F493272
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1354 | 567 | 2708 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0210033|Ga0395898_0210033_122_721 |
| Length | 199 |
| Sequence | LTASIASSKLPAARLQPFIEGQGIMAEFTVNPTRFDPYKNFKFRVKWDGQYVAAVSKVSALKRTTEVIEHREGGDPSTPRLSPGRTKFEAITLERGVTHDPAFEQWAAKVWNLGGGLGAEVSLKDFRKDIVIEVFNEAGQLVLAYKVFRCWVSEYQALPDLDANADAVMIEHIKLENEGWERDTTVVEPLEPSFAKGSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 231 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 284 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 285 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 286 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 287 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 288 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 289 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 290 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 291 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 292 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 293 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 294 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 295 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 296 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 298 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 299 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 300 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 301 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 302 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 303 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 304 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 305 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 306 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 307 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 308 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 309 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 310 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 311 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 312 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 313 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 314 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 315 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 316 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 317 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 318 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 319 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 320 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 321 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 322 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 323 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 324 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 325 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 326 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 327 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 328 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 329 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 330 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 331 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 332 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 333 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 334 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 335 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 336 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 337 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 423 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 424 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 425 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 426 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 427 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 428 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 431 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 432 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 433 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 434 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 435 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 436 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 437 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 438 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 439 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 440 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 441 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 442 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 445 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 446 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 447 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 448 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 449 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 450 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 451 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 452 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 476 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 477 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 478 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 479 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 480 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 481 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 482 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 483 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 484 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 485 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 486 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 487 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 488 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 489 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 490 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 491 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 492 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 493 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 494 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 495 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 500 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 501 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 502 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 503 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 504 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 505 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 506 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 507 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 508 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 509 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 513 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 514 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 515 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 516 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 517 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 518 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 519 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 520 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 521 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 533 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 537 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 538 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 539 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 540 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 541 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 542 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 543 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 544 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 545 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 546 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 547 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 548 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 549 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 550 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 551 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 554 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 555 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 556 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 557 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 558 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 559 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 560 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 561 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 562 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 563 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 564 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 565 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 566 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 567 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.01 |
| Metatranscriptomes | 1.03 |
| Isolates | 0.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 0.15 |
| Rhizoplane | 5.1 |
| Rhizosphere | 85.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395898_0210033 | 3300037466 | Bacteria | 1857 |
| 2 | CNAas_1004002 | 3300000532 | Bacteria | 956 |
| 3 | JGI24735J21928_10092228 | 3300002067 | Bacteria | 869 |
| 4 | JGI25156J39149_1007267 | 3300002705 | Bacteria | 2932 |
| 5 | JGI25157J39369_1003833 | 3300002741 | Bacteria | 2932 |
| 6 | JGI25406J46586_10000010 | 3300003203 | Bacteria | 109792 |
| 7 | JGI25406J46586_10008789 | 3300003203 | Bacteria | 4548 |
| 8 | Ga0055540_1017344 | 3300003792 | Bacteria | 2014 |
| 9 | Ga0055540_1020312 | 3300003792 | Bacteria | 1760 |
| 10 | Ga0058859_11603680 | 3300004798 | Bacteria | 943 |
| 11 | Ga0058863_11854324 | 3300004799 | Bacteria | 938 |
| 12 | Ga0058861_11844294 | 3300004800 | Bacteria | 1002 |
| 13 | Ga0058860_11738728 | 3300004801 | Bacteria | 940 |
| 14 | Ga0058860_11924803 | 3300004801 | Bacteria | 686 |
| 15 | Ga0058860_12076197 | 3300004801 | Bacteria | 684 |
| 16 | Ga0058862_12208179 | 3300004803 | Bacteria | 1317 |
| 17 | Ga0065704_10090112 | 3300005289 | Bacteria | 2811 |
| 18 | Ga0065704_10100036 | 3300005289 | Bacteria | 2288 |
| 19 | Ga0065712_10207421 | 3300005290 | Bacteria | 1085 |
| 20 | Ga0065715_10209158 | 3300005293 | Bacteria | 1322 |
| 21 | Ga0065715_10216462 | 3300005293 | Bacteria | 1291 |
| 22 | Ga0065707_10085147 | 3300005295 | Bacteria | 6411 |
| 23 | Ga0065707_10922474 | 3300005295 | Bacteria | 560 |
| 24 | Ga0070658_10040185 | 3300005327 | Bacteria | 3774 |
| 25 | Ga0070658_10151983 | 3300005327 | Bacteria | 1939 |
| 26 | Ga0070658_10246230 | 3300005327 | Bacteria | 1516 |
| 27 | Ga0070676_10817220 | 3300005328 | Bacteria | 689 |
| 28 | Ga0070683_100014912 | 3300005329 | Bacteria | 6811 |
| 29 | Ga0070683_100086029 | 3300005329 | Bacteria | 2948 |
| 30 | Ga0070683_100827423 | 3300005329 | Bacteria | 888 |
| 31 | Ga0070683_101483235 | 3300005329 | Bacteria | 652 |
| 32 | Ga0070690_100093419 | 3300005330 | Bacteria | 1984 |
| 33 | Ga0070690_100162746 | 3300005330 | Bacteria | 1530 |
