F493332
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1360 | 691 | 2720 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300048910|Ga0496107_0148464|Ga0496107_0148464_41_694 |
| Length | 217 |
| Sequence | MFDLTFTIETENGTTPLTLAIDQAVVAGWTGRDPVARDKHIAELQEMGIAPPASTPIYYRASARRLTMEDSIEFVLIGWQGRTFVGLGSDHTDRKVEGYSVTVSKQMCDKPIASTLWELEEVIDHWDRLILRSYAWIGGKRELYQEGTLDAMLPVLELLKRGFAGGKLPDGCAMFGGTFAAKGGIRPASRFECELEDPVLKRTIRHAYDVTELPVLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 81 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 82 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 116 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 117 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 118 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 231 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 261 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 363 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 364 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 365 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 411 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 415 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 416 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 417 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 420 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 422 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 425 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 427 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 429 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 430 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 432 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 433 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 434 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 439 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 440 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 441 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 442 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 444 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 445 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 449 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 450 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 451 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 452 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 454 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 457 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 459 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 460 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 461 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 462 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 463 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 464 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 465 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 466 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 467 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 468 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 469 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 470 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 471 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 472 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 473 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 474 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 475 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 476 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 477 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 478 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 479 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 480 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 481 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 482 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 483 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 484 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 485 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 486 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 487 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 488 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 489 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 490 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 491 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 492 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 493 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 494 | 2791355199 | |||
| 495 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 496 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 497 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 498 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 499 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 500 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 501 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 502 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 503 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 504 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 505 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 506 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 507 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 508 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 509 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 510 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 511 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 512 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 513 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 514 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 515 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 516 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 517 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 518 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 519 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 520 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 521 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 522 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 523 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 524 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 525 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 526 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 527 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 528 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 529 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 530 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 531 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 532 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 533 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 534 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 535 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 536 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 537 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 538 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 539 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 540 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 541 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 542 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 543 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 544 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 545 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 546 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 547 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 548 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 549 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 550 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 551 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 552 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 553 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 554 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 555 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 556 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 557 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 558 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 559 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 560 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 561 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 562 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 563 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 564 | 2904699407 | |||
| 565 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 566 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 567 | 2906610324 | |||
| 568 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 569 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 570 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 571 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 572 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 573 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 574 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 575 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 576 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 577 | 2922368715 | |||
| 578 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 579 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 580 | 2922425934 | |||
| 581 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 582 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 583 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 584 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 585 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 586 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 587 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 588 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 589 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 590 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 591 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 592 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 593 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 594 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 595 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 596 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 597 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 598 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 599 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 600 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 601 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 602 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 603 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 604 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 605 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 606 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 607 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 608 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 609 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 610 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 611 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 612 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 613 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 614 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 615 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 616 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 617 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 618 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 619 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 620 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 621 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 622 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 623 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 624 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 625 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 626 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 627 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 628 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 629 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 630 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 631 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 632 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 633 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 634 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 635 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 636 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 637 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 638 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 639 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 640 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 641 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 642 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 643 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 644 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 645 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 646 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 647 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 648 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 649 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 650 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 651 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 652 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 653 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 654 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 655 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 656 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 657 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 658 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 659 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 660 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 661 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 662 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 663 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 664 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 665 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 666 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 667 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 668 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 669 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 670 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 671 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 672 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 673 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 674 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 675 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 676 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 677 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 678 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 679 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 680 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 681 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 682 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 683 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 684 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 685 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 686 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 687 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 688 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 689 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 690 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 691 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.88 |
| Metatranscriptomes | 0.07 |
| Isolates | 17.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.25 |
| Nodule | 14.19 |
| Rhizoplane | 5.81 |
| Rhizosphere | 57.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496107_0148464 | 3300048910 | Bacteria | 1734 |
| 2 | JGI25406J46586_10000214 | 3300003203 | Bacteria | 25609 |
| 3 | JGI25406J46586_10006102 | 3300003203 | Bacteria | 5565 |
| 4 | JGI25160J50197_1003619 | 3300003354 | Bacteria | 6865 |
| 5 | JGI25160J50197_1033878 | 3300003354 | Bacteria | 1277 |
| 6 | Ga0055542_1013907 | 3300003762 | Bacteria | 1338 |
| 7 | Ga0055531_10009410 | 3300003794 | Bacteria | 4993 |
| 8 | Ga0055543_1003833 | 3300004625 | Bacteria | 4269 |
| 9 | Ga0065165_1002074 | 3300005262 | Bacteria | 18412 |
| 10 | Ga0065165_1002220 | 3300005262 | Bacteria | 17337 |
| 11 | Ga0065165_1016908 | 3300005262 | Bacteria | 2710 |
| 12 | Ga0070658_10061837 | 3300005327 | Bacteria | 3051 |
| 13 | Ga0070658_10277390 | 3300005327 | Bacteria | 1426 |
| 14 | Ga0070658_10669119 | 3300005327 | Bacteria | 901 |
| 15 | Ga0070683_100013050 | 3300005329 | Bacteria | 7235 |
| 16 | Ga0070670_100168954 | 3300005331 | Bacteria | 1897 |
| 17 | Ga0070670_100617758 | 3300005331 | Bacteria | 971 |
| 18 | Ga0068869_100146568 | 3300005334 | Bacteria | 1827 |
| 19 | Ga0068869_100587398 | 3300005334 | Bacteria | 939 |
| 20 | Ga0070666_10559044 | 3300005335 | Bacteria | 833 |
| 21 | Ga0070680_100012621 | 3300005336 | Bacteria | 6567 |
| 22 | Ga0070680_100031361 | 3300005336 | Bacteria | 4272 |
| 23 | Ga0068868_100108576 | 3300005338 | Bacteria | 2252 |
| 24 | Ga0070660_100003001 | 3300005339 | Bacteria | 11625 |
| 25 | Ga0070660_100360200 | 3300005339 | Bacteria | 1199 |
| 26 | Ga0070687_100119548 | 3300005343 | Bacteria | 1505 |
| 27 | Ga0070668_100366074 | 3300005347 | Bacteria | 1223 |
