
771 Ga0495669_0074157 3300046684 Bacteria 1555
772 Ga0495613_0017135 3300046689 Bacteria 5394
773 Ga0495613_0030248 3300046689 Bacteria 4022
774 Ga0495613_0215403 3300046689 Bacteria 1349
775 Ga0495613_0302262 3300046689 Bacteria 1107
776 Ga0495613_0435044 3300046689 Bacteria 891
777 Ga0495624_0029651 3300046690 Bacteria 3568
778 Ga0495670_0038292 3300046691 Bacteria 2391
779 Ga0495649_0032618 3300046694 Bacteria 2868
780 Ga0495649_0243462 3300046694 Bacteria 925
781 Ga0495600_0053718 3300046809 Bacteria 2631
782 Ga0495660_0083278 3300046810 Bacteria 1674
783 Ga0495660_0147807 3300046810 Bacteria 1163
784 Ga0495660_0271178 3300046810 Bacteria 780
785 Ga0495581_0003127 3300047315 Bacteria 9472
786 Ga0495581_0036790 3300047315 Bacteria 2832
787 Ga0495604_0041025 3300047317 Bacteria 3631
788 Ga0495604_0119608 3300047317 Bacteria 1908
789 Ga0495674_0008903 3300047319 Bacteria 9546
790 Ga0495674_0020170 3300047319 Bacteria 6174
791 Ga0495674_0053630 3300047319 Bacteria 3543
792 Ga0495674_0109800 3300047319 Bacteria 2339
793 Ga0495674_0412086 3300047319 Bacteria 1090
794 Ga0495672_0006488 3300047320 Bacteria 9047
795 Ga0495672_0110248 3300047320 Bacteria 1478
796 Ga0495672_0142443 3300047320 Bacteria 1251
797 Ga0495676_0028303 3300047321 Bacteria 4787
798 Ga0495676_0037300 3300047321 Bacteria 4047
799 Ga0495676_0080429 3300047321 Bacteria 2475
800 Ga0495676_0404431 3300047321 Bacteria 905
801 Ga0495680_0001711 3300047322 Bacteria 23324
802 Ga0495680_0025590 3300047322 Bacteria 4881
803 Ga0495680_0069244 3300047322 Bacteria 2693
804 Ga0495680_0358585 3300047322 Bacteria 1014
805 Ga0495687_070854 3300047443 Bacteria 1398
806 Ga0495675_0018890 3300047444 Bacteria 4379
807 Ga0495673_0055385 3300047469 Bacteria 1720
808 Ga0495673_0102891 3300047469 Bacteria 1152
809 Ga0495684_0022668 3300047471 Bacteria 4830
810 Ga0495684_0028314 3300047471 Bacteria 4302
811 Ga0495684_0156436 3300047471 Bacteria 1702
812 Ga0495686_0011260 3300047472 Bacteria 6306
813 Ga0495686_0052996 3300047472 Bacteria 2543
814 Ga0495686_0119295 3300047472 Bacteria 1574
815 Ga0495686_0224227 3300047472 Bacteria 1068
816 Ga0495686_0287266 3300047472 Bacteria 912
817 Ga0495593_0000439 3300047673 Bacteria 23237
818 Ga0495593_0008595 3300047673 Bacteria 5938
819 Ga0495593_0203686 3300047673 Bacteria 994
820 Ga0495593_0304568 3300047673 Bacteria 797
821 Ga0495602_0003274 3300048088 Bacteria 16731
822 Ga0495602_0392156 3300048088 Bacteria 992
823 Ga0495614_0026434 3300048089 Bacteria 2501
824 Ga0495614_0103613 3300048089 Bacteria 1246
825 Ga0495615_0064589 3300048090 Bacteria 974
826 Ga0496100_0095475 3300048903 Bacteria 2038
827 Ga0496100_0132418 3300048903 Bacteria 1758
828 Ga0496100_0138199 3300048903 Bacteria 1724
829 Ga0496100_0321691 3300048903 Bacteria 1162
830 Ga0496101_0020624 3300048904 Bacteria 4516
831 Ga0496101_0029707 3300048904 Bacteria 3824
832 Ga0496101_0034508 3300048904 Bacteria 3573
833 Ga0496101_0221880 3300048904 Bacteria 1467
834 Ga0496101_0743007 3300048904 Bacteria 774
835 Ga0496102_0001771 3300048905 Bacteria 18745
836 Ga0496102_0012689 3300048905 Bacteria 7297
837 Ga0496102_0083362 3300048905 Bacteria 2950
838 Ga0496103_0023438 3300048906 Bacteria 3722
839 Ga0496103_0038545 3300048906 Bacteria 2933
840 Ga0496103_0082141 3300048906 Bacteria 2027
841 Ga0496104_0005822 3300048907 Bacteria 10797
842 Ga0496104_0011101 3300048907 Bacteria 8061
843 Ga0496104_0077578 3300048907 Bacteria 3165
844 Ga0496104_0086985 3300048907 Bacteria 2984
845 Ga0496104_0215741 3300048907 Bacteria 1830
846 Ga0496104_0455365 3300048907 Bacteria 1191
847 Ga0496104_0588335 3300048907 Bacteria 1023
848 Ga0496105_0003099 3300048908 Bacteria 12229
849 Ga0496105_0039205 3300048908 Bacteria 3904
850 Ga0496105_0054260 3300048908 Bacteria 3309
851 Ga0496105_0060698 3300048908 Bacteria 3120
852 Ga0496105_0124463 3300048908 Bacteria 2125
853 Ga0496105_0262984 3300048908 Bacteria 1395
854 Ga0496105_0328879 3300048908 Bacteria 1224
855 Ga0496106_0034356 3300048909 Bacteria 3786
856 Ga0496106_0034378 3300048909 Bacteria 3785
857 Ga0496106_0068759 3300048909 Bacteria 2702
858 Ga0496106_0077972 3300048909 Bacteria 2541
859 Ga0496106_0119761 3300048909 Bacteria 2056
860 Ga0496106_0800032 3300048909 Bacteria 748
861 Ga0496107_0005793 3300048910 Bacteria 8456
862 Ga0496107_0009818 3300048910 Bacteria 6638
863 Ga0496107_0076705 3300048910 Bacteria 2434
864 Ga0496107_0258397 3300048910 Bacteria 1296
865 Ga0496107_0274724 3300048910 Bacteria 1254
866 Ga0496108_0038300 3300048911 Bacteria 3994
867 Ga0496108_0104326 3300048911 Bacteria 2419
868 Ga0496108_0220065 3300048911 Bacteria 1650
869 Ga0496108_0552511 3300048911 Bacteria 1004
870 Ga0496108_0581322 3300048911 Bacteria 976
871 Ga0496109_0034428 3300048912 Bacteria 4561
872 Ga0496109_0066264 3300048912 Bacteria 3306
873 Ga0496109_0208896 3300048912 Bacteria 1836
874 Ga0496109_1122667 3300048912 Bacteria 723
875 Ga0496110_0014333 3300048913 Bacteria 6577
876 Ga0496110_0057232 3300048913 Bacteria 3432
877 Ga0496110_0449395 3300048913 Bacteria 1174
878 Ga0496111_0049082 3300048914 Bacteria 3043
879 Ga0496111_0097706 3300048914 Bacteria 2156
880 Ga0496112_0060301 3300048915 Bacteria 3739
881 Ga0496112_0063364 3300048915 Bacteria 3646
882 Ga0496112_0120290 3300048915 Bacteria 2596
883 Ga0496112_0161755 3300048915 Bacteria 2205
884 Ga0496113_0006361 3300048916 Bacteria 7474
885 Ga0496113_0067440 3300048916 Bacteria 2713
886 Ga0496113_0191139 3300048916 Bacteria 1625
887 Ga0496113_0443365 3300048916 Bacteria 1043
888 Ga0496113_0455863 3300048916 Bacteria 1027
889 Ga0496114_0009691 3300048917 Bacteria 7651
890 Ga0496114_0152655 3300048917 Bacteria 2004
891 Ga0496114_0242729 3300048917 Bacteria 1584
892 Ga0496115_0002446 3300048918 Bacteria 13344
893 Ga0496115_0002841 3300048918 Bacteria 12459
894 Ga0496115_0050187 3300048918 Bacteria 3342
895 Ga0496115_0056504 3300048918 Bacteria 3155
896 Ga0496115_0094385 3300048918 Bacteria 2447
897 Ga0496115_0096229 3300048918 Bacteria 2424
898 Ga0496115_0252939 3300048918 Bacteria 1450
899 Ga0496115_0254108 3300048918 Bacteria 1446
900 Ga0496115_0278358 3300048918 Bacteria 1374
901 Ga0496115_0528239 3300048918 Bacteria 945
902 Ga0496117_0032127 3300048920 Bacteria 3994
903 Ga0496117_0046161 3300048920 Bacteria 3136
904 Ga0496117_0098573 3300048920 Bacteria 1857
905 Ga0496117_0107939 3300048920 Bacteria 1742
906 Ga0496117_0138705 3300048920 Bacteria 1460
907 Ga0496117_0258295 3300048920 Bacteria 946
908 Ga0496118_0019989 3300048921 Bacteria 5959
909 Ga0496118_0027235 3300048921 Bacteria 4843
910 Ga0496118_0039217 3300048921 Bacteria 3783
911 Ga0496118_0137350 3300048921 Bacteria 1557
912 Ga0496119_0043886 3300048922 Bacteria 2821
913 Ga0496119_0066944 3300048922 Bacteria 2120
914 Ga0496119_0191170 3300048922 Bacteria 1066
915 Ga0496120_0016795 3300048923 Bacteria 4770
916 Ga0496120_0034937 3300048923 Bacteria 3007
917 Ga0496120_0062037 3300048923 Bacteria 2084
918 Ga0496120_0119567 3300048923 Bacteria 1364
919 Ga0496120_0132181 3300048923 Bacteria 1277
920 Ga0496121_0000230 3300048924 Bacteria 120616
921 Ga0496121_0002143 3300048924 Bacteria 30998
922 Ga0496121_0004589 3300048924 Bacteria 18414
923 Ga0496121_0008031 3300048924 Bacteria 12580
924 Ga0496121_0010422 3300048924 Bacteria 10487
925 Ga0496121_0074038 3300048924 Bacteria 2726
926 Ga0496121_0095916 3300048924 Bacteria 2303