| 34 | Ga0070690_100182772 | 3300005330 | Bacteria | 1450 |
| 35 | Ga0070670_100010861 | 3300005331 | Bacteria | 7779 |
| 36 | Ga0070670_100452415 | 3300005331 | Bacteria | 1138 |
| 37 | Ga0070677_10001124 | 3300005333 | Bacteria | 8603 |
| 38 | Ga0068869_100261886 | 3300005334 | Bacteria | 1384 |
| 39 | Ga0070666_10498570 | 3300005335 | Bacteria | 883 |
| 40 | Ga0070680_100011730 | 3300005336 | Bacteria | 6793 |
| 41 | Ga0070680_100014807 | 3300005336 | Bacteria | 6099 |
| 42 | Ga0070682_100025094 | 3300005337 | Bacteria | 3555 |
| 43 | Ga0070682_100067299 | 3300005337 | Bacteria | 2281 |
| 44 | Ga0068868_100000525 | 3300005338 | Bacteria | 25646 |
| 45 | Ga0068868_100302307 | 3300005338 | Bacteria | 1359 |
| 46 | Ga0070660_100295294 | 3300005339 | Bacteria | 1328 |
| 47 | Ga0070660_100614145 | 3300005339 | Unclassified | 910 |
| 48 | Ga0070689_100000226 | 3300005340 | Bacteria | 33805 |
| 49 | Ga0070689_100157580 | 3300005340 | Bacteria | 1834 |
| 50 | Ga0070689_100449850 | 3300005340 | Bacteria | 1096 |
| 51 | Ga0070689_101152478 | 3300005340 | Unclassified | 694 |
| 52 | Ga0070687_100116565 | 3300005343 | Bacteria | 1521 |
| 53 | Ga0070661_100119021 | 3300005344 | Bacteria | 1977 |
| 54 | Ga0070661_100327116 | 3300005344 | Bacteria | 1198 |
| 55 | Ga0070668_100009781 | 3300005347 | Bacteria | 7108 |
| 56 | Ga0070668_100024777 | 3300005347 | Bacteria | 4547 |
| 57 | Ga0070668_100954375 | 3300005347 | Bacteria | 769 |
| 58 | Ga0070669_100015421 | 3300005353 | Bacteria | 5446 |
| 59 | Ga0070669_100424422 | 3300005353 | Bacteria | 1092 |
| 60 | Ga0070669_100851872 | 3300005353 | Bacteria | 777 |
| 61 | Ga0070675_100007932 | 3300005354 | Bacteria | 8230 |
| 62 | Ga0070671_100018395 | 3300005355 | Bacteria | 5675 |
| 63 | Ga0070671_100049277 | 3300005355 | Bacteria | 3504 |
| 64 | Ga0070671_100059317 | 3300005355 | Bacteria | 3184 |
| 65 | Ga0070671_100093279 | 3300005355 | Bacteria | 2523 |
| 66 | Ga0070671_100344446 | 3300005355 | Bacteria | 1272 |
| 67 | Ga0070671_100470122 | 3300005355 | Bacteria | 1080 |
| 68 | Ga0070674_100029504 | 3300005356 | Bacteria | 3614 |
| 69 | Ga0070674_100338863 | 3300005356 | Bacteria | 1211 |
| 70 | Ga0070688_100000038 | 3300005365 | Bacteria | 60923 |
| 71 | Ga0070688_100530030 | 3300005365 | Bacteria | 892 |
| 72 | Ga0070659_100023497 | 3300005366 | Bacteria | 4717 |
| 73 | Ga0070667_100251471 | 3300005367 | Bacteria | 1580 |
| 74 | Ga0070709_10757814 | 3300005434 | Bacteria | 759 |
| 75 | Ga0070714_100362752 | 3300005435 | Unclassified | 1362 |
| 76 | Ga0070714_100801801 | 3300005435 | Bacteria | 912 |
| 77 | Ga0070713_100012168 | 3300005436 | Bacteria | 6302 |
| 78 | Ga0070713_100047332 | 3300005436 | Bacteria | 3534 |
| 79 | Ga0070713_100069706 | 3300005436 | Bacteria | 2966 |
| 80 | Ga0070713_100782707 | 3300005436 | Bacteria | 914 |
| 81 | Ga0070710_10000737 | 3300005437 | Bacteria | 15575 |
| 82 | Ga0070710_10481687 | 3300005437 | Bacteria | 846 |
| 83 | Ga0070710_10640751 | 3300005437 | Bacteria | 744 |
| 84 | Ga0070701_10628074 | 3300005438 | Bacteria | 715 |
| 85 | Ga0070711_100001753 | 3300005439 | Bacteria | 12050 |
| 86 | Ga0070711_100327369 | 3300005439 | Bacteria | 1226 |
| 87 | Ga0070705_100172809 | 3300005440 | Bacteria | 1456 |
| 88 | Ga0070705_100235543 | 3300005440 | Bacteria | 1276 |
| 89 | Ga0070700_100654939 | 3300005441 | Bacteria | 830 |
| 90 | Ga0070694_100001269 | 3300005444 | Bacteria | 14667 |
| 91 | Ga0070694_100004587 | 3300005444 | Bacteria | 8307 |
| 92 | Ga0070694_100039353 | 3300005444 | Bacteria | 3147 |
| 93 | Ga0070694_100282396 | 3300005444 | Bacteria | 1266 |
| 94 | Ga0070694_100451075 | 3300005444 | Unclassified | 1015 |
| 95 | Ga0070708_100000237 | 3300005445 | Bacteria | 40825 |
| 96 | Ga0070708_100015706 | 3300005445 | Bacteria | 6257 |
| 97 | Ga0070663_100370469 | 3300005455 | Bacteria | 1164 |
| 98 | Ga0070663_100447624 | 3300005455 | Bacteria | 1064 |
| 99 | Ga0070663_100786182 | 3300005455 | Bacteria | 815 |
| 100 | Ga0070678_100021178 | 3300005456 | Bacteria | 4282 |
| 101 | Ga0070678_100047483 | 3300005456 | Bacteria | 3085 |
| 102 | Ga0070678_100327429 | 3300005456 | Bacteria | 1310 |
| 103 | Ga0070678_100502799 | 3300005456 | Bacteria | 1069 |
| 104 | Ga0070678_100796864 | 3300005456 | Bacteria | 858 |
| 105 | Ga0070662_100056400 | 3300005457 | Bacteria | 2852 |
| 106 | Ga0070662_100159473 | 3300005457 | Bacteria | 1764 |
| 107 | Ga0070662_100270926 | 3300005457 | Bacteria | 1371 |
| 108 | Ga0070681_10004421 | 3300005458 | Bacteria | 13391 |
| 109 | Ga0070681_10090798 | 3300005458 | Bacteria | 3005 |
| 110 | Ga0070681_10093332 | 3300005458 | Bacteria | 2958 |
| 111 | Ga0070681_10102841 | 3300005458 | Bacteria | 2802 |
| 112 | Ga0068867_100823348 | 3300005459 | Bacteria | 830 |
| 113 | Ga0070685_10380938 | 3300005466 | Bacteria | 972 |
| 114 | Ga0070707_100000239 | 3300005468 | Bacteria | 54793 |
| 115 | Ga0070707_100072302 | 3300005468 | Bacteria | 3324 |
| 116 | Ga0070707_100099741 | 3300005468 | Bacteria | 2814 |
| 117 | Ga0070707_100523106 | 3300005468 | Bacteria | 1148 |
| 118 | Ga0070707_101677378 | 3300005468 | Bacteria | 603 |
| 119 | Ga0070698_100002637 | 3300005471 | Bacteria | 19755 |
| 120 | Ga0070698_100048344 | 3300005471 | Bacteria | 4346 |
| 121 | Ga0070698_100089292 | 3300005471 | Bacteria | 3066 |
| 122 | Ga0070698_100301896 | 3300005471 | Bacteria | 1532 |
| 123 | Ga0070698_100576845 | 3300005471 | Bacteria | 1065 |
| 124 | Ga0070699_100011849 | 3300005518 | Bacteria | 7525 |
| 125 | Ga0070699_100050964 | 3300005518 | Bacteria | 3584 |
| 126 | Ga0070699_100077704 | 3300005518 | Bacteria | 2890 |
| 127 | Ga0070699_100147008 | 3300005518 | Bacteria | 2083 |
| 128 | Ga0070699_100682690 | 3300005518 | Bacteria | 938 |
| 129 | Ga0070679_100002006 | 3300005530 | Bacteria | 18266 |
| 130 | Ga0070679_100010620 | 3300005530 | Bacteria | 8738 |
| 131 | Ga0070679_100016572 | 3300005530 | Bacteria | 7114 |
| 132 | Ga0070679_100482497 | 3300005530 | Bacteria | 1184 |
| 133 | Ga0070679_100807759 | 3300005530 | Bacteria | 881 |
| 134 | Ga0070679_100957189 | 3300005530 | Bacteria | 800 |
| 135 | Ga0070684_100038327 | 3300005535 | Unclassified | 4117 |
| 136 | Ga0070684_100044887 | 3300005535 | Bacteria | 3825 |
| 137 | Ga0070684_100269382 | 3300005535 | Bacteria | 1559 |
| 138 | Ga0070697_100069815 | 3300005536 | Bacteria | 2879 |
| 139 | Ga0070697_100074798 | 3300005536 | Bacteria | 2784 |
| 140 | Ga0068853_100000427 | 3300005539 | Bacteria | 28683 |
| 141 | Ga0068853_101039661 | 3300005539 | Bacteria | 789 |
| 142 | Ga0068853_101573678 | 3300005539 | Bacteria | 637 |
| 143 | Ga0070672_100001493 | 3300005543 | Bacteria | 14515 |
| 144 | Ga0070672_100699250 | 3300005543 | Bacteria | 888 |
| 145 | Ga0070672_100785065 | 3300005543 | Bacteria | 837 |
| 146 | Ga0070672_101136034 | 3300005543 | Bacteria | 695 |
| 147 | Ga0070686_100062583 | 3300005544 | Bacteria | 2408 |
| 148 | Ga0070686_100106638 | 3300005544 | Bacteria | 1902 |
| 149 | Ga0070686_100499915 | 3300005544 | Bacteria | 943 |
| 150 | Ga0070695_100355807 | 3300005545 | Bacteria | 1098 |
| 151 | Ga0070695_100371126 | 3300005545 | Unclassified | 1077 |
| 152 | Ga0070696_100024052 | 3300005546 | Bacteria | 4141 |
| 153 | Ga0070696_100070370 | 3300005546 | Unclassified | 2461 |
| 154 | Ga0070696_100110970 | 3300005546 | Bacteria | 1975 |
| 155 | Ga0070696_100270891 | 3300005546 | Bacteria | 1291 |
| 156 | Ga0070693_100011117 | 3300005547 | Bacteria | 4530 |
| 157 | Ga0070693_100116709 | 3300005547 | Bacteria | 1650 |
| 158 | Ga0070665_100006034 | 3300005548 | Bacteria | 12380 |
| 159 | Ga0070665_100018589 | 3300005548 | Bacteria | 6965 |
| 160 | Ga0070665_100150114 | 3300005548 | Bacteria | 2333 |
| 161 | Ga0070665_100257240 | 3300005548 | Bacteria | 1747 |
| 162 | Ga0070665_100414013 | 3300005548 | Bacteria | 1356 |
| 163 | Ga0070665_100441161 | 3300005548 | Bacteria | 1311 |
| 164 | Ga0070665_101209221 | 3300005548 | Bacteria | 766 |
| 165 | Ga0070665_101589587 | 3300005548 | Bacteria | 662 |
| 166 | Ga0070704_100752094 | 3300005549 | Bacteria | 868 |
| 167 | Ga0070704_101221077 | 3300005549 | Bacteria | 686 |
| 168 | Ga0068855_100060062 | 3300005563 | Bacteria | 4447 |
| 169 | Ga0068855_100077079 | 3300005563 | Bacteria | 3868 |
| 170 | Ga0070664_100050270 | 3300005564 | Bacteria | 3528 |
| 171 | Ga0070664_100066190 | 3300005564 | Bacteria | 3085 |
| 172 | Ga0070664_100146805 | 3300005564 | Bacteria | 2080 |
| 173 | Ga0070664_100244648 | 3300005564 | Bacteria | 1611 |
| 174 | Ga0070664_100309431 | 3300005564 | Bacteria | 1429 |
| 175 | Ga0068857_100003463 | 3300005577 | Bacteria | 13171 |
| 176 | Ga0068857_100068756 | 3300005577 | Bacteria | 3153 |
| 177 | Ga0068857_100104257 | 3300005577 | Bacteria | 2546 |
| 178 | Ga0068857_100522091 | 3300005577 | Bacteria | 1116 |
| 179 | Ga0068857_101252312 | 3300005577 | Bacteria | 719 |
| 180 | Ga0068857_101295965 | 3300005577 | Unclassified | 707 |
| 181 | Ga0068854_100712463 | 3300005578 | Bacteria | 867 |
| 182 | Ga0068854_100800870 | 3300005578 | Bacteria | 821 |
| 183 | Ga0068854_101226603 | 3300005578 | Bacteria | 673 |
| 184 | Ga0068856_100018429 | 3300005614 | Bacteria | 6766 |
| 185 | Ga0068856_100107804 | 3300005614 | Bacteria | 2781 |
| 186 | Ga0068856_100472507 | 3300005614 | Bacteria | 1275 |
| 187 | Ga0070702_100494869 | 3300005615 | Bacteria | 896 |
| 188 | Ga0068859_100005606 | 3300005617 | Bacteria | 12793 |
| 189 | Ga0068859_100071916 | 3300005617 | Bacteria | 3494 |
| 190 | Ga0068859_100239070 | 3300005617 | Bacteria | 1905 |
| 191 | Ga0068864_100002788 | 3300005618 | Bacteria | 14430 |
| 192 | Ga0068864_100064984 | 3300005618 | Bacteria | 3165 |
| 193 | Ga0068864_100160645 | 3300005618 | Bacteria | 2042 |
| 194 | Ga0068864_100174375 | 3300005618 | Bacteria | 1962 |
| 195 | Ga0068864_100433300 | 3300005618 | Bacteria | 1255 |
| 196 | Ga0068864_100741806 | 3300005618 | Bacteria | 962 |
| 197 | Ga0068864_101293238 | 3300005618 | Bacteria | 729 |
| 198 | Ga0068866_10650128 | 3300005718 | Bacteria | 718 |
| 199 | Ga0068861_100346996 | 3300005719 | Unclassified | 1301 |
| 200 | Ga0068861_100778050 | 3300005719 | Bacteria | 896 |
| 201 | Ga0068851_10351263 | 3300005834 | Bacteria | 858 |
| 202 | Ga0068863_100041601 | 3300005841 | Bacteria | 4370 |
| 203 | Ga0068863_100043177 | 3300005841 | Bacteria | 4280 |
| 204 | Ga0068863_100043287 | 3300005841 | Bacteria | 4275 |
| 205 | Ga0068863_100131930 | 3300005841 | Bacteria | 2385 |
| 206 | Ga0068863_100479384 | 3300005841 | Bacteria | 1223 |
| 207 | Ga0068863_100668702 | 3300005841 | Bacteria | 1031 |
| 208 | Ga0068858_100383239 | 3300005842 | Bacteria | 1349 |
| 209 | Ga0068858_100625171 | 3300005842 | Bacteria | 1046 |
| 210 | Ga0068858_100822420 | 3300005842 | Bacteria | 907 |
| 211 | Ga0068858_101211710 | 3300005842 | Unclassified | 742 |
| 212 | Ga0068860_100036750 | 3300005843 | Bacteria | 4690 |
| 213 | Ga0068860_100761740 | 3300005843 | Bacteria | 980 |
| 214 | Ga0068860_101413238 | 3300005843 | Bacteria | 717 |
| 215 | Ga0068860_101570719 | 3300005843 | Bacteria | 680 |
| 216 | Ga0068862_100014830 | 3300005844 | Bacteria | 6473 |
| 217 | Ga0068862_100202569 | 3300005844 | Bacteria | 1790 |