| 28 | Ga0070668_100467235 | 3300005347 | Bacteria | 1087 |
| 29 | Ga0070669_100202934 | 3300005353 | Bacteria | 1561 |
| 30 | Ga0070669_100251774 | 3300005353 | Bacteria | 1406 |
| 31 | Ga0070671_100273868 | 3300005355 | Bacteria | 1435 |
| 32 | Ga0070673_100624233 | 3300005364 | Bacteria | 985 |
| 33 | Ga0070688_100284611 | 3300005365 | Bacteria | 1189 |
| 34 | Ga0070688_100292292 | 3300005365 | Bacteria | 1175 |
| 35 | Ga0070659_100167678 | 3300005366 | Bacteria | 1797 |
| 36 | Ga0070659_100200483 | 3300005366 | Bacteria | 1642 |
| 37 | Ga0070659_100406140 | 3300005366 | Bacteria | 1150 |
| 38 | Ga0070667_100859563 | 3300005367 | Bacteria | 843 |
| 39 | Ga0070709_10000203 | 3300005434 | Bacteria | 38151 |
| 40 | Ga0070709_10035659 | 3300005434 | Bacteria | 3024 |
| 41 | Ga0070709_10045651 | 3300005434 | Bacteria | 2720 |
| 42 | Ga0070709_10126394 | 3300005434 | Bacteria | 1740 |
| 43 | Ga0070714_100009406 | 3300005435 | Bacteria | 7683 |
| 44 | Ga0070714_100042351 | 3300005435 | Bacteria | 3846 |
| 45 | Ga0070714_100234407 | 3300005435 | Bacteria | 1692 |
| 46 | Ga0070713_100013461 | 3300005436 | Bacteria | 6042 |
| 47 | Ga0070713_100076397 | 3300005436 | Bacteria | 2844 |
| 48 | Ga0070713_100119176 | 3300005436 | Bacteria | 2312 |
| 49 | Ga0070713_100137195 | 3300005436 | Bacteria | 2163 |
| 50 | Ga0070710_10001622 | 3300005437 | Bacteria | 10623 |
| 51 | Ga0070710_10029445 | 3300005437 | Bacteria | 2947 |
| 52 | Ga0070701_10099464 | 3300005438 | Bacteria | 1608 |
| 53 | Ga0070711_100106196 | 3300005439 | Bacteria | 2052 |
| 54 | Ga0070705_100163366 | 3300005440 | Bacteria | 1491 |
| 55 | Ga0070700_100696001 | 3300005441 | Bacteria | 807 |
| 56 | Ga0070663_100011972 | 3300005455 | Bacteria | 5471 |
| 57 | Ga0070663_100049973 | 3300005455 | Bacteria | 2972 |
| 58 | Ga0070663_100066779 | 3300005455 | Bacteria | 2607 |
| 59 | Ga0070663_100071943 | 3300005455 | Bacteria | 2518 |
| 60 | Ga0070678_100007842 | 3300005456 | Bacteria | 6353 |
| 61 | Ga0070678_100040699 | 3300005456 | Bacteria | 3289 |
| 62 | Ga0070678_100213115 | 3300005456 | Bacteria | 1601 |
| 63 | Ga0070662_100116684 | 3300005457 | Bacteria | 2041 |
| 64 | Ga0070681_10057282 | 3300005458 | Bacteria | 3877 |
| 65 | Ga0070681_10166491 | 3300005458 | Bacteria | 2127 |
| 66 | Ga0070681_10241297 | 3300005458 | Bacteria | 1721 |
| 67 | Ga0068867_100376315 | 3300005459 | Bacteria | 1192 |
| 68 | Ga0070706_100105029 | 3300005467 | Bacteria | 2628 |
| 69 | Ga0070706_100945034 | 3300005467 | Bacteria | 796 |
| 70 | Ga0070707_100088722 | 3300005468 | Bacteria | 2992 |
| 71 | Ga0070707_100299391 | 3300005468 | Bacteria | 1563 |
| 72 | Ga0070698_100338108 | 3300005471 | Bacteria | 1437 |
| 73 | Ga0070679_100014122 | 3300005530 | Bacteria | 7659 |
| 74 | Ga0070679_100019456 | 3300005530 | Bacteria | 6601 |
| 75 | Ga0070679_100070354 | 3300005530 | Bacteria | 3491 |
| 76 | Ga0070679_100112682 | 3300005530 | Bacteria | 2706 |
| 77 | Ga0070679_100135998 | 3300005530 | Bacteria | 2439 |
| 78 | Ga0070679_100564567 | 3300005530 | Bacteria | 1082 |
| 79 | Ga0070679_100769637 | 3300005530 | Bacteria | 906 |
| 80 | Ga0070684_100005044 | 3300005535 | Bacteria | 10086 |
| 81 | Ga0070684_100009975 | 3300005535 | Bacteria | 7508 |
| 82 | Ga0070684_100161538 | 3300005535 | Bacteria | 2032 |
| 83 | Ga0070684_100397672 | 3300005535 | Bacteria | 1270 |
| 84 | Ga0068853_100004408 | 3300005539 | Bacteria | 10900 |
| 85 | Ga0068853_100841864 | 3300005539 | Bacteria | 879 |
| 86 | Ga0068853_100852955 | 3300005539 | Bacteria | 874 |
| 87 | Ga0068853_100886362 | 3300005539 | Bacteria | 857 |
| 88 | Ga0070672_100074296 | 3300005543 | Bacteria | 2711 |
| 89 | Ga0070672_100106450 | 3300005543 | Bacteria | 2281 |
| 90 | Ga0070672_100396874 | 3300005543 | Bacteria | 1182 |
| 91 | Ga0070686_100164062 | 3300005544 | Bacteria | 1567 |
| 92 | Ga0070693_100176930 | 3300005547 | Bacteria | 1371 |
| 93 | Ga0070693_100303737 | 3300005547 | Bacteria | 1077 |
| 94 | Ga0070665_100061335 | 3300005548 | Bacteria | 3769 |
| 95 | Ga0070665_100344735 | 3300005548 | Bacteria | 1495 |
| 96 | Ga0070665_100362326 | 3300005548 | Bacteria | 1456 |
| 97 | Ga0068855_100020164 | 3300005563 | Bacteria | 8006 |
| 98 | Ga0068855_100031608 | 3300005563 | Bacteria | 6321 |
| 99 | Ga0068855_100050152 | 3300005563 | Bacteria | 4920 |
| 100 | Ga0068855_100198629 | 3300005563 | Bacteria | 2259 |
| 101 | Ga0068855_100357095 | 3300005563 | Bacteria | 1609 |
| 102 | Ga0068855_100960747 | 3300005563 | Bacteria | 899 |
| 103 | Ga0070664_100027907 | 3300005564 | Bacteria | 4694 |
| 104 | Ga0070664_100417265 | 3300005564 | Bacteria | 1229 |
| 105 | Ga0068857_100087798 | 3300005577 | Bacteria | 2782 |
| 106 | Ga0068857_100708625 | 3300005577 | Bacteria | 957 |
| 107 | Ga0068856_100001827 | 3300005614 | Bacteria | 22255 |
| 108 | Ga0068856_100094136 | 3300005614 | Bacteria | 2982 |
| 109 | Ga0068856_100503865 | 3300005614 | Bacteria | 1232 |
| 110 | Ga0068856_100695005 | 3300005614 | Bacteria | 1037 |
| 111 | Ga0070702_100115420 | 3300005615 | Bacteria | 1672 |
| 112 | Ga0068852_100194657 | 3300005616 | Bacteria | 1915 |
| 113 | Ga0068852_100199577 | 3300005616 | Bacteria | 1892 |
| 114 | Ga0068852_100224325 | 3300005616 | Bacteria | 1788 |
| 115 | Ga0068852_100785485 | 3300005616 | Bacteria | 966 |
| 116 | Ga0068852_101191711 | 3300005616 | Bacteria | 782 |
| 117 | Ga0068859_100096353 | 3300005617 | Bacteria | 3011 |
| 118 | Ga0068859_101024744 | 3300005617 | Bacteria | 907 |
| 119 | Ga0068864_100050579 | 3300005618 | Bacteria | 3577 |
| 120 | Ga0068864_100054265 | 3300005618 | Bacteria | 3459 |
| 121 | Ga0068864_100217171 | 3300005618 | Bacteria | 1763 |
| 122 | Ga0068866_10189230 | 3300005718 | Bacteria | 1222 |
| 123 | Ga0068863_100187248 | 3300005841 | Bacteria | 1988 |
| 124 | Ga0068863_100674895 | 3300005841 | Bacteria | 1026 |
| 125 | Ga0068858_100146094 | 3300005842 | Bacteria | 2221 |
| 126 | Ga0068858_100147587 | 3300005842 | Bacteria | 2209 |
| 127 | Ga0068858_100214799 | 3300005842 | Bacteria | 1821 |
| 128 | Ga0068858_100217521 | 3300005842 | Bacteria | 1809 |
| 129 | Ga0068858_100519975 | 3300005842 | Bacteria | 1151 |
| 130 | Ga0068858_100849174 | 3300005842 | Bacteria | 892 |
| 131 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 132 | Ga0068860_100115374 | 3300005843 | Bacteria | 2568 |
| 133 | Ga0068860_100914621 | 3300005843 | Bacteria | 894 |
| 134 | Ga0068862_100260310 | 3300005844 | Bacteria | 1583 |
| 135 | Ga0081455_10013417 | 3300005937 | Bacteria | 8100 |
| 136 | Ga0081455_10041329 | 3300005937 | Bacteria | 4056 |
| 137 | Ga0081455_10094508 | 3300005937 | Bacteria | 2415 |
| 138 | Ga0081455_10143692 | 3300005937 | Bacteria | 1849 |
| 139 | Ga0081540_1003965 | 3300005983 | Bacteria | 11501 |
| 140 | Ga0081540_1005624 | 3300005983 | Bacteria | 9335 |
| 141 | Ga0081540_1005692 | 3300005983 | Bacteria | 9250 |
| 142 | Ga0081540_1010058 | 3300005983 | Bacteria | 6440 |
| 143 | Ga0081540_1014480 | 3300005983 | Bacteria | 5048 |
| 144 | Ga0081540_1035706 | 3300005983 | Bacteria | 2662 |
| 145 | Ga0081540_1043747 | 3300005983 | Bacteria | 2293 |
| 146 | Ga0081540_1056296 | 3300005983 | Bacteria | 1909 |
| 147 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 148 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 149 | Ga0081539_10019985 | 3300005985 | Bacteria | 4555 |
| 150 | Ga0081539_10067278 | 3300005985 | Bacteria | 1938 |
| 151 | Ga0081539_10231561 | 3300005985 | Bacteria | 834 |
| 152 | Ga0070717_10076659 | 3300006028 | Bacteria | 2799 |
| 153 | Ga0070717_10146487 | 3300006028 | Bacteria | 2040 |
| 154 | Ga0070717_10376256 | 3300006028 | Bacteria | 1273 |
| 155 | Ga0070717_10908434 | 3300006028 | Bacteria | 802 |
| 156 | Ga0075365_10008428 | 3300006038 | Bacteria | 5852 |
| 157 | Ga0075365_10021294 | 3300006038 | Bacteria | 4042 |
| 158 | Ga0075365_10118150 | 3300006038 | Bacteria | 1827 |
| 159 | Ga0075365_10178734 | 3300006038 | Bacteria | 1483 |
| 160 | Ga0075368_10051146 | 3300006042 | Bacteria | 1642 |
| 161 | Ga0075368_10102549 | 3300006042 | Bacteria | 1176 |
| 162 | Ga0075368_10116397 | 3300006042 | Bacteria | 1105 |
| 163 | Ga0075368_10195298 | 3300006042 | Bacteria | 855 |
| 164 | Ga0075363_100006965 | 3300006048 | Bacteria | 5170 |
| 165 | Ga0075363_100022057 | 3300006048 | Bacteria | 3215 |
| 166 | Ga0075364_10186255 | 3300006051 | Bacteria | 1405 |
| 167 | Ga0070716_100001846 | 3300006173 | Bacteria | 9603 |
| 168 | Ga0070716_100685945 | 3300006173 | Bacteria | 781 |
| 169 | Ga0070712_100006733 | 3300006175 | Bacteria | 7144 |
| 170 | Ga0070712_100024328 | 3300006175 | Bacteria | 4012 |
| 171 | Ga0070712_100044059 | 3300006175 | Bacteria | 3075 |
| 172 | Ga0075362_10068310 | 3300006177 | Bacteria | 1618 |
| 173 | Ga0075367_10029890 | 3300006178 | Bacteria | 3120 |
| 174 | Ga0075369_10052362 | 3300006186 | Bacteria | 1769 |
| 175 | Ga0075366_10056277 | 3300006195 | Bacteria | 2336 |
| 176 | Ga0097621_100341101 | 3300006237 | Bacteria | 1331 |
| 177 | Ga0075370_10103498 | 3300006353 | Bacteria | 1649 |
| 178 | Ga0075370_10142858 | 3300006353 | Bacteria | 1400 |
| 179 | Ga0068871_100078523 | 3300006358 | Bacteria | 2729 |
| 180 | Ga0068871_100687021 | 3300006358 | Bacteria | 937 |
| 181 | Ga0075434_100270509 | 3300006871 | Bacteria | 1718 |
| 182 | Ga0075434_100541799 | 3300006871 | Bacteria | 1184 |
| 183 | Ga0068865_100033651 | 3300006881 | Bacteria | 3432 |
| 184 | Ga0068865_100040328 | 3300006881 | Bacteria | 3172 |
| 185 | Ga0097620_100096353 | 3300006931 | Bacteria | 3011 |
| 186 | Ga0097620_101024770 | 3300006931 | Bacteria | 907 |
| 187 | Ga0099825_1017324 | 3300006941 | Bacteria | 5917 |
| 188 | Ga0099822_1018218 | 3300006943 | Bacteria | 7346 |
| 189 | Ga0099823_1059808 | 3300006944 | Bacteria | 2016 |
| 190 | Ga0075435_100325964 | 3300007076 | Bacteria | 1315 |
| 191 | Ga0099794_10011757 | 3300007265 | Bacteria | 3758 |
| 192 | Ga0099794_10097011 | 3300007265 | Bacteria | 1468 |
| 193 | Ga0099795_10014182 | 3300007788 | Bacteria | 2464 |
| 194 | Ga0099795_10058655 | 3300007788 | Bacteria | 1422 |
| 195 | Ga0099795_10134606 | 3300007788 | Bacteria | 1000 |
| 196 | Ga0105250_10170836 | 3300009092 | Bacteria | 910 |
| 197 | Ga0105240_10026622 | 3300009093 | Bacteria | 7589 |
| 198 | Ga0105240_10034709 | 3300009093 | Bacteria | 6503 |
| 199 | Ga0105240_10055828 | 3300009093 | Bacteria | 4944 |
| 200 | Ga0105240_10125422 | 3300009093 | Bacteria | 3086 |
| 201 | Ga0105240_10145106 | 3300009093 | Bacteria | 2833 |
| 202 | Ga0105240_10460048 | 3300009093 | Bacteria | 1422 |
| 203 | Ga0105240_10817350 | 3300009093 | Bacteria | 1008 |
| 204 | Ga0105240_11124568 | 3300009093 | Bacteria | 835 |
| 205 | Ga0105245_10033125 | 3300009098 | Bacteria | 4577 |
| 206 | Ga0105245_10258800 | 3300009098 | Bacteria | 1693 |
| 207 | Ga0105245_10809687 | 3300009098 | Bacteria | 975 |
| 208 | Ga0105247_10008197 | 3300009101 | Bacteria | 6379 |
| 209 | Ga0105247_10104916 | 3300009101 | Bacteria | 1811 |
| 210 | Ga0105247_10253365 | 3300009101 | Bacteria | 1204 |
| 211 | Ga0105243_10018993 | 3300009148 | Bacteria | 5211 |
| 212 | Ga0105243_10405296 | 3300009148 | Bacteria | 1268 |
| 213 | Ga0105243_10570125 | 3300009148 | Bacteria | 1085 |
| 214 | Ga0105241_10030969 | 3300009174 | Bacteria | 4001 |
| 215 | Ga0105242_10153337 | 3300009176 | Bacteria | 2011 |
| 216 | Ga0105242_10322761 | 3300009176 | Bacteria | 1417 |
| 217 | Ga0105242_10442847 | 3300009176 | Bacteria | 1223 |
| 218 | Ga0105242_10537981 | 3300009176 | Bacteria | 1118 |
| 219 | Ga0105248_10075716 | 3300009177 | Bacteria | 3782 |
| 220 | Ga0105248_10093026 | 3300009177 | Bacteria | 3395 |
| 221 | Ga0105248_10097999 | 3300009177 | Bacteria | 3303 |
| 222 | Ga0105248_10633706 | 3300009177 | Bacteria | 1206 |
| 223 | Ga0105237_10012336 | 3300009545 | Bacteria | 9004 |
| 224 | Ga0105237_10024997 | 3300009545 | Bacteria | 6110 |
| 225 | Ga0105237_10044165 | 3300009545 | Bacteria | 4487 |
| 226 | Ga0105237_10081141 | 3300009545 | Bacteria | 3234 |
| 227 | Ga0105237_10180622 | 3300009545 | Bacteria | 2110 |
| 228 | Ga0105237_10242635 | 3300009545 | Bacteria | 1803 |
| 229 | Ga0105237_10645509 | 3300009545 | Bacteria | 1065 |
| 230 | Ga0105238_10015861 | 3300009551 | Bacteria | 7625 |
| 231 | Ga0105238_10083037 | 3300009551 | Bacteria | 3193 |
| 232 | Ga0105238_10415895 | 3300009551 | Bacteria | 1339 |
| 233 | Ga0105238_10543691 | 3300009551 | Bacteria | 1165 |
| 234 | Ga0105238_10652073 | 3300009551 | Bacteria | 1063 |
| 235 | Ga0105249_10118682 | 3300009553 | Bacteria | 2511 |
| 236 | Ga0099796_10044327 | 3300010159 | Bacteria | 1519 |
| 237 | Ga0105239_10017391 | 3300010375 | Bacteria | 7952 |
| 238 | Ga0105239_10031991 | 3300010375 | Bacteria | 5781 |
| 239 | Ga0105239_10075749 | 3300010375 | Bacteria | 3700 |
| 240 | Ga0105239_10193690 | 3300010375 | Bacteria | 2276 |
| 241 | Ga0105246_10031772 | 3300011119 | Bacteria | 3496 |
| 242 | Ga0105246_10070395 | 3300011119 | Bacteria | 2460 |
| 243 | Ga0105246_10343304 | 3300011119 | Bacteria | 1221 |
| 244 | Ga0157373_10344774 | 3300013100 | Bacteria | 1062 |
| 245 | Ga0157371_10095539 | 3300013102 | Bacteria | 2106 |
| 246 | Ga0157371_10308039 | 3300013102 | Bacteria | 1147 |
| 247 | Ga0157370_10027113 | 3300013104 | Bacteria | 5649 |
| 248 | Ga0157370_10105073 | 3300013104 | Bacteria | 2643 |
| 249 | Ga0157370_10403770 | 3300013104 | Bacteria | 1257 |
| 250 | Ga0157369_10015050 | 3300013105 | Bacteria | 8730 |
| 251 | Ga0157369_10021463 | 3300013105 | Bacteria | 7224 |
| 252 | Ga0157369_10104910 | 3300013105 | Bacteria | 3009 |
| 253 | Ga0157369_10858147 | 3300013105 | Bacteria | 932 |
| 254 | Ga0157374_10070236 | 3300013296 | Bacteria | 3299 |
| 255 | Ga0157374_10684606 | 3300013296 | Bacteria | 1038 |
| 256 | Ga0163162_10138896 | 3300013306 | Bacteria | 2542 |
| 257 | Ga0163162_10237640 | 3300013306 | Bacteria | 1952 |
| 258 | Ga0163162_10303134 | 3300013306 | Bacteria | 1730 |
| 259 | Ga0163162_10337567 | 3300013306 | Bacteria | 1639 |
| 260 | Ga0157372_10402452 | 3300013307 | Bacteria | 1595 |
| 261 | Ga0157372_10439338 | 3300013307 | Bacteria | 1521 |
| 262 | Ga0157375_10079932 | 3300013308 | Bacteria | 3306 |
| 263 | Ga0157375_10390085 | 3300013308 | Bacteria | 1559 |
| 264 | Ga0157375_10637335 | 3300013308 | Bacteria | 1223 |
| 265 | Ga0163163_10072423 | 3300014325 | Bacteria | 3435 |
| 266 | Ga0163163_10109318 | 3300014325 | Bacteria | 2792 |
| 267 | Ga0163163_10238282 | 3300014325 | Bacteria | 1869 |
| 268 | Ga0163163_10291199 | 3300014325 | Bacteria | 1685 |
| 269 | Ga0163163_11126544 | 3300014325 | Bacteria | 848 |
| 270 | Ga0157380_10330482 | 3300014326 | Bacteria | 1417 |
| 271 | Ga0157380_11231924 | 3300014326 | Bacteria | 793 |
| 272 | Ga0182008_10163633 | 3300014497 | Bacteria | 1120 |
| 273 | Ga0157379_10078989 | 3300014968 | Bacteria | 2947 |
| 274 | Ga0157379_10254156 | 3300014968 | Bacteria | 1596 |
| 275 | Ga0157379_10393617 | 3300014968 | Bacteria | 1273 |
| 276 | Ga0157376_10040939 | 3300014969 | Bacteria | 3790 |
| 277 | Ga0157376_10145143 | 3300014969 | Bacteria | 2134 |
| 278 | Ga0163161_10051522 | 3300017792 | Bacteria | 2982 |
| 279 | Ga0163161_10256175 | 3300017792 | Bacteria | 1365 |
| 280 | Ga0206353_11236131 | 3300020082 | Bacteria | 795 |
| 281 | Ga0214544_1001813 | 3300021320 | Bacteria | 44864 |
| 282 | Ga0214544_1029472 | 3300021320 | Bacteria | 2020 |
| 283 | Ga0214544_1032156 | 3300021320 | Bacteria | 1663 |
| 284 | Ga0214542_1001236 | 3300021321 | Bacteria | 51849 |
| 285 | Ga0214542_1029050 | 3300021321 | Bacteria | 2310 |
| 286 | Ga0214542_1040372 | 3300021321 | Bacteria | 1200 |
| 287 | Ga0214542_1040750 | 3300021321 | Bacteria | 1181 |
| 288 | Ga0214545_1000924 | 3300021324 | Bacteria | 51830 |
| 289 | Ga0214545_1023872 | 3300021324 | Bacteria | 3911 |
| 290 | Ga0214543_1003531 | 3300021327 | Bacteria | 30263 |
| 291 | Ga0214543_1025126 | 3300021327 | Bacteria | 3507 |
| 292 | Ga0214543_1035012 | 3300021327 | Bacteria | 1674 |
| 293 | Ga0214543_1041233 | 3300021327 | Bacteria | 1200 |
| 294 | Ga0213873_10028627 | 3300021358 | Bacteria | 1367 |
| 295 | Ga0213876_10001431 | 3300021384 | Bacteria | 14868 |
| 296 | Ga0209563_108847 | 3300025230 | Bacteria | 1562 |
| 297 | Ga0207425_1007829 | 3300025245 | Bacteria | 2785 |
| 298 | Ga0209677_113470 | 3300025253 | Bacteria | 1160 |
| 299 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 300 | Ga0209233_1001441 | 3300025261 | Bacteria | 9387 |
| 301 | Ga0209233_1003552 | 3300025261 | Bacteria | 5483 |
| 302 | Ga0209233_1022482 | 3300025261 | Bacteria | 1612 |
| 303 | Ga0209233_1028978 | 3300025261 | Bacteria | 1322 |
| 304 | Ga0209455_1022828 | 3300025272 | Bacteria | 1184 |
| 305 | Ga0209130_1040756 | 3300025284 | Bacteria | 896 |
| 306 | Ga0209564_1000385 | 3300025295 | Bacteria | 80273 |
| 307 | Ga0209564_1011033 | 3300025295 | Bacteria | 4087 |
| 308 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 309 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 310 | Ga0209758_1001210 | 3300025297 | Bacteria | 32486 |
| 311 | Ga0209758_1011006 | 3300025297 | Bacteria | 5307 |
| 312 | Ga0209758_1015407 | 3300025297 | Bacteria | 3961 |
| 313 | Ga0209256_1005155 | 3300025299 | Bacteria | 7715 |
| 314 | Ga0209256_1024267 | 3300025299 | Bacteria | 1789 |
| 315 | Ga0209256_1024426 | 3300025299 | Bacteria | 1779 |
| 316 | Ga0207426_1000572 | 3300025302 | Bacteria | 49561 |
| 317 | Ga0207426_1001763 | 3300025302 | Bacteria | 16381 |
| 318 | Ga0207426_1006362 | 3300025302 | Bacteria | 5153 |
| 319 | Ga0207697_10230640 | 3300025315 | Bacteria | 817 |
| 320 | Ga0207656_10141294 | 3300025321 | Bacteria | 1135 |
| 321 | Ga0207692_10010389 | 3300025898 | Bacteria | 3921 |
| 322 | Ga0207692_10012280 | 3300025898 | Bacteria | 3674 |