927 Ga0496121_0108827 3300048924 Bacteria 2119
928 Ga0496121_0116751 3300048924 Bacteria 2023
929 Ga0496121_0119821 3300048924 Bacteria 1989
930 Ga0496121_0376409 3300048924 Bacteria 938
931 Ga0496122_0041499 3300048925 Bacteria 3637
932 Ga0496122_0091099 3300048925 Bacteria 2077
933 Ga0496122_0233175 3300048925 Bacteria 1045
934 Ga0496123_0013289 3300048926 Bacteria 6933
935 Ga0496124_0096227 3300048927 Bacteria 2405
936 Ga0496124_0316230 3300048927 Bacteria 1120
937 Ga0496125_0000040 3300048928 Bacteria 314478
938 Ga0496125_0004755 3300048928 Bacteria 15477
939 Ga0496125_0008234 3300048928 Bacteria 10959
940 Ga0496125_0009329 3300048928 Bacteria 10115
941 Ga0496125_0137588 3300048928 Bacteria 1705
942 Ga0496126_0012513 3300048929 Bacteria 8686
943 Ga0496126_0017723 3300048929 Bacteria 7092
944 Ga0496126_0020497 3300048929 Bacteria 6477
945 Ga0496126_0022270 3300048929 Bacteria 6169
946 Ga0496126_0029864 3300048929 Bacteria 5174
947 Ga0496126_0040584 3300048929 Bacteria 4313
948 Ga0496126_0042182 3300048929 Bacteria 4215
949 Ga0496126_0042664 3300048929 Bacteria 4188
950 Ga0496126_0069964 3300048929 Bacteria 3128
951 Ga0496126_0075640 3300048929 Bacteria 2988
952 Ga0496126_0080155 3300048929 Bacteria 2889
953 Ga0496126_0109935 3300048929 Bacteria 2402
954 Ga0496126_0142762 3300048929 Bacteria 2059
955 Ga0496126_0250240 3300048929 Bacteria 1477
956 Ga0496126_0280170 3300048929 Bacteria 1381
957 Ga0496126_0357366 3300048929 Bacteria 1194
958 Ga0496126_0432456 3300048929 Bacteria 1062
959 Ga0496126_0515773 3300048929 Bacteria 953
960 Ga0495678_069128 3300049459 Bacteria 1300
961 Ga0501031_0044962 3300049568 Bacteria 2881
962 Ga0501031_0166287 3300049568 Bacteria 1442
963 Ga0501032_0000769 3300049569 Bacteria 26023
964 Ga0501032_0011140 3300049569 Bacteria 6463
965 Ga0501033_0000311 3300049570 Bacteria 46039
966 Ga0501034_0000039 3300049571 Bacteria 237357
967 Ga0501034_0073346 3300049571 Bacteria 3431
968 Ga0501036_0000127 3300049572 Bacteria 48559
969 Ga0501036_0010199 3300049572 Bacteria 7743
970 Ga0501037_0000025 3300049573 Bacteria 143276
971 Ga0501038_0038708 3300049574 Bacteria 4174
972 Ga0501039_0000840 3300049575 Bacteria 22181
973 Ga0501043_0000120 3300049579 Bacteria 72670
974 Ga0501046_0000359 3300049580 Bacteria 45929
975 Ga0501047_0000379 3300049581 Bacteria 50147
976 Ga0501047_0012334 3300049581 Bacteria 8090
977 Ga0501047_0012496 3300049581 Bacteria 8043
978 Ga0501047_0462303 3300049581 Bacteria 1098
979 Ga0501047_0769257 3300049581 Bacteria 778
980 Ga0501048_0000352 3300049582 Bacteria 31854
981 Ga0501067_0000025 3300049583 Bacteria 91481
982 Ga0501067_0037196 3300049583 Bacteria 2704
983 Ga0501068_0000463 3300049584 Bacteria 20486
984 Ga0501068_0069986 3300049584 Bacteria 2140
985 Ga0501069_0001694 3300049585 Bacteria 10972
986 Ga0501069_0218910 3300049585 Bacteria 1106
987 Ga0501070_0002185 3300049586 Bacteria 17207
988 Ga0501071_0035407 3300049587 Bacteria 3556
989 Ga0501072_0003699 3300049588 Bacteria 11536
990 Ga0501072_0730184 3300049588 Bacteria 778
991 Ga0501073_0000091 3300049589 Bacteria 57029
992 Ga0501073_0037500 3300049589 Bacteria 3441
993 Ga0501073_0040686 3300049589 Bacteria 3287
994 Ga0501074_0000489 3300049590 Bacteria 24170
995 Ga0501074_0030384 3300049590 Bacteria 3915
996 Ga0501076_0549143 3300049592 Bacteria 953
997 Ga0501079_0004084 3300049741 Bacteria 10807
998 Ga0501079_0742045 3300049741 Bacteria 773
999 Ga0501080_0000321 3300049742 Bacteria 36637
1000 Ga0501080_0013729 3300049742 Bacteria 7457
1001 Ga0501080_0030848 3300049742 Bacteria 4995
1002 Ga0501083_0000284 3300049744 Bacteria 32169
1003 Ga0501083_0038811 3300049744 Bacteria 3236
1004 Ga0501035_0001251 3300049822 Bacteria 26410
1005 Ga0501035_0711676 3300049822 Bacteria 809
1006 Ga0501044_0000274 3300049823 Bacteria 65668
1007 Ga0501044_0016521 3300049823 Bacteria 7921
1008 Ga0501044_0051488 3300049823 Bacteria 4245
1009 Ga0501045_0005648 3300049824 Bacteria 8654
1010 nmdc:mga03n38_1383_c1 3300050490 Bacteria 6890
1011 nmdc:mga03n38_138732_c1 3300050490 Bacteria 1212
1012 nmdc:mga03n38_7252_c1 3300050490 Bacteria 3913
1013 nmdc:mga00v17_146812_c1 3300050491 Bacteria 1514
1014 nmdc:mga00v17_199308_c1 3300050491 Bacteria 1294
1015 nmdc:mga0yw44_17129_c1 3300050492 Bacteria 3935
1016 nmdc:mga0yw44_223406_c1 3300050492 Bacteria 1249
1017 nmdc:mga0yw44_3463_c1 3300050492 Bacteria 7008
1018 nmdc:mga0yw44_40352_c1 3300050492 Bacteria 2772
1019 nmdc:mga06z11_129108_c1 3300050494 Bacteria 1418
1020 nmdc:mga06z11_141167_c1 3300050494 Bacteria 1362
1021 nmdc:mga06z11_289368_c1 3300050494 Bacteria 972
1022 nmdc:mga04h51_10509_c1 3300050495 Bacteria 2544
1023 nmdc:mga04h51_192076_c1 3300050495 Bacteria 799
1024 nmdc:mga04h51_99732_c1 3300050495 Bacteria 1057
1025 nmdc:mga07m45_370744_c1 3300050496 Bacteria 832
1026 nmdc:mga07m45_745_c1 3300050496 Bacteria 13914
1027 nmdc:mga0n895_302498_c1 3300050512 Bacteria 1621
1028 nmdc:mga0n895_59607_c1 3300050512 Bacteria 3765
1029 nmdc:mga0rr50_269639_c1 3300050513 Bacteria 1418
1030 nmdc:mga0sz30_111629_c1 3300050516 Bacteria 1199
1031 nmdc:mga0sz30_33533_c1 3300050516 Bacteria 2134
1032 Ga0495601_0020870 3300053077 Bacteria 4005
1033 Ga0495601_0230688 3300053077 Bacteria 1209
1034 Ga0500635_0002485 3300053080 Bacteria 4573
1035 Ga0500635_0044884 3300053080 Bacteria 1493
1036 Ga0495595_0002193 3300053084 Bacteria 7588
1037 Ga0495595_0100469 3300053084 Bacteria 1396
1038 Ga0495619_0009059 3300053085 Bacteria 6279
1039 Ga0495619_0139924 3300053085 Bacteria 1666
1040 Ga0500643_000456 3300053087 Bacteria 30270
1041 Ga0500646_0043987 3300053090 Bacteria 1266
1042 Ga0500647_0063463 3300053091 Bacteria 1777
1043 Ga0500647_0075232 3300053091 Bacteria 1620
1044 Ga0500651_0038607 3300053093 Bacteria 3008
1045 Ga0500566_0000043 3300053094 Bacteria 62755
1046 Ga0500566_0000370 3300053094 Bacteria 24642
1047 Ga0500566_0001762 3300053094 Bacteria 12726
1048 Ga0500566_0054651 3300053094 Bacteria 2276
1049 Ga0500566_0070578 3300053094 Bacteria 1961
1050 Ga0500566_0154071 3300053094 Bacteria 1205
1051 Ga0500640_000244 3300053095 Bacteria 12061
1052 Ga0500641_0082179 3300053096 Bacteria 1368
1053 Ga0500641_0126662 3300053096 Bacteria 1102
1054 Ga0500650_0088555 3300053098 Bacteria 1449
1055 Ga0500554_001881 3300053102 Bacteria 4063
1056 Ga0500554_019495 3300053102 Bacteria 1850
1057 Ga0500555_004143 3300053103 Bacteria 4125
1058 Ga0500555_029529 3300053103 Bacteria 1559
1059 Ga0500556_0000468 3300053104 Bacteria 28502
1060 Ga0500556_0022741 3300053104 Bacteria 2039
1061 Ga0500556_0239106 3300053104 Bacteria 715
1062 Ga0500557_000003 3300053105 Bacteria 228429
1063 Ga0500572_000024 3300053111 Bacteria 47391
1064 Ga0500572_000714 3300053111 Bacteria 10751
1065 Ga0500572_040783 3300053111 Bacteria 1345
1066 Ga0500592_028439 3300053116 Bacteria 901
1067 Ga0500595_001364 3300053119 Bacteria 13121
1068 Ga0500595_002343 3300053119 Bacteria 9470
1069 Ga0500595_002877 3300053119 Bacteria 8253
1070 Ga0500595_011685 3300053119 Bacteria 3424
1071 Ga0500595_012731 3300053119 Bacteria 3242
1072 Ga0500595_063636 3300053119 Bacteria 1108
1073 Ga0500597_210926 3300053120 Bacteria 812
1074 Ga0500607_044709 3300053121 Bacteria 2381
1075 Ga0500607_092543 3300053121 Bacteria 1518
1076 Ga0500608_017517 3300053122 Bacteria 3254
1077 Ga0500608_159410 3300053122 Bacteria 979
1078 Ga0500614_001091 3300053123 Bacteria 6714