| 218 | Ga0068862_100245488 | 3300005844 | Bacteria | 1630 |
| 219 | Ga0068862_100523773 | 3300005844 | Bacteria | 1128 |
| 220 | Ga0081455_10328273 | 3300005937 | Bacteria | 1087 |
| 221 | Ga0081538_10008601 | 3300005981 | Bacteria | 8637 |
| 222 | Ga0081540_1088867 | 3300005983 | Bacteria | 1365 |
| 223 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 224 | Ga0081539_10000346 | 3300005985 | Bacteria | 101962 |
| 225 | Ga0081539_10012442 | 3300005985 | Bacteria | 6559 |
| 226 | Ga0081539_10193063 | 3300005985 | Bacteria | 946 |
| 227 | Ga0070717_10154099 | 3300006028 | Bacteria | 1989 |
| 228 | Ga0070717_10327410 | 3300006028 | Bacteria | 1366 |
| 229 | Ga0070717_10762421 | 3300006028 | Unclassified | 880 |
| 230 | Ga0075365_10016131 | 3300006038 | Bacteria | 4535 |
| 231 | Ga0075365_10102255 | 3300006038 | Bacteria | 1963 |
| 232 | Ga0075368_10004650 | 3300006042 | Bacteria | 4670 |
| 233 | Ga0075368_10041948 | 3300006042 | Bacteria | 1799 |
| 234 | Ga0075368_10071246 | 3300006042 | Bacteria | 1404 |
| 235 | Ga0075368_10076377 | 3300006042 | Bacteria | 1359 |
| 236 | Ga0075363_100053470 | 3300006048 | Bacteria | 2158 |
| 237 | Ga0075363_100091523 | 3300006048 | Bacteria | 1674 |
| 238 | Ga0075363_100139908 | 3300006048 | Bacteria | 1362 |
| 239 | Ga0075364_10003451 | 3300006051 | Bacteria | 8994 |
| 240 | Ga0075364_10019486 | 3300006051 | Bacteria | 4259 |
| 241 | Ga0075364_10064789 | 3300006051 | Bacteria | 2399 |
| 242 | Ga0075432_10161220 | 3300006058 | Bacteria | 867 |
| 243 | Ga0070715_10632920 | 3300006163 | Bacteria | 631 |
| 244 | Ga0070716_100011786 | 3300006173 | Bacteria | 4410 |
| 245 | Ga0070716_100040477 | 3300006173 | Bacteria | 2593 |
| 246 | Ga0070712_100032208 | 3300006175 | Bacteria | 3538 |
| 247 | Ga0070712_101071439 | 3300006175 | Bacteria | 699 |
| 248 | Ga0075362_10225478 | 3300006177 | Bacteria | 917 |
| 249 | Ga0075367_10019688 | 3300006178 | Bacteria | 3746 |
| 250 | Ga0075367_10020460 | 3300006178 | Bacteria | 3686 |
| 251 | Ga0075367_10057257 | 3300006178 | Bacteria | 2318 |
| 252 | Ga0075367_10070419 | 3300006178 | Bacteria | 2102 |
| 253 | Ga0075367_10189341 | 3300006178 | Bacteria | 1284 |
| 254 | Ga0075367_10266956 | 3300006178 | Bacteria | 1075 |
| 255 | Ga0075367_10475074 | 3300006178 | Bacteria | 792 |
| 256 | Ga0075369_10091204 | 3300006186 | Bacteria | 1360 |
| 257 | Ga0075366_10009393 | 3300006195 | Bacteria | 5459 |
| 258 | Ga0075366_10052816 | 3300006195 | Bacteria | 2414 |
| 259 | Ga0075366_10061096 | 3300006195 | Bacteria | 2239 |
| 260 | Ga0075366_10338233 | 3300006195 | Bacteria | 923 |
| 261 | Ga0097621_100113883 | 3300006237 | Bacteria | 2287 |
| 262 | Ga0097621_100350295 | 3300006237 | Bacteria | 1313 |
| 263 | Ga0075370_10002181 | 3300006353 | Bacteria | 8986 |
| 264 | Ga0075370_10012926 | 3300006353 | Bacteria | 4425 |
| 265 | Ga0075370_10013329 | 3300006353 | Bacteria | 4365 |
| 266 | Ga0075370_10163258 | 3300006353 | Bacteria | 1308 |
| 267 | Ga0075370_10605547 | 3300006353 | Bacteria | 664 |
| 268 | Ga0068871_100222846 | 3300006358 | Bacteria | 1635 |
| 269 | Ga0068871_100252542 | 3300006358 | Bacteria | 1536 |
| 270 | Ga0068871_100427329 | 3300006358 | Bacteria | 1184 |
| 271 | Ga0068871_100433588 | 3300006358 | Bacteria | 1175 |
| 272 | Ga0068871_100843462 | 3300006358 | Bacteria | 847 |
| 273 | Ga0068871_100863105 | 3300006358 | Bacteria | 837 |
| 274 | Ga0075428_100017272 | 3300006844 | Bacteria | 7973 |
| 275 | Ga0075428_100502573 | 3300006844 | Bacteria | 1297 |
| 276 | Ga0075428_101493254 | 3300006844 | Bacteria | 708 |
| 277 | Ga0075430_100028642 | 3300006846 | Bacteria | 4731 |
| 278 | Ga0075430_100156406 | 3300006846 | Bacteria | 1898 |
| 279 | Ga0075430_100690990 | 3300006846 | Bacteria | 841 |
| 280 | Ga0075431_100043836 | 3300006847 | Bacteria | 4614 |
| 281 | Ga0075431_100271134 | 3300006847 | Bacteria | 1720 |
| 282 | Ga0075431_100379509 | 3300006847 | Bacteria | 1418 |
| 283 | Ga0075433_10058338 | 3300006852 | Bacteria | 3376 |
| 284 | Ga0075433_10191017 | 3300006852 | Bacteria | 1822 |
| 285 | Ga0075433_11119736 | 3300006852 | Bacteria | 684 |
| 286 | Ga0075434_100015294 | 3300006871 | Bacteria | 7354 |
| 287 | Ga0075434_100049816 | 3300006871 | Bacteria | 4160 |
| 288 | Ga0075434_100454676 | 3300006871 | Bacteria | 1302 |
| 289 | Ga0075434_100661105 | 3300006871 | Bacteria | 1063 |
| 290 | Ga0075434_100706109 | 3300006871 | Bacteria | 1026 |
| 291 | Ga0075429_100237703 | 3300006880 | Bacteria | 1596 |
| 292 | Ga0068865_100001272 | 3300006881 | Bacteria | 14683 |
| 293 | Ga0068865_100452620 | 3300006881 | Bacteria | 1062 |
| 294 | Ga0068865_100787492 | 3300006881 | Bacteria | 819 |
| 295 | Ga0075436_100188202 | 3300006914 | Bacteria | 1460 |
| 296 | Ga0097620_100005606 | 3300006931 | Bacteria | 12793 |
| 297 | Ga0097620_100071915 | 3300006931 | Bacteria | 3494 |
| 298 | Ga0097620_100239042 | 3300006931 | Bacteria | 1905 |
| 299 | Ga0075435_100014528 | 3300007076 | Bacteria | 5889 |
| 300 | Ga0075435_100552806 | 3300007076 | Bacteria | 997 |
| 301 | Ga0099794_10353221 | 3300007265 | Bacteria | 765 |
| 302 | Ga0105240_10103772 | 3300009093 | Bacteria | 3453 |
| 303 | Ga0105240_10990527 | 3300009093 | Unclassified | 899 |
| 304 | Ga0111539_10003504 | 3300009094 | Bacteria | 20691 |
| 305 | Ga0111539_10022534 | 3300009094 | Bacteria | 7737 |
| 306 | Ga0111539_10042358 | 3300009094 | Bacteria | 5468 |
| 307 | Ga0111539_10049952 | 3300009094 | Bacteria | 4984 |
| 308 | Ga0111539_10257027 | 3300009094 | Unclassified | 2034 |
| 309 | Ga0105245_10493826 | 3300009098 | Bacteria | 1239 |
| 310 | Ga0105245_10807139 | 3300009098 | Bacteria | 977 |
| 311 | Ga0105247_10227955 | 3300009101 | Bacteria | 1264 |
| 312 | Ga0105247_10344493 | 3300009101 | Bacteria | 1046 |
| 313 | Ga0105247_10680063 | 3300009101 | Bacteria | 772 |
| 314 | Ga0114129_10119779 | 3300009147 | Bacteria | 3625 |
| 315 | Ga0114129_10436978 | 3300009147 | Unclassified | 1719 |
| 316 | Ga0114129_11108676 | 3300009147 | Bacteria | 990 |
| 317 | Ga0105243_10526630 | 3300009148 | Bacteria | 1125 |
| 318 | Ga0105243_10808955 | 3300009148 | Bacteria | 924 |
| 319 | Ga0105243_10990212 | 3300009148 | Bacteria | 842 |
| 320 | Ga0105243_11401465 | 3300009148 | Bacteria | 719 |
| 321 | Ga0105241_10040133 | 3300009174 | Bacteria | 3533 |
| 322 | Ga0105241_10073261 | 3300009174 | Unclassified | 2664 |
| 323 | Ga0105241_10194450 | 3300009174 | Bacteria | 1690 |
| 324 | Ga0105241_10966345 | 3300009174 | Bacteria | 795 |
| 325 | Ga0105241_10999164 | 3300009174 | Unclassified | 783 |
| 326 | Ga0105241_11228106 | 3300009174 | Bacteria | 711 |
| 327 | Ga0105242_10169898 | 3300009176 | Bacteria | 1915 |
| 328 | Ga0105242_10727088 | 3300009176 | Bacteria | 974 |
| 329 | Ga0105242_11268987 | 3300009176 | Bacteria | 759 |
| 330 | Ga0105242_11325761 | 3300009176 | Bacteria | 744 |
| 331 | Ga0105242_11934108 | 3300009176 | Bacteria | 631 |
| 332 | Ga0105248_10001957 | 3300009177 | Bacteria | 22903 |
| 333 | Ga0105248_10022278 | 3300009177 | Bacteria | 7024 |
| 334 | Ga0105248_10059986 | 3300009177 | Bacteria | 4272 |
| 335 | Ga0105248_10112372 | 3300009177 | Bacteria | 3072 |
| 336 | Ga0105248_10119519 | 3300009177 | Bacteria | 2972 |
| 337 | Ga0105248_10119532 | 3300009177 | Bacteria | 2972 |
| 338 | Ga0105248_10218137 | 3300009177 | Bacteria | 2148 |
| 339 | Ga0105248_10376167 | 3300009177 | Bacteria | 1599 |
| 340 | Ga0105248_10512838 | 3300009177 | Bacteria | 1352 |
| 341 | Ga0105248_11035499 | 3300009177 | Bacteria | 927 |
| 342 | Ga0105248_11368471 | 3300009177 | Bacteria | 801 |
| 343 | Ga0105237_10083727 | 3300009545 | Bacteria | 3180 |
| 344 | Ga0105237_10109525 | 3300009545 | Bacteria | 2754 |
| 345 | Ga0105237_10432546 | 3300009545 | Bacteria | 1322 |
| 346 | Ga0105237_11023447 | 3300009545 | Bacteria | 833 |
| 347 | Ga0105237_11173966 | 3300009545 | Bacteria | 774 |
| 348 | Ga0105237_11227813 | 3300009545 | Bacteria | 756 |
| 349 | Ga0105238_10111151 | 3300009551 | Bacteria | 2721 |
| 350 | Ga0105238_10116908 | 3300009551 | Bacteria | 2647 |
| 351 | Ga0105238_10393550 | 3300009551 | Bacteria | 1378 |
| 352 | Ga0105249_10045948 | 3300009553 | Bacteria | 3973 |
| 353 | Ga0105249_10220242 | 3300009553 | Bacteria | 1867 |
| 354 | Ga0105249_10313282 | 3300009553 | Bacteria | 1578 |
| 355 | Ga0105239_10018055 | 3300010375 | Bacteria | 7803 |
| 356 | Ga0105239_10029804 | 3300010375 | Bacteria | 6000 |
| 357 | Ga0105239_10313205 | 3300010375 | Bacteria | 1769 |
| 358 | Ga0105239_10424038 | 3300010375 | Bacteria | 1507 |
| 359 | Ga0105239_11023041 | 3300010375 | Bacteria | 950 |
| 360 | Ga0105246_10268324 | 3300011119 | Bacteria | 1363 |
| 361 | Ga0105246_10836704 | 3300011119 | Bacteria | 820 |
| 362 | Ga0157373_10283330 | 3300013100 | Bacteria | 1175 |
| 363 | Ga0157370_10314544 | 3300013104 | Bacteria | 1445 |
| 364 | Ga0157370_10728599 | 3300013104 | Bacteria | 904 |
| 365 | Ga0157369_10072655 | 3300013105 | Bacteria | 3692 |
| 366 | Ga0157369_10523991 | 3300013105 | Bacteria | 1226 |
| 367 | Ga0157369_10901694 | 3300013105 | Bacteria | 907 |
| 368 | Ga0157369_10970687 | 3300013105 | Bacteria | 870 |
| 369 | Ga0157374_10031830 | 3300013296 | Viruses | 4798 |
| 370 | Ga0157374_10060993 | 3300013296 | Bacteria | 3531 |
| 371 | Ga0157374_10100534 | 3300013296 | Bacteria | 2772 |
| 372 | Ga0157374_10212883 | 3300013296 | Bacteria | 1895 |
| 373 | Ga0157374_10861698 | 3300013296 | Bacteria | 923 |
| 374 | Ga0157378_10326093 | 3300013297 | Bacteria | 1493 |
| 375 | Ga0157378_10447392 | 3300013297 | Bacteria | 1281 |
| 376 | Ga0157378_12257621 | 3300013297 | Bacteria | 596 |
| 377 | Ga0163162_10033581 | 3300013306 | Bacteria | 5099 |
| 378 | Ga0163162_10238432 | 3300013306 | Bacteria | 1949 |
| 379 | Ga0163162_10309085 | 3300013306 | Bacteria | 1713 |
| 380 | Ga0163162_10542850 | 3300013306 | Bacteria | 1291 |
| 381 | Ga0163162_10804837 | 3300013306 | Bacteria | 1057 |
| 382 | Ga0163162_10918316 | 3300013306 | Bacteria | 988 |
| 383 | Ga0163162_10937522 | 3300013306 | Bacteria | 977 |
| 384 | Ga0163162_11439754 | 3300013306 | Bacteria | 784 |
| 385 | Ga0163162_11563681 | 3300013306 | Bacteria | 752 |
| 386 | Ga0157372_10019830 | 3300013307 | Bacteria | 7246 |
| 387 | Ga0157372_10060434 | 3300013307 | Bacteria | 4241 |
| 388 | Ga0157372_10090692 | 3300013307 | Bacteria | 3475 |
| 389 | Ga0157372_10194122 | 3300013307 | Bacteria | 2352 |
| 390 | Ga0157372_10292483 | 3300013307 | Bacteria | 1894 |
| 391 | Ga0157372_11037586 | 3300013307 | Unclassified | 949 |
| 392 | Ga0157372_11515434 | 3300013307 | Bacteria | 772 |
| 393 | Ga0157375_10079664 | 3300013308 | Bacteria | 3312 |
| 394 | Ga0157375_10263607 | 3300013308 | Bacteria | 1885 |
| 395 | Ga0157375_11207821 | 3300013308 | Bacteria | 887 |
| 396 | Ga0157375_11657834 | 3300013308 | Bacteria | 757 |
| 397 | Ga0163163_10074915 | 3300014325 | Bacteria | 3378 |
| 398 | Ga0163163_10090395 | 3300014325 | Bacteria | 3075 |
| 399 | Ga0163163_10096115 | 3300014325 | Bacteria | 2983 |
| 400 | Ga0163163_10290728 | 3300014325 | Bacteria | 1686 |
| 401 | Ga0163163_10752752 | 3300014325 | Bacteria | 1038 |
| 402 | Ga0163163_10795224 | 3300014325 | Bacteria | 1009 |
| 403 | Ga0163163_10863915 | 3300014325 | Bacteria | 968 |
| 404 | Ga0157380_10019554 | 3300014326 | Bacteria | 5048 |