| 323 | Ga0207692_10156023 | 3300025898 | Bacteria | 1311 |
| 324 | Ga0207692_10265572 | 3300025898 | Bacteria | 1033 |
| 325 | Ga0207642_10064945 | 3300025899 | Bacteria | 1713 |
| 326 | Ga0207642_10217426 | 3300025899 | Bacteria | 1066 |
| 327 | Ga0207710_10050507 | 3300025900 | Bacteria | 1866 |
| 328 | Ga0207688_10013784 | 3300025901 | Bacteria | 4393 |
| 329 | Ga0207688_10027182 | 3300025901 | Bacteria | 3147 |
| 330 | Ga0207680_10322944 | 3300025903 | Bacteria | 1080 |
| 331 | Ga0207647_10256686 | 3300025904 | Bacteria | 1002 |
| 332 | Ga0207685_10032271 | 3300025905 | Bacteria | 1883 |
| 333 | Ga0207685_10077271 | 3300025905 | Bacteria | 1367 |
| 334 | Ga0207699_10004445 | 3300025906 | Bacteria | 6706 |
| 335 | Ga0207699_10021389 | 3300025906 | Bacteria | 3485 |
| 336 | Ga0207699_10021591 | 3300025906 | Bacteria | 3473 |
| 337 | Ga0207699_10029552 | 3300025906 | Bacteria | 3057 |
| 338 | Ga0207699_10149149 | 3300025906 | Bacteria | 1545 |
| 339 | Ga0207699_10204556 | 3300025906 | Bacteria | 1340 |
| 340 | Ga0207645_10064837 | 3300025907 | Bacteria | 2334 |
| 341 | Ga0207643_10062976 | 3300025908 | Bacteria | 2120 |
| 342 | Ga0207705_10051852 | 3300025909 | Bacteria | 2953 |
| 343 | Ga0207684_10082993 | 3300025910 | Bacteria | 2729 |
| 344 | Ga0207654_10040051 | 3300025911 | Bacteria | 2639 |
| 345 | Ga0207654_10362035 | 3300025911 | Bacteria | 1001 |
| 346 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 347 | Ga0207707_10173010 | 3300025912 | Bacteria | 1887 |
| 348 | Ga0207707_10200980 | 3300025912 | Bacteria | 1738 |
| 349 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 350 | Ga0207695_10104517 | 3300025913 | Bacteria | 2821 |
| 351 | Ga0207695_10187313 | 3300025913 | Bacteria | 1988 |
| 352 | Ga0207671_10005294 | 3300025914 | Bacteria | 11960 |
| 353 | Ga0207671_10009638 | 3300025914 | Bacteria | 8050 |
| 354 | Ga0207671_10041027 | 3300025914 | Bacteria | 3425 |
| 355 | Ga0207671_10059807 | 3300025914 | Bacteria | 2826 |
| 356 | Ga0207671_10206717 | 3300025914 | Bacteria | 1534 |
| 357 | Ga0207671_10444980 | 3300025914 | Bacteria | 1032 |
| 358 | Ga0207671_10519638 | 3300025914 | Bacteria | 949 |
| 359 | Ga0207693_10004777 | 3300025915 | Bacteria | 11394 |
| 360 | Ga0207693_10006974 | 3300025915 | Bacteria | 9332 |
| 361 | Ga0207693_10014354 | 3300025915 | Bacteria | 6372 |
| 362 | Ga0207693_10015344 | 3300025915 | Bacteria | 6148 |
| 363 | Ga0207693_10053164 | 3300025915 | Bacteria | 3178 |
| 364 | Ga0207693_10136318 | 3300025915 | Bacteria | 1930 |
| 365 | Ga0207693_10346044 | 3300025915 | Bacteria | 1163 |
| 366 | Ga0207663_10002050 | 3300025916 | Bacteria | 9597 |
| 367 | Ga0207663_10033664 | 3300025916 | Bacteria | 3055 |
| 368 | Ga0207663_10221108 | 3300025916 | Bacteria | 1378 |
| 369 | Ga0207660_10006961 | 3300025917 | Bacteria | 7324 |
| 370 | Ga0207660_10033360 | 3300025917 | Bacteria | 3561 |
| 371 | Ga0207660_10274950 | 3300025917 | Bacteria | 1335 |
| 372 | Ga0207662_10085372 | 3300025918 | Bacteria | 1933 |
| 373 | Ga0207657_10006890 | 3300025919 | Bacteria | 11724 |
| 374 | Ga0207657_10034513 | 3300025919 | Bacteria | 4547 |
| 375 | Ga0207649_10263314 | 3300025920 | Bacteria | 1247 |
| 376 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 377 | Ga0207652_10065122 | 3300025921 | Bacteria | 3155 |
| 378 | Ga0207652_10090468 | 3300025921 | Bacteria | 2689 |
| 379 | Ga0207652_10101751 | 3300025921 | Bacteria | 2538 |
| 380 | Ga0207652_10117474 | 3300025921 | Bacteria | 2363 |
| 381 | Ga0207652_10236636 | 3300025921 | Bacteria | 1646 |
| 382 | Ga0207652_10502817 | 3300025921 | Bacteria | 1091 |
| 383 | Ga0207646_10053986 | 3300025922 | Bacteria | 3595 |
| 384 | Ga0207681_10611511 | 3300025923 | Bacteria | 901 |
| 385 | Ga0207694_10005031 | 3300025924 | Bacteria | 10225 |
| 386 | Ga0207694_10324194 | 3300025924 | Bacteria | 1272 |
| 387 | Ga0207694_10372001 | 3300025924 | Bacteria | 1185 |
| 388 | Ga0207659_10483071 | 3300025926 | Bacteria | 1047 |
| 389 | Ga0207687_10091412 | 3300025927 | Bacteria | 2220 |
| 390 | Ga0207700_10063585 | 3300025928 | Bacteria | 2807 |
| 391 | Ga0207700_10087847 | 3300025928 | Bacteria | 2446 |
| 392 | Ga0207700_10112570 | 3300025928 | Bacteria | 2193 |
| 393 | Ga0207700_10219058 | 3300025928 | Bacteria | 1613 |
| 394 | Ga0207700_10322788 | 3300025928 | Bacteria | 1338 |
| 395 | Ga0207664_10002721 | 3300025929 | Bacteria | 11731 |
| 396 | Ga0207664_10016371 | 3300025929 | Bacteria | 5409 |
| 397 | Ga0207664_10432638 | 3300025929 | Bacteria | 1173 |
| 398 | Ga0207664_10590784 | 3300025929 | Bacteria | 997 |
| 399 | Ga0207664_10703412 | 3300025929 | Bacteria | 909 |
| 400 | Ga0207644_10076825 | 3300025931 | Bacteria | 2458 |
| 401 | Ga0207690_10503143 | 3300025932 | Bacteria | 980 |
| 402 | Ga0207690_10783159 | 3300025932 | Bacteria | 787 |
| 403 | Ga0207706_10034381 | 3300025933 | Bacteria | 4510 |
| 404 | Ga0207686_10096308 | 3300025934 | Bacteria | 1966 |
| 405 | Ga0207686_10219824 | 3300025934 | Bacteria | 1371 |
| 406 | Ga0207709_10236759 | 3300025935 | Bacteria | 1325 |
| 407 | Ga0207670_10174646 | 3300025936 | Bacteria | 1614 |
| 408 | Ga0207704_10069584 | 3300025938 | Bacteria | 2224 |
| 409 | Ga0207704_10103399 | 3300025938 | Bacteria | 1905 |
| 410 | Ga0207665_10001320 | 3300025939 | Bacteria | 16732 |
| 411 | Ga0207665_10010178 | 3300025939 | Bacteria | 6173 |
| 412 | Ga0207711_10106450 | 3300025941 | Bacteria | 2489 |
| 413 | Ga0207711_10108996 | 3300025941 | Bacteria | 2460 |
| 414 | Ga0207711_10148134 | 3300025941 | Bacteria | 2116 |
| 415 | Ga0207689_10032632 | 3300025942 | Bacteria | 4329 |
| 416 | Ga0207661_10001270 | 3300025944 | Bacteria | 16867 |
| 417 | Ga0207661_10008424 | 3300025944 | Bacteria | 7371 |
| 418 | Ga0207661_10021928 | 3300025944 | Bacteria | 4796 |
| 419 | Ga0207679_10054338 | 3300025945 | Bacteria | 2947 |
| 420 | Ga0207679_10103081 | 3300025945 | Bacteria | 2236 |
| 421 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 422 | Ga0207667_10159022 | 3300025949 | Bacteria | 2324 |
| 423 | Ga0207667_10204693 | 3300025949 | Bacteria | 2024 |
| 424 | Ga0207667_10291746 | 3300025949 | Bacteria | 1666 |
| 425 | Ga0207667_10318094 | 3300025949 | Bacteria | 1589 |
| 426 | Ga0207668_10023206 | 3300025972 | Bacteria | 3983 |
| 427 | Ga0207668_10516617 | 3300025972 | Bacteria | 1030 |
| 428 | Ga0207640_10235256 | 3300025981 | Bacteria | 1412 |
| 429 | Ga0207640_10569355 | 3300025981 | Bacteria | 955 |
| 430 | Ga0207658_10395783 | 3300025986 | Bacteria | 1213 |
| 431 | Ga0207658_10491338 | 3300025986 | Bacteria | 1092 |
| 432 | Ga0207677_10014286 | 3300026023 | Bacteria | 4632 |
| 433 | Ga0207677_10094719 | 3300026023 | Bacteria | 2180 |
| 434 | Ga0207703_10057761 | 3300026035 | Bacteria | 3165 |
| 435 | Ga0207703_10590460 | 3300026035 | Bacteria | 1050 |
| 436 | Ga0207639_10014358 | 3300026041 | Bacteria | 5569 |
| 437 | Ga0207639_10194488 | 3300026041 | Bacteria | 1735 |
| 438 | Ga0207678_10013434 | 3300026067 | Bacteria | 7187 |
| 439 | Ga0207678_10043423 | 3300026067 | Bacteria | 3890 |
| 440 | Ga0207678_10044113 | 3300026067 | Bacteria | 3858 |
| 441 | Ga0207678_10056735 | 3300026067 | Bacteria | 3371 |
| 442 | Ga0207678_10133768 | 3300026067 | Bacteria | 2115 |
| 443 | Ga0207702_10002952 | 3300026078 | Bacteria | 15870 |
| 444 | Ga0207702_10273621 | 3300026078 | Bacteria | 1594 |
| 445 | Ga0207702_10377753 | 3300026078 | Bacteria | 1362 |
| 446 | Ga0207702_10600858 | 3300026078 | Bacteria | 1079 |
| 447 | Ga0207702_10830616 | 3300026078 | Bacteria | 914 |
| 448 | Ga0207641_10142070 | 3300026088 | Bacteria | 2167 |
| 449 | Ga0207641_10209060 | 3300026088 | Bacteria | 1804 |
| 450 | Ga0207648_10086612 | 3300026089 | Bacteria | 2733 |
| 451 | Ga0207648_10376351 | 3300026089 | Bacteria | 1283 |
| 452 | Ga0207676_10667987 | 3300026095 | Bacteria | 1004 |
| 453 | Ga0207674_10071396 | 3300026116 | Bacteria | 3488 |
| 454 | Ga0207674_10608841 | 3300026116 | Bacteria | 1055 |
| 455 | Ga0207674_10680628 | 3300026116 | Bacteria | 993 |
| 456 | Ga0207675_100233128 | 3300026118 | Bacteria | 1777 |
| 457 | Ga0207683_10782212 | 3300026121 | Bacteria | 886 |
| 458 | Ga0207698_10045951 | 3300026142 | Bacteria | 3293 |
| 459 | Ga0207698_10121806 | 3300026142 | Bacteria | 2209 |
| 460 | Ga0207698_10218793 | 3300026142 | Bacteria | 1719 |
| 461 | Ga0207698_10913554 | 3300026142 | Bacteria | 885 |
| 462 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 463 | Ga0209389_1000115 | 3300027296 | Bacteria | 71798 |
| 464 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 465 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 466 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 467 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 468 | Ga0209489_100612 | 3300027361 | Bacteria | 69168 |
| 469 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 470 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 471 | Ga0209179_1004389 | 3300027512 | Bacteria | 2123 |
| 472 | Ga0209588_1006547 | 3300027671 | Bacteria | 3391 |
| 473 | Ga0209588_1039035 | 3300027671 | Bacteria | 1531 |
| 474 | Ga0209813_10120758 | 3300027866 | Bacteria | 912 |
| 475 | Ga0209813_10166207 | 3300027866 | Bacteria | 799 |
| 476 | Ga0268266_10008590 | 3300028379 | Bacteria | 9072 |
| 477 | Ga0268266_10381617 | 3300028379 | Bacteria | 1329 |
| 478 | Ga0268266_10548059 | 3300028379 | Bacteria | 1108 |
| 479 | Ga0268265_10122547 | 3300028380 | Bacteria | 2144 |
| 480 | Ga0268265_10218799 | 3300028380 | Bacteria | 1665 |
| 481 | Ga0268265_10355923 | 3300028380 | Bacteria | 1338 |
| 482 | Ga0268265_10364172 | 3300028380 | Bacteria | 1324 |
| 483 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 484 | Ga0268264_10530728 | 3300028381 | Bacteria | 1152 |
| 485 | Ga0265337_1007889 | 3300028556 | Bacteria | 3937 |
| 486 | Ga0265334_10005731 | 3300028573 | Bacteria | 5414 |
| 487 | Ga0265323_10019130 | 3300028653 | Bacteria | 2644 |
| 488 | Ga0265336_10000362 | 3300028666 | Bacteria | 29324 |
| 489 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 490 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 491 | Ga0265338_10001385 | 3300028800 | Bacteria | 39441 |
| 492 | Ga0307511_10101412 | 3300030521 | Bacteria | 1887 |
| 493 | Ga0265330_10017515 | 3300031235 | Bacteria | 3298 |
| 494 | Ga0265330_10034042 | 3300031235 | Bacteria | 2276 |
| 495 | Ga0265332_10021959 | 3300031238 | Bacteria | 2817 |
| 496 | Ga0265328_10007270 | 3300031239 | Bacteria | 4628 |
| 497 | Ga0265328_10076374 | 3300031239 | Bacteria | 1233 |
| 498 | Ga0265325_10008844 | 3300031241 | Bacteria | 5916 |
| 499 | Ga0265340_10158752 | 3300031247 | Bacteria | 1028 |
| 500 | Ga0265339_10008162 | 3300031249 | Bacteria | 6683 |
| 501 | Ga0265331_10021239 | 3300031250 | Bacteria | 3325 |
| 502 | Ga0265316_10320410 | 3300031344 | Bacteria | 1126 |
| 503 | Ga0307513_10276547 | 3300031456 | Bacteria | 1459 |
| 504 | Ga0307509_10005537 | 3300031507 | Bacteria | 17522 |
| 505 | Ga0307509_10206607 | 3300031507 | Bacteria | 1793 |
| 506 | Ga0307509_10407196 | 3300031507 | Bacteria | 1065 |
| 507 | Ga0307408_101004154 | 3300031548 | Bacteria | 769 |
| 508 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 509 | Ga0307508_10372435 | 3300031616 | Bacteria | 1019 |
| 510 | Ga0307508_10432315 | 3300031616 | Bacteria | 908 |
| 511 | Ga0265314_10002560 | 3300031711 | Bacteria | 18464 |
| 512 | Ga0265314_10002580 | 3300031711 | Bacteria | 18334 |
| 513 | Ga0265314_10102344 | 3300031711 | Bacteria | 1838 |
| 514 | Ga0307516_10005934 | 3300031730 | Bacteria | 14450 |
| 515 | Ga0307516_10068507 | 3300031730 | Bacteria | 3417 |
| 516 | Ga0307516_10124641 | 3300031730 | Bacteria | 2362 |
| 517 | Ga0307516_10257667 | 3300031730 | Bacteria | 1436 |
| 518 | Ga0307516_10485636 | 3300031730 | Bacteria | 890 |
| 519 | Ga0307413_10342064 | 3300031824 | Bacteria | 1151 |
| 520 | Ga0307406_10185047 | 3300031901 | Bacteria | 1520 |
| 521 | Ga0307412_10153348 | 3300031911 | Bacteria | 1703 |
| 522 | Ga0307414_10075999 | 3300032004 | Bacteria | 2440 |
| 523 | Ga0307507_10011278 | 3300033179 | Bacteria | 11327 |
| 524 | Ga0307510_10023885 | 3300033180 | Bacteria | 7075 |
| 525 | Ga0307510_10030948 | 3300033180 | Bacteria | 6057 |
| 526 | Ga0307510_10031256 | 3300033180 | Bacteria | 6020 |
| 527 | Ga0307510_10116818 | 3300033180 | Bacteria | 2388 |
| 528 | Ga0307510_10170518 | 3300033180 | Bacteria | 1756 |
| 529 | Ga0307510_10215439 | 3300033180 | Bacteria | 1438 |
| 530 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 531 | Ga0373938_0022256 | 3300034957 | Bacteria | 1293 |
| 532 | Ga0373928_0005474 | 3300035084 | Bacteria | 2428 |
| 533 | Ga0373934_0016831 | 3300035086 | Bacteria | 2783 |
| 534 | Ga0373934_0085874 | 3300035086 | Bacteria | 1266 |
| 535 | Ga0373944_0025260 | 3300035089 | Bacteria | 1748 |
| 536 | Ga0373923_0008272 | 3300035111 | Bacteria | 3702 |
| 537 | Ga0373923_0021636 | 3300035111 | Bacteria | 2512 |
| 538 | Ga0373923_0032934 | 3300035111 | Bacteria | 2096 |
| 539 | Ga0373936_0014550 | 3300035113 | Bacteria | 3011 |
| 540 | Ga0373936_0035815 | 3300035113 | Bacteria | 1977 |
| 541 | Ga0373945_0046796 | 3300035116 | Bacteria | 1580 |
| 542 | Ga0373945_0070345 | 3300035116 | Bacteria | 1323 |
| 543 | Ga0373953_0036149 | 3300035117 | Bacteria | 1944 |
| 544 | Ga0373954_0055843 | 3300035118 | Bacteria | 1858 |
| 545 | Ga0373957_0007517 | 3300035120 | Bacteria | 3488 |
| 546 | Ga0373943_0013488 | 3300035170 | Bacteria | 3691 |
| 547 | Ga0373943_0223402 | 3300035170 | Bacteria | 1050 |
| 548 | Ga0373946_0004997 | 3300035171 | Bacteria | 4775 |
| 549 | Ga0373946_0039352 | 3300035171 | Bacteria | 1930 |
| 550 | Ga0373946_0055373 | 3300035171 | Bacteria | 1672 |
| 551 | Ga0373955_0002074 | 3300035172 | Bacteria | 8641 |
| 552 | Ga0373955_0081494 | 3300035172 | Bacteria | 1830 |
| 553 | Ga0373955_0127362 | 3300035172 | Bacteria | 1484 |
| 554 | Ga0373955_0144524 | 3300035172 | Bacteria | 1396 |
| 555 | Ga0373924_0017806 | 3300035410 | Bacteria | 2731 |
| 556 | Ga0373931_0003529 | 3300035691 | Bacteria | 7049 |
| 557 | Ga0373931_0009359 | 3300035691 | Bacteria | 4683 |
| 558 | Ga0373931_0174913 | 3300035691 | Bacteria | 1267 |
| 559 | Ga0373935_0003875 | 3300035692 | Bacteria | 8728 |
| 560 | Ga0373935_0195730 | 3300035692 | Bacteria | 1394 |
| 561 | Ga0373935_0326294 | 3300035692 | Bacteria | 1090 |
| 562 | Ga0373927_0002882 | 3300035695 | Bacteria | 12525 |
| 563 | Ga0373927_0008495 | 3300035695 | Bacteria | 6908 |
| 564 | Ga0373927_0018156 | 3300035695 | Bacteria | 4626 |
| 565 | Ga0373927_0023311 | 3300035695 | Bacteria | 4054 |
| 566 | Ga0373927_0035141 | 3300035695 | Bacteria | 3259 |
| 567 | Ga0373927_0065861 | 3300035695 | Bacteria | 2343 |
| 568 | Ga0373927_0089292 | 3300035695 | Bacteria | 2001 |
| 569 | Ga0373927_0179284 | 3300035695 | Bacteria | 1389 |
| 570 | Ga0373933_0010030 | 3300035724 | Bacteria | 5185 |
| 571 | Ga0373947_0052981 | 3300035725 | Bacteria | 2445 |
| 572 | Ga0373947_0070557 | 3300035725 | Bacteria | 2141 |
| 573 | Ga0373947_0199122 | 3300035725 | Bacteria | 1310 |
| 574 | Ga0373937_0044597 | 3300036401 | Bacteria | 4051 |
| 575 | Ga0373937_0127459 | 3300036401 | Bacteria | 2375 |
| 576 | Ga0373937_0176515 | 3300036401 | Bacteria | 2006 |
| 577 | Ga0373937_0216543 | 3300036401 | Bacteria | 1802 |
| 578 | Ga0373925_0061485 | 3300037068 | Bacteria | 2821 |
| 579 | Ga0373925_0075399 | 3300037068 | Bacteria | 2556 |
| 580 | Ga0373925_0115107 | 3300037068 | Bacteria | 2082 |
| 581 | Ga0373925_0143307 | 3300037068 | Bacteria | 1871 |
| 582 | Ga0373925_0169719 | 3300037068 | Bacteria | 1722 |
| 583 | Ga0373925_0358953 | 3300037068 | Bacteria | 1184 |
| 584 | Ga0395900_0001029 | 3300037418 | Bacteria | 35765 |
| 585 | Ga0395900_0029402 | 3300037418 | Bacteria | 5637 |
| 586 | Ga0395900_0073178 | 3300037418 | Bacteria | 3523 |
| 587 | Ga0395900_0333659 | 3300037418 | Bacteria | 1494 |
| 588 | Ga0395898_0002778 | 3300037466 | Bacteria | 20117 |
| 589 | Ga0395898_0015307 | 3300037466 | Bacteria | 7872 |
| 590 | Ga0395898_0022553 | 3300037466 | Bacteria | 6376 |
| 591 | Ga0395898_0036427 | 3300037466 | Bacteria | 4885 |
| 592 | Ga0395898_0168160 | 3300037466 | Bacteria | 2096 |
| 593 | Ga0395898_0327425 | 3300037466 | Bacteria | 1461 |
| 594 | Ga0395905_0055862 | 3300037471 | Bacteria | 3695 |
| 595 | Ga0395905_0072510 | 3300037471 | Bacteria | 3229 |
| 596 | Ga0395905_0349583 | 3300037471 | Bacteria | 1370 |
| 597 | Ga0395905_0993334 | 3300037471 | Bacteria | 742 |
| 598 | Ga0395901_0099375 | 3300038443 | Bacteria | 3051 |
| 599 | Ga0395901_0465024 | 3300038443 | Bacteria | 1292 |
| 600 | Ga0436365_0297479 | 3300039437 | Bacteria | 12092 |
| 601 | Ga0436365_0692920 | 3300039437 | Bacteria | 1319 |
| 602 | Ga0436365_1332974 | 3300039437 | Bacteria | 1487 |
| 603 | Ga0436360_0431909 | 3300039438 | Bacteria | 1782 |
| 604 | Ga0436360_0504290 | 3300039438 | Bacteria | 1089 |
| 605 | Ga0436360_0991394 | 3300039438 | Bacteria | 875 |
| 606 | Ga0436360_1347011 | 3300039438 | Bacteria | 697 |
| 607 | Ga0436361_0243217 | 3300039447 | Bacteria | 1792 |
| 608 | Ga0436361_0457301 | 3300039447 | Bacteria | 800 |
| 609 | Ga0436361_0555937 | 3300039447 | Bacteria | 1238 |
| 610 | Ga0436363_0130456 | 3300039450 | Bacteria | 1092 |
| 611 | Ga0436363_1017085 | 3300039450 | Bacteria | 1616 |
| 612 | Ga0436362_0299747 | 3300039453 | Bacteria | 3630 |
| 613 | Ga0451847_0293411 | 3300041503 | Bacteria | 1016 |
| 614 | Ga0466969_0010286 | 3300044656 | Bacteria | 4963 |
| 615 | Ga0466969_0055449 | 3300044656 | Bacteria | 1939 |
| 616 | Ga0466972_0002106 | 3300044658 | Bacteria | 9768 |
| 617 | Ga0466965_0199067 | 3300044683 | Bacteria | 1062 |
| 618 | Ga0466966_0000128 | 3300044684 | Bacteria | 48511 |
| 619 | Ga0466966_0053431 | 3300044684 | Bacteria | 2563 |