1079 Ga0500642_0000019 3300053130 Bacteria 159944
1080 Ga0500642_0000252 3300053130 Bacteria 20158
1081 Ga0500652_005796 3300053131 Bacteria 3925
1082 Ga0500658_0008833 3300053134 Bacteria 3718
1083 Ga0500658_0025119 3300053134 Bacteria 2288
1084 Ga0500658_0028700 3300053134 Bacteria 2161
1085 Ga0500559_0000030 3300053136 Bacteria 115347
1086 Ga0500559_0001011 3300053136 Bacteria 17309
1087 Ga0500559_0004998 3300053136 Bacteria 6157
1088 Ga0500568_0018873 3300053139 Bacteria 3008
1089 Ga0500577_0019106 3300053142 Bacteria 2216
1090 Ga0500586_011707 3300053145 Bacteria 2523
1091 Ga0500589_112207 3300053147 Bacteria 1167
1092 Ga0500590_109037 3300053148 Bacteria 1317
1093 Ga0500603_000121 3300053150 Bacteria 18383
1094 Ga0500603_000391 3300053150 Bacteria 11472
1095 Ga0500603_035201 3300053150 Bacteria 1312
1096 Ga0500616_0000041 3300053153 Bacteria 359328
1097 Ga0500616_0056297 3300053153 Bacteria 2053
1098 Ga0500616_0081622 3300053153 Bacteria 1624
1099 Ga0500622_0004419 3300053156 Bacteria 8842
1100 Ga0500622_0025979 3300053156 Bacteria 3092
1101 Ga0500630_000112 3300053159 Bacteria 26672
1102 Ga0500638_001152 3300053162 Bacteria 7931
1103 Ga0500638_084128 3300053162 Bacteria 1507
1104 Ga0500638_126535 3300053162 Bacteria 1163
1105 Ga0500639_000040 3300053163 Bacteria 63516
1106 Ga0500639_018412 3300053163 Bacteria 3685
1107 Ga0500636_0000365 3300053177 Bacteria 24884
1108 Ga0500636_0121949 3300053177 Bacteria 1461
1109 Ga0500637_0000042 3300053178 Bacteria 46215
1110 Ga0500637_0002167 3300053178 Bacteria 8637
1111 Ga0500637_0020311 3300053178 Bacteria 3595
1112 Ga0500637_0216997 3300053178 Bacteria 1083
1113 Ga0500637_0239867 3300053178 Bacteria 1016
1114 Ga0500570_117425 3300053724 Bacteria 1057
1115 Ga0500576_008130 3300053725 Bacteria 4538
1116 Ga0500576_105573 3300053725 Bacteria 1140
1117 Ga0500552_007808 3300053733 Bacteria 1246
1118 Ga0500596_001493 3300053735 Bacteria 4734
1119 Ga0500599_001116 3300053736 Bacteria 3036
1120 Ga0500601_000203 3300053737 Bacteria 12048
1121 Ga0501084_0003294 3300054114 Bacteria 13074
1122 Ga0500661_001328 3300055283 Bacteria 4613
1123 Ga0501082_0007446 3300060353 Bacteria 9446
1124 Ga0466962_0094396 3300061719 Bacteria 1434
1125 2507507675 2507262055 Bacteria 8048963
1126 2508541790 2508501009 Bacteria 7784016
1127 2508692661 2508501042 Bacteria 8719808
1128 2509149312 2508501128 Bacteria 8613869
1129 2511398186 2511231028 Bacteria 8046582
1130 2513621878 2513237092 Bacteria 8341956
1131 2513642975 2513237094 Bacteria 8789602
1132 2513647503 2513237095 Bacteria 8976980
1133 2513654078 2513237096 Bacteria 8722461
1134 2513671437 2513237098 Bacteria 9902361
1135 2513698093 2513237101 Bacteria 7952346
1136 2513704275 2513237102 Bacteria 7703324
1137 2513719470 2513237104 Bacteria 10034502
1138 2513856830 2513237137 Bacteria 9558895
1139 2513878510 2513237139 Bacteria 8737671
1140 2513891264 2513237141 Bacteria 8496279
1141 2513918418 2513237145 Bacteria 8979722
1142 2514009443 2513237161 Bacteria 8871253
1143 2515626067 2515154112 Bacteria 8294334
1144 2517104147 2517093001 Bacteria 9002274
1145 2517891348 2517572143 Bacteria 9484767
1146 2524436289 2524023205 Bacteria 8918781
1147 2524463900 2524023210 Bacteria 9029266
1148 2524468467 2524023210 Bacteria 9029266
1149 2524540886 2524023228 Bacteria 10118060
1150 2528848992 2528768022 Bacteria 10457665
1151 2603860908 2602042107 Bacteria 6226103
1152 2617346787 2617270735 Bacteria 9163226
1153 2617372717 2617270741 Bacteria 8201522
1154 2644289107 2643221651 Bacteria 4798932
1155 2671118872 2667528175 Bacteria 7532676
1156 2723843695 2721755755 Bacteria 8322773
1157 2728750061 2728368998 Bacteria 8720350
1158 2745080756 2744054633 Bacteria 8678936
1159 2793065219 2791355196 Bacteria 7323613
1160 2793066716 2791355197 Bacteria 8420563
1161 2793080660
1162 2805919066 2802429603 Bacteria 8777136
1163 2818236540 2816332527 Bacteria 8933356
1164 2824606549 2824600985 Bacteria 8488197
1165 2824613034 2824609381 Bacteria 8672835
1166 2824620399 2824617872 Bacteria 8814715
1167 2824628553 2824626560 Bacteria 8813858
1168 2824639095 2824635225 Bacteria 8785348
1169 2824647320 2824644064 Bacteria 8743947
1170 2824658527 2824653114 Bacteria 8493680
1171 2824666476 2824661429 Bacteria 9877870
1172 2824674132 2824671348 Bacteria 8369588
1173 2824685670 2824679649 Bacteria 8248951
1174 2824691973 2824687955 Bacteria 8360029
1175 2824701131 2824696289 Bacteria 8335049
1176 2824710242 2824704595 Bacteria 9667483
1177 2824723323 2824714736 Bacteria 8717648
1178 2824732446 2824723954 Bacteria 8758240
1179 2824735848 2824732956 Bacteria 7810675
1180 2824750095 2824746037 Bacteria 7911610
1181 2824755970 2824753945 Bacteria 9787441
1182 2824767508 2824763712 Bacteria 9792355
1183 2824775137 2824773399 Bacteria 8360218
1184 2838130492 2838122688 Bacteria 8803140
1185 2841949290 2841941048 Bacteria 8688029
1186 2841953465 2841949485 Bacteria 8680857
1187 2841959703 2841957949 Bacteria 8652217
1188 2841972058 2841966195 Bacteria 8673214
1189 2841978194 2841974524 Bacteria 8931498
1190 2841991005 2841983080 Bacteria 8395090
1191 2842040635 2842038055 Bacteria 8002051
1192 2842046419 2842045827 Bacteria 8006841
1193 2844320010 2844315083 Bacteria 8138177
1194 2847937310 2847930680 Bacteria 9342022
1195 2847947729 2847939898 Bacteria 8606328
1196 2849078410 2849076700 Bacteria 7039503
1197 2857512782 2857509624 Bacteria 7472071
1198 2857524640 2857524615 Bacteria 6615449
1199 2874598785 2874590934 Bacteria 8299676
1200 2874607396 2874604998 Bacteria 7834745
1201 2874614585 2874612657 Bacteria 8252029
1202 2874628067 2874620515 Bacteria 8290088
1203 2874635018 2874628541 Bacteria 8630250
1204 2874652241 2874645413 Bacteria 8214782
1205 2876766229 2876761206 Bacteria 10111113
1206 2876778824 2876771140 Bacteria 8287509
1207 2876817720 2876808645 Bacteria 8824342
1208 2876824281 2876818435 Bacteria 8274608
1209 2879082617 2879074833 Bacteria 8279565
1210 2879086612 2879083081 Bacteria 8587928
1211 2879107121 2879099564 Bacteria 10442239
1212 2879111854 2879110137 Bacteria 8907982
1213 2879131534 2879127579 Bacteria 8294491
1214 2879147980 2879142872 Bacteria 8267021
1215 2881371472 2881364244 Bacteria 7710352
1216 2881666565 2881665667 Bacteria 8175609
1217 2885369959 2885366525 Bacteria 8326213
1218 2885374998 2885374607 Bacteria 8927485
1219 2885386833 2885383462 Bacteria 9473874
1220 2885410275 2885409591 Bacteria 9235467
1221 2888385440 2888378607 Bacteria 9652610
1222 2888392792 2888388044 Bacteria 7304136
1223 2888425570 2888419890 Bacteria 7857137
1224 2889038027 2889033259 Bacteria 9099371
1225 2893069161 2893066018 Bacteria 6158120
1226 2903730315 2903727486 Bacteria 8281579
1227 2903755309 2903748898 Bacteria 9972761
1228 2903769624 2903768456 Bacteria 9749579
1229 2903769715 2903768456 Bacteria 9749579
1230 2904674315 2904666416 Bacteria 8226587
1231 2904691217 2904690495 Bacteria 9412302
1232 2904701301
1233 2904711985 2904711408 Bacteria 9771557
1234 2906604750 2906602504 Bacteria 8295279
1235 2906616534
1236 2906627333 2906626472 Bacteria 8826946
1237 2906635307 2906635258 Bacteria 8601019
1238 2906643931 2906643746 Bacteria 8722424
1239 2906666852 2906660503 Bacteria 8595048
1240 2908741702 2908739725 Bacteria 8628932
1241 2908759142 2908756301 Bacteria 8864324
1242 2908781160 2908775508 Bacteria 8092255
1243 2919078522 2919073203 Bacteria 6531949