| 405 | Ga0157380_10099011 | 3300014326 | Bacteria | 2424 |
| 406 | Ga0157380_10414949 | 3300014326 | Bacteria | 1282 |
| 407 | Ga0157380_10545998 | 3300014326 | Unclassified | 1136 |
| 408 | Ga0157380_10742204 | 3300014326 | Bacteria | 992 |
| 409 | Ga0157380_11238853 | 3300014326 | Bacteria | 791 |
| 410 | Ga0157380_11332854 | 3300014326 | Bacteria | 766 |
| 411 | Ga0157377_10131636 | 3300014745 | Bacteria | 1528 |
| 412 | Ga0157377_10246367 | 3300014745 | Bacteria | 1156 |
| 413 | Ga0157379_10027114 | 3300014968 | Bacteria | 5099 |
| 414 | Ga0157379_10947718 | 3300014968 | Bacteria | 818 |
| 415 | Ga0157379_11238136 | 3300014968 | Bacteria | 719 |
| 416 | Ga0157376_10835963 | 3300014969 | Bacteria | 935 |
| 417 | Ga0157376_10870292 | 3300014969 | Bacteria | 917 |
| 418 | Ga0163161_10576125 | 3300017792 | Bacteria | 925 |
| 419 | Ga0163161_10758443 | 3300017792 | Bacteria | 812 |
| 420 | Ga0163161_10967278 | 3300017792 | Bacteria | 725 |
| 421 | Ga0197907_10250064 | 3300020069 | Bacteria | 1621 |
| 422 | Ga0206356_10835401 | 3300020070 | Bacteria | 3665 |
| 423 | Ga0206352_11263230 | 3300020078 | Bacteria | 875 |
| 424 | Ga0206350_10254172 | 3300020080 | Bacteria | 788 |
| 425 | Ga0154015_1216348 | 3300020610 | Bacteria | 799 |
| 426 | Ga0213876_10069700 | 3300021384 | Bacteria | 1857 |
| 427 | Ga0213875_10004794 | 3300021388 | Bacteria | 7352 |
| 428 | Ga0209646_1005277 | 3300025246 | Bacteria | 2270 |
| 429 | Ga0209026_1001118 | 3300025250 | Bacteria | 12743 |
| 430 | Ga0209759_1001219 | 3300025256 | Bacteria | 15749 |
| 431 | Ga0209050_1065246 | 3300025298 | Bacteria | 839 |
| 432 | Ga0209051_1000772 | 3300025303 | Bacteria | 33982 |
| 433 | Ga0209051_1023639 | 3300025303 | Bacteria | 2549 |
| 434 | Ga0209051_1024759 | 3300025303 | Bacteria | 2460 |
| 435 | Ga0207697_10226645 | 3300025315 | Bacteria | 825 |
| 436 | Ga0207656_10099209 | 3300025321 | Bacteria | 1333 |
| 437 | Ga0207682_10000542 | 3300025893 | Bacteria | 17400 |
| 438 | Ga0207692_10000651 | 3300025898 | Bacteria | 12233 |
| 439 | Ga0207692_10140432 | 3300025898 | Bacteria | 1374 |
| 440 | Ga0207692_10456028 | 3300025898 | Bacteria | 805 |
| 441 | Ga0207692_10599884 | 3300025898 | Bacteria | 708 |
| 442 | Ga0207692_10804841 | 3300025898 | Bacteria | 615 |
| 443 | Ga0207710_10074763 | 3300025900 | Bacteria | 1560 |
| 444 | Ga0207688_10038134 | 3300025901 | Bacteria | 2666 |
| 445 | Ga0207680_10123163 | 3300025903 | Bacteria | 1699 |
| 446 | Ga0207680_10462627 | 3300025903 | Bacteria | 901 |
| 447 | Ga0207647_10020107 | 3300025904 | Bacteria | 4482 |
| 448 | Ga0207647_10620308 | 3300025904 | Bacteria | 595 |
| 449 | Ga0207647_10623765 | 3300025904 | Bacteria | 593 |
| 450 | Ga0207699_10000194 | 3300025906 | Bacteria | 36380 |
| 451 | Ga0207645_10112689 | 3300025907 | Bacteria | 1762 |
| 452 | Ga0207705_10053688 | 3300025909 | Bacteria | 2904 |
| 453 | Ga0207705_10055357 | 3300025909 | Bacteria | 2860 |
| 454 | Ga0207654_10048227 | 3300025911 | Unclassified | 2436 |
| 455 | Ga0207654_10114069 | 3300025911 | Bacteria | 1686 |
| 456 | Ga0207654_10159068 | 3300025911 | Bacteria | 1457 |
| 457 | Ga0207654_10599717 | 3300025911 | Unclassified | 786 |
| 458 | Ga0207654_11145552 | 3300025911 | Bacteria | 567 |
| 459 | Ga0207707_10063588 | 3300025912 | Bacteria | 3212 |
| 460 | Ga0207707_10140082 | 3300025912 | Bacteria | 2115 |
| 461 | Ga0207707_10247833 | 3300025912 | Bacteria | 1548 |
| 462 | Ga0207695_10936018 | 3300025913 | Bacteria | 746 |
| 463 | Ga0207671_10193280 | 3300025914 | Bacteria | 1587 |
| 464 | Ga0207671_10687608 | 3300025914 | Bacteria | 814 |
| 465 | Ga0207671_10771588 | 3300025914 | Bacteria | 763 |
| 466 | Ga0207693_10043037 | 3300025915 | Bacteria | 3555 |
| 467 | Ga0207693_10320999 | 3300025915 | Bacteria | 1212 |
| 468 | Ga0207663_10003668 | 3300025916 | Bacteria | 7547 |
| 469 | Ga0207663_10421442 | 3300025916 | Bacteria | 1025 |
| 470 | Ga0207663_10726502 | 3300025916 | Unclassified | 788 |
| 471 | Ga0207663_10905286 | 3300025916 | Bacteria | 705 |
| 472 | Ga0207660_10024051 | 3300025917 | Bacteria | 4120 |
| 473 | Ga0207660_10026227 | 3300025917 | Bacteria | 3967 |
| 474 | Ga0207660_10389556 | 3300025917 | Bacteria | 1121 |
| 475 | Ga0207660_10418892 | 3300025917 | Bacteria | 1080 |
| 476 | Ga0207662_10119875 | 3300025918 | Bacteria | 1649 |
| 477 | Ga0207657_10000952 | 3300025919 | Bacteria | 30667 |
| 478 | Ga0207657_10505653 | 3300025919 | Unclassified | 946 |
| 479 | Ga0207657_10508960 | 3300025919 | Bacteria | 943 |
| 480 | Ga0207649_10316650 | 3300025920 | Bacteria | 1145 |
| 481 | Ga0207649_11248938 | 3300025920 | Unclassified | 587 |
| 482 | Ga0207652_10002763 | 3300025921 | Bacteria | 14740 |
| 483 | Ga0207652_10099865 | 3300025921 | Bacteria | 2561 |
| 484 | Ga0207652_10416559 | 3300025921 | Bacteria | 1212 |
| 485 | Ga0207646_10011382 | 3300025922 | Bacteria | 8628 |
| 486 | Ga0207646_10117032 | 3300025922 | Bacteria | 2394 |
| 487 | Ga0207681_10206063 | 3300025923 | Bacteria | 1513 |
| 488 | Ga0207681_10226090 | 3300025923 | Bacteria | 1450 |
| 489 | Ga0207681_10974220 | 3300025923 | Bacteria | 711 |
| 490 | Ga0207694_10001305 | 3300025924 | Bacteria | 21455 |
| 491 | Ga0207694_10272448 | 3300025924 | Bacteria | 1389 |
| 492 | Ga0207694_10332518 | 3300025924 | Bacteria | 1255 |
| 493 | Ga0207650_10036850 | 3300025925 | Bacteria | 3560 |
| 494 | Ga0207650_10779971 | 3300025925 | Bacteria | 810 |
| 495 | Ga0207650_10782575 | 3300025925 | Bacteria | 808 |
| 496 | Ga0207650_10934191 | 3300025925 | Bacteria | 737 |
| 497 | Ga0207659_10070253 | 3300025926 | Bacteria | 2553 |
| 498 | Ga0207659_10074883 | 3300025926 | Bacteria | 2482 |
| 499 | Ga0207659_11268183 | 3300025926 | Bacteria | 633 |
| 500 | Ga0207687_10516820 | 3300025927 | Bacteria | 998 |
| 501 | Ga0207687_11090538 | 3300025927 | Bacteria | 686 |
| 502 | Ga0207700_10074521 | 3300025928 | Bacteria | 2626 |
| 503 | Ga0207700_10089288 | 3300025928 | Bacteria | 2429 |
| 504 | Ga0207700_10249808 | 3300025928 | Bacteria | 1515 |
| 505 | Ga0207700_11142953 | 3300025928 | Bacteria | 696 |
| 506 | Ga0207664_10778060 | 3300025929 | Unclassified | 861 |
| 507 | Ga0207664_10791670 | 3300025929 | Bacteria | 853 |
| 508 | Ga0207644_10033525 | 3300025931 | Bacteria | 3589 |
| 509 | Ga0207644_10067322 | 3300025931 | Bacteria | 2610 |
| 510 | Ga0207644_10160307 | 3300025931 | Bacteria | 1748 |
| 511 | Ga0207644_10832476 | 3300025931 | Bacteria | 772 |
| 512 | Ga0207690_10057850 | 3300025932 | Bacteria | 2621 |
| 513 | Ga0207690_10232272 | 3300025932 | Bacteria | 1417 |
| 514 | Ga0207706_10000849 | 3300025933 | Bacteria | 31433 |
| 515 | Ga0207706_10015018 | 3300025933 | Bacteria | 7012 |
| 516 | Ga0207706_10187810 | 3300025933 | Bacteria | 1814 |
| 517 | Ga0207706_10194881 | 3300025933 | Bacteria | 1777 |
| 518 | Ga0207706_10633837 | 3300025933 | Unclassified | 916 |
| 519 | Ga0207706_10934419 | 3300025933 | Bacteria | 731 |
| 520 | Ga0207686_10962600 | 3300025934 | Bacteria | 691 |
| 521 | Ga0207709_10317752 | 3300025935 | Bacteria | 1164 |
| 522 | Ga0207709_10462752 | 3300025935 | Bacteria | 982 |
| 523 | Ga0207670_10000448 | 3300025936 | Bacteria | 23148 |
| 524 | Ga0207669_10019579 | 3300025937 | Bacteria | 3528 |
| 525 | Ga0207704_10000435 | 3300025938 | Bacteria | 18647 |
| 526 | Ga0207704_10340450 | 3300025938 | Bacteria | 1164 |
| 527 | Ga0207704_10872519 | 3300025938 | Bacteria | 755 |
| 528 | Ga0207704_11320302 | 3300025938 | Bacteria | 617 |
| 529 | Ga0207665_10021480 | 3300025939 | Bacteria | 4245 |
| 530 | Ga0207665_10054108 | 3300025939 | Bacteria | 2706 |
| 531 | Ga0207665_10240803 | 3300025939 | Bacteria | 1333 |
| 532 | Ga0207665_10493483 | 3300025939 | Bacteria | 945 |
| 533 | Ga0207691_10004521 | 3300025940 | Bacteria | 13455 |
| 534 | Ga0207691_10230530 | 3300025940 | Bacteria | 1604 |
| 535 | Ga0207691_10720325 | 3300025940 | Bacteria | 841 |
| 536 | Ga0207711_10001596 | 3300025941 | Bacteria | 20956 |
| 537 | Ga0207711_10030078 | 3300025941 | Bacteria | 4580 |
| 538 | Ga0207711_10156249 | 3300025941 | Bacteria | 2061 |
| 539 | Ga0207711_10239513 | 3300025941 | Bacteria | 1663 |
| 540 | Ga0207711_10245493 | 3300025941 | Bacteria | 1643 |
| 541 | Ga0207711_10329176 | 3300025941 | Bacteria | 1413 |
| 542 | Ga0207711_10399407 | 3300025941 | Bacteria | 1277 |
| 543 | Ga0207711_10754049 | 3300025941 | Bacteria | 907 |
| 544 | Ga0207689_10268342 | 3300025942 | Bacteria | 1413 |
| 545 | Ga0207661_10186781 | 3300025944 | Bacteria | 1814 |
| 546 | Ga0207661_10705911 | 3300025944 | Bacteria | 928 |
| 547 | Ga0207661_11073606 | 3300025944 | Bacteria | 741 |
| 548 | Ga0207661_11252047 | 3300025944 | Bacteria | 682 |
| 549 | Ga0207661_11282534 | 3300025944 | Bacteria | 673 |
| 550 | Ga0207679_10032054 | 3300025945 | Bacteria | 3685 |
| 551 | Ga0207679_10275799 | 3300025945 | Bacteria | 1440 |
| 552 | Ga0207679_10392247 | 3300025945 | Bacteria | 1219 |
| 553 | Ga0207679_10685209 | 3300025945 | Bacteria | 929 |
| 554 | Ga0207667_10227574 | 3300025949 | Bacteria | 1910 |
| 555 | Ga0207667_10416537 | 3300025949 | Bacteria | 1367 |
| 556 | Ga0207667_10670620 | 3300025949 | Bacteria | 1041 |
| 557 | Ga0207667_10844423 | 3300025949 | Bacteria | 910 |
| 558 | Ga0207712_10217066 | 3300025961 | Bacteria | 1527 |
| 559 | Ga0207712_10279948 | 3300025961 | Bacteria | 1361 |
| 560 | Ga0207712_10511435 | 3300025961 | Bacteria | 1028 |
| 561 | Ga0207712_11142392 | 3300025961 | Bacteria | 694 |
| 562 | Ga0207668_10002784 | 3300025972 | Bacteria | 10220 |
| 563 | Ga0207668_10033380 | 3300025972 | Bacteria | 3409 |
| 564 | Ga0207668_10428850 | 3300025972 | Bacteria | 1124 |
| 565 | Ga0207668_10642862 | 3300025972 | Bacteria | 928 |
| 566 | Ga0207668_10690681 | 3300025972 | Bacteria | 896 |
| 567 | Ga0207668_10802545 | 3300025972 | Bacteria | 833 |
| 568 | Ga0207640_10241540 | 3300025981 | Bacteria | 1396 |
| 569 | Ga0207640_10612802 | 3300025981 | Bacteria | 923 |
| 570 | Ga0207640_10897843 | 3300025981 | Bacteria | 774 |
| 571 | Ga0207677_10000069 | 3300026023 | Bacteria | 85177 |
| 572 | Ga0207677_10642603 | 3300026023 | Bacteria | 936 |
| 573 | Ga0207703_10270090 | 3300026035 | Bacteria | 1540 |
| 574 | Ga0207703_10558340 | 3300026035 | Bacteria | 1080 |
| 575 | Ga0207703_10853474 | 3300026035 | Bacteria | 871 |
| 576 | Ga0207639_10000936 | 3300026041 | Bacteria | 19751 |
| 577 | Ga0207639_10044506 | 3300026041 | Bacteria | 3339 |
| 578 | Ga0207639_10253489 | 3300026041 | Bacteria | 1536 |
| 579 | Ga0207639_10418932 | 3300026041 | Bacteria | 1210 |
| 580 | Ga0207639_10595617 | 3300026041 | Bacteria | 1019 |
| 581 | Ga0207639_10620402 | 3300026041 | Bacteria | 998 |
| 582 | Ga0207639_10930015 | 3300026041 | Bacteria | 813 |
| 583 | Ga0207678_10034267 | 3300026067 | Bacteria | 4422 |
| 584 | Ga0207678_10145742 | 3300026067 | Bacteria | 2021 |
| 585 | Ga0207678_10347643 | 3300026067 | Bacteria | 1279 |
| 586 | Ga0207678_10530678 | 3300026067 | Bacteria | 1028 |
| 587 | Ga0207708_10182093 | 3300026075 | Bacteria | 1668 |
| 588 | Ga0207708_10782379 | 3300026075 | Bacteria | 820 |
| 589 | Ga0207702_10097679 | 3300026078 | Bacteria | 2585 |
| 590 | Ga0207702_10136729 | 3300026078 | Bacteria | 2212 |
| 591 | Ga0207702_10363357 | 3300026078 | Bacteria | 1388 |