| 620 | Ga0466966_0194655 | 3300044684 | Bacteria | 1228 |
| 621 | Ga0466966_0230714 | 3300044684 | Bacteria | 1117 |
| 622 | Ga0466961_0000236 | 3300044693 | Bacteria | 37237 |
| 623 | Ga0466963_0305926 | 3300044694 | Bacteria | 1118 |
| 624 | Ga0466963_0413362 | 3300044694 | Bacteria | 951 |
| 625 | Ga0466964_0041479 | 3300044706 | Bacteria | 1862 |
| 626 | Ga0466964_0304968 | 3300044706 | Bacteria | 804 |
| 627 | Ga0466960_0017212 | 3300044901 | Bacteria | 3146 |
| 628 | Ga0466960_0033671 | 3300044901 | Bacteria | 2383 |
| 629 | Ga0466959_0001099 | 3300045049 | Bacteria | 16214 |
| 630 | Ga0466959_0076070 | 3300045049 | Bacteria | 2425 |
| 631 | Ga0466959_0119013 | 3300045049 | Bacteria | 1879 |
| 632 | Ga0466959_0228219 | 3300045049 | Bacteria | 1290 |
| 633 | Ga0466958_0019026 | 3300045836 | Bacteria | 3994 |
| 634 | Ga0466967_0113044 | 3300045976 | Bacteria | 2497 |
| 635 | Ga0466967_0175802 | 3300045976 | Bacteria | 2017 |
| 636 | Ga0466967_0460396 | 3300045976 | Bacteria | 1244 |
| 637 | Ga0495617_098726 | 3300046452 | Bacteria | 950 |
| 638 | Ga0495592_0013200 | 3300046454 | Bacteria | 6288 |
| 639 | Ga0495592_0065398 | 3300046454 | Bacteria | 2662 |
| 640 | Ga0495592_0101197 | 3300046454 | Bacteria | 2053 |
| 641 | Ga0495592_0363510 | 3300046454 | Bacteria | 925 |
| 642 | Ga0495603_0000217 | 3300046455 | Bacteria | 29788 |
| 643 | Ga0495603_0009199 | 3300046455 | Bacteria | 5971 |
| 644 | Ga0495603_0022004 | 3300046455 | Bacteria | 3860 |
| 645 | Ga0495603_0049213 | 3300046455 | Bacteria | 2509 |
| 646 | Ga0495590_0156394 | 3300046457 | Bacteria | 827 |
| 647 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 648 | Ga0495629_0021708 | 3300046459 | Bacteria | 4580 |
| 649 | Ga0495629_0030060 | 3300046459 | Bacteria | 3852 |
| 650 | Ga0495629_0153409 | 3300046459 | Bacteria | 1601 |
| 651 | Ga0495629_0167936 | 3300046459 | Bacteria | 1523 |
| 652 | Ga0495629_0540381 | 3300046459 | Bacteria | 783 |
| 653 | Ga0495638_0005277 | 3300046460 | Bacteria | 9656 |
| 654 | Ga0495638_0008841 | 3300046460 | Bacteria | 7110 |
| 655 | Ga0495638_0052200 | 3300046460 | Bacteria | 2547 |
| 656 | Ga0495638_0226002 | 3300046460 | Bacteria | 1044 |
| 657 | Ga0495641_0003672 | 3300046461 | Bacteria | 11330 |
| 658 | Ga0495641_0032216 | 3300046461 | Bacteria | 2496 |
| 659 | Ga0495651_0001756 | 3300046462 | Bacteria | 16727 |
| 660 | Ga0495653_0062866 | 3300046463 | Bacteria | 2804 |
| 661 | Ga0495580_0005364 | 3300046472 | Bacteria | 10616 |
| 662 | Ga0495580_0006588 | 3300046472 | Bacteria | 9437 |
| 663 | Ga0495580_0041543 | 3300046472 | Bacteria | 3280 |
| 664 | Ga0495580_0181880 | 3300046472 | Bacteria | 1452 |
| 665 | Ga0495580_0294261 | 3300046472 | Bacteria | 1106 |
| 666 | Ga0495582_0000990 | 3300046473 | Bacteria | 15910 |
| 667 | Ga0495582_0023883 | 3300046473 | Bacteria | 3343 |
| 668 | Ga0495605_0102522 | 3300046474 | Bacteria | 1314 |
| 669 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 670 | Ga0495639_0017690 | 3300046475 | Bacteria | 3097 |
| 671 | Ga0495639_0170585 | 3300046475 | Bacteria | 1056 |
| 672 | Ga0495639_0317297 | 3300046475 | Bacteria | 779 |
| 673 | Ga0495662_0001589 | 3300046476 | Bacteria | 11287 |
| 674 | Ga0495664_0001505 | 3300046477 | Bacteria | 12344 |
| 675 | Ga0495664_0070721 | 3300046477 | Bacteria | 2084 |
| 676 | Ga0495664_0077786 | 3300046477 | Bacteria | 1987 |
| 677 | Ga0495664_0121258 | 3300046477 | Bacteria | 1581 |
| 678 | Ga0495585_0072186 | 3300046492 | Bacteria | 1881 |
| 679 | Ga0495585_0301669 | 3300046492 | Bacteria | 787 |
| 680 | Ga0495594_0000128 | 3300046499 | Bacteria | 35750 |
| 681 | Ga0495607_0204860 | 3300046501 | Bacteria | 974 |
| 682 | Ga0495583_0025356 | 3300046506 | Bacteria | 2963 |
| 683 | Ga0495606_0052648 | 3300046507 | Bacteria | 2645 |
| 684 | Ga0495606_0063466 | 3300046507 | Bacteria | 2354 |
| 685 | Ga0495606_0072414 | 3300046507 | Bacteria | 2165 |
| 686 | Ga0495606_0177070 | 3300046507 | Bacteria | 1233 |
| 687 | Ga0495608_0022212 | 3300046511 | Bacteria | 4348 |
| 688 | Ga0495608_0048299 | 3300046511 | Bacteria | 2828 |
| 689 | Ga0495608_0264012 | 3300046511 | Bacteria | 1071 |
| 690 | Ga0495610_0152922 | 3300046512 | Bacteria | 982 |
| 691 | Ga0495610_0159637 | 3300046512 | Bacteria | 954 |
| 692 | Ga0495616_0037223 | 3300046513 | Bacteria | 2505 |
| 693 | Ga0495616_0068104 | 3300046513 | Bacteria | 1729 |
| 694 | Ga0495618_0112331 | 3300046514 | Bacteria | 1745 |
| 695 | Ga0495618_0226137 | 3300046514 | Bacteria | 1179 |
| 696 | Ga0495620_0019752 | 3300046515 | Bacteria | 3306 |
| 697 | Ga0495628_0017576 | 3300046516 | Bacteria | 5949 |
| 698 | Ga0495628_0039638 | 3300046516 | Bacteria | 3767 |
| 699 | Ga0495628_0112715 | 3300046516 | Bacteria | 2091 |
| 700 | Ga0495628_0113435 | 3300046516 | Bacteria | 2083 |
| 701 | Ga0495628_0133441 | 3300046516 | Bacteria | 1898 |
| 702 | Ga0495630_0036462 | 3300046517 | Bacteria | 3676 |
| 703 | Ga0495630_0668546 | 3300046517 | Bacteria | 795 |
| 704 | Ga0495632_0172967 | 3300046519 | Bacteria | 991 |
| 705 | Ga0495643_0061414 | 3300046522 | Bacteria | 1993 |
| 706 | Ga0495643_0063321 | 3300046522 | Bacteria | 1956 |
| 707 | Ga0495643_0068935 | 3300046522 | Bacteria | 1860 |
| 708 | Ga0495648_0000936 | 3300046524 | Bacteria | 30292 |
| 709 | Ga0495648_0040934 | 3300046524 | Bacteria | 2932 |
| 710 | Ga0495648_0049911 | 3300046524 | Bacteria | 2561 |
| 711 | Ga0495666_0013204 | 3300046526 | Bacteria | 4118 |
| 712 | Ga0495666_0044738 | 3300046526 | Bacteria | 2137 |
| 713 | Ga0495652_0007874 | 3300046529 | Bacteria | 9783 |
| 714 | Ga0495652_0582583 | 3300046529 | Bacteria | 765 |
| 715 | Ga0495654_0030044 | 3300046530 | Bacteria | 2767 |
| 716 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 717 | Ga0495640_0027356 | 3300046533 | Bacteria | 4113 |
| 718 | Ga0495640_0036958 | 3300046533 | Bacteria | 3448 |
| 719 | Ga0495640_0073084 | 3300046533 | Bacteria | 2296 |
| 720 | Ga0495640_0115722 | 3300046533 | Bacteria | 1747 |
| 721 | Ga0495587_0018206 | 3300046536 | Bacteria | 4357 |
| 722 | Ga0495645_0035879 | 3300046543 | Bacteria | 3615 |
| 723 | Ga0495645_0085462 | 3300046543 | Bacteria | 2258 |
| 724 | Ga0495645_0092361 | 3300046543 | Bacteria | 2161 |
| 725 | Ga0495645_0119758 | 3300046543 | Bacteria | 1854 |
| 726 | Ga0495622_0019117 | 3300046557 | Bacteria | 3190 |
| 727 | Ga0495622_0020586 | 3300046557 | Bacteria | 3072 |
| 728 | Ga0495622_0028278 | 3300046557 | Bacteria | 2618 |
| 729 | Ga0495622_0164145 | 3300046557 | Bacteria | 1001 |
| 730 | Ga0495622_0294810 | 3300046557 | Bacteria | 707 |
| 731 | Ga0495633_0256519 | 3300046558 | Bacteria | 797 |
| 732 | Ga0495667_0018942 | 3300046559 | Bacteria | 4646 |
| 733 | Ga0495667_0022214 | 3300046559 | Bacteria | 4276 |
| 734 | Ga0495667_0102853 | 3300046559 | Bacteria | 1847 |
| 735 | Ga0495656_0085052 | 3300046615 | Bacteria | 1436 |
| 736 | Ga0495634_0001583 | 3300046642 | Bacteria | 19998 |
| 737 | Ga0495634_0024426 | 3300046642 | Bacteria | 4241 |
| 738 | Ga0495634_0048105 | 3300046642 | Bacteria | 2872 |
| 739 | Ga0495634_0064787 | 3300046642 | Bacteria | 2422 |
| 740 | Ga0495634_0089301 | 3300046642 | Bacteria | 2003 |
| 741 | Ga0495611_0019750 | 3300046648 | Bacteria | 2896 |
| 742 | Ga0495625_0025626 | 3300046660 | Bacteria | 4470 |
| 743 | Ga0495625_0044250 | 3300046660 | Bacteria | 3224 |
| 744 | Ga0495625_0107919 | 3300046660 | Bacteria | 1905 |
| 745 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 746 | Ga0495635_0015088 | 3300046663 | Bacteria | 5404 |
| 747 | Ga0495635_0016639 | 3300046663 | Bacteria | 5137 |
| 748 | Ga0495635_0026390 | 3300046663 | Bacteria | 4042 |
| 749 | Ga0495635_0028565 | 3300046663 | Bacteria | 3877 |
| 750 | Ga0495661_0030247 | 3300046665 | Bacteria | 3450 |
| 751 | Ga0495661_0123407 | 3300046665 | Bacteria | 1428 |
| 752 | Ga0495661_0201703 | 3300046665 | Bacteria | 1041 |
| 753 | Ga0495588_0002049 | 3300046674 | Bacteria | 8621 |
| 754 | Ga0495588_0016129 | 3300046674 | Bacteria | 3607 |
| 755 | Ga0495588_0042317 | 3300046674 | Bacteria | 2329 |
| 756 | Ga0495588_0131830 | 3300046674 | Bacteria | 1318 |
| 757 | Ga0495657_0016639 | 3300046675 | Bacteria | 5354 |
| 758 | Ga0495599_0010784 | 3300046678 | Bacteria | 5599 |
| 759 | Ga0495599_0034169 | 3300046678 | Bacteria | 3195 |
| 760 | Ga0495623_0015025 | 3300046679 | Bacteria | 5005 |
| 761 | Ga0495623_0027993 | 3300046679 | Bacteria | 3628 |
| 762 | Ga0495646_0001905 | 3300046680 | Bacteria | 12540 |
| 763 | Ga0495646_0055522 | 3300046680 | Bacteria | 2378 |
| 764 | Ga0495646_0070638 | 3300046680 | Bacteria | 2056 |
| 765 | Ga0495647_0000394 | 3300046681 | Bacteria | 12460 |
| 766 | Ga0495647_0061944 | 3300046681 | Bacteria | 1478 |
| 767 | Ga0495647_0079400 | 3300046681 | Bacteria | 1328 |
| 768 | Ga0495658_0018051 | 3300046683 | Bacteria | 3660 |
| 769 | Ga0495658_0405146 | 3300046683 | Bacteria | 870 |
| 770 | Ga0495669_0009622 | 3300046684 | Bacteria | 4078 |
| 771 | Ga0495669_0074157 | 3300046684 | Bacteria | 1555 |
| 772 | Ga0495613_0017135 | 3300046689 | Bacteria | 5394 |
| 773 | Ga0495613_0030248 | 3300046689 | Bacteria | 4022 |
| 774 | Ga0495613_0215403 | 3300046689 | Bacteria | 1349 |
| 775 | Ga0495613_0302262 | 3300046689 | Bacteria | 1107 |
| 776 | Ga0495613_0435044 | 3300046689 | Bacteria | 891 |
| 777 | Ga0495624_0029651 | 3300046690 | Bacteria | 3568 |
| 778 | Ga0495670_0038292 | 3300046691 | Bacteria | 2391 |
| 779 | Ga0495649_0032618 | 3300046694 | Bacteria | 2868 |
| 780 | Ga0495649_0243462 | 3300046694 | Bacteria | 925 |
| 781 | Ga0495600_0053718 | 3300046809 | Bacteria | 2631 |
| 782 | Ga0495660_0083278 | 3300046810 | Bacteria | 1674 |
| 783 | Ga0495660_0147807 | 3300046810 | Bacteria | 1163 |
| 784 | Ga0495660_0271178 | 3300046810 | Bacteria | 780 |
| 785 | Ga0495581_0003127 | 3300047315 | Bacteria | 9472 |
| 786 | Ga0495581_0036790 | 3300047315 | Bacteria | 2832 |
| 787 | Ga0495604_0041025 | 3300047317 | Bacteria | 3631 |
| 788 | Ga0495604_0119608 | 3300047317 | Bacteria | 1908 |
| 789 | Ga0495674_0008903 | 3300047319 | Bacteria | 9546 |
| 790 | Ga0495674_0020170 | 3300047319 | Bacteria | 6174 |
| 791 | Ga0495674_0053630 | 3300047319 | Bacteria | 3543 |
| 792 | Ga0495674_0109800 | 3300047319 | Bacteria | 2339 |
| 793 | Ga0495674_0412086 | 3300047319 | Bacteria | 1090 |
| 794 | Ga0495672_0006488 | 3300047320 | Bacteria | 9047 |
| 795 | Ga0495672_0110248 | 3300047320 | Bacteria | 1478 |
| 796 | Ga0495672_0142443 | 3300047320 | Bacteria | 1251 |
| 797 | Ga0495676_0028303 | 3300047321 | Bacteria | 4787 |
| 798 | Ga0495676_0037300 | 3300047321 | Bacteria | 4047 |
| 799 | Ga0495676_0080429 | 3300047321 | Bacteria | 2475 |
| 800 | Ga0495676_0404431 | 3300047321 | Bacteria | 905 |
| 801 | Ga0495680_0001711 | 3300047322 | Bacteria | 23324 |
| 802 | Ga0495680_0025590 | 3300047322 | Bacteria | 4881 |
| 803 | Ga0495680_0069244 | 3300047322 | Bacteria | 2693 |
| 804 | Ga0495680_0358585 | 3300047322 | Bacteria | 1014 |
| 805 | Ga0495687_070854 | 3300047443 | Bacteria | 1398 |
| 806 | Ga0495675_0018890 | 3300047444 | Bacteria | 4379 |
| 807 | Ga0495673_0055385 | 3300047469 | Bacteria | 1720 |
| 808 | Ga0495673_0102891 | 3300047469 | Bacteria | 1152 |
| 809 | Ga0495684_0022668 | 3300047471 | Bacteria | 4830 |
| 810 | Ga0495684_0028314 | 3300047471 | Bacteria | 4302 |
| 811 | Ga0495684_0156436 | 3300047471 | Bacteria | 1702 |
| 812 | Ga0495686_0011260 | 3300047472 | Bacteria | 6306 |
| 813 | Ga0495686_0052996 | 3300047472 | Bacteria | 2543 |
| 814 | Ga0495686_0119295 | 3300047472 | Bacteria | 1574 |
| 815 | Ga0495686_0224227 | 3300047472 | Bacteria | 1068 |
| 816 | Ga0495686_0287266 | 3300047472 | Bacteria | 912 |
| 817 | Ga0495593_0000439 | 3300047673 | Bacteria | 23237 |
| 818 | Ga0495593_0008595 | 3300047673 | Bacteria | 5938 |
| 819 | Ga0495593_0203686 | 3300047673 | Bacteria | 994 |
| 820 | Ga0495593_0304568 | 3300047673 | Bacteria | 797 |
| 821 | Ga0495602_0003274 | 3300048088 | Bacteria | 16731 |
| 822 | Ga0495602_0392156 | 3300048088 | Bacteria | 992 |
| 823 | Ga0495614_0026434 | 3300048089 | Bacteria | 2501 |
| 824 | Ga0495614_0103613 | 3300048089 | Bacteria | 1246 |
| 825 | Ga0495615_0064589 | 3300048090 | Bacteria | 974 |
| 826 | Ga0496100_0095475 | 3300048903 | Bacteria | 2038 |
| 827 | Ga0496100_0132418 | 3300048903 | Bacteria | 1758 |
| 828 | Ga0496100_0138199 | 3300048903 | Bacteria | 1724 |
| 829 | Ga0496100_0321691 | 3300048903 | Bacteria | 1162 |
| 830 | Ga0496101_0020624 | 3300048904 | Bacteria | 4516 |
| 831 | Ga0496101_0029707 | 3300048904 | Bacteria | 3824 |
| 832 | Ga0496101_0034508 | 3300048904 | Bacteria | 3573 |
| 833 | Ga0496101_0221880 | 3300048904 | Bacteria | 1467 |
| 834 | Ga0496101_0743007 | 3300048904 | Bacteria | 774 |
| 835 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 836 | Ga0496102_0012689 | 3300048905 | Bacteria | 7297 |
| 837 | Ga0496102_0083362 | 3300048905 | Bacteria | 2950 |
| 838 | Ga0496103_0023438 | 3300048906 | Bacteria | 3722 |
| 839 | Ga0496103_0038545 | 3300048906 | Bacteria | 2933 |
| 840 | Ga0496103_0082141 | 3300048906 | Bacteria | 2027 |
| 841 | Ga0496104_0005822 | 3300048907 | Bacteria | 10797 |
| 842 | Ga0496104_0011101 | 3300048907 | Bacteria | 8061 |
| 843 | Ga0496104_0077578 | 3300048907 | Bacteria | 3165 |
| 844 | Ga0496104_0086985 | 3300048907 | Bacteria | 2984 |
| 845 | Ga0496104_0215741 | 3300048907 | Bacteria | 1830 |
| 846 | Ga0496104_0455365 | 3300048907 | Bacteria | 1191 |
| 847 | Ga0496104_0588335 | 3300048907 | Bacteria | 1023 |
| 848 | Ga0496105_0003099 | 3300048908 | Bacteria | 12229 |
| 849 | Ga0496105_0039205 | 3300048908 | Bacteria | 3904 |
| 850 | Ga0496105_0054260 | 3300048908 | Bacteria | 3309 |
| 851 | Ga0496105_0060698 | 3300048908 | Bacteria | 3120 |
| 852 | Ga0496105_0124463 | 3300048908 | Bacteria | 2125 |
| 853 | Ga0496105_0262984 | 3300048908 | Bacteria | 1395 |
| 854 | Ga0496105_0328879 | 3300048908 | Bacteria | 1224 |
| 855 | Ga0496106_0034356 | 3300048909 | Bacteria | 3786 |
| 856 | Ga0496106_0034378 | 3300048909 | Bacteria | 3785 |
| 857 | Ga0496106_0068759 | 3300048909 | Bacteria | 2702 |
| 858 | Ga0496106_0077972 | 3300048909 | Bacteria | 2541 |
| 859 | Ga0496106_0119761 | 3300048909 | Bacteria | 2056 |
| 860 | Ga0496106_0800032 | 3300048909 | Bacteria | 748 |
| 861 | Ga0496107_0005793 | 3300048910 | Bacteria | 8456 |
| 862 | Ga0496107_0009818 | 3300048910 | Bacteria | 6638 |
| 863 | Ga0496107_0076705 | 3300048910 | Bacteria | 2434 |
| 864 | Ga0496107_0258397 | 3300048910 | Bacteria | 1296 |
| 865 | Ga0496107_0274724 | 3300048910 | Bacteria | 1254 |
| 866 | Ga0496108_0038300 | 3300048911 | Bacteria | 3994 |
| 867 | Ga0496108_0104326 | 3300048911 | Bacteria | 2419 |
| 868 | Ga0496108_0220065 | 3300048911 | Bacteria | 1650 |
| 869 | Ga0496108_0552511 | 3300048911 | Bacteria | 1004 |
| 870 | Ga0496108_0581322 | 3300048911 | Bacteria | 976 |
| 871 | Ga0496109_0034428 | 3300048912 | Bacteria | 4561 |
| 872 | Ga0496109_0066264 | 3300048912 | Bacteria | 3306 |
| 873 | Ga0496109_0208896 | 3300048912 | Bacteria | 1836 |
| 874 | Ga0496109_1122667 | 3300048912 | Bacteria | 723 |
| 875 | Ga0496110_0014333 | 3300048913 | Bacteria | 6577 |
| 876 | Ga0496110_0057232 | 3300048913 | Bacteria | 3432 |
| 877 | Ga0496110_0449395 | 3300048913 | Bacteria | 1174 |
| 878 | Ga0496111_0049082 | 3300048914 | Bacteria | 3043 |
| 879 | Ga0496111_0097706 | 3300048914 | Bacteria | 2156 |
| 880 | Ga0496112_0060301 | 3300048915 | Bacteria | 3739 |
| 881 | Ga0496112_0063364 | 3300048915 | Bacteria | 3646 |
| 882 | Ga0496112_0120290 | 3300048915 | Bacteria | 2596 |
| 883 | Ga0496112_0161755 | 3300048915 | Bacteria | 2205 |
| 884 | Ga0496113_0006361 | 3300048916 | Bacteria | 7474 |
| 885 | Ga0496113_0067440 | 3300048916 | Bacteria | 2713 |
| 886 | Ga0496113_0191139 | 3300048916 | Bacteria | 1625 |
| 887 | Ga0496113_0443365 | 3300048916 | Bacteria | 1043 |
| 888 | Ga0496113_0455863 | 3300048916 | Bacteria | 1027 |
| 889 | Ga0496114_0009691 | 3300048917 | Bacteria | 7651 |
| 890 | Ga0496114_0152655 | 3300048917 | Bacteria | 2004 |
| 891 | Ga0496114_0242729 | 3300048917 | Bacteria | 1584 |
| 892 | Ga0496115_0002446 | 3300048918 | Bacteria | 13344 |
| 893 | Ga0496115_0002841 | 3300048918 | Bacteria | 12459 |
| 894 | Ga0496115_0050187 | 3300048918 | Bacteria | 3342 |
| 895 | Ga0496115_0056504 | 3300048918 | Bacteria | 3155 |
| 896 | Ga0496115_0094385 | 3300048918 | Bacteria | 2447 |
| 897 | Ga0496115_0096229 | 3300048918 | Bacteria | 2424 |
| 898 | Ga0496115_0252939 | 3300048918 | Bacteria | 1450 |
| 899 | Ga0496115_0254108 | 3300048918 | Bacteria | 1446 |
| 900 | Ga0496115_0278358 | 3300048918 | Bacteria | 1374 |
| 901 | Ga0496115_0528239 | 3300048918 | Bacteria | 945 |
| 902 | Ga0496117_0032127 | 3300048920 | Bacteria | 3994 |
| 903 | Ga0496117_0046161 | 3300048920 | Bacteria | 3136 |
| 904 | Ga0496117_0098573 | 3300048920 | Bacteria | 1857 |
| 905 | Ga0496117_0107939 | 3300048920 | Bacteria | 1742 |
| 906 | Ga0496117_0138705 | 3300048920 | Bacteria | 1460 |
| 907 | Ga0496117_0258295 | 3300048920 | Bacteria | 946 |
| 908 | Ga0496118_0019989 | 3300048921 | Bacteria | 5959 |
| 909 | Ga0496118_0027235 | 3300048921 | Bacteria | 4843 |
| 910 | Ga0496118_0039217 | 3300048921 | Bacteria | 3783 |
| 911 | Ga0496118_0137350 | 3300048921 | Bacteria | 1557 |
| 912 | Ga0496119_0043886 | 3300048922 | Bacteria | 2821 |
| 913 | Ga0496119_0066944 | 3300048922 | Bacteria | 2120 |
| 914 | Ga0496119_0191170 | 3300048922 | Bacteria | 1066 |
| 915 | Ga0496120_0016795 | 3300048923 | Bacteria | 4770 |
| 916 | Ga0496120_0034937 | 3300048923 | Bacteria | 3007 |
| 917 | Ga0496120_0062037 | 3300048923 | Bacteria | 2084 |
| 918 | Ga0496120_0119567 | 3300048923 | Bacteria | 1364 |
| 919 | Ga0496120_0132181 | 3300048923 | Bacteria | 1277 |