1244 2922366026 2922361189 Bacteria 7436256
1245 2922372419
1246 2922387362 2922386360 Bacteria 7017218
1247 2922397083 2922393267 Bacteria 8285685
1248 2922431447
1249 2929626157 2929624759 Bacteria 9339455
1250 2932784963 2932784394 Bacteria 9704911
1251 2932795159 2932794094 Bacteria 7915132
1252 2932805687 2932801729 Bacteria 7987968
1253 2932809996 2932809354 Bacteria 9135765
1254 2932818261 2932818245 Bacteria 9955613
1255 2932828800 2932828146 Bacteria 9745859
1256 2933583118 2933577622 Bacteria 9116884
1257 2935609816 2935608549 Bacteria 8203142
1258 2935619780 2935616580 Bacteria 9032984
1259 2935634042 2935630451 Bacteria 8169952
1260 2935638761 2935638405 Bacteria 10015038
1261 2935652155 2935648319 Bacteria 8801166
1262 2935659872 2935656913 Bacteria 8965014
1263 2935666388 2935665750 Bacteria 9571747
1264 2935676565 2935675223 Bacteria 9928132
1265 2935690763 2935684952 Bacteria 9590419
1266 2935694646 2935694250 Bacteria 9291695
1267 2935703767 2935703347 Bacteria 10242284
1268 2935718144 2935713505 Bacteria 9608509
1269 2935727875 2935722832 Bacteria 9608746
1270 2935736579 2935732158 Bacteria 9706831
1271 2935745958 2935741537 Bacteria 9707219
1272 2935756339 2935750917 Bacteria 9590372
1273 2935760556 2935760218 Bacteria 9817913
1274 2935777008 2935769743 Bacteria 7878163
1275 2935783564 2935777560 Bacteria 8077691
1276 2935792791 2935785616 Bacteria 7962367
1277 2935800861 2935793552 Bacteria 8012592
1278 2935801904 2935801545 Bacteria 9301974
1279 2935810674 2935810662 Bacteria 9401221
1280 2935822977 2935819856 Bacteria 8261050
1281 2935828255 2935827899 Bacteria 10038562
1282 2935842459 2935837841 Bacteria 9454360
1283 2935848559 2935847175 Bacteria 8228321
1284 2935857905 2935855204 Bacteria 9035059
1285 2935868753 2935864058 Bacteria 9784707
1286 2935874168 2935873716 Bacteria 9632195
1287 2935883943 2935883170 Bacteria 7964738
1288 2935909633 2935908558 Bacteria 8568796
1289 2935917358 2935916978 Bacteria 9113783
1290 2935927114 2935926038 Bacteria 8601059
1291 2935937042 2935934488 Bacteria 8602579
1292 2935944655 2935942939 Bacteria 8599779
1293 2935953092 2935951376 Bacteria 8602333
1294 2935966594 2935959822 Bacteria 7869783
1295 2935969932 2935967501 Bacteria 8603075
1296 2935980224 2935975950 Bacteria 8347125
1297 2935987017 2935984226 Bacteria 8302647
1298 2935992907 2935992306 Bacteria 9802711
1299 2936002820 2936002035 Bacteria 9362176
1300 2936014288 2936011229 Bacteria 8801034
1301 2936023872 2936019824 Bacteria 8804134
1302 2936031515 2936028420 Bacteria 8965941
1303 2936037906 2936037263 Bacteria 9446081
1304 2936049394 2936046547 Bacteria 8903709
1305 2936062144 2936055302 Bacteria 8785755
1306 2940561686 2940556831 Bacteria 9590747
1307 2941510655 2941507105 Bacteria 8166816
1308 2941518039 2941515067 Bacteria 8166720
1309 2941527090 2941523033 Bacteria 8169134
1310 2941531195 2941531003 Bacteria 7653939
1311 2941542508 2941538514 Bacteria 9402094
1312 3005481239 3005474847 Bacteria 9259049
1313 3005484805 3005483717 Bacteria 7877331
1314 3005508444 3005506211 Bacteria 6943378
1315 3005588053 3005587118 Bacteria 7794411
1316 3005600303 3005594810 Bacteria 8716512
1317 3005715796 3005710791 Bacteria 7622528
1318 3005723151 3005718088 Bacteria 8283608
1319 8006927953 8006926726 Bacteria 6749210
1320 8006939470 8006933436 Bacteria 10410654
1321 8006972128 8006964411 Bacteria 8966052
1322 8006979220 8006973647 Bacteria 10679141
1323 8006984417 8006984368 Bacteria 9651211
1324 8007001351 8006994254 Bacteria 8309700
1325 8016520673 8016511872 Bacteria 9921665
1326 8016528699 8016522445 Bacteria 8156687
1327 8016533878 8016530956 Bacteria 8155261
1328 8016547101 8016539877 Bacteria 8155419
1329 8016555019 8016548790 Bacteria 8155074
1330 8016563389 8016557553 Bacteria 8154380
1331 8016572216 8016566248 Bacteria 8158151
1332 8016576405 8016575299 Bacteria 8154085
1333 8016594323 8016583857 Bacteria 10421953
1334 8016601139 8016595262 Bacteria 8149947
1335 8016609309 8016603502 Bacteria 8731218
1336 8016615595 8016613128 Bacteria 8794220
1337 8016625625 8016622563 Bacteria 7999408
1338 8017064909 8017057580 Bacteria 10023680
1339 8019533649 8019530166 Bacteria 8155624
1340 8019546017 8019538911 Bacteria 7872763
1341 8019552704 8019547302 Bacteria 7996444
1342 8019565347 8019555841 Bacteria 9642137
1343 8019575447 8019565922 Bacteria 9639779
1344 8019584285 8019576017 Bacteria 10049540
1345 8019592053 8019586578 Bacteria 10212056
1346 8019609128 8019608314 Bacteria 10042931
1347 8019619801 8019619141 Bacteria 9218857
1348 8019633314 8019629233 Bacteria 8687553
1349 8019646586 8019638758 Bacteria 9062356
1350 8019649356 8019648815 Bacteria 10014479
1351 8019661188 8019659431 Bacteria 8577854
1352 8019670739 8019668869 Bacteria 8791617
1353 8019685492 8019678201 Bacteria 8863603
1354 8019691055 8019687851 Bacteria 8712826
1355 8055745125 8055742211 Bacteria 9226248
1356 8056681095 8056673599 Bacteria 7871253
1357 8056682539 8056681323 Bacteria 8472857
1358 8056684740 8056681323 Bacteria 8472857
1359 8056693074 8056689827 Bacteria 6712655
1360 8056975083 8056967851 Bacteria 9038162
1361 Ga0496107_0148464
1362 JGI25406J46586_10000214
1363 JGI25406J46586_10006102
1364 JGI25160J50197_1003619
1365 JGI25160J50197_1033878
1366 Ga0055542_1013907
1367 Ga0055531_10009410
1368 Ga0055543_1003833
1369 Ga0065165_1002074
1370 Ga0065165_1002220
1371 Ga0065165_1016908
1372 Ga0070658_10061837
1373 Ga0070658_10277390
1374 Ga0070658_10669119
1375 Ga0070683_100013050
1376 Ga0070670_100168954
1377 Ga0070670_100617758
1378 Ga0068869_100146568
1379 Ga0068869_100587398
1380 Ga0070666_10559044
1381 Ga0070680_100012621
1382 Ga0070680_100031361
1383 Ga0068868_100108576
1384 Ga0070660_100003001
1385 Ga0070660_100360200
1386 Ga0070687_100119548
1387 Ga0070668_100366074
1388 Ga0070668_100467235
1389 Ga0070669_100202934
1390 Ga0070669_100251774
1391 Ga0070671_100273868
1392 Ga0070673_100624233
1393 Ga0070688_100284611
1394 Ga0070688_100292292
1395 Ga0070659_100167678
1396 Ga0070659_100200483
1397 Ga0070659_100406140
1398 Ga0070667_100859563
1399 Ga0070709_10000203
1400 Ga0070709_10035659
1401 Ga0070709_10045651
1402 Ga0070709_10126394
1403 Ga0070714_100009406
1404 Ga0070714_100042351
1405 Ga0070714_100234407
1406 Ga0070713_100013461
1407 Ga0070713_100076397
1408 Ga0070713_100119176
1409 Ga0070713_100137195
1410 Ga0070710_10001622
1411 Ga0070710_10029445
1412 Ga0070701_10099464
1413 Ga0070711_100106196
1414 Ga0070705_100163366
1415 Ga0070700_100696001
1416 Ga0070663_100011972
1417 Ga0070663_100049973
1418 Ga0070663_100066779
1419 Ga0070663_100071943
1420 Ga0070678_100007842
1421 Ga0070678_100040699
1422 Ga0070678_100213115
1423 Ga0070662_100116684
1424 Ga0070681_10057282
1425 Ga0070681_10166491
1426 Ga0070681_10241297
1427 Ga0068867_100376315
1428 Ga0070706_100105029
1429 Ga0070706_100945034
1430 Ga0070707_100088722
1431 Ga0070707_100299391
1432 Ga0070698_100338108
1433 Ga0070679_100014122
1434 Ga0070679_100019456
1435 Ga0070679_100070354
1436 Ga0070679_100112682
1437 Ga0070679_100135998
1438 Ga0070679_100564567
1439 Ga0070679_100769637
1440 Ga0070684_100005044
1441 Ga0070684_100009975
1442 Ga0070684_100161538
1443 Ga0070684_100397672
1444 Ga0068853_100004408
1445 Ga0068853_100841864
1446 Ga0068853_100852955
1447 Ga0068853_100886362
1448 Ga0070672_100074296
1449 Ga0070672_100106450
1450 Ga0070672_100396874