| 592 | Ga0207702_10990215 | 3300026078 | Bacteria | 834 |
| 593 | Ga0207641_10046055 | 3300026088 | Bacteria | 3676 |
| 594 | Ga0207641_10098214 | 3300026088 | Bacteria | 2575 |
| 595 | Ga0207641_10166814 | 3300026088 | Bacteria | 2006 |
| 596 | Ga0207641_10420196 | 3300026088 | Bacteria | 1287 |
| 597 | Ga0207641_10949849 | 3300026088 | Bacteria | 855 |
| 598 | Ga0207641_11359649 | 3300026088 | Bacteria | 711 |
| 599 | Ga0207641_11616182 | 3300026088 | Bacteria | 650 |
| 600 | Ga0207641_12019031 | 3300026088 | Bacteria | 578 |
| 601 | Ga0207648_10853437 | 3300026089 | Bacteria | 849 |
| 602 | Ga0207648_11682561 | 3300026089 | Bacteria | 596 |
| 603 | Ga0207676_10002300 | 3300026095 | Bacteria | 13708 |
| 604 | Ga0207676_10010779 | 3300026095 | Bacteria | 6520 |
| 605 | Ga0207676_10066825 | 3300026095 | Bacteria | 2869 |
| 606 | Ga0207676_10168228 | 3300026095 | Bacteria | 1907 |
| 607 | Ga0207676_10637500 | 3300026095 | Bacteria | 1027 |
| 608 | Ga0207674_10006167 | 3300026116 | Bacteria | 14153 |
| 609 | Ga0207674_10011453 | 3300026116 | Bacteria | 9965 |
| 610 | Ga0207674_10253498 | 3300026116 | Bacteria | 1707 |
| 611 | Ga0207674_10518147 | 3300026116 | Bacteria | 1152 |
| 612 | Ga0207674_10705282 | 3300026116 | Bacteria | 974 |
| 613 | Ga0207675_100259286 | 3300026118 | Bacteria | 1684 |
| 614 | Ga0207675_100410990 | 3300026118 | Unclassified | 1335 |
| 615 | Ga0207675_100820356 | 3300026118 | Bacteria | 944 |
| 616 | Ga0207683_10046102 | 3300026121 | Bacteria | 3813 |
| 617 | Ga0207683_10065177 | 3300026121 | Bacteria | 3211 |
| 618 | Ga0207683_10190797 | 3300026121 | Bacteria | 1860 |
| 619 | Ga0207683_10197404 | 3300026121 | Bacteria | 1828 |
| 620 | Ga0207683_10209690 | 3300026121 | Bacteria | 1773 |
| 621 | Ga0207683_10599503 | 3300026121 | Bacteria | 1019 |
| 622 | Ga0207698_10181741 | 3300026142 | Bacteria | 1864 |
| 623 | Ga0207698_10501225 | 3300026142 | Bacteria | 1182 |
| 624 | Ga0207698_10994659 | 3300026142 | Bacteria | 849 |
| 625 | Ga0207698_11084122 | 3300026142 | Bacteria | 813 |
| 626 | Ga0209588_1201530 | 3300027671 | Bacteria | 620 |
| 627 | Ga0209813_10015168 | 3300027866 | Bacteria | 2083 |
| 628 | Ga0209813_10016619 | 3300027866 | Bacteria | 2010 |
| 629 | Ga0209813_10034278 | 3300027866 | Bacteria | 1514 |
| 630 | Ga0207428_10015869 | 3300027907 | Bacteria | 6498 |
| 631 | Ga0207428_10190787 | 3300027907 | Bacteria | 1545 |
| 632 | Ga0207428_10236053 | 3300027907 | Bacteria | 1367 |
| 633 | Ga0207428_10360977 | 3300027907 | Bacteria | 1068 |
| 634 | Ga0268266_10033801 | 3300028379 | Bacteria | 4346 |
| 635 | Ga0268266_10294203 | 3300028379 | Bacteria | 1513 |
| 636 | Ga0268265_10009031 | 3300028380 | Bacteria | 6741 |
| 637 | Ga0268265_10060507 | 3300028380 | Bacteria | 2903 |
| 638 | Ga0268265_10198244 | 3300028380 | Bacteria | 1739 |
| 639 | Ga0268265_11116452 | 3300028380 | Bacteria | 783 |
| 640 | Ga0268264_10035100 | 3300028381 | Bacteria | 4129 |
| 641 | Ga0268264_10768508 | 3300028381 | Bacteria | 961 |
| 642 | Ga0268264_10942713 | 3300028381 | Bacteria | 868 |
| 643 | Ga0268264_11011008 | 3300028381 | Bacteria | 838 |
| 644 | Ga0265334_10003926 | 3300028573 | Bacteria | 6697 |
| 645 | Ga0265318_10000016 | 3300028577 | Bacteria | 184782 |
| 646 | Ga0307515_10086670 | 3300028794 | Bacteria | 3988 |
| 647 | Ga0307515_10463390 | 3300028794 | Bacteria | 881 |
| 648 | Ga0265338_10189069 | 3300028800 | Bacteria | 1562 |
| 649 | Ga0265338_10814281 | 3300028800 | Bacteria | 639 |
| 650 | Ga0265324_10013329 | 3300029957 | Bacteria | 3070 |
| 651 | Ga0265767_108251 | 3300030836 | Bacteria | 674 |
| 652 | Ga0265332_10030665 | 3300031238 | Bacteria | 2348 |
| 653 | Ga0265328_10000019 | 3300031239 | Bacteria | 130536 |
| 654 | Ga0265328_10007021 | 3300031239 | Bacteria | 4723 |
| 655 | Ga0265320_10003281 | 3300031240 | Bacteria | 10923 |
| 656 | Ga0265339_10382783 | 3300031249 | Bacteria | 659 |
| 657 | Ga0265331_10025888 | 3300031250 | Bacteria | 2957 |
| 658 | Ga0265316_10110709 | 3300031344 | Bacteria | 2079 |
| 659 | Ga0265316_10939340 | 3300031344 | Bacteria | 603 |
| 660 | Ga0307513_10084886 | 3300031456 | Bacteria | 3251 |
| 661 | Ga0307513_10127195 | 3300031456 | Bacteria | 2501 |
| 662 | Ga0307408_100008603 | 3300031548 | Bacteria | 6740 |
| 663 | Ga0307408_100042714 | 3300031548 | Bacteria | 3222 |
| 664 | Ga0307408_100106374 | 3300031548 | Bacteria | 2146 |
| 665 | Ga0307408_100111336 | 3300031548 | Bacteria | 2103 |
| 666 | Ga0307408_100144442 | 3300031548 | Bacteria | 1871 |
| 667 | Ga0307408_100336488 | 3300031548 | Bacteria | 1276 |
| 668 | Ga0265313_10002768 | 3300031595 | Bacteria | 14786 |
| 669 | Ga0307508_10096487 | 3300031616 | Bacteria | 2548 |
| 670 | Ga0307508_10323461 | 3300031616 | Bacteria | 1134 |
| 671 | Ga0316579_10013022 | 3300031691 | Bacteria | 3573 |
| 672 | Ga0265314_10000596 | 3300031711 | Bacteria | 45506 |
| 673 | Ga0316576_10348290 | 3300031727 | Bacteria | 1102 |
| 674 | Ga0316578_10052128 | 3300031728 | Bacteria | 2397 |
| 675 | Ga0316578_10124084 | 3300031728 | Bacteria | 1553 |
| 676 | Ga0307516_10002446 | 3300031730 | Bacteria | 24850 |
| 677 | Ga0307516_10008341 | 3300031730 | Bacteria | 11744 |
| 678 | Ga0307516_10009998 | 3300031730 | Bacteria | 10504 |
| 679 | Ga0307516_10420643 | 3300031730 | Bacteria | 994 |
| 680 | Ga0307405_10003502 | 3300031731 | Bacteria | 7225 |
| 681 | Ga0307405_10084737 | 3300031731 | Bacteria | 2081 |
| 682 | Ga0307405_10098809 | 3300031731 | Bacteria | 1952 |
| 683 | Ga0307405_10280897 | 3300031731 | Bacteria | 1253 |
| 684 | Ga0307413_10002867 | 3300031824 | Bacteria | 7116 |
| 685 | Ga0307413_10027727 | 3300031824 | Bacteria | 3144 |
| 686 | Ga0307413_10091708 | 3300031824 | Bacteria | 1980 |
| 687 | Ga0307413_10388108 | 3300031824 | Bacteria | 1090 |
| 688 | Ga0307410_10006693 | 3300031852 | Bacteria | 6242 |
| 689 | Ga0307410_10007880 | 3300031852 | Bacteria | 5867 |
| 690 | Ga0307410_10065252 | 3300031852 | Bacteria | 2504 |
| 691 | Ga0307410_10107092 | 3300031852 | Bacteria | 2016 |
| 692 | Ga0307410_10122219 | 3300031852 | Bacteria | 1900 |
| 693 | Ga0307410_10243065 | 3300031852 | Bacteria | 1396 |
| 694 | Ga0307410_10701516 | 3300031852 | Bacteria | 853 |
| 695 | Ga0307406_10003830 | 3300031901 | Bacteria | 8190 |
| 696 | Ga0307407_10001158 | 3300031903 | Bacteria | 9257 |
| 697 | Ga0307407_10034240 | 3300031903 | Bacteria | 2779 |
| 698 | Ga0307407_10397934 | 3300031903 | Bacteria | 987 |
| 699 | Ga0307412_10150729 | 3300031911 | Bacteria | 1715 |
| 700 | Ga0307412_10345644 | 3300031911 | Bacteria | 1192 |
| 701 | Ga0307412_10395974 | 3300031911 | Bacteria | 1123 |
| 702 | Ga0307412_10471288 | 3300031911 | Bacteria | 1039 |
| 703 | Ga0307409_100003996 | 3300031995 | Bacteria | 8179 |
| 704 | Ga0307409_100013589 | 3300031995 | Bacteria | 5250 |
| 705 | Ga0307409_100047015 | 3300031995 | Bacteria | 3271 |
| 706 | Ga0307409_100241018 | 3300031995 | Bacteria | 1646 |
| 707 | Ga0307409_100426045 | 3300031995 | Bacteria | 1274 |
| 708 | Ga0307409_100542967 | 3300031995 | Bacteria | 1140 |
| 709 | Ga0307416_100006864 | 3300032002 | Bacteria | 7164 |
| 710 | Ga0307416_100015598 | 3300032002 | Bacteria | 5253 |
| 711 | Ga0307416_100062445 | 3300032002 | Bacteria | 3046 |
| 712 | Ga0307416_100258211 | 3300032002 | Bacteria | 1701 |
| 713 | Ga0307416_100575719 | 3300032002 | Bacteria | 1202 |
| 714 | Ga0307416_101390618 | 3300032002 | Bacteria | 807 |
| 715 | Ga0307416_101558741 | 3300032002 | Unclassified | 766 |
| 716 | Ga0307414_10018888 | 3300032004 | Bacteria | 4259 |
| 717 | Ga0307414_10035853 | 3300032004 | Bacteria | 3305 |
| 718 | Ga0307414_10076263 | 3300032004 | Bacteria | 2436 |
| 719 | Ga0307411_10002709 | 3300032005 | Bacteria | 7943 |
| 720 | Ga0307411_10018142 | 3300032005 | Bacteria | 4030 |
| 721 | Ga0307411_10030603 | 3300032005 | Bacteria | 3301 |
| 722 | Ga0307411_10034726 | 3300032005 | Bacteria | 3141 |
| 723 | Ga0307411_10237776 | 3300032005 | Bacteria | 1424 |
| 724 | Ga0307411_10255728 | 3300032005 | Bacteria | 1380 |
| 725 | Ga0307411_11459179 | 3300032005 | Bacteria | 628 |
| 726 | Ga0307415_100055513 | 3300032126 | Bacteria | 2711 |
| 727 | Ga0307415_100067894 | 3300032126 | Bacteria | 2493 |
| 728 | Ga0307415_100118379 | 3300032126 | Bacteria | 1980 |
| 729 | Ga0307415_100121128 | 3300032126 | Bacteria | 1962 |
| 730 | Ga0307415_100267440 | 3300032126 | Bacteria | 1399 |
| 731 | Ga0307415_100489996 | 3300032126 | Bacteria | 1072 |
| 732 | Ga0373948_0108667 | 3300034817 | Bacteria | 660 |
| 733 | Ga0373923_0092188 | 3300035111 | Bacteria | 1326 |
| 734 | Ga0373936_0000302 | 3300035113 | Bacteria | 16524 |
| 735 | Ga0373939_0101425 | 3300035114 | Bacteria | 988 |
| 736 | Ga0373945_0004590 | 3300035116 | Bacteria | 4392 |
| 737 | Ga0373945_0141998 | 3300035116 | Bacteria | 969 |
| 738 | Ga0373953_0001387 | 3300035117 | Bacteria | 6968 |
| 739 | Ga0373954_0001462 | 3300035118 | Bacteria | 9600 |
| 740 | Ga0373956_0104761 | 3300035119 | Bacteria | 1314 |
| 741 | Ga0373956_0133312 | 3300035119 | Bacteria | 1164 |
| 742 | Ga0373956_0457155 | 3300035119 | Bacteria | 609 |
| 743 | Ga0373957_0001060 | 3300035120 | Bacteria | 7254 |
| 744 | Ga0373943_0096528 | 3300035170 | Bacteria | 1539 |
| 745 | Ga0373946_0001689 | 3300035171 | Bacteria | 7694 |
| 746 | Ga0373946_0386887 | 3300035171 | Bacteria | 704 |
| 747 | Ga0373955_0000030 | 3300035172 | Bacteria | 56889 |
| 748 | Ga0373955_0136641 | 3300035172 | Bacteria | 1434 |
| 749 | Ga0373962_0168592 | 3300035242 | Bacteria | 726 |
| 750 | Ga0316574_0130501 | 3300035398 | Bacteria | 1617 |
| 751 | Ga0373931_0007107 | 3300035691 | Bacteria | 5263 |
| 752 | Ga0373931_0315580 | 3300035691 | Bacteria | 969 |
| 753 | Ga0373935_0000187 | 3300035692 | Bacteria | 29255 |
| 754 | Ga0373935_0057356 | 3300035692 | Bacteria | 2484 |
| 755 | Ga0373935_0261567 | 3300035692 | Bacteria | 1214 |
| 756 | Ga0373927_0057722 | 3300035695 | Bacteria | 2510 |
| 757 | Ga0373927_0069442 | 3300035695 | Bacteria | 2280 |
| 758 | Ga0373927_0253441 | 3300035695 | Bacteria | 1157 |
| 759 | Ga0373933_0002169 | 3300035724 | Bacteria | 11234 |
| 760 | Ga0373933_0301542 | 3300035724 | Bacteria | 1037 |
| 761 | Ga0373947_0000376 | 3300035725 | Bacteria | 25253 |
| 762 | Ga0373947_0105686 | 3300035725 | Bacteria | 1774 |
| 763 | Ga0373947_0355314 | 3300035725 | Bacteria | 984 |
| 764 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 765 | Ga0373937_0155255 | 3300036401 | Bacteria | 2145 |
| 766 | Ga0373937_0413261 | 3300036401 | Bacteria | 1280 |
| 767 | Ga0373937_0490766 | 3300036401 | Bacteria | 1167 |
| 768 | Ga0316582_0038470 | 3300036647 | Bacteria | 2973 |
| 769 | Ga0316582_0256180 | 3300036647 | Bacteria | 1199 |
| 770 | Ga0316584_0285895 | 3300036712 | Bacteria | 1197 |
| 771 | Ga0373925_0000095 | 3300037068 | Bacteria | 95071 |
| 772 | Ga0373925_0040021 | 3300037068 | Bacteria | 3469 |
| 773 | Ga0373925_0179948 | 3300037068 | Bacteria | 1673 |
| 774 | Ga0373925_0364512 | 3300037068 | Bacteria | 1175 |
| 775 | Ga0373925_0533927 | 3300037068 | Bacteria | 964 |
| 776 | Ga0395899_0299799 | 3300037312 | Bacteria | 1088 |
| 777 | Ga0395898_0116607 | 3300037466 | Unclassified | 2559 |
| 778 | Ga0395898_0837125 | 3300037466 | Bacteria | 860 |
| 779 | Ga0395905_0124177 | 3300037471 | Bacteria | 2427 |