| 920 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 921 | Ga0496121_0002143 | 3300048924 | Bacteria | 30998 |
| 922 | Ga0496121_0004589 | 3300048924 | Bacteria | 18414 |
| 923 | Ga0496121_0008031 | 3300048924 | Bacteria | 12580 |
| 924 | Ga0496121_0010422 | 3300048924 | Bacteria | 10487 |
| 925 | Ga0496121_0074038 | 3300048924 | Bacteria | 2726 |
| 926 | Ga0496121_0095916 | 3300048924 | Bacteria | 2303 |
| 927 | Ga0496121_0108827 | 3300048924 | Bacteria | 2119 |
| 928 | Ga0496121_0116751 | 3300048924 | Bacteria | 2023 |
| 929 | Ga0496121_0119821 | 3300048924 | Bacteria | 1989 |
| 930 | Ga0496121_0376409 | 3300048924 | Bacteria | 938 |
| 931 | Ga0496122_0041499 | 3300048925 | Bacteria | 3637 |
| 932 | Ga0496122_0091099 | 3300048925 | Bacteria | 2077 |
| 933 | Ga0496122_0233175 | 3300048925 | Bacteria | 1045 |
| 934 | Ga0496123_0013289 | 3300048926 | Bacteria | 6933 |
| 935 | Ga0496124_0096227 | 3300048927 | Bacteria | 2405 |
| 936 | Ga0496124_0316230 | 3300048927 | Bacteria | 1120 |
| 937 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 938 | Ga0496125_0004755 | 3300048928 | Bacteria | 15477 |
| 939 | Ga0496125_0008234 | 3300048928 | Bacteria | 10959 |
| 940 | Ga0496125_0009329 | 3300048928 | Bacteria | 10115 |
| 941 | Ga0496125_0137588 | 3300048928 | Bacteria | 1705 |
| 942 | Ga0496126_0012513 | 3300048929 | Bacteria | 8686 |
| 943 | Ga0496126_0017723 | 3300048929 | Bacteria | 7092 |
| 944 | Ga0496126_0020497 | 3300048929 | Bacteria | 6477 |
| 945 | Ga0496126_0022270 | 3300048929 | Bacteria | 6169 |
| 946 | Ga0496126_0029864 | 3300048929 | Bacteria | 5174 |
| 947 | Ga0496126_0040584 | 3300048929 | Bacteria | 4313 |
| 948 | Ga0496126_0042182 | 3300048929 | Bacteria | 4215 |
| 949 | Ga0496126_0042664 | 3300048929 | Bacteria | 4188 |
| 950 | Ga0496126_0069964 | 3300048929 | Bacteria | 3128 |
| 951 | Ga0496126_0075640 | 3300048929 | Bacteria | 2988 |
| 952 | Ga0496126_0080155 | 3300048929 | Bacteria | 2889 |
| 953 | Ga0496126_0109935 | 3300048929 | Bacteria | 2402 |
| 954 | Ga0496126_0142762 | 3300048929 | Bacteria | 2059 |
| 955 | Ga0496126_0250240 | 3300048929 | Bacteria | 1477 |
| 956 | Ga0496126_0280170 | 3300048929 | Bacteria | 1381 |
| 957 | Ga0496126_0357366 | 3300048929 | Bacteria | 1194 |
| 958 | Ga0496126_0432456 | 3300048929 | Bacteria | 1062 |
| 959 | Ga0496126_0515773 | 3300048929 | Bacteria | 953 |
| 960 | Ga0495678_069128 | 3300049459 | Bacteria | 1300 |
| 961 | Ga0501031_0044962 | 3300049568 | Bacteria | 2881 |
| 962 | Ga0501031_0166287 | 3300049568 | Bacteria | 1442 |
| 963 | Ga0501032_0000769 | 3300049569 | Bacteria | 26023 |
| 964 | Ga0501032_0011140 | 3300049569 | Bacteria | 6463 |
| 965 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 966 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 967 | Ga0501034_0073346 | 3300049571 | Bacteria | 3431 |
| 968 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 969 | Ga0501036_0010199 | 3300049572 | Bacteria | 7743 |
| 970 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 971 | Ga0501038_0038708 | 3300049574 | Bacteria | 4174 |
| 972 | Ga0501039_0000840 | 3300049575 | Bacteria | 22181 |
| 973 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 974 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 975 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 976 | Ga0501047_0012334 | 3300049581 | Bacteria | 8090 |
| 977 | Ga0501047_0012496 | 3300049581 | Bacteria | 8043 |
| 978 | Ga0501047_0462303 | 3300049581 | Bacteria | 1098 |
| 979 | Ga0501047_0769257 | 3300049581 | Bacteria | 778 |
| 980 | Ga0501048_0000352 | 3300049582 | Bacteria | 31854 |
| 981 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 982 | Ga0501067_0037196 | 3300049583 | Bacteria | 2704 |
| 983 | Ga0501068_0000463 | 3300049584 | Bacteria | 20486 |
| 984 | Ga0501068_0069986 | 3300049584 | Bacteria | 2140 |
| 985 | Ga0501069_0001694 | 3300049585 | Bacteria | 10972 |
| 986 | Ga0501069_0218910 | 3300049585 | Bacteria | 1106 |
| 987 | Ga0501070_0002185 | 3300049586 | Bacteria | 17207 |
| 988 | Ga0501071_0035407 | 3300049587 | Bacteria | 3556 |
| 989 | Ga0501072_0003699 | 3300049588 | Bacteria | 11536 |
| 990 | Ga0501072_0730184 | 3300049588 | Bacteria | 778 |
| 991 | Ga0501073_0000091 | 3300049589 | Bacteria | 57029 |
| 992 | Ga0501073_0037500 | 3300049589 | Bacteria | 3441 |
| 993 | Ga0501073_0040686 | 3300049589 | Bacteria | 3287 |
| 994 | Ga0501074_0000489 | 3300049590 | Bacteria | 24170 |
| 995 | Ga0501074_0030384 | 3300049590 | Bacteria | 3915 |
| 996 | Ga0501076_0549143 | 3300049592 | Bacteria | 953 |
| 997 | Ga0501079_0004084 | 3300049741 | Bacteria | 10807 |
| 998 | Ga0501079_0742045 | 3300049741 | Bacteria | 773 |
| 999 | Ga0501080_0000321 | 3300049742 | Bacteria | 36637 |
| 1000 | Ga0501080_0013729 | 3300049742 | Bacteria | 7457 |
| 1001 | Ga0501080_0030848 | 3300049742 | Bacteria | 4995 |
| 1002 | Ga0501083_0000284 | 3300049744 | Bacteria | 32169 |
| 1003 | Ga0501083_0038811 | 3300049744 | Bacteria | 3236 |
| 1004 | Ga0501035_0001251 | 3300049822 | Bacteria | 26410 |
| 1005 | Ga0501035_0711676 | 3300049822 | Bacteria | 809 |
| 1006 | Ga0501044_0000274 | 3300049823 | Bacteria | 65668 |
| 1007 | Ga0501044_0016521 | 3300049823 | Bacteria | 7921 |
| 1008 | Ga0501044_0051488 | 3300049823 | Bacteria | 4245 |
| 1009 | Ga0501045_0005648 | 3300049824 | Bacteria | 8654 |
| 1010 | nmdc:mga03n38_1383_c1 | 3300050490 | Bacteria | 6890 |
| 1011 | nmdc:mga03n38_138732_c1 | 3300050490 | Bacteria | 1212 |
| 1012 | nmdc:mga03n38_7252_c1 | 3300050490 | Bacteria | 3913 |
| 1013 | nmdc:mga00v17_146812_c1 | 3300050491 | Bacteria | 1514 |
| 1014 | nmdc:mga00v17_199308_c1 | 3300050491 | Bacteria | 1294 |
| 1015 | nmdc:mga0yw44_17129_c1 | 3300050492 | Bacteria | 3935 |
| 1016 | nmdc:mga0yw44_223406_c1 | 3300050492 | Bacteria | 1249 |
| 1017 | nmdc:mga0yw44_3463_c1 | 3300050492 | Bacteria | 7008 |
| 1018 | nmdc:mga0yw44_40352_c1 | 3300050492 | Bacteria | 2772 |
| 1019 | nmdc:mga06z11_129108_c1 | 3300050494 | Bacteria | 1418 |
| 1020 | nmdc:mga06z11_141167_c1 | 3300050494 | Bacteria | 1362 |
| 1021 | nmdc:mga06z11_289368_c1 | 3300050494 | Bacteria | 972 |
| 1022 | nmdc:mga04h51_10509_c1 | 3300050495 | Bacteria | 2544 |
| 1023 | nmdc:mga04h51_192076_c1 | 3300050495 | Bacteria | 799 |
| 1024 | nmdc:mga04h51_99732_c1 | 3300050495 | Bacteria | 1057 |
| 1025 | nmdc:mga07m45_370744_c1 | 3300050496 | Bacteria | 832 |
| 1026 | nmdc:mga07m45_745_c1 | 3300050496 | Bacteria | 13914 |
| 1027 | nmdc:mga0n895_302498_c1 | 3300050512 | Bacteria | 1621 |
| 1028 | nmdc:mga0n895_59607_c1 | 3300050512 | Bacteria | 3765 |
| 1029 | nmdc:mga0rr50_269639_c1 | 3300050513 | Bacteria | 1418 |
| 1030 | nmdc:mga0sz30_111629_c1 | 3300050516 | Bacteria | 1199 |
| 1031 | nmdc:mga0sz30_33533_c1 | 3300050516 | Bacteria | 2134 |
| 1032 | Ga0495601_0020870 | 3300053077 | Bacteria | 4005 |
| 1033 | Ga0495601_0230688 | 3300053077 | Bacteria | 1209 |
| 1034 | Ga0500635_0002485 | 3300053080 | Bacteria | 4573 |
| 1035 | Ga0500635_0044884 | 3300053080 | Bacteria | 1493 |
| 1036 | Ga0495595_0002193 | 3300053084 | Bacteria | 7588 |
| 1037 | Ga0495595_0100469 | 3300053084 | Bacteria | 1396 |
| 1038 | Ga0495619_0009059 | 3300053085 | Bacteria | 6279 |
| 1039 | Ga0495619_0139924 | 3300053085 | Bacteria | 1666 |
| 1040 | Ga0500643_000456 | 3300053087 | Bacteria | 30270 |
| 1041 | Ga0500646_0043987 | 3300053090 | Bacteria | 1266 |
| 1042 | Ga0500647_0063463 | 3300053091 | Bacteria | 1777 |
| 1043 | Ga0500647_0075232 | 3300053091 | Bacteria | 1620 |
| 1044 | Ga0500651_0038607 | 3300053093 | Bacteria | 3008 |
| 1045 | Ga0500566_0000043 | 3300053094 | Bacteria | 62755 |
| 1046 | Ga0500566_0000370 | 3300053094 | Bacteria | 24642 |
| 1047 | Ga0500566_0001762 | 3300053094 | Bacteria | 12726 |
| 1048 | Ga0500566_0054651 | 3300053094 | Bacteria | 2276 |
| 1049 | Ga0500566_0070578 | 3300053094 | Bacteria | 1961 |
| 1050 | Ga0500566_0154071 | 3300053094 | Bacteria | 1205 |
| 1051 | Ga0500640_000244 | 3300053095 | Bacteria | 12061 |
| 1052 | Ga0500641_0082179 | 3300053096 | Bacteria | 1368 |
| 1053 | Ga0500641_0126662 | 3300053096 | Bacteria | 1102 |
| 1054 | Ga0500650_0088555 | 3300053098 | Bacteria | 1449 |
| 1055 | Ga0500554_001881 | 3300053102 | Bacteria | 4063 |
| 1056 | Ga0500554_019495 | 3300053102 | Bacteria | 1850 |
| 1057 | Ga0500555_004143 | 3300053103 | Bacteria | 4125 |
| 1058 | Ga0500555_029529 | 3300053103 | Bacteria | 1559 |
| 1059 | Ga0500556_0000468 | 3300053104 | Bacteria | 28502 |
| 1060 | Ga0500556_0022741 | 3300053104 | Bacteria | 2039 |
| 1061 | Ga0500556_0239106 | 3300053104 | Bacteria | 715 |
| 1062 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 1063 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 1064 | Ga0500572_000714 | 3300053111 | Bacteria | 10751 |
| 1065 | Ga0500572_040783 | 3300053111 | Bacteria | 1345 |
| 1066 | Ga0500592_028439 | 3300053116 | Bacteria | 901 |
| 1067 | Ga0500595_001364 | 3300053119 | Bacteria | 13121 |
| 1068 | Ga0500595_002343 | 3300053119 | Bacteria | 9470 |
| 1069 | Ga0500595_002877 | 3300053119 | Bacteria | 8253 |
| 1070 | Ga0500595_011685 | 3300053119 | Bacteria | 3424 |
| 1071 | Ga0500595_012731 | 3300053119 | Bacteria | 3242 |
| 1072 | Ga0500595_063636 | 3300053119 | Bacteria | 1108 |
| 1073 | Ga0500597_210926 | 3300053120 | Bacteria | 812 |
| 1074 | Ga0500607_044709 | 3300053121 | Bacteria | 2381 |
| 1075 | Ga0500607_092543 | 3300053121 | Bacteria | 1518 |
| 1076 | Ga0500608_017517 | 3300053122 | Bacteria | 3254 |
| 1077 | Ga0500608_159410 | 3300053122 | Bacteria | 979 |
| 1078 | Ga0500614_001091 | 3300053123 | Bacteria | 6714 |
| 1079 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 1080 | Ga0500642_0000252 | 3300053130 | Bacteria | 20158 |
| 1081 | Ga0500652_005796 | 3300053131 | Bacteria | 3925 |
| 1082 | Ga0500658_0008833 | 3300053134 | Bacteria | 3718 |
| 1083 | Ga0500658_0025119 | 3300053134 | Bacteria | 2288 |
| 1084 | Ga0500658_0028700 | 3300053134 | Bacteria | 2161 |
| 1085 | Ga0500559_0000030 | 3300053136 | Bacteria | 115347 |
| 1086 | Ga0500559_0001011 | 3300053136 | Bacteria | 17309 |
| 1087 | Ga0500559_0004998 | 3300053136 | Bacteria | 6157 |
| 1088 | Ga0500568_0018873 | 3300053139 | Bacteria | 3008 |
| 1089 | Ga0500577_0019106 | 3300053142 | Bacteria | 2216 |
| 1090 | Ga0500586_011707 | 3300053145 | Bacteria | 2523 |
| 1091 | Ga0500589_112207 | 3300053147 | Bacteria | 1167 |
| 1092 | Ga0500590_109037 | 3300053148 | Bacteria | 1317 |
| 1093 | Ga0500603_000121 | 3300053150 | Bacteria | 18383 |
| 1094 | Ga0500603_000391 | 3300053150 | Bacteria | 11472 |
| 1095 | Ga0500603_035201 | 3300053150 | Bacteria | 1312 |
| 1096 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 1097 | Ga0500616_0056297 | 3300053153 | Bacteria | 2053 |
| 1098 | Ga0500616_0081622 | 3300053153 | Bacteria | 1624 |
| 1099 | Ga0500622_0004419 | 3300053156 | Bacteria | 8842 |
| 1100 | Ga0500622_0025979 | 3300053156 | Bacteria | 3092 |
| 1101 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 1102 | Ga0500638_001152 | 3300053162 | Bacteria | 7931 |
| 1103 | Ga0500638_084128 | 3300053162 | Bacteria | 1507 |
| 1104 | Ga0500638_126535 | 3300053162 | Bacteria | 1163 |
| 1105 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 1106 | Ga0500639_018412 | 3300053163 | Bacteria | 3685 |
| 1107 | Ga0500636_0000365 | 3300053177 | Bacteria | 24884 |
| 1108 | Ga0500636_0121949 | 3300053177 | Bacteria | 1461 |
| 1109 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 1110 | Ga0500637_0002167 | 3300053178 | Bacteria | 8637 |
| 1111 | Ga0500637_0020311 | 3300053178 | Bacteria | 3595 |
| 1112 | Ga0500637_0216997 | 3300053178 | Bacteria | 1083 |
| 1113 | Ga0500637_0239867 | 3300053178 | Bacteria | 1016 |
| 1114 | Ga0500570_117425 | 3300053724 | Bacteria | 1057 |
| 1115 | Ga0500576_008130 | 3300053725 | Bacteria | 4538 |
| 1116 | Ga0500576_105573 | 3300053725 | Bacteria | 1140 |
| 1117 | Ga0500552_007808 | 3300053733 | Bacteria | 1246 |
| 1118 | Ga0500596_001493 | 3300053735 | Bacteria | 4734 |
| 1119 | Ga0500599_001116 | 3300053736 | Bacteria | 3036 |
| 1120 | Ga0500601_000203 | 3300053737 | Bacteria | 12048 |
| 1121 | Ga0501084_0003294 | 3300054114 | Bacteria | 13074 |
| 1122 | Ga0500661_001328 | 3300055283 | Bacteria | 4613 |
| 1123 | Ga0501082_0007446 | 3300060353 | Bacteria | 9446 |
| 1124 | Ga0466962_0094396 | 3300061719 | Bacteria | 1434 |
| 1125 | 2507507675 | 2507262055 | Bacteria | 8048963 |
| 1126 | 2508541790 | 2508501009 | Bacteria | 7784016 |
| 1127 | 2508692661 | 2508501042 | Bacteria | 8719808 |
| 1128 | 2509149312 | 2508501128 | Bacteria | 8613869 |
| 1129 | 2511398186 | 2511231028 | Bacteria | 8046582 |
| 1130 | 2513621878 | 2513237092 | Bacteria | 8341956 |
| 1131 | 2513642975 | 2513237094 | Bacteria | 8789602 |
| 1132 | 2513647503 | 2513237095 | Bacteria | 8976980 |
| 1133 | 2513654078 | 2513237096 | Bacteria | 8722461 |
| 1134 | 2513671437 | 2513237098 | Bacteria | 9902361 |
| 1135 | 2513698093 | 2513237101 | Bacteria | 7952346 |
| 1136 | 2513704275 | 2513237102 | Bacteria | 7703324 |
| 1137 | 2513719470 | 2513237104 | Bacteria | 10034502 |
| 1138 | 2513856830 | 2513237137 | Bacteria | 9558895 |
| 1139 | 2513878510 | 2513237139 | Bacteria | 8737671 |
| 1140 | 2513891264 | 2513237141 | Bacteria | 8496279 |
| 1141 | 2513918418 | 2513237145 | Bacteria | 8979722 |
| 1142 | 2514009443 | 2513237161 | Bacteria | 8871253 |
| 1143 | 2515626067 | 2515154112 | Bacteria | 8294334 |
| 1144 | 2517104147 | 2517093001 | Bacteria | 9002274 |
| 1145 | 2517891348 | 2517572143 | Bacteria | 9484767 |
| 1146 | 2524436289 | 2524023205 | Bacteria | 8918781 |
| 1147 | 2524463900 | 2524023210 | Bacteria | 9029266 |
| 1148 | 2524468467 | 2524023210 | Bacteria | 9029266 |
| 1149 | 2524540886 | 2524023228 | Bacteria | 10118060 |
| 1150 | 2528848992 | 2528768022 | Bacteria | 10457665 |
| 1151 | 2603860908 | 2602042107 | Bacteria | 6226103 |
| 1152 | 2617346787 | 2617270735 | Bacteria | 9163226 |
| 1153 | 2617372717 | 2617270741 | Bacteria | 8201522 |
| 1154 | 2644289107 | 2643221651 | Bacteria | 4798932 |
| 1155 | 2671118872 | 2667528175 | Bacteria | 7532676 |
| 1156 | 2723843695 | 2721755755 | Bacteria | 8322773 |
| 1157 | 2728750061 | 2728368998 | Bacteria | 8720350 |
| 1158 | 2745080756 | 2744054633 | Bacteria | 8678936 |
| 1159 | 2793065219 | 2791355196 | Bacteria | 7323613 |
| 1160 | 2793066716 | 2791355197 | Bacteria | 8420563 |
| 1161 | 2793080660 | |||
| 1162 | 2805919066 | 2802429603 | Bacteria | 8777136 |
| 1163 | 2818236540 | 2816332527 | Bacteria | 8933356 |
| 1164 | 2824606549 | 2824600985 | Bacteria | 8488197 |
| 1165 | 2824613034 | 2824609381 | Bacteria | 8672835 |
| 1166 | 2824620399 | 2824617872 | Bacteria | 8814715 |
| 1167 | 2824628553 | 2824626560 | Bacteria | 8813858 |
| 1168 | 2824639095 | 2824635225 | Bacteria | 8785348 |
| 1169 | 2824647320 | 2824644064 | Bacteria | 8743947 |
| 1170 | 2824658527 | 2824653114 | Bacteria | 8493680 |
| 1171 | 2824666476 | 2824661429 | Bacteria | 9877870 |
| 1172 | 2824674132 | 2824671348 | Bacteria | 8369588 |
| 1173 | 2824685670 | 2824679649 | Bacteria | 8248951 |
| 1174 | 2824691973 | 2824687955 | Bacteria | 8360029 |
| 1175 | 2824701131 | 2824696289 | Bacteria | 8335049 |
| 1176 | 2824710242 | 2824704595 | Bacteria | 9667483 |
| 1177 | 2824723323 | 2824714736 | Bacteria | 8717648 |
| 1178 | 2824732446 | 2824723954 | Bacteria | 8758240 |
| 1179 | 2824735848 | 2824732956 | Bacteria | 7810675 |
| 1180 | 2824750095 | 2824746037 | Bacteria | 7911610 |
| 1181 | 2824755970 | 2824753945 | Bacteria | 9787441 |
| 1182 | 2824767508 | 2824763712 | Bacteria | 9792355 |
| 1183 | 2824775137 | 2824773399 | Bacteria | 8360218 |
| 1184 | 2838130492 | 2838122688 | Bacteria | 8803140 |
| 1185 | 2841949290 | 2841941048 | Bacteria | 8688029 |
| 1186 | 2841953465 | 2841949485 | Bacteria | 8680857 |
| 1187 | 2841959703 | 2841957949 | Bacteria | 8652217 |
| 1188 | 2841972058 | 2841966195 | Bacteria | 8673214 |
| 1189 | 2841978194 | 2841974524 | Bacteria | 8931498 |
| 1190 | 2841991005 | 2841983080 | Bacteria | 8395090 |
| 1191 | 2842040635 | 2842038055 | Bacteria | 8002051 |
| 1192 | 2842046419 | 2842045827 | Bacteria | 8006841 |
| 1193 | 2844320010 | 2844315083 | Bacteria | 8138177 |
| 1194 | 2847937310 | 2847930680 | Bacteria | 9342022 |
| 1195 | 2847947729 | 2847939898 | Bacteria | 8606328 |
| 1196 | 2849078410 | 2849076700 | Bacteria | 7039503 |
| 1197 | 2857512782 | 2857509624 | Bacteria | 7472071 |
| 1198 | 2857524640 | 2857524615 | Bacteria | 6615449 |
| 1199 | 2874598785 | 2874590934 | Bacteria | 8299676 |
| 1200 | 2874607396 | 2874604998 | Bacteria | 7834745 |
| 1201 | 2874614585 | 2874612657 | Bacteria | 8252029 |
| 1202 | 2874628067 | 2874620515 | Bacteria | 8290088 |
| 1203 | 2874635018 | 2874628541 | Bacteria | 8630250 |
| 1204 | 2874652241 | 2874645413 | Bacteria | 8214782 |
| 1205 | 2876766229 | 2876761206 | Bacteria | 10111113 |
| 1206 | 2876778824 | 2876771140 | Bacteria | 8287509 |
| 1207 | 2876817720 | 2876808645 | Bacteria | 8824342 |
| 1208 | 2876824281 | 2876818435 | Bacteria | 8274608 |
| 1209 | 2879082617 | 2879074833 | Bacteria | 8279565 |
| 1210 | 2879086612 | 2879083081 | Bacteria | 8587928 |
| 1211 | 2879107121 | 2879099564 | Bacteria | 10442239 |
| 1212 | 2879111854 | 2879110137 | Bacteria | 8907982 |
| 1213 | 2879131534 | 2879127579 | Bacteria | 8294491 |
| 1214 | 2879147980 | 2879142872 | Bacteria | 8267021 |
| 1215 | 2881371472 | 2881364244 | Bacteria | 7710352 |
| 1216 | 2881666565 | 2881665667 | Bacteria | 8175609 |
| 1217 | 2885369959 | 2885366525 | Bacteria | 8326213 |
| 1218 | 2885374998 | 2885374607 | Bacteria | 8927485 |
| 1219 | 2885386833 | 2885383462 | Bacteria | 9473874 |
| 1220 | 2885410275 | 2885409591 | Bacteria | 9235467 |
| 1221 | 2888385440 | 2888378607 | Bacteria | 9652610 |