1451 Ga0070686_100164062
1452 Ga0070693_100176930
1453 Ga0070693_100303737
1454 Ga0070665_100061335
1455 Ga0070665_100344735
1456 Ga0070665_100362326
1457 Ga0068855_100020164
1458 Ga0068855_100031608
1459 Ga0068855_100050152
1460 Ga0068855_100198629
1461 Ga0068855_100357095
1462 Ga0068855_100960747
1463 Ga0070664_100027907
1464 Ga0070664_100417265
1465 Ga0068857_100087798
1466 Ga0068857_100708625
1467 Ga0068856_100001827
1468 Ga0068856_100094136
1469 Ga0068856_100503865
1470 Ga0068856_100695005
1471 Ga0070702_100115420
1472 Ga0068852_100194657
1473 Ga0068852_100199577
1474 Ga0068852_100224325
1475 Ga0068852_100785485
1476 Ga0068852_101191711
1477 Ga0068859_100096353
1478 Ga0068859_101024744
1479 Ga0068864_100050579
1480 Ga0068864_100054265
1481 Ga0068864_100217171
1482 Ga0068866_10189230
1483 Ga0068863_100187248
1484 Ga0068863_100674895
1485 Ga0068858_100146094
1486 Ga0068858_100147587
1487 Ga0068858_100214799
1488 Ga0068858_100217521
1489 Ga0068858_100519975
1490 Ga0068858_100849174
1491 Ga0068860_100000081
1492 Ga0068860_100115374
1493 Ga0068860_100914621
1494 Ga0068862_100260310
1495 Ga0081455_10013417
1496 Ga0081455_10041329
1497 Ga0081455_10094508
1498 Ga0081455_10143692
1499 Ga0081540_1003965
1500 Ga0081540_1005624
1501 Ga0081540_1005692
1502 Ga0081540_1010058
1503 Ga0081540_1014480
1504 Ga0081540_1035706
1505 Ga0081540_1043747
1506 Ga0081540_1056296
1507 Ga0081539_10000768
1508 Ga0081539_10001470
1509 Ga0081539_10019985
1510 Ga0081539_10067278
1511 Ga0081539_10231561
1512 Ga0070717_10076659
1513 Ga0070717_10146487
1514 Ga0070717_10376256
1515 Ga0070717_10908434
1516 Ga0075365_10008428
1517 Ga0075365_10021294
1518 Ga0075365_10118150
1519 Ga0075365_10178734
1520 Ga0075368_10051146
1521 Ga0075368_10102549
1522 Ga0075368_10116397
1523 Ga0075368_10195298
1524 Ga0075363_100006965
1525 Ga0075363_100022057
1526 Ga0075364_10186255
1527 Ga0070716_100001846
1528 Ga0070716_100685945
1529 Ga0070712_100006733
1530 Ga0070712_100024328
1531 Ga0070712_100044059
1532 Ga0075362_10068310
1533 Ga0075367_10029890
1534 Ga0075369_10052362
1535 Ga0075366_10056277
1536 Ga0097621_100341101
1537 Ga0075370_10103498
1538 Ga0075370_10142858
1539 Ga0068871_100078523
1540 Ga0068871_100687021
1541 Ga0075434_100270509
1542 Ga0075434_100541799
1543 Ga0068865_100033651
1544 Ga0068865_100040328
1545 Ga0097620_100096353
1546 Ga0097620_101024770
1547 Ga0099825_1017324
1548 Ga0099822_1018218
1549 Ga0099823_1059808
1550 Ga0075435_100325964
1551 Ga0099794_10011757
1552 Ga0099794_10097011
1553 Ga0099795_10014182
1554 Ga0099795_10058655
1555 Ga0099795_10134606
1556 Ga0105250_10170836
1557 Ga0105240_10026622
1558 Ga0105240_10034709
1559 Ga0105240_10055828
1560 Ga0105240_10125422
1561 Ga0105240_10145106
1562 Ga0105240_10460048
1563 Ga0105240_10817350
1564 Ga0105240_11124568
1565 Ga0105245_10033125
1566 Ga0105245_10258800
1567 Ga0105245_10809687
1568 Ga0105247_10008197
1569 Ga0105247_10104916
1570 Ga0105247_10253365
1571 Ga0105243_10018993
1572 Ga0105243_10405296
1573 Ga0105243_10570125
1574 Ga0105241_10030969
1575 Ga0105242_10153337
1576 Ga0105242_10322761
1577 Ga0105242_10442847
1578 Ga0105242_10537981
1579 Ga0105248_10075716
1580 Ga0105248_10093026
1581 Ga0105248_10097999
1582 Ga0105248_10633706
1583 Ga0105237_10012336
1584 Ga0105237_10024997
1585 Ga0105237_10044165
1586 Ga0105237_10081141
1587 Ga0105237_10180622
1588 Ga0105237_10242635
1589 Ga0105237_10645509
1590 Ga0105238_10015861
1591 Ga0105238_10083037
1592 Ga0105238_10415895
1593 Ga0105238_10543691
1594 Ga0105238_10652073
1595 Ga0105249_10118682
1596 Ga0099796_10044327
1597 Ga0105239_10017391
1598 Ga0105239_10031991
1599 Ga0105239_10075749
1600 Ga0105239_10193690
1601 Ga0105246_10031772
1602 Ga0105246_10070395
1603 Ga0105246_10343304
1604 Ga0157373_10344774
1605 Ga0157371_10095539
1606 Ga0157371_10308039
1607 Ga0157370_10027113
1608 Ga0157370_10105073
1609 Ga0157370_10403770
1610 Ga0157369_10015050
1611 Ga0157369_10021463
1612 Ga0157369_10104910
1613 Ga0157369_10858147
1614 Ga0157374_10070236
1615 Ga0157374_10684606
1616 Ga0163162_10138896
1617 Ga0163162_10237640
1618 Ga0163162_10303134
1619 Ga0163162_10337567
1620 Ga0157372_10402452
1621 Ga0157372_10439338
1622 Ga0157375_10079932
1623 Ga0157375_10390085
1624 Ga0157375_10637335
1625 Ga0163163_10072423
1626 Ga0163163_10109318
1627 Ga0163163_10238282
1628 Ga0163163_10291199
1629 Ga0163163_11126544
1630 Ga0157380_10330482
1631 Ga0157380_11231924
1632 Ga0182008_10163633
1633 Ga0157379_10078989
1634 Ga0157379_10254156
1635 Ga0157379_10393617
1636 Ga0157376_10040939
1637 Ga0157376_10145143
1638 Ga0163161_10051522
1639 Ga0163161_10256175
1640 Ga0206353_11236131
1641 Ga0214544_1001813
1642 Ga0214544_1029472
1643 Ga0214544_1032156
1644 Ga0214542_1001236
1645 Ga0214542_1029050
1646 Ga0214542_1040372
1647 Ga0214542_1040750
1648 Ga0214545_1000924
1649 Ga0214545_1023872
1650 Ga0214543_1003531
1651 Ga0214543_1025126
1652 Ga0214543_1035012
1653 Ga0214543_1041233
1654 Ga0213873_10028627
1655 Ga0213876_10001431
1656 Ga0209563_108847
1657 Ga0207425_1007829
1658 Ga0209677_113470
1659 Ga0209148_1000180
1660 Ga0209233_1001441
1661 Ga0209233_1003552
1662 Ga0209233_1022482
1663 Ga0209233_1028978
1664 Ga0209455_1022828
1665 Ga0209130_1040756
1666 Ga0209564_1000385
1667 Ga0209564_1011033
1668 Ga0209758_1000011
1669 Ga0209758_1000133
1670 Ga0209758_1001210
1671 Ga0209758_1011006
1672 Ga0209758_1015407
1673 Ga0209256_1005155
1674 Ga0209256_1024267
1675 Ga0209256_1024426
1676 Ga0207426_1000572
1677 Ga0207426_1001763
1678 Ga0207426_1006362
1679 Ga0207697_10230640
1680 Ga0207656_10141294
1681 Ga0207692_10010389
1682 Ga0207692_10012280
1683 Ga0207692_10156023
1684 Ga0207692_10265572
1685 Ga0207642_10064945
1686 Ga0207642_10217426
1687 Ga0207710_10050507
1688 Ga0207688_10013784
1689 Ga0207688_10027182
1690 Ga0207680_10322944
1691 Ga0207647_10256686
1692 Ga0207685_10032271
1693 Ga0207685_10077271
1694 Ga0207699_10004445
1695 Ga0207699_10021389
1696 Ga0207699_10021591
1697 Ga0207699_10029552
1698 Ga0207699_10149149
1699 Ga0207699_10204556
1700 Ga0207645_10064837
1701 Ga0207643_10062976
1702 Ga0207705_10051852
1703 Ga0207684_10082993
1704 Ga0207654_10040051
1705 Ga0207654_10362035
1706 Ga0207707_10002705
1707 Ga0207707_10173010
1708 Ga0207707_10200980
1709 Ga0207695_10000008
1710 Ga0207695_10104517
1711 Ga0207695_10187313
1712 Ga0207671_10005294
1713 Ga0207671_10009638
1714 Ga0207671_10041027
1715 Ga0207671_10059807
1716 Ga0207671_10206717
1717 Ga0207671_10444980
1718 Ga0207671_10519638
1719 Ga0207693_10004777
1720 Ga0207693_10006974
1721 Ga0207693_10014354
1722 Ga0207693_10015344
1723 Ga0207693_10053164
1724 Ga0207693_10136318
1725 Ga0207693_10346044
1726 Ga0207663_10002050
1727 Ga0207663_10033664
1728 Ga0207663_10221108
1729 Ga0207660_10006961
1730 Ga0207660_10033360
1731 Ga0207660_10274950
1732 Ga0207662_10085372
1733 Ga0207657_10006890
1734 Ga0207657_10034513
1735 Ga0207649_10263314
1736 Ga0207652_10001690
1737 Ga0207652_10065122
1738 Ga0207652_10090468
1739 Ga0207652_10101751
1740 Ga0207652_10117474
1741 Ga0207652_10236636
1742 Ga0207652_10502817
1743 Ga0207646_10053986
1744 Ga0207681_10611511
1745 Ga0207694_10005031
1746 Ga0207694_10324194
1747 Ga0207694_10372001
1748 Ga0207659_10483071
1749 Ga0207687_10091412
1750 Ga0207700_10063585
1751 Ga0207700_10087847
1752 Ga0207700_10112570
1753 Ga0207700_10219058
1754 Ga0207700_10322788
1755 Ga0207664_10002721
1756 Ga0207664_10016371