| 780 | Ga0395905_0252221 | 3300037471 | Bacteria | 1648 |
| 781 | Ga0316581_0002183 | 3300037588 | Bacteria | 4621 |
| 782 | Ga0316581_0014742 | 3300037588 | Bacteria | 2227 |
| 783 | Ga0436364_0093884 | 3300037853 | Bacteria | 7447 |
| 784 | Ga0395901_0000076 | 3300038443 | Bacteria | 138169 |
| 785 | Ga0395901_0261083 | 3300038443 | Bacteria | 1803 |
| 786 | Ga0395901_0602987 | 3300038443 | Bacteria | 1107 |
| 787 | Ga0395901_1170767 | 3300038443 | Bacteria | 736 |
| 788 | Ga0400490_48312 | 3300038726 | Bacteria | 4689 |
| 789 | Ga0400485_19896 | 3300038735 | Bacteria | 4174 |
| 790 | Ga0400488_62281 | 3300038741 | Bacteria | 5616 |
| 791 | Ga0400483_108538 | 3300039062 | Bacteria | 5326 |
| 792 | Ga0436365_0727857 | 3300039437 | Bacteria | 4779 |
| 793 | Ga0436365_0858454 | 3300039437 | Bacteria | 2893 |
| 794 | Ga0436365_1236325 | 3300039437 | Bacteria | 1675 |
| 795 | Ga0436363_0415220 | 3300039450 | Bacteria | 4051 |
| 796 | Ga0439436_0001347 | 3300041404 | Bacteria | 7065 |
| 797 | Ga0439436_0125249 | 3300041404 | Bacteria | 719 |
| 798 | Ga0439438_001161 | 3300041405 | Bacteria | 11692 |
| 799 | Ga0439439_0040254 | 3300041406 | Bacteria | 1209 |
| 800 | Ga0439447_000738 | 3300041407 | Bacteria | 12106 |
| 801 | Ga0439447_027904 | 3300041407 | Bacteria | 1438 |
| 802 | Ga0439453_0008205 | 3300041408 | Bacteria | 1673 |
| 803 | Ga0439466_0003579 | 3300041411 | Bacteria | 6006 |
| 804 | Ga0439465_0003601 | 3300041413 | Bacteria | 5057 |
| 805 | Ga0451807_2035927 | 3300041486 | Bacteria | 624 |
| 806 | Ga0439431_0054414 | 3300041997 | Bacteria | 1044 |
| 807 | Ga0439431_0108336 | 3300041997 | Bacteria | 768 |
| 808 | Ga0439437_001050 | 3300042000 | Bacteria | 2894 |
| 809 | Ga0439437_001357 | 3300042000 | Bacteria | 2573 |
| 810 | Ga0439442_006004 | 3300042002 | Bacteria | 2434 |
| 811 | Ga0439443_098706 | 3300042003 | Bacteria | 558 |
| 812 | Ga0439448_0073009 | 3300042005 | Bacteria | 1144 |
| 813 | Ga0439432_043948 | 3300042006 | Bacteria | 1408 |
| 814 | Ga0439452_007612 | 3300042010 | Bacteria | 3311 |
| 815 | Ga0439455_0028953 | 3300042012 | Bacteria | 1367 |
| 816 | Ga0439455_0037931 | 3300042012 | Bacteria | 1224 |
| 817 | Ga0439456_045989 | 3300042013 | Bacteria | 950 |
| 818 | Ga0439462_0002090 | 3300042015 | Bacteria | 4581 |
| 819 | Ga0450911_000004 | 3300042115 | Bacteria | 234537 |
| 820 | Ga0450912_001939 | 3300042116 | Bacteria | 1334 |
| 821 | Ga0450913_000050 | 3300042117 | Bacteria | 2681 |
| 822 | Ga0450913_011032 | 3300042117 | Bacteria | 731 |
| 823 | Ga0450917_000165 | 3300042120 | Bacteria | 4491 |
| 824 | Ga0450888_001082 | 3300042126 | Bacteria | 2578 |
| 825 | Ga0450890_000388 | 3300042127 | Bacteria | 6445 |
| 826 | Ga0450890_023809 | 3300042127 | Unclassified | 843 |
| 827 | Ga0450891_000011 | 3300042129 | Bacteria | 14278 |
| 828 | Ga0450892_000573 | 3300042130 | Bacteria | 4224 |
| 829 | Ga0450894_011519 | 3300042131 | Bacteria | 1152 |
| 830 | Ga0450894_031496 | 3300042131 | Bacteria | 741 |
| 831 | Ga0450896_016470 | 3300042133 | Bacteria | 1062 |
| 832 | Ga0450898_024920 | 3300042134 | Bacteria | 1071 |
| 833 | Ga0450904_000040 | 3300042139 | Bacteria | 29183 |
| 834 | Ga0450889_000398 | 3300042144 | Bacteria | 4843 |
| 835 | Ga0450906_001797 | 3300042145 | Bacteria | 4709 |
| 836 | Ga0450906_021416 | 3300042145 | Bacteria | 1155 |
| 837 | Ga0439446_0001360 | 3300042156 | Bacteria | 5520 |
| 838 | Ga0439446_0020338 | 3300042156 | Bacteria | 1869 |
| 839 | Ga0450909_003075 | 3300042185 | Bacteria | 2372 |
| 840 | Ga0439434_0018991 | 3300042435 | Bacteria | 2060 |
| 841 | Ga0439435_0005821 | 3300042436 | Bacteria | 2733 |
| 842 | Ga0439435_0007076 | 3300042436 | Bacteria | 2550 |
| 843 | Ga0439435_0031705 | 3300042436 | Bacteria | 1439 |
| 844 | Ga0439444_0063457 | 3300042437 | Bacteria | 776 |
| 845 | Ga0439459_0007596 | 3300042438 | Bacteria | 1835 |
| 846 | Ga0439459_0010685 | 3300042438 | Bacteria | 1605 |
| 847 | Ga0439460_0129142 | 3300042461 | Bacteria | 832 |
| 848 | Ga0439460_0210068 | 3300042461 | Bacteria | 665 |
| 849 | Ga0450916_000704 | 3300042530 | Bacteria | 3049 |
| 850 | Ga0450893_0001119 | 3300042532 | Bacteria | 4033 |
| 851 | Ga0450893_0008316 | 3300042532 | Bacteria | 1687 |
| 852 | Ga0450901_004880 | 3300042533 | Bacteria | 1381 |
| 853 | Ga0451577_0179793 | 3300042876 | Bacteria | 1907 |
| 854 | Ga0451577_0259557 | 3300042876 | Bacteria | 1573 |
| 855 | Ga0451577_0498538 | 3300042876 | Bacteria | 1106 |
| 856 | Ga0451577_1054026 | 3300042876 | Bacteria | 729 |
| 857 | Ga0451577_1127112 | 3300042876 | Bacteria | 701 |
| 858 | Ga0466963_0088821 | 3300044694 | Bacteria | 2102 |
| 859 | Ga0453684_0175604 | 3300044712 | Bacteria | 2520 |
| 860 | Ga0451576_0058799 | 3300045051 | Bacteria | 4015 |
| 861 | Ga0451576_0066178 | 3300045051 | Bacteria | 3762 |
| 862 | Ga0451576_1356304 | 3300045051 | Bacteria | 741 |
| 863 | Ga0466958_0005307 | 3300045836 | Bacteria | 6916 |
| 864 | Ga0466958_0028824 | 3300045836 | Bacteria | 3294 |
| 865 | Ga0466967_0093324 | 3300045976 | Bacteria | 2738 |
| 866 | Ga0466967_1023737 | 3300045976 | Bacteria | 822 |
| 867 | Ga0466967_1686557 | 3300045976 | Bacteria | 631 |
| 868 | Ga0495617_101072 | 3300046452 | Bacteria | 937 |
| 869 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 870 | Ga0495603_0394666 | 3300046455 | Bacteria | 793 |
| 871 | Ga0495603_0550613 | 3300046455 | Bacteria | 661 |
| 872 | Ga0495590_0028274 | 3300046457 | Bacteria | 1966 |
| 873 | Ga0495590_0068834 | 3300046457 | Bacteria | 1241 |
| 874 | Ga0495629_0000008 | 3300046459 | Bacteria | 352138 |
| 875 | Ga0495629_0036618 | 3300046459 | Bacteria | 3462 |
| 876 | Ga0495629_0084638 | 3300046459 | Bacteria | 2213 |
| 877 | Ga0495629_0598033 | 3300046459 | Unclassified | 738 |
| 878 | Ga0495638_0000093 | 3300046460 | Bacteria | 142356 |
| 879 | Ga0495638_0000277 | 3300046460 | Bacteria | 69421 |
| 880 | Ga0495638_0001726 | 3300046460 | Bacteria | 19228 |
| 881 | Ga0495638_0145934 | 3300046460 | Bacteria | 1376 |
| 882 | Ga0495638_0322298 | 3300046460 | Bacteria | 825 |
| 883 | Ga0495641_0036067 | 3300046461 | Bacteria | 2326 |
| 884 | Ga0495641_0152737 | 3300046461 | Bacteria | 1032 |
| 885 | Ga0495651_0000535 | 3300046462 | Bacteria | 29302 |
| 886 | Ga0495653_0000045 | 3300046463 | Bacteria | 115410 |
| 887 | Ga0495653_0267786 | 3300046463 | Bacteria | 1127 |
| 888 | Ga0495580_0000217 | 3300046472 | Bacteria | 44487 |
| 889 | Ga0495582_0271961 | 3300046473 | Bacteria | 972 |
| 890 | Ga0495582_0362881 | 3300046473 | Bacteria | 834 |
| 891 | Ga0495605_0021305 | 3300046474 | Bacteria | 3435 |
| 892 | Ga0495639_0005034 | 3300046475 | Bacteria | 5673 |
| 893 | Ga0495639_0146514 | 3300046475 | Bacteria | 1137 |
| 894 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 895 | Ga0495664_0779174 | 3300046477 | Bacteria | 563 |
| 896 | Ga0495584_0000028 | 3300046491 | Bacteria | 111816 |
| 897 | Ga0495584_0035496 | 3300046491 | Bacteria | 2520 |
| 898 | Ga0495584_0151269 | 3300046491 | Bacteria | 1179 |
| 899 | Ga0495585_0000086 | 3300046492 | Bacteria | 97481 |
| 900 | Ga0495585_0015642 | 3300046492 | Bacteria | 4406 |
| 901 | Ga0495585_0098215 | 3300046492 | Bacteria | 1569 |
| 902 | Ga0495594_0403129 | 3300046499 | Bacteria | 778 |
| 903 | Ga0495596_0001610 | 3300046500 | Bacteria | 12832 |
| 904 | Ga0495607_0002640 | 3300046501 | Bacteria | 14394 |
| 905 | Ga0495607_0009005 | 3300046501 | Bacteria | 6789 |
| 906 | Ga0495607_0134664 | 3300046501 | Bacteria | 1281 |
| 907 | Ga0495583_0000419 | 3300046506 | Bacteria | 64108 |
| 908 | Ga0495606_0001218 | 3300046507 | Bacteria | 36043 |
| 909 | Ga0495606_0001429 | 3300046507 | Bacteria | 32047 |
| 910 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 911 | Ga0495608_0452007 | 3300046511 | Bacteria | 782 |
| 912 | Ga0495610_0150433 | 3300046512 | Bacteria | 993 |
| 913 | Ga0495610_0155377 | 3300046512 | Bacteria | 972 |
| 914 | Ga0495616_0002066 | 3300046513 | Bacteria | 13492 |
| 915 | Ga0495616_0102973 | 3300046513 | Bacteria | 1337 |
| 916 | Ga0495616_0142254 | 3300046513 | Bacteria | 1091 |
| 917 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 918 | Ga0495618_0089042 | 3300046514 | Bacteria | 1974 |
| 919 | Ga0495620_0046771 | 3300046515 | Bacteria | 1866 |
| 920 | Ga0495620_0214544 | 3300046515 | Bacteria | 738 |
| 921 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 922 | Ga0495630_0006296 | 3300046517 | Bacteria | 8430 |
| 923 | Ga0495630_0053954 | 3300046517 | Bacteria | 3011 |
| 924 | Ga0495632_0000570 | 3300046519 | Bacteria | 34221 |
| 925 | Ga0495632_0000731 | 3300046519 | Bacteria | 29723 |
| 926 | Ga0495632_0029701 | 3300046519 | Bacteria | 2843 |
| 927 | Ga0495632_0031178 | 3300046519 | Bacteria | 2759 |
| 928 | Ga0495632_0079065 | 3300046519 | Bacteria | 1570 |
| 929 | Ga0495637_0010875 | 3300046520 | Bacteria | 4385 |
| 930 | Ga0495637_0180576 | 3300046520 | Bacteria | 783 |
| 931 | Ga0495643_0000081 | 3300046522 | Bacteria | 160004 |
| 932 | Ga0495644_0158070 | 3300046523 | Bacteria | 869 |
| 933 | Ga0495648_0000199 | 3300046524 | Bacteria | 69421 |
| 934 | Ga0495648_0056420 | 3300046524 | Bacteria | 2363 |
| 935 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 936 | Ga0495654_0017098 | 3300046530 | Bacteria | 3819 |
| 937 | Ga0495654_0062230 | 3300046530 | Bacteria | 1790 |
| 938 | Ga0495665_0139553 | 3300046531 | Bacteria | 1267 |
| 939 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 940 | Ga0495586_0004691 | 3300046535 | Bacteria | 7308 |
| 941 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 942 | Ga0495598_0165594 | 3300046537 | Bacteria | 780 |
| 943 | Ga0495598_0178513 | 3300046537 | Unclassified | 756 |
| 944 | Ga0495609_0014617 | 3300046538 | Bacteria | 3686 |
| 945 | Ga0495609_0019454 | 3300046538 | Bacteria | 3142 |
| 946 | Ga0495597_0008372 | 3300046542 | Bacteria | 5184 |
| 947 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 948 | Ga0495633_0002816 | 3300046558 | Bacteria | 12034 |
| 949 | Ga0495633_0051413 | 3300046558 | Bacteria | 1942 |
| 950 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 951 | Ga0495667_0036406 | 3300046559 | Bacteria | 3286 |
| 952 | Ga0495656_0039189 | 3300046615 | Bacteria | 1967 |
| 953 | Ga0495656_0068632 | 3300046615 | Bacteria | 1568 |
| 954 | Ga0495668_0032304 | 3300046616 | Bacteria | 2946 |
| 955 | Ga0495668_0094138 | 3300046616 | Bacteria | 1640 |
| 956 | Ga0495634_0031220 | 3300046642 | Bacteria | 3671 |
| 957 | Ga0495634_0096485 | 3300046642 | Bacteria | 1914 |
| 958 | Ga0495611_0009558 | 3300046648 | Bacteria | 4096 |
| 959 | Ga0495625_0016828 | 3300046660 | Bacteria | 5741 |
| 960 | Ga0495625_0076835 | 3300046660 | Bacteria | 2334 |
| 961 | Ga0495625_0288009 | 3300046660 | Bacteria | 1055 |
| 962 | Ga0495625_0367167 | 3300046660 | Bacteria | 906 |
| 963 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 964 | Ga0495635_0063635 | 3300046663 | Bacteria | 2533 |
| 965 | Ga0495635_0290095 | 3300046663 | Bacteria | 1098 |
| 966 | Ga0495588_0156501 | 3300046674 | Bacteria | 1205 |
| 967 | Ga0495588_0223040 | 3300046674 | Bacteria | 995 |
| 968 | Ga0495657_0000064 | 3300046675 | Bacteria | 94324 |
| 969 | Ga0495599_0000064 | 3300046678 | Bacteria | 73422 |