| 1222 | 2888392792 | 2888388044 | Bacteria | 7304136 |
| 1223 | 2888425570 | 2888419890 | Bacteria | 7857137 |
| 1224 | 2889038027 | 2889033259 | Bacteria | 9099371 |
| 1225 | 2893069161 | 2893066018 | Bacteria | 6158120 |
| 1226 | 2903730315 | 2903727486 | Bacteria | 8281579 |
| 1227 | 2903755309 | 2903748898 | Bacteria | 9972761 |
| 1228 | 2903769624 | 2903768456 | Bacteria | 9749579 |
| 1229 | 2903769715 | 2903768456 | Bacteria | 9749579 |
| 1230 | 2904674315 | 2904666416 | Bacteria | 8226587 |
| 1231 | 2904691217 | 2904690495 | Bacteria | 9412302 |
| 1232 | 2904701301 | |||
| 1233 | 2904711985 | 2904711408 | Bacteria | 9771557 |
| 1234 | 2906604750 | 2906602504 | Bacteria | 8295279 |
| 1235 | 2906616534 | |||
| 1236 | 2906627333 | 2906626472 | Bacteria | 8826946 |
| 1237 | 2906635307 | 2906635258 | Bacteria | 8601019 |
| 1238 | 2906643931 | 2906643746 | Bacteria | 8722424 |
| 1239 | 2906666852 | 2906660503 | Bacteria | 8595048 |
| 1240 | 2908741702 | 2908739725 | Bacteria | 8628932 |
| 1241 | 2908759142 | 2908756301 | Bacteria | 8864324 |
| 1242 | 2908781160 | 2908775508 | Bacteria | 8092255 |
| 1243 | 2919078522 | 2919073203 | Bacteria | 6531949 |
| 1244 | 2922366026 | 2922361189 | Bacteria | 7436256 |
| 1245 | 2922372419 | |||
| 1246 | 2922387362 | 2922386360 | Bacteria | 7017218 |
| 1247 | 2922397083 | 2922393267 | Bacteria | 8285685 |
| 1248 | 2922431447 | |||
| 1249 | 2929626157 | 2929624759 | Bacteria | 9339455 |
| 1250 | 2932784963 | 2932784394 | Bacteria | 9704911 |
| 1251 | 2932795159 | 2932794094 | Bacteria | 7915132 |
| 1252 | 2932805687 | 2932801729 | Bacteria | 7987968 |
| 1253 | 2932809996 | 2932809354 | Bacteria | 9135765 |
| 1254 | 2932818261 | 2932818245 | Bacteria | 9955613 |
| 1255 | 2932828800 | 2932828146 | Bacteria | 9745859 |
| 1256 | 2933583118 | 2933577622 | Bacteria | 9116884 |
| 1257 | 2935609816 | 2935608549 | Bacteria | 8203142 |
| 1258 | 2935619780 | 2935616580 | Bacteria | 9032984 |
| 1259 | 2935634042 | 2935630451 | Bacteria | 8169952 |
| 1260 | 2935638761 | 2935638405 | Bacteria | 10015038 |
| 1261 | 2935652155 | 2935648319 | Bacteria | 8801166 |
| 1262 | 2935659872 | 2935656913 | Bacteria | 8965014 |
| 1263 | 2935666388 | 2935665750 | Bacteria | 9571747 |
| 1264 | 2935676565 | 2935675223 | Bacteria | 9928132 |
| 1265 | 2935690763 | 2935684952 | Bacteria | 9590419 |
| 1266 | 2935694646 | 2935694250 | Bacteria | 9291695 |
| 1267 | 2935703767 | 2935703347 | Bacteria | 10242284 |
| 1268 | 2935718144 | 2935713505 | Bacteria | 9608509 |
| 1269 | 2935727875 | 2935722832 | Bacteria | 9608746 |
| 1270 | 2935736579 | 2935732158 | Bacteria | 9706831 |
| 1271 | 2935745958 | 2935741537 | Bacteria | 9707219 |
| 1272 | 2935756339 | 2935750917 | Bacteria | 9590372 |
| 1273 | 2935760556 | 2935760218 | Bacteria | 9817913 |
| 1274 | 2935777008 | 2935769743 | Bacteria | 7878163 |
| 1275 | 2935783564 | 2935777560 | Bacteria | 8077691 |
| 1276 | 2935792791 | 2935785616 | Bacteria | 7962367 |
| 1277 | 2935800861 | 2935793552 | Bacteria | 8012592 |
| 1278 | 2935801904 | 2935801545 | Bacteria | 9301974 |
| 1279 | 2935810674 | 2935810662 | Bacteria | 9401221 |
| 1280 | 2935822977 | 2935819856 | Bacteria | 8261050 |
| 1281 | 2935828255 | 2935827899 | Bacteria | 10038562 |
| 1282 | 2935842459 | 2935837841 | Bacteria | 9454360 |
| 1283 | 2935848559 | 2935847175 | Bacteria | 8228321 |
| 1284 | 2935857905 | 2935855204 | Bacteria | 9035059 |
| 1285 | 2935868753 | 2935864058 | Bacteria | 9784707 |
| 1286 | 2935874168 | 2935873716 | Bacteria | 9632195 |
| 1287 | 2935883943 | 2935883170 | Bacteria | 7964738 |
| 1288 | 2935909633 | 2935908558 | Bacteria | 8568796 |
| 1289 | 2935917358 | 2935916978 | Bacteria | 9113783 |
| 1290 | 2935927114 | 2935926038 | Bacteria | 8601059 |
| 1291 | 2935937042 | 2935934488 | Bacteria | 8602579 |
| 1292 | 2935944655 | 2935942939 | Bacteria | 8599779 |
| 1293 | 2935953092 | 2935951376 | Bacteria | 8602333 |
| 1294 | 2935966594 | 2935959822 | Bacteria | 7869783 |
| 1295 | 2935969932 | 2935967501 | Bacteria | 8603075 |
| 1296 | 2935980224 | 2935975950 | Bacteria | 8347125 |
| 1297 | 2935987017 | 2935984226 | Bacteria | 8302647 |
| 1298 | 2935992907 | 2935992306 | Bacteria | 9802711 |
| 1299 | 2936002820 | 2936002035 | Bacteria | 9362176 |
| 1300 | 2936014288 | 2936011229 | Bacteria | 8801034 |
| 1301 | 2936023872 | 2936019824 | Bacteria | 8804134 |
| 1302 | 2936031515 | 2936028420 | Bacteria | 8965941 |
| 1303 | 2936037906 | 2936037263 | Bacteria | 9446081 |
| 1304 | 2936049394 | 2936046547 | Bacteria | 8903709 |
| 1305 | 2936062144 | 2936055302 | Bacteria | 8785755 |
| 1306 | 2940561686 | 2940556831 | Bacteria | 9590747 |
| 1307 | 2941510655 | 2941507105 | Bacteria | 8166816 |
| 1308 | 2941518039 | 2941515067 | Bacteria | 8166720 |
| 1309 | 2941527090 | 2941523033 | Bacteria | 8169134 |
| 1310 | 2941531195 | 2941531003 | Bacteria | 7653939 |
| 1311 | 2941542508 | 2941538514 | Bacteria | 9402094 |
| 1312 | 3005481239 | 3005474847 | Bacteria | 9259049 |
| 1313 | 3005484805 | 3005483717 | Bacteria | 7877331 |
| 1314 | 3005508444 | 3005506211 | Bacteria | 6943378 |
| 1315 | 3005588053 | 3005587118 | Bacteria | 7794411 |
| 1316 | 3005600303 | 3005594810 | Bacteria | 8716512 |
| 1317 | 3005715796 | 3005710791 | Bacteria | 7622528 |
| 1318 | 3005723151 | 3005718088 | Bacteria | 8283608 |
| 1319 | 8006927953 | 8006926726 | Bacteria | 6749210 |
| 1320 | 8006939470 | 8006933436 | Bacteria | 10410654 |
| 1321 | 8006972128 | 8006964411 | Bacteria | 8966052 |
| 1322 | 8006979220 | 8006973647 | Bacteria | 10679141 |
| 1323 | 8006984417 | 8006984368 | Bacteria | 9651211 |
| 1324 | 8007001351 | 8006994254 | Bacteria | 8309700 |
| 1325 | 8016520673 | 8016511872 | Bacteria | 9921665 |
| 1326 | 8016528699 | 8016522445 | Bacteria | 8156687 |
| 1327 | 8016533878 | 8016530956 | Bacteria | 8155261 |
| 1328 | 8016547101 | 8016539877 | Bacteria | 8155419 |
| 1329 | 8016555019 | 8016548790 | Bacteria | 8155074 |
| 1330 | 8016563389 | 8016557553 | Bacteria | 8154380 |
| 1331 | 8016572216 | 8016566248 | Bacteria | 8158151 |
| 1332 | 8016576405 | 8016575299 | Bacteria | 8154085 |
| 1333 | 8016594323 | 8016583857 | Bacteria | 10421953 |
| 1334 | 8016601139 | 8016595262 | Bacteria | 8149947 |
| 1335 | 8016609309 | 8016603502 | Bacteria | 8731218 |
| 1336 | 8016615595 | 8016613128 | Bacteria | 8794220 |
| 1337 | 8016625625 | 8016622563 | Bacteria | 7999408 |
| 1338 | 8017064909 | 8017057580 | Bacteria | 10023680 |
| 1339 | 8019533649 | 8019530166 | Bacteria | 8155624 |
| 1340 | 8019546017 | 8019538911 | Bacteria | 7872763 |
| 1341 | 8019552704 | 8019547302 | Bacteria | 7996444 |
| 1342 | 8019565347 | 8019555841 | Bacteria | 9642137 |
| 1343 | 8019575447 | 8019565922 | Bacteria | 9639779 |
| 1344 | 8019584285 | 8019576017 | Bacteria | 10049540 |
| 1345 | 8019592053 | 8019586578 | Bacteria | 10212056 |
| 1346 | 8019609128 | 8019608314 | Bacteria | 10042931 |
| 1347 | 8019619801 | 8019619141 | Bacteria | 9218857 |
| 1348 | 8019633314 | 8019629233 | Bacteria | 8687553 |
| 1349 | 8019646586 | 8019638758 | Bacteria | 9062356 |
| 1350 | 8019649356 | 8019648815 | Bacteria | 10014479 |
| 1351 | 8019661188 | 8019659431 | Bacteria | 8577854 |
| 1352 | 8019670739 | 8019668869 | Bacteria | 8791617 |
| 1353 | 8019685492 | 8019678201 | Bacteria | 8863603 |
| 1354 | 8019691055 | 8019687851 | Bacteria | 8712826 |
| 1355 | 8055745125 | 8055742211 | Bacteria | 9226248 |
| 1356 | 8056681095 | 8056673599 | Bacteria | 7871253 |
| 1357 | 8056682539 | 8056681323 | Bacteria | 8472857 |
| 1358 | 8056684740 | 8056681323 | Bacteria | 8472857 |
| 1359 | 8056693074 | 8056689827 | Bacteria | 6712655 |
| 1360 | 8056975083 | 8056967851 | Bacteria | 9038162 |
| 1361 | Ga0496107_0148464 | |||
| 1362 | JGI25406J46586_10000214 | |||
| 1363 | JGI25406J46586_10006102 | |||
| 1364 | JGI25160J50197_1003619 | |||
| 1365 | JGI25160J50197_1033878 | |||
| 1366 | Ga0055542_1013907 | |||
| 1367 | Ga0055531_10009410 | |||
| 1368 | Ga0055543_1003833 | |||
| 1369 | Ga0065165_1002074 | |||
| 1370 | Ga0065165_1002220 | |||
| 1371 | Ga0065165_1016908 | |||
| 1372 | Ga0070658_10061837 | |||
| 1373 | Ga0070658_10277390 | |||
| 1374 | Ga0070658_10669119 | |||
| 1375 | Ga0070683_100013050 | |||
| 1376 | Ga0070670_100168954 | |||
| 1377 | Ga0070670_100617758 | |||
| 1378 | Ga0068869_100146568 | |||
| 1379 | Ga0068869_100587398 | |||
| 1380 | Ga0070666_10559044 | |||
| 1381 | Ga0070680_100012621 | |||
| 1382 | Ga0070680_100031361 | |||
| 1383 | Ga0068868_100108576 | |||
| 1384 | Ga0070660_100003001 | |||
| 1385 | Ga0070660_100360200 | |||
| 1386 | Ga0070687_100119548 | |||
| 1387 | Ga0070668_100366074 | |||
| 1388 | Ga0070668_100467235 | |||
| 1389 | Ga0070669_100202934 | |||
| 1390 | Ga0070669_100251774 | |||
| 1391 | Ga0070671_100273868 | |||
| 1392 | Ga0070673_100624233 | |||
| 1393 | Ga0070688_100284611 | |||
| 1394 | Ga0070688_100292292 | |||
| 1395 | Ga0070659_100167678 | |||
| 1396 | Ga0070659_100200483 | |||
| 1397 | Ga0070659_100406140 | |||
| 1398 | Ga0070667_100859563 | |||
| 1399 | Ga0070709_10000203 | |||
| 1400 | Ga0070709_10035659 | |||
| 1401 | Ga0070709_10045651 | |||
| 1402 | Ga0070709_10126394 | |||
| 1403 | Ga0070714_100009406 | |||
| 1404 | Ga0070714_100042351 | |||
| 1405 | Ga0070714_100234407 | |||
| 1406 | Ga0070713_100013461 | |||
| 1407 | Ga0070713_100076397 | |||
| 1408 | Ga0070713_100119176 | |||
| 1409 | Ga0070713_100137195 | |||
| 1410 | Ga0070710_10001622 | |||
| 1411 | Ga0070710_10029445 | |||
| 1412 | Ga0070701_10099464 | |||
| 1413 | Ga0070711_100106196 | |||
| 1414 | Ga0070705_100163366 | |||
| 1415 | Ga0070700_100696001 | |||
| 1416 | Ga0070663_100011972 | |||
| 1417 | Ga0070663_100049973 | |||
| 1418 | Ga0070663_100066779 | |||
| 1419 | Ga0070663_100071943 | |||
| 1420 | Ga0070678_100007842 | |||
| 1421 | Ga0070678_100040699 | |||
| 1422 | Ga0070678_100213115 | |||
| 1423 | Ga0070662_100116684 | |||
| 1424 | Ga0070681_10057282 | |||
| 1425 | Ga0070681_10166491 | |||
| 1426 | Ga0070681_10241297 | |||
| 1427 | Ga0068867_100376315 | |||
| 1428 | Ga0070706_100105029 | |||
| 1429 | Ga0070706_100945034 | |||
| 1430 | Ga0070707_100088722 | |||
| 1431 | Ga0070707_100299391 | |||
| 1432 | Ga0070698_100338108 | |||
| 1433 | Ga0070679_100014122 | |||
| 1434 | Ga0070679_100019456 | |||
| 1435 | Ga0070679_100070354 | |||
| 1436 | Ga0070679_100112682 | |||
| 1437 | Ga0070679_100135998 | |||
| 1438 | Ga0070679_100564567 | |||
| 1439 | Ga0070679_100769637 | |||
| 1440 | Ga0070684_100005044 | |||
| 1441 | Ga0070684_100009975 | |||
| 1442 | Ga0070684_100161538 | |||
| 1443 | Ga0070684_100397672 | |||
| 1444 | Ga0068853_100004408 | |||
| 1445 | Ga0068853_100841864 | |||
| 1446 | Ga0068853_100852955 | |||
| 1447 | Ga0068853_100886362 | |||
| 1448 | Ga0070672_100074296 | |||
| 1449 | Ga0070672_100106450 | |||
| 1450 | Ga0070672_100396874 | |||
| 1451 | Ga0070686_100164062 | |||
| 1452 | Ga0070693_100176930 | |||
| 1453 | Ga0070693_100303737 | |||
| 1454 | Ga0070665_100061335 | |||
| 1455 | Ga0070665_100344735 | |||
| 1456 | Ga0070665_100362326 | |||
| 1457 | Ga0068855_100020164 | |||
| 1458 | Ga0068855_100031608 | |||
| 1459 | Ga0068855_100050152 | |||
| 1460 | Ga0068855_100198629 | |||
| 1461 | Ga0068855_100357095 | |||
| 1462 | Ga0068855_100960747 | |||
| 1463 | Ga0070664_100027907 | |||
| 1464 | Ga0070664_100417265 | |||
| 1465 | Ga0068857_100087798 | |||
| 1466 | Ga0068857_100708625 | |||
| 1467 | Ga0068856_100001827 | |||
| 1468 | Ga0068856_100094136 | |||
| 1469 | Ga0068856_100503865 | |||
| 1470 | Ga0068856_100695005 | |||
| 1471 | Ga0070702_100115420 | |||
| 1472 | Ga0068852_100194657 | |||
| 1473 | Ga0068852_100199577 | |||
| 1474 | Ga0068852_100224325 | |||
| 1475 | Ga0068852_100785485 | |||
| 1476 | Ga0068852_101191711 | |||
| 1477 | Ga0068859_100096353 | |||
| 1478 | Ga0068859_101024744 | |||
| 1479 | Ga0068864_100050579 | |||
| 1480 | Ga0068864_100054265 | |||
| 1481 | Ga0068864_100217171 | |||
| 1482 | Ga0068866_10189230 | |||
| 1483 | Ga0068863_100187248 | |||
| 1484 | Ga0068863_100674895 | |||
| 1485 | Ga0068858_100146094 | |||
| 1486 | Ga0068858_100147587 | |||
| 1487 | Ga0068858_100214799 | |||
| 1488 | Ga0068858_100217521 | |||
| 1489 | Ga0068858_100519975 | |||
| 1490 | Ga0068858_100849174 | |||
| 1491 | Ga0068860_100000081 | |||
| 1492 | Ga0068860_100115374 | |||
| 1493 | Ga0068860_100914621 | |||
| 1494 | Ga0068862_100260310 | |||
| 1495 | Ga0081455_10013417 | |||
| 1496 | Ga0081455_10041329 | |||
| 1497 | Ga0081455_10094508 | |||
| 1498 | Ga0081455_10143692 | |||
| 1499 | Ga0081540_1003965 | |||
| 1500 | Ga0081540_1005624 | |||
| 1501 | Ga0081540_1005692 | |||
| 1502 | Ga0081540_1010058 | |||
| 1503 | Ga0081540_1014480 | |||
| 1504 | Ga0081540_1035706 | |||
| 1505 | Ga0081540_1043747 | |||
| 1506 | Ga0081540_1056296 | |||
| 1507 | Ga0081539_10000768 | |||
| 1508 | Ga0081539_10001470 | |||
| 1509 | Ga0081539_10019985 | |||
| 1510 | Ga0081539_10067278 | |||
| 1511 | Ga0081539_10231561 | |||
| 1512 | Ga0070717_10076659 | |||
| 1513 | Ga0070717_10146487 | |||
| 1514 | Ga0070717_10376256 | |||
| 1515 | Ga0070717_10908434 | |||
| 1516 | Ga0075365_10008428 | |||
| 1517 | Ga0075365_10021294 | |||
| 1518 | Ga0075365_10118150 | |||
| 1519 | Ga0075365_10178734 | |||
| 1520 | Ga0075368_10051146 | |||
| 1521 | Ga0075368_10102549 | |||
| 1522 | Ga0075368_10116397 | |||
| 1523 | Ga0075368_10195298 | |||
| 1524 | Ga0075363_100006965 | |||
| 1525 | Ga0075363_100022057 | |||
| 1526 | Ga0075364_10186255 | |||
| 1527 | Ga0070716_100001846 | |||
| 1528 | Ga0070716_100685945 | |||
| 1529 | Ga0070712_100006733 | |||
| 1530 | Ga0070712_100024328 | |||
| 1531 | Ga0070712_100044059 | |||
| 1532 | Ga0075362_10068310 | |||
| 1533 | Ga0075367_10029890 | |||
| 1534 | Ga0075369_10052362 | |||
| 1535 | Ga0075366_10056277 | |||
| 1536 | Ga0097621_100341101 | |||
| 1537 | Ga0075370_10103498 | |||
| 1538 | Ga0075370_10142858 | |||
| 1539 | Ga0068871_100078523 | |||
| 1540 | Ga0068871_100687021 | |||
| 1541 | Ga0075434_100270509 | |||
| 1542 | Ga0075434_100541799 | |||
| 1543 | Ga0068865_100033651 | |||
| 1544 | Ga0068865_100040328 | |||
| 1545 | Ga0097620_100096353 | |||
| 1546 | Ga0097620_101024770 | |||
| 1547 | Ga0099825_1017324 | |||
| 1548 | Ga0099822_1018218 | |||
| 1549 | Ga0099823_1059808 | |||
| 1550 | Ga0075435_100325964 | |||
| 1551 | Ga0099794_10011757 | |||
| 1552 | Ga0099794_10097011 | |||
| 1553 | Ga0099795_10014182 | |||
| 1554 | Ga0099795_10058655 | |||
| 1555 | Ga0099795_10134606 | |||
| 1556 | Ga0105250_10170836 | |||
| 1557 | Ga0105240_10026622 | |||
| 1558 | Ga0105240_10034709 | |||
| 1559 | Ga0105240_10055828 | |||
| 1560 | Ga0105240_10125422 | |||
| 1561 | Ga0105240_10145106 | |||
| 1562 | Ga0105240_10460048 | |||
| 1563 | Ga0105240_10817350 | |||
| 1564 | Ga0105240_11124568 | |||
| 1565 | Ga0105245_10033125 | |||
| 1566 | Ga0105245_10258800 | |||
| 1567 | Ga0105245_10809687 | |||
| 1568 | Ga0105247_10008197 | |||
| 1569 | Ga0105247_10104916 | |||
| 1570 | Ga0105247_10253365 | |||
| 1571 | Ga0105243_10018993 | |||
| 1572 | Ga0105243_10405296 | |||
| 1573 | Ga0105243_10570125 | |||
| 1574 | Ga0105241_10030969 | |||
| 1575 | Ga0105242_10153337 | |||
| 1576 | Ga0105242_10322761 | |||
| 1577 | Ga0105242_10442847 | |||
| 1578 | Ga0105242_10537981 | |||
| 1579 | Ga0105248_10075716 | |||
| 1580 | Ga0105248_10093026 | |||
| 1581 | Ga0105248_10097999 | |||
| 1582 | Ga0105248_10633706 | |||
| 1583 | Ga0105237_10012336 | |||
| 1584 | Ga0105237_10024997 | |||
| 1585 | Ga0105237_10044165 | |||
| 1586 | Ga0105237_10081141 | |||
| 1587 | Ga0105237_10180622 | |||
| 1588 | Ga0105237_10242635 | |||
| 1589 | Ga0105237_10645509 | |||
| 1590 | Ga0105238_10015861 | |||
| 1591 | Ga0105238_10083037 | |||
| 1592 | Ga0105238_10415895 | |||
| 1593 | Ga0105238_10543691 | |||
| 1594 | Ga0105238_10652073 | |||
| 1595 | Ga0105249_10118682 | |||
| 1596 | Ga0099796_10044327 | |||
| 1597 | Ga0105239_10017391 | |||
| 1598 | Ga0105239_10031991 | |||
| 1599 | Ga0105239_10075749 | |||
| 1600 | Ga0105239_10193690 | |||
| 1601 | Ga0105246_10031772 | |||
| 1602 | Ga0105246_10070395 | |||
| 1603 | Ga0105246_10343304 | |||
| 1604 | Ga0157373_10344774 | |||
| 1605 | Ga0157371_10095539 | |||
| 1606 | Ga0157371_10308039 | |||
| 1607 | Ga0157370_10027113 | |||
| 1608 | Ga0157370_10105073 | |||
| 1609 | Ga0157370_10403770 | |||
| 1610 | Ga0157369_10015050 | |||
| 1611 | Ga0157369_10021463 | |||
| 1612 | Ga0157369_10104910 | |||
| 1613 | Ga0157369_10858147 | |||
| 1614 | Ga0157374_10070236 | |||
| 1615 | Ga0157374_10684606 | |||
| 1616 | Ga0163162_10138896 | |||
| 1617 | Ga0163162_10237640 | |||
| 1618 | Ga0163162_10303134 | |||
| 1619 | Ga0163162_10337567 | |||
| 1620 | Ga0157372_10402452 | |||
| 1621 | Ga0157372_10439338 | |||
| 1622 | Ga0157375_10079932 | |||
| 1623 | Ga0157375_10390085 | |||
| 1624 | Ga0157375_10637335 | |||
| 1625 | Ga0163163_10072423 | |||
| 1626 | Ga0163163_10109318 | |||
| 1627 | Ga0163163_10238282 | |||
| 1628 | Ga0163163_10291199 | |||
| 1629 | Ga0163163_11126544 | |||
| 1630 | Ga0157380_10330482 | |||
| 1631 | Ga0157380_11231924 | |||
| 1632 | Ga0182008_10163633 | |||
| 1633 | Ga0157379_10078989 | |||
| 1634 | Ga0157379_10254156 | |||
| 1635 | Ga0157379_10393617 | |||
| 1636 | Ga0157376_10040939 | |||
| 1637 | Ga0157376_10145143 | |||
| 1638 | Ga0163161_10051522 | |||
| 1639 | Ga0163161_10256175 | |||
| 1640 | Ga0206353_11236131 | |||
| 1641 | Ga0214544_1001813 | |||
| 1642 | Ga0214544_1029472 | |||
| 1643 | Ga0214544_1032156 | |||
| 1644 | Ga0214542_1001236 | |||
| 1645 | Ga0214542_1029050 | |||
| 1646 | Ga0214542_1040372 | |||
| 1647 | Ga0214542_1040750 | |||
| 1648 | Ga0214545_1000924 | |||
| 1649 | Ga0214545_1023872 | |||
| 1650 | Ga0214543_1003531 | |||