1757 Ga0207664_10432638
1758 Ga0207664_10590784
1759 Ga0207664_10703412
1760 Ga0207644_10076825
1761 Ga0207690_10503143
1762 Ga0207690_10783159
1763 Ga0207706_10034381
1764 Ga0207686_10096308
1765 Ga0207686_10219824
1766 Ga0207709_10236759
1767 Ga0207670_10174646
1768 Ga0207704_10069584
1769 Ga0207704_10103399
1770 Ga0207665_10001320
1771 Ga0207665_10010178
1772 Ga0207711_10106450
1773 Ga0207711_10108996
1774 Ga0207711_10148134
1775 Ga0207689_10032632
1776 Ga0207661_10001270
1777 Ga0207661_10008424
1778 Ga0207661_10021928
1779 Ga0207679_10054338
1780 Ga0207679_10103081
1781 Ga0207667_10002017
1782 Ga0207667_10159022
1783 Ga0207667_10204693
1784 Ga0207667_10291746
1785 Ga0207667_10318094
1786 Ga0207668_10023206
1787 Ga0207668_10516617
1788 Ga0207640_10235256
1789 Ga0207640_10569355
1790 Ga0207658_10395783
1791 Ga0207658_10491338
1792 Ga0207677_10014286
1793 Ga0207677_10094719
1794 Ga0207703_10057761
1795 Ga0207703_10590460
1796 Ga0207639_10014358
1797 Ga0207639_10194488
1798 Ga0207678_10013434
1799 Ga0207678_10043423
1800 Ga0207678_10044113
1801 Ga0207678_10056735
1802 Ga0207678_10133768
1803 Ga0207702_10002952
1804 Ga0207702_10273621
1805 Ga0207702_10377753
1806 Ga0207702_10600858
1807 Ga0207702_10830616
1808 Ga0207641_10142070
1809 Ga0207641_10209060
1810 Ga0207648_10086612
1811 Ga0207648_10376351
1812 Ga0207676_10667987
1813 Ga0207674_10071396
1814 Ga0207674_10608841
1815 Ga0207674_10680628
1816 Ga0207675_100233128
1817 Ga0207683_10782212
1818 Ga0207698_10045951
1819 Ga0207698_10121806
1820 Ga0207698_10218793
1821 Ga0207698_10913554
1822 Ga0209389_1000001
1823 Ga0209389_1000115
1824 Ga0209589_1000014
1825 Ga0209589_1000033
1826 Ga0209489_100014
1827 Ga0209489_100040
1828 Ga0209489_100612
1829 Ga0209700_100007
1830 Ga0209700_100024
1831 Ga0209179_1004389
1832 Ga0209588_1006547
1833 Ga0209588_1039035
1834 Ga0209813_10120758
1835 Ga0209813_10166207
1836 Ga0268266_10008590
1837 Ga0268266_10381617
1838 Ga0268266_10548059
1839 Ga0268265_10122547
1840 Ga0268265_10218799
1841 Ga0268265_10355923
1842 Ga0268265_10364172
1843 Ga0268264_10000048
1844 Ga0268264_10530728
1845 Ga0265337_1007889
1846 Ga0265334_10005731
1847 Ga0265323_10019130
1848 Ga0265336_10000362
1849 Ga0307517_10000634
1850 Ga0307515_10006012
1851 Ga0265338_10001385
1852 Ga0307511_10101412
1853 Ga0265330_10017515
1854 Ga0265330_10034042
1855 Ga0265332_10021959
1856 Ga0265328_10007270
1857 Ga0265328_10076374
1858 Ga0265325_10008844
1859 Ga0265340_10158752
1860 Ga0265339_10008162
1861 Ga0265331_10021239
1862 Ga0265316_10320410
1863 Ga0307513_10276547
1864 Ga0307509_10005537
1865 Ga0307509_10206607
1866 Ga0307509_10407196
1867 Ga0307408_101004154
1868 Ga0307508_10000032
1869 Ga0307508_10372435
1870 Ga0307508_10432315
1871 Ga0265314_10002560
1872 Ga0265314_10002580
1873 Ga0265314_10102344
1874 Ga0307516_10005934
1875 Ga0307516_10068507
1876 Ga0307516_10124641
1877 Ga0307516_10257667
1878 Ga0307516_10485636
1879 Ga0307413_10342064
1880 Ga0307406_10185047
1881 Ga0307412_10153348
1882 Ga0307414_10075999
1883 Ga0307507_10011278
1884 Ga0307510_10023885
1885 Ga0307510_10030948
1886 Ga0307510_10031256
1887 Ga0307510_10116818
1888 Ga0307510_10170518
1889 Ga0307510_10215439
1890 Ga0315911_1000002
1891 Ga0373938_0022256
1892 Ga0373928_0005474
1893 Ga0373934_0016831
1894 Ga0373934_0085874
1895 Ga0373944_0025260
1896 Ga0373923_0008272
1897 Ga0373923_0021636
1898 Ga0373923_0032934
1899 Ga0373936_0014550
1900 Ga0373936_0035815
1901 Ga0373945_0046796
1902 Ga0373945_0070345
1903 Ga0373953_0036149
1904 Ga0373954_0055843
1905 Ga0373957_0007517
1906 Ga0373943_0013488
1907 Ga0373943_0223402
1908 Ga0373946_0004997
1909 Ga0373946_0039352
1910 Ga0373946_0055373
1911 Ga0373955_0002074
1912 Ga0373955_0081494
1913 Ga0373955_0127362
1914 Ga0373955_0144524
1915 Ga0373924_0017806
1916 Ga0373931_0003529
1917 Ga0373931_0009359
1918 Ga0373931_0174913
1919 Ga0373935_0003875
1920 Ga0373935_0195730
1921 Ga0373935_0326294
1922 Ga0373927_0002882
1923 Ga0373927_0008495
1924 Ga0373927_0018156
1925 Ga0373927_0023311
1926 Ga0373927_0035141
1927 Ga0373927_0065861
1928 Ga0373927_0089292
1929 Ga0373927_0179284
1930 Ga0373933_0010030
1931 Ga0373947_0052981
1932 Ga0373947_0070557
1933 Ga0373947_0199122
1934 Ga0373937_0044597
1935 Ga0373937_0127459
1936 Ga0373937_0176515
1937 Ga0373937_0216543
1938 Ga0373925_0061485
1939 Ga0373925_0075399
1940 Ga0373925_0115107
1941 Ga0373925_0143307
1942 Ga0373925_0169719
1943 Ga0373925_0358953
1944 Ga0395900_0001029
1945 Ga0395900_0029402
1946 Ga0395900_0073178
1947 Ga0395900_0333659
1948 Ga0395898_0002778
1949 Ga0395898_0015307
1950 Ga0395898_0022553
1951 Ga0395898_0036427
1952 Ga0395898_0168160
1953 Ga0395898_0327425
1954 Ga0395905_0055862
1955 Ga0395905_0072510
1956 Ga0395905_0349583
1957 Ga0395905_0993334
1958 Ga0395901_0099375
1959 Ga0395901_0465024
1960 Ga0436365_0297479
1961 Ga0436365_0692920
1962 Ga0436365_1332974
1963 Ga0436360_0431909
1964 Ga0436360_0504290
1965 Ga0436360_0991394
1966 Ga0436360_1347011
1967 Ga0436361_0243217
1968 Ga0436361_0457301
1969 Ga0436361_0555937
1970 Ga0436363_0130456
1971 Ga0436363_1017085
1972 Ga0436362_0299747
1973 Ga0451847_0293411
1974 Ga0466969_0010286
1975 Ga0466969_0055449
1976 Ga0466972_0002106
1977 Ga0466965_0199067
1978 Ga0466966_0000128
1979 Ga0466966_0053431
1980 Ga0466966_0194655
1981 Ga0466966_0230714
1982 Ga0466961_0000236
1983 Ga0466963_0305926
1984 Ga0466963_0413362
1985 Ga0466964_0041479
1986 Ga0466964_0304968
1987 Ga0466960_0017212
1988 Ga0466960_0033671
1989 Ga0466959_0001099
1990 Ga0466959_0076070
1991 Ga0466959_0119013
1992 Ga0466959_0228219
1993 Ga0466958_0019026
1994 Ga0466967_0113044
1995 Ga0466967_0175802
1996 Ga0466967_0460396
1997 Ga0495617_098726
1998 Ga0495592_0013200
1999 Ga0495592_0065398
2000 Ga0495592_0101197
2001 Ga0495592_0363510
2002 Ga0495603_0000217
2003 Ga0495603_0009199
2004 Ga0495603_0022004
2005 Ga0495603_0049213
2006 Ga0495590_0156394
2007 Ga0495629_0000862
2008 Ga0495629_0021708
2009 Ga0495629_0030060
2010 Ga0495629_0153409
2011 Ga0495629_0167936
2012 Ga0495629_0540381
2013 Ga0495638_0005277
2014 Ga0495638_0008841
2015 Ga0495638_0052200
2016 Ga0495638_0226002
2017 Ga0495641_0003672
2018 Ga0495641_0032216
2019 Ga0495651_0001756
2020 Ga0495653_0062866
2021 Ga0495580_0005364
2022 Ga0495580_0006588
2023 Ga0495580_0041543
2024 Ga0495580_0181880
2025 Ga0495580_0294261
2026 Ga0495582_0000990
2027 Ga0495582_0023883
2028 Ga0495605_0102522
2029 Ga0495639_0000544
2030 Ga0495639_0017690
2031 Ga0495639_0170585
2032 Ga0495639_0317297
2033 Ga0495662_0001589
2034 Ga0495664_0001505
2035 Ga0495664_0070721
2036 Ga0495664_0077786
2037 Ga0495664_0121258
2038 Ga0495585_0072186
2039 Ga0495585_0301669
2040 Ga0495594_0000128
2041 Ga0495607_0204860
2042 Ga0495583_0025356
2043 Ga0495606_0052648
2044 Ga0495606_0063466
2045 Ga0495606_0072414
2046 Ga0495606_0177070
2047 Ga0495608_0022212
2048 Ga0495608_0048299
2049 Ga0495608_0264012
2050 Ga0495610_0152922
2051 Ga0495610_0159637
2052 Ga0495616_0037223
2053 Ga0495616_0068104
2054 Ga0495618_0112331
2055 Ga0495618_0226137
2056 Ga0495620_0019752
2057 Ga0495628_0017576
2058 Ga0495628_0039638
2059 Ga0495628_0112715
2060 Ga0495628_0113435
2061 Ga0495628_0133441
2062 Ga0495630_0036462
2063 Ga0495630_0668546
2064 Ga0495632_0172967
2065 Ga0495643_0061414
2066 Ga0495643_0063321
2067 Ga0495643_0068935
2068 Ga0495648_0000936
2069 Ga0495648_0040934
2070 Ga0495648_0049911