| 970 | Ga0495623_0000065 | 3300046679 | Bacteria | 65151 |
| 971 | Ga0495623_0318766 | 3300046679 | Bacteria | 854 |
| 972 | Ga0495646_0000023 | 3300046680 | Bacteria | 110212 |
| 973 | Ga0495658_0067051 | 3300046683 | Bacteria | 2075 |
| 974 | Ga0495658_0351691 | 3300046683 | Bacteria | 936 |
| 975 | Ga0495658_0462480 | 3300046683 | Unclassified | 811 |
| 976 | Ga0495669_0000752 | 3300046684 | Bacteria | 13940 |
| 977 | Ga0495669_0019290 | 3300046684 | Bacteria | 2942 |
| 978 | Ga0495669_0128409 | 3300046684 | Bacteria | 1192 |
| 979 | Ga0495669_0295081 | 3300046684 | Bacteria | 781 |
| 980 | Ga0495613_0025068 | 3300046689 | Bacteria | 4445 |
| 981 | Ga0495613_0070714 | 3300046689 | Bacteria | 2544 |
| 982 | Ga0495613_0073985 | 3300046689 | Bacteria | 2482 |
| 983 | Ga0495613_0155767 | 3300046689 | Bacteria | 1628 |
| 984 | Ga0495624_0017097 | 3300046690 | Bacteria | 4874 |
| 985 | Ga0495670_0055136 | 3300046691 | Bacteria | 1993 |
| 986 | Ga0495671_0000124 | 3300046692 | Bacteria | 70221 |
| 987 | Ga0495671_0000135 | 3300046692 | Bacteria | 65732 |
| 988 | Ga0495671_0000963 | 3300046692 | Bacteria | 20154 |
| 989 | Ga0495671_0068246 | 3300046692 | Bacteria | 1748 |
| 990 | Ga0495649_0000561 | 3300046694 | Bacteria | 31476 |
| 991 | Ga0495649_0017156 | 3300046694 | Bacteria | 4089 |
| 992 | Ga0495649_0027931 | 3300046694 | Bacteria | 3128 |
| 993 | Ga0495649_0031668 | 3300046694 | Bacteria | 2915 |
| 994 | Ga0495589_0064793 | 3300046794 | Bacteria | 1792 |
| 995 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 996 | Ga0495660_0288443 | 3300046810 | Bacteria | 748 |
| 997 | Ga0495581_0039058 | 3300047315 | Bacteria | 2748 |
| 998 | Ga0495581_0186301 | 3300047315 | Bacteria | 1214 |
| 999 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 1000 | Ga0495636_0000111 | 3300047318 | Bacteria | 34245 |
| 1001 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 1002 | Ga0495674_0024508 | 3300047319 | Bacteria | 5542 |
| 1003 | Ga0495674_0154218 | 3300047319 | Bacteria | 1925 |
| 1004 | Ga0495672_0111118 | 3300047320 | Bacteria | 1471 |
| 1005 | Ga0495676_0454338 | 3300047321 | Bacteria | 845 |
| 1006 | Ga0495680_0001344 | 3300047322 | Bacteria | 26713 |
| 1007 | Ga0495680_0009855 | 3300047322 | Bacteria | 8564 |
| 1008 | Ga0495683_0000076 | 3300047323 | Bacteria | 97809 |
| 1009 | Ga0495683_0014312 | 3300047323 | Bacteria | 4133 |
| 1010 | Ga0495683_0061713 | 3300047323 | Bacteria | 1856 |
| 1011 | Ga0495683_0269666 | 3300047323 | Bacteria | 740 |
| 1012 | Ga0495675_0000178 | 3300047444 | Bacteria | 46542 |
| 1013 | Ga0495673_0000303 | 3300047469 | Bacteria | 65717 |
| 1014 | Ga0495673_0162509 | 3300047469 | Bacteria | 856 |
| 1015 | Ga0495681_0030908 | 3300047470 | Bacteria | 2720 |
| 1016 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 1017 | Ga0495684_0162200 | 3300047471 | Bacteria | 1667 |
| 1018 | Ga0495686_0099455 | 3300047472 | Bacteria | 1756 |
| 1019 | Ga0495593_0002369 | 3300047673 | Bacteria | 11323 |
| 1020 | Ga0495593_0389454 | 3300047673 | Bacteria | 697 |
| 1021 | Ga0495593_0443219 | 3300047673 | Bacteria | 650 |
| 1022 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 1023 | Ga0495602_0155380 | 3300048088 | Bacteria | 1792 |
| 1024 | Ga0495615_0000004 | 3300048090 | Bacteria | 102268 |
| 1025 | Ga0495626_0000444 | 3300048091 | Bacteria | 42261 |
| 1026 | Ga0495626_0009839 | 3300048091 | Bacteria | 5141 |
| 1027 | Ga0496100_0056972 | 3300048903 | Bacteria | 2558 |
| 1028 | Ga0496100_0101820 | 3300048903 | Bacteria | 1981 |
| 1029 | Ga0496100_0105464 | 3300048903 | Bacteria | 1949 |
| 1030 | Ga0496101_0011508 | 3300048904 | Bacteria | 5874 |
| 1031 | Ga0496101_0217225 | 3300048904 | Bacteria | 1483 |
| 1032 | Ga0496101_0313485 | 3300048904 | Bacteria | 1230 |
| 1033 | Ga0496101_0746871 | 3300048904 | Bacteria | 772 |
| 1034 | Ga0496102_0361388 | 3300048905 | Bacteria | 1367 |
| 1035 | Ga0496103_0224677 | 3300048906 | Bacteria | 1207 |
| 1036 | Ga0496103_0335606 | 3300048906 | Unclassified | 972 |
| 1037 | Ga0496104_0018658 | 3300048907 | Bacteria | 6332 |
| 1038 | Ga0496104_0032785 | 3300048907 | Bacteria | 4836 |
| 1039 | Ga0496104_0040433 | 3300048907 | Bacteria | 4370 |
| 1040 | Ga0496104_1017378 | 3300048907 | Bacteria | 732 |
| 1041 | Ga0496105_0038328 | 3300048908 | Bacteria | 3948 |
| 1042 | Ga0496105_0087705 | 3300048908 | Bacteria | 2571 |
| 1043 | Ga0496105_0208525 | 3300048908 | Bacteria | 1593 |
| 1044 | Ga0496105_0638658 | 3300048908 | Bacteria | 822 |
| 1045 | Ga0496105_0757756 | 3300048908 | Bacteria | 741 |
| 1046 | Ga0496105_0819841 | 3300048908 | Bacteria | 706 |
| 1047 | Ga0496106_0099763 | 3300048909 | Bacteria | 2251 |
| 1048 | Ga0496106_0157711 | 3300048909 | Bacteria | 1793 |
| 1049 | Ga0496106_0181293 | 3300048909 | Bacteria | 1672 |
| 1050 | Ga0496106_0339336 | 3300048909 | Bacteria | 1207 |
| 1051 | Ga0496106_0916712 | 3300048909 | Unclassified | 691 |
| 1052 | Ga0496106_1104953 | 3300048909 | Bacteria | 621 |
| 1053 | Ga0496107_0023422 | 3300048910 | Bacteria | 4366 |
| 1054 | Ga0496107_0060646 | 3300048910 | Bacteria | 2738 |
| 1055 | Ga0496107_0077406 | 3300048910 | Bacteria | 2423 |
| 1056 | Ga0496107_0577757 | 3300048910 | Bacteria | 831 |
| 1057 | Ga0496107_0617898 | 3300048910 | Bacteria | 800 |
| 1058 | Ga0496108_0015389 | 3300048911 | Bacteria | 6240 |
| 1059 | Ga0496108_0061105 | 3300048911 | Bacteria | 3170 |
| 1060 | Ga0496108_0165929 | 3300048911 | Bacteria | 1909 |
| 1061 | Ga0496108_0408006 | 3300048911 | Bacteria | 1187 |
| 1062 | Ga0496109_0024989 | 3300048912 | Bacteria | 5318 |
| 1063 | Ga0496109_0025994 | 3300048912 | Bacteria | 5217 |
| 1064 | Ga0496109_0260557 | 3300048912 | Bacteria | 1633 |
| 1065 | Ga0496109_0282430 | 3300048912 | Bacteria | 1564 |
| 1066 | Ga0496109_0508877 | 3300048912 | Bacteria | 1137 |
| 1067 | Ga0496110_0014036 | 3300048913 | Bacteria | 6639 |
| 1068 | Ga0496110_0124434 | 3300048913 | Bacteria | 2326 |
| 1069 | Ga0496110_0245051 | 3300048913 | Bacteria | 1631 |
| 1070 | Ga0496110_0810344 | 3300048913 | Bacteria | 841 |
| 1071 | Ga0496110_1079391 | 3300048913 | Unclassified | 711 |
| 1072 | Ga0496111_0016470 | 3300048914 | Bacteria | 5093 |
| 1073 | Ga0496111_0320544 | 3300048914 | Bacteria | 1148 |
| 1074 | Ga0496111_0423799 | 3300048914 | Bacteria | 983 |
| 1075 | Ga0496112_0009723 | 3300048915 | Bacteria | 8681 |
| 1076 | Ga0496112_0105727 | 3300048915 | Bacteria | 2784 |
| 1077 | Ga0496112_0114033 | 3300048915 | Bacteria | 2673 |
| 1078 | Ga0496112_0168535 | 3300048915 | Bacteria | 2156 |
| 1079 | Ga0496112_0279217 | 3300048915 | Bacteria | 1618 |
| 1080 | Ga0496112_0457632 | 3300048915 | Bacteria | 1213 |
| 1081 | Ga0496112_0625390 | 3300048915 | Bacteria | 1007 |
| 1082 | Ga0496112_1437087 | 3300048915 | Bacteria | 604 |
| 1083 | Ga0496113_0004304 | 3300048916 | Bacteria | 8723 |
| 1084 | Ga0496113_0016246 | 3300048916 | Bacteria | 5138 |
| 1085 | Ga0496113_0039668 | 3300048916 | Bacteria | 3467 |
| 1086 | Ga0496113_0078110 | 3300048916 | Bacteria | 2532 |
| 1087 | Ga0496113_0154979 | 3300048916 | Bacteria | 1808 |
| 1088 | Ga0496113_0302076 | 3300048916 | Bacteria | 1282 |
| 1089 | Ga0496114_0199679 | 3300048917 | Bacteria | 1751 |
| 1090 | Ga0496114_0418979 | 3300048917 | Bacteria | 1186 |
| 1091 | Ga0496114_0670973 | 3300048917 | Bacteria | 910 |
| 1092 | Ga0496114_0904148 | 3300048917 | Bacteria | 764 |
| 1093 | Ga0496115_0354246 | 3300048918 | Bacteria | 1197 |
| 1094 | Ga0496115_0557336 | 3300048918 | Bacteria | 915 |
| 1095 | Ga0496118_0362095 | 3300048921 | Bacteria | 768 |
| 1096 | Ga0496122_0000929 | 3300048925 | Bacteria | 53417 |
| 1097 | Ga0496123_0000798 | 3300048926 | Bacteria | 50960 |
| 1098 | Ga0496124_0004446 | 3300048927 | Bacteria | 16344 |
| 1099 | Ga0496125_0032291 | 3300048928 | Bacteria | 4652 |
| 1100 | Ga0496125_0036215 | 3300048928 | Bacteria | 4313 |
| 1101 | Ga0496126_0485011 | 3300048929 | Bacteria | 990 |
| 1102 | Ga0495678_004092 | 3300049459 | Bacteria | 8644 |
| 1103 | Ga0495678_007647 | 3300049459 | Bacteria | 5575 |
| 1104 | Ga0495682_0084249 | 3300049460 | Bacteria | 1143 |
| 1105 | Ga0495682_0091400 | 3300049460 | Bacteria | 1093 |
| 1106 | Ga0495682_0228697 | 3300049460 | Bacteria | 658 |
| 1107 | Ga0501291_008616 | 3300049514 | Bacteria | 1413 |
| 1108 | Ga0501291_028190 | 3300049514 | Bacteria | 934 |
| 1109 | Ga0501292_006605 | 3300049515 | Viruses | 1654 |
| 1110 | Ga0501293_008645 | 3300049516 | Bacteria | 858 |
| 1111 | Ga0501294_002875 | 3300049517 | Bacteria | 1628 |
| 1112 | Ga0501296_003944 | 3300049519 | Bacteria | 1602 |
| 1113 | Ga0501298_007937 | 3300049521 | Bacteria | 1772 |
| 1114 | Ga0501299_006449 | 3300049522 | Bacteria | 1841 |
| 1115 | Ga0501299_008861 | 3300049522 | Bacteria | 1646 |
| 1116 | Ga0501299_066669 | 3300049522 | Bacteria | 773 |
| 1117 | Ga0501300_015381 | 3300049523 | Bacteria | 1117 |
| 1118 | Ga0501031_0000443 | 3300049568 | Bacteria | 23880 |
| 1119 | Ga0501031_0009136 | 3300049568 | Bacteria | 6446 |
| 1120 | Ga0501031_0011507 | 3300049568 | Bacteria | 5768 |
| 1121 | Ga0501031_0459064 | 3300049568 | Bacteria | 823 |
| 1122 | Ga0501032_0010096 | 3300049569 | Bacteria | 6816 |
| 1123 | Ga0501032_0082900 | 3300049569 | Bacteria | 2133 |
| 1124 | Ga0501032_0115286 | 3300049569 | Bacteria | 1777 |
| 1125 | Ga0501033_0221325 | 3300049570 | Bacteria | 1347 |
| 1126 | Ga0501034_0006511 | 3300049571 | Bacteria | 12559 |
| 1127 | Ga0501034_0007288 | 3300049571 | Bacteria | 11791 |
| 1128 | Ga0501036_0000230 | 3300049572 | Bacteria | 37374 |
| 1129 | Ga0501036_0164742 | 3300049572 | Archaea | 1869 |
| 1130 | Ga0501036_0308011 | 3300049572 | Bacteria | 1324 |
| 1131 | Ga0501036_1000038 | 3300049572 | Bacteria | 685 |
| 1132 | Ga0501037_0004342 | 3300049573 | Bacteria | 10291 |
| 1133 | Ga0501037_0027855 | 3300049573 | Bacteria | 4175 |
| 1134 | Ga0501037_0082094 | 3300049573 | Bacteria | 2336 |
| 1135 | Ga0501037_0326387 | 3300049573 | Archaea | 1062 |
| 1136 | Ga0501038_0010658 | 3300049574 | Bacteria | 8405 |
| 1137 | Ga0501038_0156847 | 3300049574 | Bacteria | 1853 |
| 1138 | Ga0501038_0511115 | 3300049574 | Bacteria | 918 |
| 1139 | Ga0501038_0760795 | 3300049574 | Unclassified | 722 |
| 1140 | Ga0501039_0000557 | 3300049575 | Bacteria | 26996 |
| 1141 | Ga0501039_0001390 | 3300049575 | Bacteria | 17776 |
| 1142 | Ga0501039_0358018 | 3300049575 | Bacteria | 1147 |
| 1143 | Ga0501040_0000331 | 3300049576 | Bacteria | 27776 |
| 1144 | Ga0501040_0062828 | 3300049576 | Unclassified | 2555 |
| 1145 | Ga0501040_0093710 | 3300049576 | Bacteria | 2089 |
| 1146 | Ga0501040_0101404 | 3300049576 | Bacteria | 2008 |
| 1147 | Ga0501040_0193210 | 3300049576 | Bacteria | 1445 |
| 1148 | Ga0501041_0000256 | 3300049577 | Bacteria | 25091 |
| 1149 | Ga0501041_0006710 | 3300049577 | Bacteria | 6745 |
| 1150 | Ga0501041_0016032 | 3300049577 | Bacteria | 4453 |
| 1151 | Ga0501041_0125086 | 3300049577 | Unclassified | 1600 |
| 1152 | Ga0501041_0128813 | 3300049577 | Bacteria | 1576 |
| 1153 | Ga0501041_0527579 | 3300049577 | Bacteria | 752 |
| 1154 | Ga0501042_0004679 | 3300049578 | Bacteria | 8730 |
| 1155 | Ga0501042_0010292 | 3300049578 | Bacteria | 6262 |
| 1156 | Ga0501042_0089132 | 3300049578 | Bacteria | 2213 |
| 1157 | Ga0501042_0301164 | 3300049578 | Bacteria | 1158 |