| 1651 | Ga0214543_1025126 | |||
| 1652 | Ga0214543_1035012 | |||
| 1653 | Ga0214543_1041233 | |||
| 1654 | Ga0213873_10028627 | |||
| 1655 | Ga0213876_10001431 | |||
| 1656 | Ga0209563_108847 | |||
| 1657 | Ga0207425_1007829 | |||
| 1658 | Ga0209677_113470 | |||
| 1659 | Ga0209148_1000180 | |||
| 1660 | Ga0209233_1001441 | |||
| 1661 | Ga0209233_1003552 | |||
| 1662 | Ga0209233_1022482 | |||
| 1663 | Ga0209233_1028978 | |||
| 1664 | Ga0209455_1022828 | |||
| 1665 | Ga0209130_1040756 | |||
| 1666 | Ga0209564_1000385 | |||
| 1667 | Ga0209564_1011033 | |||
| 1668 | Ga0209758_1000011 | |||
| 1669 | Ga0209758_1000133 | |||
| 1670 | Ga0209758_1001210 | |||
| 1671 | Ga0209758_1011006 | |||
| 1672 | Ga0209758_1015407 | |||
| 1673 | Ga0209256_1005155 | |||
| 1674 | Ga0209256_1024267 | |||
| 1675 | Ga0209256_1024426 | |||
| 1676 | Ga0207426_1000572 | |||
| 1677 | Ga0207426_1001763 | |||
| 1678 | Ga0207426_1006362 | |||
| 1679 | Ga0207697_10230640 | |||
| 1680 | Ga0207656_10141294 | |||
| 1681 | Ga0207692_10010389 | |||
| 1682 | Ga0207692_10012280 | |||
| 1683 | Ga0207692_10156023 | |||
| 1684 | Ga0207692_10265572 | |||
| 1685 | Ga0207642_10064945 | |||
| 1686 | Ga0207642_10217426 | |||
| 1687 | Ga0207710_10050507 | |||
| 1688 | Ga0207688_10013784 | |||
| 1689 | Ga0207688_10027182 | |||
| 1690 | Ga0207680_10322944 | |||
| 1691 | Ga0207647_10256686 | |||
| 1692 | Ga0207685_10032271 | |||
| 1693 | Ga0207685_10077271 | |||
| 1694 | Ga0207699_10004445 | |||
| 1695 | Ga0207699_10021389 | |||
| 1696 | Ga0207699_10021591 | |||
| 1697 | Ga0207699_10029552 | |||
| 1698 | Ga0207699_10149149 | |||
| 1699 | Ga0207699_10204556 | |||
| 1700 | Ga0207645_10064837 | |||
| 1701 | Ga0207643_10062976 | |||
| 1702 | Ga0207705_10051852 | |||
| 1703 | Ga0207684_10082993 | |||
| 1704 | Ga0207654_10040051 | |||
| 1705 | Ga0207654_10362035 | |||
| 1706 | Ga0207707_10002705 | |||
| 1707 | Ga0207707_10173010 | |||
| 1708 | Ga0207707_10200980 | |||
| 1709 | Ga0207695_10000008 | |||
| 1710 | Ga0207695_10104517 | |||
| 1711 | Ga0207695_10187313 | |||
| 1712 | Ga0207671_10005294 | |||
| 1713 | Ga0207671_10009638 | |||
| 1714 | Ga0207671_10041027 | |||
| 1715 | Ga0207671_10059807 | |||
| 1716 | Ga0207671_10206717 | |||
| 1717 | Ga0207671_10444980 | |||
| 1718 | Ga0207671_10519638 | |||
| 1719 | Ga0207693_10004777 | |||
| 1720 | Ga0207693_10006974 | |||
| 1721 | Ga0207693_10014354 | |||
| 1722 | Ga0207693_10015344 | |||
| 1723 | Ga0207693_10053164 | |||
| 1724 | Ga0207693_10136318 | |||
| 1725 | Ga0207693_10346044 | |||
| 1726 | Ga0207663_10002050 | |||
| 1727 | Ga0207663_10033664 | |||
| 1728 | Ga0207663_10221108 | |||
| 1729 | Ga0207660_10006961 | |||
| 1730 | Ga0207660_10033360 | |||
| 1731 | Ga0207660_10274950 | |||
| 1732 | Ga0207662_10085372 | |||
| 1733 | Ga0207657_10006890 | |||
| 1734 | Ga0207657_10034513 | |||
| 1735 | Ga0207649_10263314 | |||
| 1736 | Ga0207652_10001690 | |||
| 1737 | Ga0207652_10065122 | |||
| 1738 | Ga0207652_10090468 | |||
| 1739 | Ga0207652_10101751 | |||
| 1740 | Ga0207652_10117474 | |||
| 1741 | Ga0207652_10236636 | |||
| 1742 | Ga0207652_10502817 | |||
| 1743 | Ga0207646_10053986 | |||
| 1744 | Ga0207681_10611511 | |||
| 1745 | Ga0207694_10005031 | |||
| 1746 | Ga0207694_10324194 | |||
| 1747 | Ga0207694_10372001 | |||
| 1748 | Ga0207659_10483071 | |||
| 1749 | Ga0207687_10091412 | |||
| 1750 | Ga0207700_10063585 | |||
| 1751 | Ga0207700_10087847 | |||
| 1752 | Ga0207700_10112570 | |||
| 1753 | Ga0207700_10219058 | |||
| 1754 | Ga0207700_10322788 | |||
| 1755 | Ga0207664_10002721 | |||
| 1756 | Ga0207664_10016371 | |||
| 1757 | Ga0207664_10432638 | |||
| 1758 | Ga0207664_10590784 | |||
| 1759 | Ga0207664_10703412 | |||
| 1760 | Ga0207644_10076825 | |||
| 1761 | Ga0207690_10503143 | |||
| 1762 | Ga0207690_10783159 | |||
| 1763 | Ga0207706_10034381 | |||
| 1764 | Ga0207686_10096308 | |||
| 1765 | Ga0207686_10219824 | |||
| 1766 | Ga0207709_10236759 | |||
| 1767 | Ga0207670_10174646 | |||
| 1768 | Ga0207704_10069584 | |||
| 1769 | Ga0207704_10103399 | |||
| 1770 | Ga0207665_10001320 | |||
| 1771 | Ga0207665_10010178 | |||
| 1772 | Ga0207711_10106450 | |||
| 1773 | Ga0207711_10108996 | |||
| 1774 | Ga0207711_10148134 | |||
| 1775 | Ga0207689_10032632 | |||
| 1776 | Ga0207661_10001270 | |||
| 1777 | Ga0207661_10008424 | |||
| 1778 | Ga0207661_10021928 | |||
| 1779 | Ga0207679_10054338 | |||
| 1780 | Ga0207679_10103081 | |||
| 1781 | Ga0207667_10002017 | |||
| 1782 | Ga0207667_10159022 | |||
| 1783 | Ga0207667_10204693 | |||
| 1784 | Ga0207667_10291746 | |||
| 1785 | Ga0207667_10318094 | |||
| 1786 | Ga0207668_10023206 | |||
| 1787 | Ga0207668_10516617 | |||
| 1788 | Ga0207640_10235256 | |||
| 1789 | Ga0207640_10569355 | |||
| 1790 | Ga0207658_10395783 | |||
| 1791 | Ga0207658_10491338 | |||
| 1792 | Ga0207677_10014286 | |||
| 1793 | Ga0207677_10094719 | |||
| 1794 | Ga0207703_10057761 | |||
| 1795 | Ga0207703_10590460 | |||
| 1796 | Ga0207639_10014358 | |||
| 1797 | Ga0207639_10194488 | |||
| 1798 | Ga0207678_10013434 | |||
| 1799 | Ga0207678_10043423 | |||
| 1800 | Ga0207678_10044113 | |||
| 1801 | Ga0207678_10056735 | |||
| 1802 | Ga0207678_10133768 | |||
| 1803 | Ga0207702_10002952 | |||
| 1804 | Ga0207702_10273621 | |||
| 1805 | Ga0207702_10377753 | |||
| 1806 | Ga0207702_10600858 | |||
| 1807 | Ga0207702_10830616 | |||
| 1808 | Ga0207641_10142070 | |||
| 1809 | Ga0207641_10209060 | |||
| 1810 | Ga0207648_10086612 | |||
| 1811 | Ga0207648_10376351 | |||
| 1812 | Ga0207676_10667987 | |||
| 1813 | Ga0207674_10071396 | |||
| 1814 | Ga0207674_10608841 | |||
| 1815 | Ga0207674_10680628 | |||
| 1816 | Ga0207675_100233128 | |||
| 1817 | Ga0207683_10782212 | |||
| 1818 | Ga0207698_10045951 | |||
| 1819 | Ga0207698_10121806 | |||
| 1820 | Ga0207698_10218793 | |||
| 1821 | Ga0207698_10913554 | |||
| 1822 | Ga0209389_1000001 | |||
| 1823 | Ga0209389_1000115 | |||
| 1824 | Ga0209589_1000014 | |||
| 1825 | Ga0209589_1000033 | |||
| 1826 | Ga0209489_100014 | |||
| 1827 | Ga0209489_100040 | |||
| 1828 | Ga0209489_100612 | |||
| 1829 | Ga0209700_100007 | |||
| 1830 | Ga0209700_100024 | |||
| 1831 | Ga0209179_1004389 | |||
| 1832 | Ga0209588_1006547 | |||
| 1833 | Ga0209588_1039035 | |||
| 1834 | Ga0209813_10120758 | |||
| 1835 | Ga0209813_10166207 | |||
| 1836 | Ga0268266_10008590 | |||
| 1837 | Ga0268266_10381617 | |||
| 1838 | Ga0268266_10548059 | |||
| 1839 | Ga0268265_10122547 | |||
| 1840 | Ga0268265_10218799 | |||
| 1841 | Ga0268265_10355923 | |||
| 1842 | Ga0268265_10364172 | |||
| 1843 | Ga0268264_10000048 | |||
| 1844 | Ga0268264_10530728 | |||
| 1845 | Ga0265337_1007889 | |||
| 1846 | Ga0265334_10005731 | |||
| 1847 | Ga0265323_10019130 | |||
| 1848 | Ga0265336_10000362 | |||
| 1849 | Ga0307517_10000634 | |||
| 1850 | Ga0307515_10006012 | |||
| 1851 | Ga0265338_10001385 | |||
| 1852 | Ga0307511_10101412 | |||
| 1853 | Ga0265330_10017515 | |||
| 1854 | Ga0265330_10034042 | |||
| 1855 | Ga0265332_10021959 | |||
| 1856 | Ga0265328_10007270 | |||
| 1857 | Ga0265328_10076374 | |||
| 1858 | Ga0265325_10008844 | |||
| 1859 | Ga0265340_10158752 | |||
| 1860 | Ga0265339_10008162 | |||
| 1861 | Ga0265331_10021239 | |||
| 1862 | Ga0265316_10320410 | |||
| 1863 | Ga0307513_10276547 | |||
| 1864 | Ga0307509_10005537 | |||
| 1865 | Ga0307509_10206607 | |||
| 1866 | Ga0307509_10407196 | |||
| 1867 | Ga0307408_101004154 | |||
| 1868 | Ga0307508_10000032 | |||
| 1869 | Ga0307508_10372435 | |||
| 1870 | Ga0307508_10432315 | |||
| 1871 | Ga0265314_10002560 | |||
| 1872 | Ga0265314_10002580 | |||
| 1873 | Ga0265314_10102344 | |||
| 1874 | Ga0307516_10005934 | |||
| 1875 | Ga0307516_10068507 | |||
| 1876 | Ga0307516_10124641 | |||
| 1877 | Ga0307516_10257667 | |||
| 1878 | Ga0307516_10485636 | |||
| 1879 | Ga0307413_10342064 | |||
| 1880 | Ga0307406_10185047 | |||
| 1881 | Ga0307412_10153348 | |||
| 1882 | Ga0307414_10075999 | |||
| 1883 | Ga0307507_10011278 | |||
| 1884 | Ga0307510_10023885 | |||
| 1885 | Ga0307510_10030948 | |||
| 1886 | Ga0307510_10031256 | |||
| 1887 | Ga0307510_10116818 | |||
| 1888 | Ga0307510_10170518 | |||
| 1889 | Ga0307510_10215439 | |||
| 1890 | Ga0315911_1000002 | |||
| 1891 | Ga0373938_0022256 | |||
| 1892 | Ga0373928_0005474 | |||
| 1893 | Ga0373934_0016831 | |||
| 1894 | Ga0373934_0085874 | |||
| 1895 | Ga0373944_0025260 | |||
| 1896 | Ga0373923_0008272 | |||
| 1897 | Ga0373923_0021636 | |||
| 1898 | Ga0373923_0032934 | |||
| 1899 | Ga0373936_0014550 | |||
| 1900 | Ga0373936_0035815 | |||
| 1901 | Ga0373945_0046796 | |||
| 1902 | Ga0373945_0070345 | |||
| 1903 | Ga0373953_0036149 | |||
| 1904 | Ga0373954_0055843 | |||
| 1905 | Ga0373957_0007517 | |||
| 1906 | Ga0373943_0013488 | |||
| 1907 | Ga0373943_0223402 | |||
| 1908 | Ga0373946_0004997 | |||
| 1909 | Ga0373946_0039352 | |||
| 1910 | Ga0373946_0055373 | |||
| 1911 | Ga0373955_0002074 | |||
| 1912 | Ga0373955_0081494 | |||
| 1913 | Ga0373955_0127362 | |||
| 1914 | Ga0373955_0144524 | |||
| 1915 | Ga0373924_0017806 | |||
| 1916 | Ga0373931_0003529 | |||
| 1917 | Ga0373931_0009359 | |||
| 1918 | Ga0373931_0174913 | |||
| 1919 | Ga0373935_0003875 | |||
| 1920 | Ga0373935_0195730 | |||
| 1921 | Ga0373935_0326294 | |||
| 1922 | Ga0373927_0002882 | |||
| 1923 | Ga0373927_0008495 | |||
| 1924 | Ga0373927_0018156 | |||
| 1925 | Ga0373927_0023311 | |||
| 1926 | Ga0373927_0035141 | |||
| 1927 | Ga0373927_0065861 | |||
| 1928 | Ga0373927_0089292 | |||
| 1929 | Ga0373927_0179284 | |||
| 1930 | Ga0373933_0010030 | |||
| 1931 | Ga0373947_0052981 | |||
| 1932 | Ga0373947_0070557 | |||
| 1933 | Ga0373947_0199122 | |||
| 1934 | Ga0373937_0044597 | |||
| 1935 | Ga0373937_0127459 | |||
| 1936 | Ga0373937_0176515 | |||
| 1937 | Ga0373937_0216543 | |||
| 1938 | Ga0373925_0061485 | |||
| 1939 | Ga0373925_0075399 | |||
| 1940 | Ga0373925_0115107 | |||
| 1941 | Ga0373925_0143307 | |||
| 1942 | Ga0373925_0169719 | |||
| 1943 | Ga0373925_0358953 | |||
| 1944 | Ga0395900_0001029 | |||
| 1945 | Ga0395900_0029402 | |||
| 1946 | Ga0395900_0073178 | |||
| 1947 | Ga0395900_0333659 | |||
| 1948 | Ga0395898_0002778 | |||
| 1949 | Ga0395898_0015307 | |||
| 1950 | Ga0395898_0022553 | |||
| 1951 | Ga0395898_0036427 | |||
| 1952 | Ga0395898_0168160 | |||
| 1953 | Ga0395898_0327425 | |||
| 1954 | Ga0395905_0055862 | |||
| 1955 | Ga0395905_0072510 | |||
| 1956 | Ga0395905_0349583 | |||
| 1957 | Ga0395905_0993334 | |||
| 1958 | Ga0395901_0099375 | |||
| 1959 | Ga0395901_0465024 | |||
| 1960 | Ga0436365_0297479 | |||
| 1961 | Ga0436365_0692920 | |||
| 1962 | Ga0436365_1332974 | |||
| 1963 | Ga0436360_0431909 | |||
| 1964 | Ga0436360_0504290 | |||
| 1965 | Ga0436360_0991394 | |||
| 1966 | Ga0436360_1347011 | |||
| 1967 | Ga0436361_0243217 | |||
| 1968 | Ga0436361_0457301 | |||
| 1969 | Ga0436361_0555937 | |||
| 1970 | Ga0436363_0130456 | |||
| 1971 | Ga0436363_1017085 | |||
| 1972 | Ga0436362_0299747 | |||
| 1973 | Ga0451847_0293411 | |||
| 1974 | Ga0466969_0010286 | |||
| 1975 | Ga0466969_0055449 | |||
| 1976 | Ga0466972_0002106 | |||
| 1977 | Ga0466965_0199067 | |||
| 1978 | Ga0466966_0000128 | |||
| 1979 | Ga0466966_0053431 | |||
| 1980 | Ga0466966_0194655 | |||
| 1981 | Ga0466966_0230714 | |||
| 1982 | Ga0466961_0000236 | |||
| 1983 | Ga0466963_0305926 | |||
| 1984 | Ga0466963_0413362 | |||
| 1985 | Ga0466964_0041479 | |||
| 1986 | Ga0466964_0304968 | |||
| 1987 | Ga0466960_0017212 | |||
| 1988 | Ga0466960_0033671 | |||
| 1989 | Ga0466959_0001099 | |||
| 1990 | Ga0466959_0076070 | |||
| 1991 | Ga0466959_0119013 | |||
| 1992 | Ga0466959_0228219 | |||
| 1993 | Ga0466958_0019026 | |||
| 1994 | Ga0466967_0113044 | |||
| 1995 | Ga0466967_0175802 | |||
| 1996 | Ga0466967_0460396 | |||
| 1997 | Ga0495617_098726 | |||
| 1998 | Ga0495592_0013200 | |||
| 1999 | Ga0495592_0065398 | |||
| 2000 | Ga0495592_0101197 | |||
| 2001 | Ga0495592_0363510 | |||
| 2002 | Ga0495603_0000217 | |||
| 2003 | Ga0495603_0009199 | |||
| 2004 | Ga0495603_0022004 | |||
| 2005 | Ga0495603_0049213 | |||
| 2006 | Ga0495590_0156394 | |||
| 2007 | Ga0495629_0000862 | |||
| 2008 | Ga0495629_0021708 | |||
| 2009 | Ga0495629_0030060 | |||
| 2010 | Ga0495629_0153409 | |||
| 2011 | Ga0495629_0167936 | |||
| 2012 | Ga0495629_0540381 | |||
| 2013 | Ga0495638_0005277 | |||
| 2014 | Ga0495638_0008841 | |||
| 2015 | Ga0495638_0052200 | |||
| 2016 | Ga0495638_0226002 | |||
| 2017 | Ga0495641_0003672 | |||
| 2018 | Ga0495641_0032216 | |||
| 2019 | Ga0495651_0001756 | |||
| 2020 | Ga0495653_0062866 | |||
| 2021 | Ga0495580_0005364 | |||
| 2022 | Ga0495580_0006588 | |||
| 2023 | Ga0495580_0041543 | |||
| 2024 | Ga0495580_0181880 | |||
| 2025 | Ga0495580_0294261 | |||
| 2026 | Ga0495582_0000990 | |||
| 2027 | Ga0495582_0023883 | |||
| 2028 | Ga0495605_0102522 | |||
| 2029 | Ga0495639_0000544 | |||
| 2030 | Ga0495639_0017690 | |||
| 2031 | Ga0495639_0170585 | |||
| 2032 | Ga0495639_0317297 | |||
| 2033 | Ga0495662_0001589 | |||
| 2034 | Ga0495664_0001505 | |||
| 2035 | Ga0495664_0070721 | |||
| 2036 | Ga0495664_0077786 | |||
| 2037 | Ga0495664_0121258 | |||
| 2038 | Ga0495585_0072186 | |||
| 2039 | Ga0495585_0301669 | |||
| 2040 | Ga0495594_0000128 | |||
| 2041 | Ga0495607_0204860 | |||
| 2042 | Ga0495583_0025356 | |||
| 2043 | Ga0495606_0052648 | |||
| 2044 | Ga0495606_0063466 | |||
| 2045 | Ga0495606_0072414 | |||
| 2046 | Ga0495606_0177070 | |||
| 2047 | Ga0495608_0022212 | |||
| 2048 | Ga0495608_0048299 | |||
| 2049 | Ga0495608_0264012 | |||
| 2050 | Ga0495610_0152922 | |||
| 2051 | Ga0495610_0159637 | |||
| 2052 | Ga0495616_0037223 | |||
| 2053 | Ga0495616_0068104 | |||
| 2054 | Ga0495618_0112331 | |||
| 2055 | Ga0495618_0226137 | |||
| 2056 | Ga0495620_0019752 | |||
| 2057 | Ga0495628_0017576 | |||
| 2058 | Ga0495628_0039638 | |||
| 2059 | Ga0495628_0112715 | |||
| 2060 | Ga0495628_0113435 | |||
| 2061 | Ga0495628_0133441 | |||
| 2062 | Ga0495630_0036462 | |||
| 2063 | Ga0495630_0668546 | |||
| 2064 | Ga0495632_0172967 | |||
| 2065 | Ga0495643_0061414 | |||
| 2066 | Ga0495643_0063321 | |||
| 2067 | Ga0495643_0068935 | |||
| 2068 | Ga0495648_0000936 | |||
| 2069 | Ga0495648_0040934 | |||
| 2070 | Ga0495648_0049911 | |||
| 2071 | Ga0495666_0013204 | |||
| 2072 | Ga0495666_0044738 | |||
| 2073 | Ga0495652_0007874 | |||
| 2074 | Ga0495652_0582583 | |||
| 2075 | Ga0495654_0030044 | |||
| 2076 | Ga0495640_0002595 | |||
| 2077 | Ga0495640_0027356 | |||
| 2078 | Ga0495640_0036958 | |||
| 2079 | Ga0495640_0073084 | |||
| 2080 | Ga0495640_0115722 | |||
| 2081 | Ga0495587_0018206 | |||
| 2082 | Ga0495645_0035879 | |||
| 2083 | Ga0495645_0085462 | |||
| 2084 | Ga0495645_0092361 | |||
| 2085 | Ga0495645_0119758 | |||
| 2086 | Ga0495622_0019117 | |||
| 2087 | Ga0495622_0020586 | |||
| 2088 | Ga0495622_0028278 | |||
| 2089 | Ga0495622_0164145 | |||
| 2090 | Ga0495622_0294810 | |||
| 2091 | Ga0495633_0256519 | |||
| 2092 | Ga0495667_0018942 | |||
| 2093 | Ga0495667_0022214 | |||
| 2094 | Ga0495667_0102853 | |||
| 2095 | Ga0495656_0085052 | |||
| 2096 | Ga0495634_0001583 | |||
| 2097 | Ga0495634_0024426 | |||
| 2098 | Ga0495634_0048105 | |||
| 2099 | Ga0495634_0064787 | |||
| 2100 | Ga0495634_0089301 | |||
| 2101 | Ga0495611_0019750 | |||
| 2102 | Ga0495625_0025626 | |||
| 2103 | Ga0495625_0044250 | |||
| 2104 | Ga0495625_0107919 | |||
| 2105 | Ga0495635_0000436 | |||
| 2106 | Ga0495635_0015088 | |||
| 2107 | Ga0495635_0016639 | |||
| 2108 | Ga0495635_0026390 | |||
| 2109 | Ga0495635_0028565 | |||
| 2110 | Ga0495661_0030247 | |||
| 2111 | Ga0495661_0123407 | |||
| 2112 | Ga0495661_0201703 | |||
| 2113 | Ga0495588_0002049 | |||
| 2114 | Ga0495588_0016129 | |||
| 2115 | Ga0495588_0042317 | |||
| 2116 | Ga0495588_0131830 | |||
| 2117 | Ga0495657_0016639 | |||
| 2118 | Ga0495599_0010784 | |||
| 2119 | Ga0495599_0034169 | |||
| 2120 | Ga0495623_0015025 | |||
| 2121 | Ga0495623_0027993 | |||
| 2122 | Ga0495646_0001905 | |||
| 2123 | Ga0495646_0055522 | |||
| 2124 | Ga0495646_0070638 | |||
| 2125 | Ga0495647_0000394 | |||
| 2126 | Ga0495647_0061944 | |||
| 2127 | Ga0495647_0079400 | |||
| 2128 | Ga0495658_0018051 | |||
| 2129 | Ga0495658_0405146 | |||
| 2130 | Ga0495669_0009622 | |||
| 2131 | Ga0495669_0074157 | |||
| 2132 | Ga0495613_0017135 | |||
| 2133 | Ga0495613_0030248 | |||
| 2134 | Ga0495613_0215403 | |||
| 2135 | Ga0495613_0302262 | |||
| 2136 | Ga0495613_0435044 | |||
| 2137 | Ga0495624_0029651 | |||
| 2138 | Ga0495670_0038292 | |||
| 2139 | Ga0495649_0032618 | |||
| 2140 | Ga0495649_0243462 | |||
| 2141 | Ga0495600_0053718 | |||
| 2142 | Ga0495660_0083278 | |||
| 2143 | Ga0495660_0147807 | |||
| 2144 | Ga0495660_0271178 | |||
| 2145 | Ga0495581_0003127 | |||
| 2146 | Ga0495581_0036790 | |||
| 2147 | Ga0495604_0041025 | |||
| 2148 | Ga0495604_0119608 | |||
| 2149 | Ga0495674_0008903 | |||
| 2150 | Ga0495674_0020170 | |||
| 2151 | Ga0495674_0053630 | |||
| 2152 | Ga0495674_0109800 | |||
| 2153 | Ga0495674_0412086 | |||
| 2154 | Ga0495672_0006488 | |||
| 2155 | Ga0495672_0110248 | |||
| 2156 | Ga0495672_0142443 | |||
| 2157 | Ga0495676_0028303 | |||
| 2158 | Ga0495676_0037300 | |||
| 2159 | Ga0495676_0080429 | |||
| 2160 | Ga0495676_0404431 | |||
| 2161 | Ga0495680_0001711 | |||
| 2162 | Ga0495680_0025590 | |||
| 2163 | Ga0495680_0069244 | |||
| 2164 | Ga0495680_0358585 | |||
| 2165 | Ga0495687_070854 | |||
| 2166 | Ga0495675_0018890 | |||
| 2167 | Ga0495673_0055385 | |||
| 2168 | Ga0495673_0102891 | |||
| 2169 | Ga0495684_0022668 | |||
| 2170 | Ga0495684_0028314 | |||
| 2171 | Ga0495684_0156436 | |||
| 2172 | Ga0495686_0011260 | |||
| 2173 | Ga0495686_0052996 | |||
| 2174 | Ga0495686_0119295 | |||
| 2175 | Ga0495686_0224227 | |||
| 2176 | Ga0495686_0287266 | |||
| 2177 | Ga0495593_0000439 | |||
| 2178 | Ga0495593_0008595 | |||
| 2179 | Ga0495593_0203686 | |||
| 2180 | Ga0495593_0304568 | |||