2071 Ga0495666_0013204
2072 Ga0495666_0044738
2073 Ga0495652_0007874
2074 Ga0495652_0582583
2075 Ga0495654_0030044
2076 Ga0495640_0002595
2077 Ga0495640_0027356
2078 Ga0495640_0036958
2079 Ga0495640_0073084
2080 Ga0495640_0115722
2081 Ga0495587_0018206
2082 Ga0495645_0035879
2083 Ga0495645_0085462
2084 Ga0495645_0092361
2085 Ga0495645_0119758
2086 Ga0495622_0019117
2087 Ga0495622_0020586
2088 Ga0495622_0028278
2089 Ga0495622_0164145
2090 Ga0495622_0294810
2091 Ga0495633_0256519
2092 Ga0495667_0018942
2093 Ga0495667_0022214
2094 Ga0495667_0102853
2095 Ga0495656_0085052
2096 Ga0495634_0001583
2097 Ga0495634_0024426
2098 Ga0495634_0048105
2099 Ga0495634_0064787
2100 Ga0495634_0089301
2101 Ga0495611_0019750
2102 Ga0495625_0025626
2103 Ga0495625_0044250
2104 Ga0495625_0107919
2105 Ga0495635_0000436
2106 Ga0495635_0015088
2107 Ga0495635_0016639
2108 Ga0495635_0026390
2109 Ga0495635_0028565
2110 Ga0495661_0030247
2111 Ga0495661_0123407
2112 Ga0495661_0201703
2113 Ga0495588_0002049
2114 Ga0495588_0016129
2115 Ga0495588_0042317
2116 Ga0495588_0131830
2117 Ga0495657_0016639
2118 Ga0495599_0010784
2119 Ga0495599_0034169
2120 Ga0495623_0015025
2121 Ga0495623_0027993
2122 Ga0495646_0001905
2123 Ga0495646_0055522
2124 Ga0495646_0070638
2125 Ga0495647_0000394
2126 Ga0495647_0061944
2127 Ga0495647_0079400
2128 Ga0495658_0018051
2129 Ga0495658_0405146
2130 Ga0495669_0009622
2131 Ga0495669_0074157
2132 Ga0495613_0017135
2133 Ga0495613_0030248
2134 Ga0495613_0215403
2135 Ga0495613_0302262
2136 Ga0495613_0435044
2137 Ga0495624_0029651
2138 Ga0495670_0038292
2139 Ga0495649_0032618
2140 Ga0495649_0243462
2141 Ga0495600_0053718
2142 Ga0495660_0083278
2143 Ga0495660_0147807
2144 Ga0495660_0271178
2145 Ga0495581_0003127
2146 Ga0495581_0036790
2147 Ga0495604_0041025
2148 Ga0495604_0119608
2149 Ga0495674_0008903
2150 Ga0495674_0020170
2151 Ga0495674_0053630
2152 Ga0495674_0109800
2153 Ga0495674_0412086
2154 Ga0495672_0006488
2155 Ga0495672_0110248
2156 Ga0495672_0142443
2157 Ga0495676_0028303
2158 Ga0495676_0037300
2159 Ga0495676_0080429
2160 Ga0495676_0404431
2161 Ga0495680_0001711
2162 Ga0495680_0025590
2163 Ga0495680_0069244
2164 Ga0495680_0358585
2165 Ga0495687_070854
2166 Ga0495675_0018890
2167 Ga0495673_0055385
2168 Ga0495673_0102891
2169 Ga0495684_0022668
2170 Ga0495684_0028314
2171 Ga0495684_0156436
2172 Ga0495686_0011260
2173 Ga0495686_0052996
2174 Ga0495686_0119295
2175 Ga0495686_0224227
2176 Ga0495686_0287266
2177 Ga0495593_0000439
2178 Ga0495593_0008595
2179 Ga0495593_0203686
2180 Ga0495593_0304568
2181 Ga0495602_0003274
2182 Ga0495602_0392156
2183 Ga0495614_0026434
2184 Ga0495614_0103613
2185 Ga0495615_0064589
2186 Ga0496100_0095475
2187 Ga0496100_0132418
2188 Ga0496100_0138199
2189 Ga0496100_0321691
2190 Ga0496101_0020624
2191 Ga0496101_0029707
2192 Ga0496101_0034508
2193 Ga0496101_0221880
2194 Ga0496101_0743007
2195 Ga0496102_0001771
2196 Ga0496102_0012689
2197 Ga0496102_0083362
2198 Ga0496103_0023438
2199 Ga0496103_0038545
2200 Ga0496103_0082141
2201 Ga0496104_0005822
2202 Ga0496104_0011101
2203 Ga0496104_0077578
2204 Ga0496104_0086985
2205 Ga0496104_0215741
2206 Ga0496104_0455365
2207 Ga0496104_0588335
2208 Ga0496105_0003099
2209 Ga0496105_0039205
2210 Ga0496105_0054260
2211 Ga0496105_0060698
2212 Ga0496105_0124463
2213 Ga0496105_0262984
2214 Ga0496105_0328879
2215 Ga0496106_0034356
2216 Ga0496106_0034378
2217 Ga0496106_0068759
2218 Ga0496106_0077972
2219 Ga0496106_0119761
2220 Ga0496106_0800032
2221 Ga0496107_0005793
2222 Ga0496107_0009818
2223 Ga0496107_0076705
2224 Ga0496107_0258397
2225 Ga0496107_0274724
2226 Ga0496108_0038300
2227 Ga0496108_0104326
2228 Ga0496108_0220065
2229 Ga0496108_0552511
2230 Ga0496108_0581322
2231 Ga0496109_0034428
2232 Ga0496109_0066264
2233 Ga0496109_0208896
2234 Ga0496109_1122667
2235 Ga0496110_0014333
2236 Ga0496110_0057232
2237 Ga0496110_0449395
2238 Ga0496111_0049082
2239 Ga0496111_0097706
2240 Ga0496112_0060301
2241 Ga0496112_0063364
2242 Ga0496112_0120290
2243 Ga0496112_0161755
2244 Ga0496113_0006361
2245 Ga0496113_0067440
2246 Ga0496113_0191139
2247 Ga0496113_0443365
2248 Ga0496113_0455863
2249 Ga0496114_0009691
2250 Ga0496114_0152655
2251 Ga0496114_0242729
2252 Ga0496115_0002446
2253 Ga0496115_0002841
2254 Ga0496115_0050187
2255 Ga0496115_0056504
2256 Ga0496115_0094385
2257 Ga0496115_0096229
2258 Ga0496115_0252939
2259 Ga0496115_0254108
2260 Ga0496115_0278358
2261 Ga0496115_0528239
2262 Ga0496117_0032127
2263 Ga0496117_0046161
2264 Ga0496117_0098573
2265 Ga0496117_0107939
2266 Ga0496117_0138705
2267 Ga0496117_0258295
2268 Ga0496118_0019989
2269 Ga0496118_0027235
2270 Ga0496118_0039217
2271 Ga0496118_0137350
2272 Ga0496119_0043886
2273 Ga0496119_0066944
2274 Ga0496119_0191170
2275 Ga0496120_0016795
2276 Ga0496120_0034937
2277 Ga0496120_0062037
2278 Ga0496120_0119567
2279 Ga0496120_0132181
2280 Ga0496121_0000230
2281 Ga0496121_0002143
2282 Ga0496121_0004589
2283 Ga0496121_0008031
2284 Ga0496121_0010422
2285 Ga0496121_0074038
2286 Ga0496121_0095916
2287 Ga0496121_0108827
2288 Ga0496121_0116751
2289 Ga0496121_0119821
2290 Ga0496121_0376409
2291 Ga0496122_0041499
2292 Ga0496122_0091099
2293 Ga0496122_0233175
2294 Ga0496123_0013289
2295 Ga0496124_0096227
2296 Ga0496124_0316230
2297 Ga0496125_0000040
2298 Ga0496125_0004755
2299 Ga0496125_0008234
2300 Ga0496125_0009329
2301 Ga0496125_0137588
2302 Ga0496126_0012513
2303 Ga0496126_0017723
2304 Ga0496126_0020497
2305 Ga0496126_0022270
2306 Ga0496126_0029864
2307 Ga0496126_0040584
2308 Ga0496126_0042182
2309 Ga0496126_0042664
2310 Ga0496126_0069964
2311 Ga0496126_0075640
2312 Ga0496126_0080155
2313 Ga0496126_0109935
2314 Ga0496126_0142762
2315 Ga0496126_0250240
2316 Ga0496126_0280170
2317 Ga0496126_0357366
2318 Ga0496126_0432456
2319 Ga0496126_0515773
2320 Ga0495678_069128
2321 Ga0501031_0044962
2322 Ga0501031_0166287
2323 Ga0501032_0000769
2324 Ga0501032_0011140
2325 Ga0501033_0000311
2326 Ga0501034_0000039
2327 Ga0501034_0073346
2328 Ga0501036_0000127
2329 Ga0501036_0010199
2330 Ga0501037_0000025
2331 Ga0501038_0038708
2332 Ga0501039_0000840
2333 Ga0501043_0000120
2334 Ga0501046_0000359
2335 Ga0501047_0000379
2336 Ga0501047_0012334
2337 Ga0501047_0012496
2338 Ga0501047_0462303
2339 Ga0501047_0769257
2340 Ga0501048_0000352
2341 Ga0501067_0000025
2342 Ga0501067_0037196
2343 Ga0501068_0000463
2344 Ga0501068_0069986
2345 Ga0501069_0001694
2346 Ga0501069_0218910
2347 Ga0501070_0002185
2348 Ga0501071_0035407
2349 Ga0501072_0003699
2350 Ga0501072_0730184
2351 Ga0501073_0000091
2352 Ga0501073_0037500
2353 Ga0501073_0040686
2354 Ga0501074_0000489
2355 Ga0501074_0030384
2356 Ga0501076_0549143
2357 Ga0501079_0004084
2358 Ga0501079_0742045
2359 Ga0501080_0000321
2360 Ga0501080_0013729
2361 Ga0501080_0030848
2362 Ga0501083_0000284
2363 Ga0501083_0038811
2364 Ga0501035_0001251
2365 Ga0501035_0711676
2366 Ga0501044_0000274
2367 Ga0501044_0016521
2368 Ga0501044_0051488
2369 Ga0501045_0005648
2370 nmdc:mga03n38_1383_c1
2371 nmdc:mga03n38_138732_c1
2372 nmdc:mga03n38_7252_c1
2373 nmdc:mga00v17_146812_c1
2374 nmdc:mga00v17_199308_c1
2375 nmdc:mga0yw44_17129_c1
2376 nmdc:mga0yw44_223406_c1
2377 nmdc:mga0yw44_3463_c1
2378 nmdc:mga0yw44_40352_c1
2379 nmdc:mga06z11_129108_c1
2380 nmdc:mga06z11_141167_c1
2381 nmdc:mga06z11_289368_c1
2382 nmdc:mga04h51_10509_c1
2383 nmdc:mga04h51_192076_c1
2384 nmdc:mga04h51_99732_c1
2385 nmdc:mga07m45_370744_c1
2386 nmdc:mga07m45_745_c1