| 2181 | Ga0495602_0003274 | |||
| 2182 | Ga0495602_0392156 | |||
| 2183 | Ga0495614_0026434 | |||
| 2184 | Ga0495614_0103613 | |||
| 2185 | Ga0495615_0064589 | |||
| 2186 | Ga0496100_0095475 | |||
| 2187 | Ga0496100_0132418 | |||
| 2188 | Ga0496100_0138199 | |||
| 2189 | Ga0496100_0321691 | |||
| 2190 | Ga0496101_0020624 | |||
| 2191 | Ga0496101_0029707 | |||
| 2192 | Ga0496101_0034508 | |||
| 2193 | Ga0496101_0221880 | |||
| 2194 | Ga0496101_0743007 | |||
| 2195 | Ga0496102_0001771 | |||
| 2196 | Ga0496102_0012689 | |||
| 2197 | Ga0496102_0083362 | |||
| 2198 | Ga0496103_0023438 | |||
| 2199 | Ga0496103_0038545 | |||
| 2200 | Ga0496103_0082141 | |||
| 2201 | Ga0496104_0005822 | |||
| 2202 | Ga0496104_0011101 | |||
| 2203 | Ga0496104_0077578 | |||
| 2204 | Ga0496104_0086985 | |||
| 2205 | Ga0496104_0215741 | |||
| 2206 | Ga0496104_0455365 | |||
| 2207 | Ga0496104_0588335 | |||
| 2208 | Ga0496105_0003099 | |||
| 2209 | Ga0496105_0039205 | |||
| 2210 | Ga0496105_0054260 | |||
| 2211 | Ga0496105_0060698 | |||
| 2212 | Ga0496105_0124463 | |||
| 2213 | Ga0496105_0262984 | |||
| 2214 | Ga0496105_0328879 | |||
| 2215 | Ga0496106_0034356 | |||
| 2216 | Ga0496106_0034378 | |||
| 2217 | Ga0496106_0068759 | |||
| 2218 | Ga0496106_0077972 | |||
| 2219 | Ga0496106_0119761 | |||
| 2220 | Ga0496106_0800032 | |||
| 2221 | Ga0496107_0005793 | |||
| 2222 | Ga0496107_0009818 | |||
| 2223 | Ga0496107_0076705 | |||
| 2224 | Ga0496107_0258397 | |||
| 2225 | Ga0496107_0274724 | |||
| 2226 | Ga0496108_0038300 | |||
| 2227 | Ga0496108_0104326 | |||
| 2228 | Ga0496108_0220065 | |||
| 2229 | Ga0496108_0552511 | |||
| 2230 | Ga0496108_0581322 | |||
| 2231 | Ga0496109_0034428 | |||
| 2232 | Ga0496109_0066264 | |||
| 2233 | Ga0496109_0208896 | |||
| 2234 | Ga0496109_1122667 | |||
| 2235 | Ga0496110_0014333 | |||
| 2236 | Ga0496110_0057232 | |||
| 2237 | Ga0496110_0449395 | |||
| 2238 | Ga0496111_0049082 | |||
| 2239 | Ga0496111_0097706 | |||
| 2240 | Ga0496112_0060301 | |||
| 2241 | Ga0496112_0063364 | |||
| 2242 | Ga0496112_0120290 | |||
| 2243 | Ga0496112_0161755 | |||
| 2244 | Ga0496113_0006361 | |||
| 2245 | Ga0496113_0067440 | |||
| 2246 | Ga0496113_0191139 | |||
| 2247 | Ga0496113_0443365 | |||
| 2248 | Ga0496113_0455863 | |||
| 2249 | Ga0496114_0009691 | |||
| 2250 | Ga0496114_0152655 | |||
| 2251 | Ga0496114_0242729 | |||
| 2252 | Ga0496115_0002446 | |||
| 2253 | Ga0496115_0002841 | |||
| 2254 | Ga0496115_0050187 | |||
| 2255 | Ga0496115_0056504 | |||
| 2256 | Ga0496115_0094385 | |||
| 2257 | Ga0496115_0096229 | |||
| 2258 | Ga0496115_0252939 | |||
| 2259 | Ga0496115_0254108 | |||
| 2260 | Ga0496115_0278358 | |||
| 2261 | Ga0496115_0528239 | |||
| 2262 | Ga0496117_0032127 | |||
| 2263 | Ga0496117_0046161 | |||
| 2264 | Ga0496117_0098573 | |||
| 2265 | Ga0496117_0107939 | |||
| 2266 | Ga0496117_0138705 | |||
| 2267 | Ga0496117_0258295 | |||
| 2268 | Ga0496118_0019989 | |||
| 2269 | Ga0496118_0027235 | |||
| 2270 | Ga0496118_0039217 | |||
| 2271 | Ga0496118_0137350 | |||
| 2272 | Ga0496119_0043886 | |||
| 2273 | Ga0496119_0066944 | |||
| 2274 | Ga0496119_0191170 | |||
| 2275 | Ga0496120_0016795 | |||
| 2276 | Ga0496120_0034937 | |||
| 2277 | Ga0496120_0062037 | |||
| 2278 | Ga0496120_0119567 | |||
| 2279 | Ga0496120_0132181 | |||
| 2280 | Ga0496121_0000230 | |||
| 2281 | Ga0496121_0002143 | |||
| 2282 | Ga0496121_0004589 | |||
| 2283 | Ga0496121_0008031 | |||
| 2284 | Ga0496121_0010422 | |||
| 2285 | Ga0496121_0074038 | |||
| 2286 | Ga0496121_0095916 | |||
| 2287 | Ga0496121_0108827 | |||
| 2288 | Ga0496121_0116751 | |||
| 2289 | Ga0496121_0119821 | |||
| 2290 | Ga0496121_0376409 | |||
| 2291 | Ga0496122_0041499 | |||
| 2292 | Ga0496122_0091099 | |||
| 2293 | Ga0496122_0233175 | |||
| 2294 | Ga0496123_0013289 | |||
| 2295 | Ga0496124_0096227 | |||
| 2296 | Ga0496124_0316230 | |||
| 2297 | Ga0496125_0000040 | |||
| 2298 | Ga0496125_0004755 | |||
| 2299 | Ga0496125_0008234 | |||
| 2300 | Ga0496125_0009329 | |||
| 2301 | Ga0496125_0137588 | |||
| 2302 | Ga0496126_0012513 | |||
| 2303 | Ga0496126_0017723 | |||
| 2304 | Ga0496126_0020497 | |||
| 2305 | Ga0496126_0022270 | |||
| 2306 | Ga0496126_0029864 | |||
| 2307 | Ga0496126_0040584 | |||
| 2308 | Ga0496126_0042182 | |||
| 2309 | Ga0496126_0042664 | |||
| 2310 | Ga0496126_0069964 | |||
| 2311 | Ga0496126_0075640 | |||
| 2312 | Ga0496126_0080155 | |||
| 2313 | Ga0496126_0109935 | |||
| 2314 | Ga0496126_0142762 | |||
| 2315 | Ga0496126_0250240 | |||
| 2316 | Ga0496126_0280170 | |||
| 2317 | Ga0496126_0357366 | |||
| 2318 | Ga0496126_0432456 | |||
| 2319 | Ga0496126_0515773 | |||
| 2320 | Ga0495678_069128 | |||
| 2321 | Ga0501031_0044962 | |||
| 2322 | Ga0501031_0166287 | |||
| 2323 | Ga0501032_0000769 | |||
| 2324 | Ga0501032_0011140 | |||
| 2325 | Ga0501033_0000311 | |||
| 2326 | Ga0501034_0000039 | |||
| 2327 | Ga0501034_0073346 | |||
| 2328 | Ga0501036_0000127 | |||
| 2329 | Ga0501036_0010199 | |||
| 2330 | Ga0501037_0000025 | |||
| 2331 | Ga0501038_0038708 | |||
| 2332 | Ga0501039_0000840 | |||
| 2333 | Ga0501043_0000120 | |||
| 2334 | Ga0501046_0000359 | |||
| 2335 | Ga0501047_0000379 | |||
| 2336 | Ga0501047_0012334 | |||
| 2337 | Ga0501047_0012496 | |||
| 2338 | Ga0501047_0462303 | |||
| 2339 | Ga0501047_0769257 | |||
| 2340 | Ga0501048_0000352 | |||
| 2341 | Ga0501067_0000025 | |||
| 2342 | Ga0501067_0037196 | |||
| 2343 | Ga0501068_0000463 | |||
| 2344 | Ga0501068_0069986 | |||
| 2345 | Ga0501069_0001694 | |||
| 2346 | Ga0501069_0218910 | |||
| 2347 | Ga0501070_0002185 | |||
| 2348 | Ga0501071_0035407 | |||
| 2349 | Ga0501072_0003699 | |||
| 2350 | Ga0501072_0730184 | |||
| 2351 | Ga0501073_0000091 | |||
| 2352 | Ga0501073_0037500 | |||
| 2353 | Ga0501073_0040686 | |||
| 2354 | Ga0501074_0000489 | |||
| 2355 | Ga0501074_0030384 | |||
| 2356 | Ga0501076_0549143 | |||
| 2357 | Ga0501079_0004084 | |||
| 2358 | Ga0501079_0742045 | |||
| 2359 | Ga0501080_0000321 | |||
| 2360 | Ga0501080_0013729 | |||
| 2361 | Ga0501080_0030848 | |||
| 2362 | Ga0501083_0000284 | |||
| 2363 | Ga0501083_0038811 | |||
| 2364 | Ga0501035_0001251 | |||
| 2365 | Ga0501035_0711676 | |||
| 2366 | Ga0501044_0000274 | |||
| 2367 | Ga0501044_0016521 | |||
| 2368 | Ga0501044_0051488 | |||
| 2369 | Ga0501045_0005648 | |||
| 2370 | nmdc:mga03n38_1383_c1 | |||
| 2371 | nmdc:mga03n38_138732_c1 | |||
| 2372 | nmdc:mga03n38_7252_c1 | |||
| 2373 | nmdc:mga00v17_146812_c1 | |||
| 2374 | nmdc:mga00v17_199308_c1 | |||
| 2375 | nmdc:mga0yw44_17129_c1 | |||
| 2376 | nmdc:mga0yw44_223406_c1 | |||
| 2377 | nmdc:mga0yw44_3463_c1 | |||
| 2378 | nmdc:mga0yw44_40352_c1 | |||
| 2379 | nmdc:mga06z11_129108_c1 | |||
| 2380 | nmdc:mga06z11_141167_c1 | |||
| 2381 | nmdc:mga06z11_289368_c1 | |||
| 2382 | nmdc:mga04h51_10509_c1 | |||
| 2383 | nmdc:mga04h51_192076_c1 | |||
| 2384 | nmdc:mga04h51_99732_c1 | |||
| 2385 | nmdc:mga07m45_370744_c1 | |||
| 2386 | nmdc:mga07m45_745_c1 | |||
| 2387 | nmdc:mga0n895_302498_c1 | |||
| 2388 | nmdc:mga0n895_59607_c1 | |||
| 2389 | nmdc:mga0rr50_269639_c1 | |||
| 2390 | nmdc:mga0sz30_111629_c1 | |||
| 2391 | nmdc:mga0sz30_33533_c1 | |||
| 2392 | Ga0495601_0020870 | |||
| 2393 | Ga0495601_0230688 | |||
| 2394 | Ga0500635_0002485 | |||
| 2395 | Ga0500635_0044884 | |||
| 2396 | Ga0495595_0002193 | |||
| 2397 | Ga0495595_0100469 | |||
| 2398 | Ga0495619_0009059 | |||
| 2399 | Ga0495619_0139924 | |||
| 2400 | Ga0500643_000456 | |||
| 2401 | Ga0500646_0043987 | |||
| 2402 | Ga0500647_0063463 | |||
| 2403 | Ga0500647_0075232 | |||
| 2404 | Ga0500651_0038607 | |||
| 2405 | Ga0500566_0000043 | |||
| 2406 | Ga0500566_0000370 | |||
| 2407 | Ga0500566_0001762 | |||
| 2408 | Ga0500566_0054651 | |||
| 2409 | Ga0500566_0070578 | |||
| 2410 | Ga0500566_0154071 | |||
| 2411 | Ga0500640_000244 | |||
| 2412 | Ga0500641_0082179 | |||
| 2413 | Ga0500641_0126662 | |||
| 2414 | Ga0500650_0088555 | |||
| 2415 | Ga0500554_001881 | |||
| 2416 | Ga0500554_019495 | |||
| 2417 | Ga0500555_004143 | |||
| 2418 | Ga0500555_029529 | |||
| 2419 | Ga0500556_0000468 | |||
| 2420 | Ga0500556_0022741 | |||
| 2421 | Ga0500556_0239106 | |||
| 2422 | Ga0500557_000003 | |||
| 2423 | Ga0500572_000024 | |||
| 2424 | Ga0500572_000714 | |||
| 2425 | Ga0500572_040783 | |||
| 2426 | Ga0500592_028439 | |||
| 2427 | Ga0500595_001364 | |||
| 2428 | Ga0500595_002343 | |||
| 2429 | Ga0500595_002877 | |||
| 2430 | Ga0500595_011685 | |||
| 2431 | Ga0500595_012731 | |||
| 2432 | Ga0500595_063636 | |||
| 2433 | Ga0500597_210926 | |||
| 2434 | Ga0500607_044709 | |||
| 2435 | Ga0500607_092543 | |||
| 2436 | Ga0500608_017517 | |||
| 2437 | Ga0500608_159410 | |||
| 2438 | Ga0500614_001091 | |||
| 2439 | Ga0500642_0000019 | |||
| 2440 | Ga0500642_0000252 | |||
| 2441 | Ga0500652_005796 | |||
| 2442 | Ga0500658_0008833 | |||
| 2443 | Ga0500658_0025119 | |||
| 2444 | Ga0500658_0028700 | |||
| 2445 | Ga0500559_0000030 | |||
| 2446 | Ga0500559_0001011 | |||
| 2447 | Ga0500559_0004998 | |||
| 2448 | Ga0500568_0018873 | |||
| 2449 | Ga0500577_0019106 | |||
| 2450 | Ga0500586_011707 | |||
| 2451 | Ga0500589_112207 | |||
| 2452 | Ga0500590_109037 | |||
| 2453 | Ga0500603_000121 | |||
| 2454 | Ga0500603_000391 | |||
| 2455 | Ga0500603_035201 | |||
| 2456 | Ga0500616_0000041 | |||
| 2457 | Ga0500616_0056297 | |||
| 2458 | Ga0500616_0081622 | |||
| 2459 | Ga0500622_0004419 | |||
| 2460 | Ga0500622_0025979 | |||
| 2461 | Ga0500630_000112 | |||
| 2462 | Ga0500638_001152 | |||
| 2463 | Ga0500638_084128 | |||
| 2464 | Ga0500638_126535 | |||
| 2465 | Ga0500639_000040 | |||
| 2466 | Ga0500639_018412 | |||
| 2467 | Ga0500636_0000365 | |||
| 2468 | Ga0500636_0121949 | |||
| 2469 | Ga0500637_0000042 | |||
| 2470 | Ga0500637_0002167 | |||
| 2471 | Ga0500637_0020311 | |||
| 2472 | Ga0500637_0216997 | |||
| 2473 | Ga0500637_0239867 | |||
| 2474 | Ga0500570_117425 | |||
| 2475 | Ga0500576_008130 | |||
| 2476 | Ga0500576_105573 | |||
| 2477 | Ga0500552_007808 | |||
| 2478 | Ga0500596_001493 | |||
| 2479 | Ga0500599_001116 | |||
| 2480 | Ga0500601_000203 | |||
| 2481 | Ga0501084_0003294 | |||
| 2482 | Ga0500661_001328 | |||
| 2483 | Ga0501082_0007446 | |||
| 2484 | Ga0466962_0094396 | |||
| 2485 | 2507507675 | |||
| 2486 | 2508541790 | |||
| 2487 | 2508692661 | |||
| 2488 | 2509149312 | |||
| 2489 | 2511398186 | |||
| 2490 | 2513621878 | |||
| 2491 | 2513642975 | |||
| 2492 | 2513647503 | |||
| 2493 | 2513654078 | |||
| 2494 | 2513671437 | |||
| 2495 | 2513698093 | |||
| 2496 | 2513704275 | |||
| 2497 | 2513719470 | |||
| 2498 | 2513856830 | |||
| 2499 | 2513878510 | |||
| 2500 | 2513891264 | |||
| 2501 | 2513918418 | |||
| 2502 | 2514009443 | |||
| 2503 | 2515626067 | |||
| 2504 | 2517104147 | |||
| 2505 | 2517891348 | |||
| 2506 | 2524436289 | |||
| 2507 | 2524463900 | |||
| 2508 | 2524468467 | |||
| 2509 | 2524540886 | |||
| 2510 | 2528848992 | |||
| 2511 | 2603860908 | |||
| 2512 | 2617346787 | |||
| 2513 | 2617372717 | |||
| 2514 | 2644289107 | |||
| 2515 | 2671118872 | |||
| 2516 | 2723843695 | |||
| 2517 | 2728750061 | |||
| 2518 | 2745080756 | |||
| 2519 | 2793065219 | |||
| 2520 | 2793066716 | |||
| 2521 | 2793080660 | |||
| 2522 | 2805919066 | |||
| 2523 | 2818236540 | |||
| 2524 | 2824606549 | |||
| 2525 | 2824613034 | |||
| 2526 | 2824620399 | |||
| 2527 | 2824628553 | |||
| 2528 | 2824639095 | |||
| 2529 | 2824647320 | |||
| 2530 | 2824658527 | |||
| 2531 | 2824666476 | |||
| 2532 | 2824674132 | |||
| 2533 | 2824685670 | |||
| 2534 | 2824691973 | |||
| 2535 | 2824701131 | |||
| 2536 | 2824710242 | |||
| 2537 | 2824723323 | |||
| 2538 | 2824732446 | |||
| 2539 | 2824735848 | |||
| 2540 | 2824750095 | |||
| 2541 | 2824755970 | |||
| 2542 | 2824767508 | |||
| 2543 | 2824775137 | |||
| 2544 | 2838130492 | |||
| 2545 | 2841949290 | |||
| 2546 | 2841953465 | |||
| 2547 | 2841959703 | |||
| 2548 | 2841972058 | |||
| 2549 | 2841978194 | |||
| 2550 | 2841991005 | |||
| 2551 | 2842040635 | |||
| 2552 | 2842046419 | |||
| 2553 | 2844320010 | |||
| 2554 | 2847937310 | |||
| 2555 | 2847947729 | |||
| 2556 | 2849078410 | |||
| 2557 | 2857512782 | |||
| 2558 | 2857524640 | |||
| 2559 | 2874598785 | |||
| 2560 | 2874607396 | |||
| 2561 | 2874614585 | |||
| 2562 | 2874628067 | |||
| 2563 | 2874635018 | |||
| 2564 | 2874652241 | |||
| 2565 | 2876766229 | |||
| 2566 | 2876778824 | |||
| 2567 | 2876817720 | |||
| 2568 | 2876824281 | |||
| 2569 | 2879082617 | |||
| 2570 | 2879086612 | |||
| 2571 | 2879107121 | |||
| 2572 | 2879111854 | |||
| 2573 | 2879131534 | |||
| 2574 | 2879147980 | |||
| 2575 | 2881371472 | |||
| 2576 | 2881666565 | |||
| 2577 | 2885369959 | |||
| 2578 | 2885374998 | |||
| 2579 | 2885386833 | |||
| 2580 | 2885410275 | |||
| 2581 | 2888385440 | |||
| 2582 | 2888392792 | |||
| 2583 | 2888425570 | |||
| 2584 | 2889038027 | |||
| 2585 | 2893069161 | |||
| 2586 | 2903730315 | |||
| 2587 | 2903755309 | |||
| 2588 | 2903769624 | |||
| 2589 | 2903769715 | |||
| 2590 | 2904674315 | |||
| 2591 | 2904691217 | |||
| 2592 | 2904701301 | |||
| 2593 | 2904711985 | |||
| 2594 | 2906604750 | |||
| 2595 | 2906616534 | |||
| 2596 | 2906627333 | |||
| 2597 | 2906635307 | |||
| 2598 | 2906643931 | |||
| 2599 | 2906666852 | |||
| 2600 | 2908741702 | |||
| 2601 | 2908759142 | |||
| 2602 | 2908781160 | |||
| 2603 | 2919078522 | |||
| 2604 | 2922366026 | |||
| 2605 | 2922372419 | |||
| 2606 | 2922387362 | |||
| 2607 | 2922397083 | |||
| 2608 | 2922431447 | |||
| 2609 | 2929626157 | |||
| 2610 | 2932784963 | |||
| 2611 | 2932795159 | |||
| 2612 | 2932805687 | |||
| 2613 | 2932809996 | |||
| 2614 | 2932818261 | |||
| 2615 | 2932828800 | |||
| 2616 | 2933583118 | |||
| 2617 | 2935609816 | |||
| 2618 | 2935619780 | |||
| 2619 | 2935634042 | |||
| 2620 | 2935638761 | |||
| 2621 | 2935652155 | |||
| 2622 | 2935659872 | |||
| 2623 | 2935666388 | |||
| 2624 | 2935676565 | |||
| 2625 | 2935690763 | |||
| 2626 | 2935694646 | |||
| 2627 | 2935703767 | |||
| 2628 | 2935718144 | |||
| 2629 | 2935727875 | |||
| 2630 | 2935736579 | |||
| 2631 | 2935745958 | |||
| 2632 | 2935756339 | |||
| 2633 | 2935760556 | |||
| 2634 | 2935777008 | |||
| 2635 | 2935783564 | |||
| 2636 | 2935792791 | |||
| 2637 | 2935800861 | |||
| 2638 | 2935801904 | |||
| 2639 | 2935810674 | |||
| 2640 | 2935822977 | |||
| 2641 | 2935828255 | |||
| 2642 | 2935842459 | |||
| 2643 | 2935848559 | |||
| 2644 | 2935857905 | |||
| 2645 | 2935868753 | |||
| 2646 | 2935874168 | |||
| 2647 | 2935883943 | |||
| 2648 | 2935909633 | |||
| 2649 | 2935917358 | |||
| 2650 | 2935927114 | |||
| 2651 | 2935937042 | |||
| 2652 | 2935944655 | |||
| 2653 | 2935953092 | |||
| 2654 | 2935966594 | |||
| 2655 | 2935969932 | |||
| 2656 | 2935980224 | |||
| 2657 | 2935987017 | |||
| 2658 | 2935992907 | |||
| 2659 | 2936002820 | |||
| 2660 | 2936014288 | |||
| 2661 | 2936023872 | |||
| 2662 | 2936031515 | |||
| 2663 | 2936037906 | |||
| 2664 | 2936049394 | |||
| 2665 | 2936062144 | |||
| 2666 | 2940561686 | |||
| 2667 | 2941510655 | |||
| 2668 | 2941518039 | |||
| 2669 | 2941527090 | |||
| 2670 | 2941531195 | |||
| 2671 | 2941542508 | |||
| 2672 | 3005481239 | |||
| 2673 | 3005484805 | |||
| 2674 | 3005508444 | |||
| 2675 | 3005588053 | |||
| 2676 | 3005600303 | |||
| 2677 | 3005715796 | |||
| 2678 | 3005723151 | |||
| 2679 | 8006927953 | |||
| 2680 | 8006939470 | |||
| 2681 | 8006972128 | |||
| 2682 | 8006979220 | |||
| 2683 | 8006984417 | |||
| 2684 | 8007001351 | |||
| 2685 | 8016520673 | |||
| 2686 | 8016528699 | |||
| 2687 | 8016533878 | |||
| 2688 | 8016547101 | |||
| 2689 | 8016555019 | |||
| 2690 | 8016563389 | |||
| 2691 | 8016572216 | |||
| 2692 | 8016576405 | |||
| 2693 | 8016594323 | |||
| 2694 | 8016601139 | |||
| 2695 | 8016609309 | |||
| 2696 | 8016615595 | |||
| 2697 | 8016625625 | |||
| 2698 | 8017064909 | |||
| 2699 | 8019533649 | |||
| 2700 | 8019546017 | |||
| 2701 | 8019552704 | |||
| 2702 | 8019565347 | |||
| 2703 | 8019575447 | |||
| 2704 | 8019584285 | |||
| 2705 | 8019592053 | |||
| 2706 | 8019609128 | |||
| 2707 | 8019619801 | |||
| 2708 | 8019633314 | |||
| 2709 | 8019646586 | |||
| 2710 | 8019649356 | |||
| 2711 | 8019661188 | |||
| 2712 | 8019670739 | |||
| 2713 | 8019685492 | |||
| 2714 | 8019691055 | |||
| 2715 | 8055745125 | |||
| 2716 | 8056681095 | |||
| 2717 | 8056682539 | |||
| 2718 | 8056684740 | |||
| 2719 | 8056693074 | |||
| 2720 | 8056975083 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dbf-assembly1.cif.gz_A | crystal structures of cg1458 | 0.722 | 19 | 224 |
| 2q1d-assembly1.cif.gz_X | 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate | 0.6653 | 19 | 224 |
| 4dbf-assembly1.cif.gz_B | crystal structures of cg1458 | 0.658 | 3 | 224 |
| 4dbh-assembly1.cif.gz_B | crystal structure of cg1458 with inhibitor | 0.6497 | 3 | 224 |
| 3bqb-assembly1.cif.gz_X | hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase | 0.6451 | 19 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dbfB02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.7367 | 23 | 224 | 3.90.850.10 |
| af_Q1ZXQ1_120_425_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.7275 | 21 | 226 | 3.90.850.10 |
| 4dbfB02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.7202 | 23 | 224 | 3.90.850.10 |
| af_Q9NSI5_146_240_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6867 | 196 | 224 | 2.60.40.10 |
| af_Q1ZXQ1_120_425_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.664 | 21 | 226 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1L3FKG2-F1-model_v4 | DUF2848 domain-containing protein | 0.9799 | 1 | 228 |
GO:0003824
|
| AF-A0A516J760-F1-model_v4 | deleted | 0.9796 | 1 | 228 |
|
| AF-A0A437QQV3-F1-model_v4 | DUF2848 domain-containing protein | 0.9794 | 1 | 228 |
GO:0003824
|
| AF-U1IFE9-F1-model_v4 | deleted | 0.9783 | 1 | 228 |
|
| AF-A0A2U8Q8J7-F1-model_v4 | deleted | 0.9782 | 1 | 228 |
|