2387 nmdc:mga0n895_302498_c1
2388 nmdc:mga0n895_59607_c1
2389 nmdc:mga0rr50_269639_c1
2390 nmdc:mga0sz30_111629_c1
2391 nmdc:mga0sz30_33533_c1
2392 Ga0495601_0020870
2393 Ga0495601_0230688
2394 Ga0500635_0002485
2395 Ga0500635_0044884
2396 Ga0495595_0002193
2397 Ga0495595_0100469
2398 Ga0495619_0009059
2399 Ga0495619_0139924
2400 Ga0500643_000456
2401 Ga0500646_0043987
2402 Ga0500647_0063463
2403 Ga0500647_0075232
2404 Ga0500651_0038607
2405 Ga0500566_0000043
2406 Ga0500566_0000370
2407 Ga0500566_0001762
2408 Ga0500566_0054651
2409 Ga0500566_0070578
2410 Ga0500566_0154071
2411 Ga0500640_000244
2412 Ga0500641_0082179
2413 Ga0500641_0126662
2414 Ga0500650_0088555
2415 Ga0500554_001881
2416 Ga0500554_019495
2417 Ga0500555_004143
2418 Ga0500555_029529
2419 Ga0500556_0000468
2420 Ga0500556_0022741
2421 Ga0500556_0239106
2422 Ga0500557_000003
2423 Ga0500572_000024
2424 Ga0500572_000714
2425 Ga0500572_040783
2426 Ga0500592_028439
2427 Ga0500595_001364
2428 Ga0500595_002343
2429 Ga0500595_002877
2430 Ga0500595_011685
2431 Ga0500595_012731
2432 Ga0500595_063636
2433 Ga0500597_210926
2434 Ga0500607_044709
2435 Ga0500607_092543
2436 Ga0500608_017517
2437 Ga0500608_159410
2438 Ga0500614_001091
2439 Ga0500642_0000019
2440 Ga0500642_0000252
2441 Ga0500652_005796
2442 Ga0500658_0008833
2443 Ga0500658_0025119
2444 Ga0500658_0028700
2445 Ga0500559_0000030
2446 Ga0500559_0001011
2447 Ga0500559_0004998
2448 Ga0500568_0018873
2449 Ga0500577_0019106
2450 Ga0500586_011707
2451 Ga0500589_112207
2452 Ga0500590_109037
2453 Ga0500603_000121
2454 Ga0500603_000391
2455 Ga0500603_035201
2456 Ga0500616_0000041
2457 Ga0500616_0056297
2458 Ga0500616_0081622
2459 Ga0500622_0004419
2460 Ga0500622_0025979
2461 Ga0500630_000112
2462 Ga0500638_001152
2463 Ga0500638_084128
2464 Ga0500638_126535
2465 Ga0500639_000040
2466 Ga0500639_018412
2467 Ga0500636_0000365
2468 Ga0500636_0121949
2469 Ga0500637_0000042
2470 Ga0500637_0002167
2471 Ga0500637_0020311
2472 Ga0500637_0216997
2473 Ga0500637_0239867
2474 Ga0500570_117425
2475 Ga0500576_008130
2476 Ga0500576_105573
2477 Ga0500552_007808
2478 Ga0500596_001493
2479 Ga0500599_001116
2480 Ga0500601_000203
2481 Ga0501084_0003294
2482 Ga0500661_001328
2483 Ga0501082_0007446
2484 Ga0466962_0094396
2485 2507507675
2486 2508541790
2487 2508692661
2488 2509149312
2489 2511398186
2490 2513621878
2491 2513642975
2492 2513647503
2493 2513654078
2494 2513671437
2495 2513698093
2496 2513704275
2497 2513719470
2498 2513856830
2499 2513878510
2500 2513891264
2501 2513918418
2502 2514009443
2503 2515626067
2504 2517104147
2505 2517891348
2506 2524436289
2507 2524463900
2508 2524468467
2509 2524540886
2510 2528848992
2511 2603860908
2512 2617346787
2513 2617372717
2514 2644289107
2515 2671118872
2516 2723843695
2517 2728750061
2518 2745080756
2519 2793065219
2520 2793066716
2521 2793080660
2522 2805919066
2523 2818236540
2524 2824606549
2525 2824613034
2526 2824620399
2527 2824628553
2528 2824639095
2529 2824647320
2530 2824658527
2531 2824666476
2532 2824674132
2533 2824685670
2534 2824691973
2535 2824701131
2536 2824710242
2537 2824723323
2538 2824732446
2539 2824735848
2540 2824750095
2541 2824755970
2542 2824767508
2543 2824775137
2544 2838130492
2545 2841949290
2546 2841953465
2547 2841959703
2548 2841972058
2549 2841978194
2550 2841991005
2551 2842040635
2552 2842046419
2553 2844320010
2554 2847937310
2555 2847947729
2556 2849078410
2557 2857512782
2558 2857524640
2559 2874598785
2560 2874607396
2561 2874614585
2562 2874628067
2563 2874635018
2564 2874652241
2565 2876766229
2566 2876778824
2567 2876817720
2568 2876824281
2569 2879082617
2570 2879086612
2571 2879107121
2572 2879111854
2573 2879131534
2574 2879147980
2575 2881371472
2576 2881666565
2577 2885369959
2578 2885374998
2579 2885386833
2580 2885410275
2581 2888385440
2582 2888392792
2583 2888425570
2584 2889038027
2585 2893069161
2586 2903730315
2587 2903755309
2588 2903769624
2589 2903769715
2590 2904674315
2591 2904691217
2592 2904701301
2593 2904711985
2594 2906604750
2595 2906616534
2596 2906627333
2597 2906635307
2598 2906643931
2599 2906666852
2600 2908741702
2601 2908759142
2602 2908781160
2603 2919078522
2604 2922366026
2605 2922372419
2606 2922387362
2607 2922397083
2608 2922431447
2609 2929626157
2610 2932784963
2611 2932795159
2612 2932805687
2613 2932809996
2614 2932818261
2615 2932828800
2616 2933583118
2617 2935609816
2618 2935619780
2619 2935634042
2620 2935638761
2621 2935652155
2622 2935659872
2623 2935666388
2624 2935676565
2625 2935690763
2626 2935694646
2627 2935703767
2628 2935718144
2629 2935727875
2630 2935736579
2631 2935745958
2632 2935756339
2633 2935760556
2634 2935777008
2635 2935783564
2636 2935792791
2637 2935800861
2638 2935801904
2639 2935810674
2640 2935822977
2641 2935828255
2642 2935842459
2643 2935848559
2644 2935857905
2645 2935868753
2646 2935874168
2647 2935883943
2648 2935909633
2649 2935917358
2650 2935927114
2651 2935937042
2652 2935944655
2653 2935953092
2654 2935966594
2655 2935969932
2656 2935980224
2657 2935987017
2658 2935992907
2659 2936002820
2660 2936014288
2661 2936023872
2662 2936031515
2663 2936037906
2664 2936049394
2665 2936062144
2666 2940561686
2667 2941510655
2668 2941518039
2669 2941527090
2670 2941531195
2671 2941542508
2672 3005481239
2673 3005484805
2674 3005508444
2675 3005588053
2676 3005600303
2677 3005715796
2678 3005723151
2679 8006927953
2680 8006939470
2681 8006972128
2682 8006979220
2683 8006984417
2684 8007001351
2685 8016520673
2686 8016528699
2687 8016533878
2688 8016547101
2689 8016555019
2690 8016563389
2691 8016572216
2692 8016576405
2693 8016594323
2694 8016601139
2695 8016609309
2696 8016615595
2697 8016625625
2698 8017064909
2699 8019533649
2700 8019546017
2701 8019552704
2702 8019565347
2703 8019575447
2704 8019584285
2705 8019592053
2706 8019609128
2707 8019619801
2708 8019633314
2709 8019646586
2710 8019649356
2711 8019661188
2712 8019670739
2713 8019685492
2714 8019691055
2715 8055745125
2716 8056681095
2717 8056682539
2718 8056684740
2719 8056693074
2720 8056975083

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11010

DUF2848

Protein of unknown function (DUF2848)

27

208

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbf-assembly1.cif.gz_A crystal structures of cg1458 0.722 19 224
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.6653 19 224
4dbf-assembly1.cif.gz_B crystal structures of cg1458 0.658 3 224
4dbh-assembly1.cif.gz_B crystal structure of cg1458 with inhibitor 0.6497 3 224
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.6451 19 226
ID Description Score Start End Superfamily
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7367 23 224 3.90.850.10
af_Q1ZXQ1_120_425_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7275 21 226 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7202 23 224 3.90.850.10
af_Q9NSI5_146_240_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6867 196 224 2.60.40.10
af_Q1ZXQ1_120_425_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.664 21 226 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A1L3FKG2-F1-model_v4 DUF2848 domain-containing protein 0.9799 1 228 GO:0003824
AF-A0A516J760-F1-model_v4 deleted 0.9796 1 228
AF-A0A437QQV3-F1-model_v4 DUF2848 domain-containing protein 0.9794 1 228 GO:0003824
AF-U1IFE9-F1-model_v4 deleted 0.9783 1 228
AF-A0A2U8Q8J7-F1-model_v4 deleted 0.9782 1 228

Map