| 1158 | Ga0501046_0000618 | 3300049580 | Bacteria | 34970 |
| 1159 | Ga0501046_0014890 | 3300049580 | Bacteria | 6545 |
| 1160 | Ga0501046_0277103 | 3300049580 | Bacteria | 1229 |
| 1161 | Ga0501047_0128166 | 3300049581 | Bacteria | 2417 |
| 1162 | Ga0501048_0000179 | 3300049582 | Bacteria | 40163 |
| 1163 | Ga0501048_0183356 | 3300049582 | Unclassified | 1484 |
| 1164 | Ga0501048_0387647 | 3300049582 | Bacteria | 998 |
| 1165 | Ga0501068_0021192 | 3300049584 | Bacteria | 3794 |
| 1166 | Ga0501068_0021809 | 3300049584 | Bacteria | 3743 |
| 1167 | Ga0501068_0134569 | 3300049584 | Bacteria | 1547 |
| 1168 | Ga0501070_0188471 | 3300049586 | Bacteria | 1696 |
| 1169 | Ga0501071_0000665 | 3300049587 | Bacteria | 17910 |
| 1170 | Ga0501071_0030549 | 3300049587 | Archaea | 3812 |
| 1171 | Ga0501071_0190926 | 3300049587 | Bacteria | 1536 |
| 1172 | Ga0501071_0554094 | 3300049587 | Bacteria | 883 |
| 1173 | Ga0501072_0001546 | 3300049588 | Bacteria | 17200 |
| 1174 | Ga0501072_0107365 | 3300049588 | Archaea | 2220 |
| 1175 | Ga0501072_0459501 | 3300049588 | Bacteria | 1008 |
| 1176 | Ga0501072_0682377 | 3300049588 | Bacteria | 808 |
| 1177 | Ga0501073_0272587 | 3300049589 | Bacteria | 1168 |
| 1178 | Ga0501074_0001783 | 3300049590 | Bacteria | 14714 |
| 1179 | Ga0501074_0207875 | 3300049590 | Bacteria | 1395 |
| 1180 | Ga0501075_0000833 | 3300049591 | Bacteria | 19419 |
| 1181 | Ga0501075_0003400 | 3300049591 | Bacteria | 10645 |
| 1182 | Ga0501076_0000188 | 3300049592 | Bacteria | 36912 |
| 1183 | Ga0501076_0438950 | 3300049592 | Bacteria | 1075 |
| 1184 | Ga0501076_0785922 | 3300049592 | Bacteria | 785 |
| 1185 | Ga0501076_1001817 | 3300049592 | Bacteria | 688 |
| 1186 | Ga0501077_0004501 | 3300049593 | Bacteria | 8467 |
| 1187 | Ga0501077_0006741 | 3300049593 | Bacteria | 7067 |
| 1188 | Ga0501199_004511 | 3300049650 | Viruses | 1373 |
| 1189 | Ga0501199_004863 | 3300049650 | Bacteria | 1337 |
| 1190 | Ga0501201_001179 | 3300049651 | Bacteria | 2448 |
| 1191 | Ga0501202_036395 | 3300049652 | Bacteria | 1048 |
| 1192 | Ga0501207_007049 | 3300049654 | Bacteria | 1594 |
| 1193 | Ga0501208_004835 | 3300049655 | Bacteria | 1616 |
| 1194 | Ga0501211_010183 | 3300049658 | Bacteria | 921 |
| 1195 | Ga0501217_017932 | 3300049661 | Bacteria | 1637 |
| 1196 | Ga0501217_049691 | 3300049661 | Bacteria | 1092 |
| 1197 | Ga0501222_001860 | 3300049662 | Bacteria | 2924 |
| 1198 | Ga0501223_021102 | 3300049663 | Bacteria | 1275 |
| 1199 | Ga0501227_025559 | 3300049665 | Bacteria | 1386 |
| 1200 | Ga0501233_018791 | 3300049668 | Bacteria | 1457 |
| 1201 | Ga0501233_020186 | 3300049668 | Bacteria | 1420 |
| 1202 | Ga0501235_021193 | 3300049669 | Bacteria | 1444 |
| 1203 | Ga0501243_039351 | 3300049675 | Unclassified | 827 |
| 1204 | Ga0501247_016410 | 3300049677 | Bacteria | 931 |
| 1205 | Ga0501249_052262 | 3300049679 | Bacteria | 939 |
| 1206 | Ga0501250_009639 | 3300049680 | Viruses | 1091 |
| 1207 | Ga0501257_149176 | 3300049686 | Unclassified | 644 |
| 1208 | Ga0501259_090689 | 3300049688 | Unclassified | 686 |
| 1209 | Ga0501221_004693 | 3300049704 | Bacteria | 2267 |
| 1210 | Ga0501225_0021888 | 3300049705 | Viruses | 1764 |
| 1211 | Ga0501079_0000792 | 3300049741 | Bacteria | 21536 |
| 1212 | Ga0501079_0275315 | 3300049741 | Bacteria | 1316 |
| 1213 | Ga0501080_0005633 | 3300049742 | Bacteria | 11191 |
| 1214 | Ga0501080_0033872 | 3300049742 | Bacteria | 4769 |
| 1215 | Ga0501080_0224108 | 3300049742 | Bacteria | 1720 |
| 1216 | Ga0501080_0364869 | 3300049742 | Bacteria | 1303 |
| 1217 | Ga0501080_0368765 | 3300049742 | Bacteria | 1295 |
| 1218 | Ga0501080_0777405 | 3300049742 | Bacteria | 841 |
| 1219 | Ga0501081_0023524 | 3300049743 | Bacteria | 4130 |
| 1220 | Ga0501081_0218502 | 3300049743 | Bacteria | 1386 |
| 1221 | Ga0501081_0371320 | 3300049743 | Bacteria | 1056 |
| 1222 | Ga0501081_0633557 | 3300049743 | Bacteria | 801 |
| 1223 | Ga0501083_0010454 | 3300049744 | Bacteria | 6535 |
| 1224 | Ga0501232_000316 | 3300049757 | Bacteria | 3088 |
| 1225 | Ga0501262_006551 | 3300049759 | Bacteria | 1395 |
| 1226 | Ga0501267_000505 | 3300049764 | Bacteria | 3048 |
| 1227 | Ga0501271_021899 | 3300049768 | Bacteria | 745 |
| 1228 | Ga0501272_001325 | 3300049769 | Bacteria | 2329 |
| 1229 | Ga0501273_008544 | 3300049770 | Bacteria | 1229 |
| 1230 | Ga0501274_024193 | 3300049771 | Unclassified | 649 |
| 1231 | Ga0501280_023887 | 3300049776 | Bacteria | 924 |
| 1232 | Ga0501282_004766 | 3300049778 | Bacteria | 1448 |
| 1233 | Ga0501283_012568 | 3300049779 | Bacteria | 1274 |
| 1234 | Ga0501035_0049175 | 3300049822 | Bacteria | 3780 |
| 1235 | Ga0501035_0052578 | 3300049822 | Bacteria | 3645 |
| 1236 | Ga0501035_0355395 | 3300049822 | Bacteria | 1225 |
| 1237 | Ga0501044_0103822 | 3300049823 | Bacteria | 2857 |
| 1238 | Ga0501044_0256057 | 3300049823 | Bacteria | 1690 |
| 1239 | Ga0501045_0002959 | 3300049824 | Bacteria | 11619 |
| 1240 | Ga0501045_0088674 | 3300049824 | Bacteria | 2285 |
| 1241 | Ga0501045_0305123 | 3300049824 | Bacteria | 1185 |
| 1242 | Ga0501045_0417022 | 3300049824 | Bacteria | 999 |
| 1243 | Ga0501226_000003 | 3300049853 | Bacteria | 358977 |
| 1244 | nmdc:mga03683_239099_c1 | 3300050489 | Bacteria | 841 |
| 1245 | nmdc:mga03683_369582_c1 | 3300050489 | Bacteria | 681 |
| 1246 | nmdc:mga03n38_99342_c1 | 3300050490 | Bacteria | 1401 |
| 1247 | nmdc:mga00v17_21823_c1 | 3300050491 | Bacteria | 3686 |
| 1248 | nmdc:mga00v17_50934_c1 | 3300050491 | Bacteria | 2517 |
| 1249 | nmdc:mga00v17_91649_c1 | 3300050491 | Bacteria | 1910 |
| 1250 | nmdc:mga0yw44_328519_c1 | 3300050492 | Bacteria | 1028 |
| 1251 | nmdc:mga0yw44_37334_c1 | 3300050492 | Bacteria | 2868 |
| 1252 | nmdc:mga0k408_106382_c1 | 3300050493 | Unclassified | 1657 |
| 1253 | nmdc:mga0k408_11684_c1 | 3300050493 | Bacteria | 4786 |
| 1254 | nmdc:mga0k408_12312_c1 | 3300050493 | Bacteria | 2827 |
| 1255 | nmdc:mga0k408_97938_c1 | 3300050493 | Bacteria | 1728 |
| 1256 | nmdc:mga06z11_157568_c1 | 3300050494 | Bacteria | 1295 |
| 1257 | nmdc:mga06z11_2682_c1 | 3300050494 | Bacteria | 6817 |
| 1258 | nmdc:mga06z11_307930_c1 | 3300050494 | Bacteria | 943 |
| 1259 | nmdc:mga06z11_37103_c1 | 3300050494 | Bacteria | 2411 |
| 1260 | nmdc:mga06z11_3804_c1 | 3300050494 | Bacteria | 5877 |
| 1261 | nmdc:mga06z11_7267_c1 | 3300050494 | Bacteria | 4547 |
| 1262 | nmdc:mga04h51_14549_c1 | 3300050495 | Bacteria | 2250 |
| 1263 | nmdc:mga04h51_28972_c1 | 3300050495 | Bacteria | 1731 |
| 1264 | nmdc:mga07m45_104889_c1 | 3300050496 | Bacteria | 1625 |
| 1265 | nmdc:mga07m45_1316_c1 | 3300050496 | Bacteria | 11316 |
| 1266 | nmdc:mga07m45_66103_c1 | 3300050496 | Bacteria | 2054 |
| 1267 | nmdc:mga05p37_953940_c1 | 3300050507 | Bacteria | 917 |
| 1268 | nmdc:mga05p37_989043_c1 | 3300050507 | Bacteria | 895 |
| 1269 | nmdc:mga09592_102960_c1 | 3300050508 | Bacteria | 2446 |
| 1270 | nmdc:mga09592_1190625_c1 | 3300050508 | Bacteria | 630 |
| 1271 | nmdc:mga0qj67_29970_c1 | 3300050509 | Bacteria | 4230 |
| 1272 | nmdc:mga0qj67_43561_c1 | 3300050509 | Bacteria | 3534 |
| 1273 | nmdc:mga06r32_148837_c1 | 3300050510 | Bacteria | 2319 |
| 1274 | nmdc:mga06r32_1527683_c1 | 3300050510 | Bacteria | 607 |
| 1275 | nmdc:mga06r32_155969_c1 | 3300050510 | Bacteria | 2264 |
| 1276 | nmdc:mga06r32_500393_c1 | 3300050510 | Bacteria | 1192 |
| 1277 | nmdc:mga06r32_56095_c1 | 3300050510 | Bacteria | 3780 |
| 1278 | nmdc:mga08y16_16096_c1 | 3300050511 | Bacteria | 7865 |
| 1279 | nmdc:mga08y16_27352_c1 | 3300050511 | Bacteria | 4313 |
| 1280 | nmdc:mga08y16_43807_c1 | 3300050511 | Bacteria | 4689 |
| 1281 | nmdc:mga08y16_494051_c1 | 3300050511 | Bacteria | 1244 |
| 1282 | nmdc:mga08y16_54145_c1 | 3300050511 | Bacteria | 4193 |
| 1283 | nmdc:mga0n895_464217_c1 | 3300050512 | Unclassified | 1278 |
| 1284 | nmdc:mga0n895_466202_c1 | 3300050512 | Bacteria | 1274 |
| 1285 | nmdc:mga0n895_76931_c1 | 3300050512 | Bacteria | 3318 |
| 1286 | nmdc:mga0rr50_152308_c1 | 3300050513 | Bacteria | 1870 |
| 1287 | nmdc:mga0rr50_387363_c1 | 3300050513 | Bacteria | 1179 |
| 1288 | nmdc:mga08x19_7633_c1 | 3300050514 | Bacteria | 6425 |
| 1289 | nmdc:mga0a205_1010611_c1 | 3300050515 | Unclassified | 679 |
| 1290 | nmdc:mga0a205_450047_c1 | 3300050515 | Bacteria | 1148 |
| 1291 | nmdc:mga0a205_679692_c1 | 3300050515 | Bacteria | 880 |
| 1292 | nmdc:mga0a205_926474_c1 | 3300050515 | Bacteria | 718 |
| 1293 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 1294 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 1295 | Ga0500610_0009419 | 3300053079 | Bacteria | 4329 |
| 1296 | Ga0500610_0071228 | 3300053079 | Bacteria | 1813 |
| 1297 | Ga0495655_0001360 | 3300053083 | Bacteria | 3760 |
| 1298 | Ga0495595_0000020 | 3300053084 | Bacteria | 115983 |
| 1299 | Ga0495595_0062939 | 3300053084 | Bacteria | 1741 |
| 1300 | Ga0495619_0000110 | 3300053085 | Bacteria | 61419 |
| 1301 | Ga0500578_0040662 | 3300053086 | Bacteria | 2988 |
| 1302 | Ga0500651_0013688 | 3300053093 | Bacteria | 4950 |
| 1303 | Ga0500651_0522050 | 3300053093 | Bacteria | 652 |
| 1304 | Ga0500566_0002361 | 3300053094 | Bacteria | 11170 |
| 1305 | Ga0500566_0179531 | 3300053094 | Bacteria | 1087 |
| 1306 | Ga0500650_0164049 | 3300053098 | Bacteria | 1024 |
| 1307 | Ga0500594_0004368 | 3300053118 | Bacteria | 3115 |
| 1308 | Ga0500559_0101334 | 3300053136 | Bacteria | 1327 |
| 1309 | Ga0500559_0313279 | 3300053136 | Bacteria | 736 |
| 1310 | Ga0500568_0081361 | 3300053139 | Bacteria | 1229 |
| 1311 | Ga0500577_0085938 | 3300053142 | Bacteria | 1263 |
| 1312 | Ga0500588_0278953 | 3300053146 | Bacteria | 631 |
| 1313 | Ga0500604_0070952 | 3300053151 | Bacteria | 1111 |
| 1314 | Ga0500604_0178675 | 3300053151 | Bacteria | 727 |
| 1315 | Ga0500616_0002794 | 3300053153 | Bacteria | 14058 |
| 1316 | Ga0500616_0037526 | 3300053153 | Bacteria | 2622 |
| 1317 | Ga0500627_0064691 | 3300053158 | Bacteria | 1613 |
| 1318 | Ga0500627_0170563 | 3300053158 | Bacteria | 980 |
| 1319 | Ga0500611_036731 | 3300053727 | Bacteria | 1051 |
| 1320 | Ga0500599_015621 | 3300053736 | Bacteria | 1044 |
| 1321 | Ga0501084_0008839 | 3300054114 | Bacteria | 8337 |
| 1322 | Ga0501084_0290798 | 3300054114 | Bacteria | 1380 |
| 1323 | Ga0501084_0547373 | 3300054114 | Bacteria | 978 |
| 1324 | Ga0501084_0784437 | 3300054114 | Bacteria | 803 |
| 1325 | Ga0501084_0939321 | 3300054114 | Bacteria | 727 |
| 1326 | Ga0501084_1187529 | 3300054114 | Bacteria | 640 |
| 1327 | Ga0587084_030607 | 3300059477 | Bacteria | 864 |
| 1328 | Ga0501082_0000049 | 3300060353 | Bacteria | 84011 |
| 1329 | Ga0501082_0002023 | 3300060353 | Bacteria | 17825 |
| 1330 | Ga0501082_0057783 | 3300060353 | Unclassified | 3342 |
| 1331 | Ga0501082_0265781 | 3300060353 | Bacteria | 1493 |
| 1332 | Ga0501082_0386585 | 3300060353 | Bacteria | 1221 |
| 1333 | Ga0501082_0756606 | 3300060353 | Bacteria | 850 |
| 1334 | Ga0501082_1151389 | 3300060353 | Bacteria | 678 |
| 1335 | Ga0466962_0386676 | 3300061719 | Bacteria | 699 |
| 1336 | Ga0530510_0000068 | 3300061734 | Bacteria | 51899 |
| 1337 | Ga0530510_0007312 | 3300061734 | Bacteria | 7685 |
| 1338 | Ga0530510_0033779 | 3300061734 | Bacteria | 3683 |
| 1339 | Ga0530510_0079841 | 3300061734 | Bacteria | 2380 |
| 1340 | Ga0530510_0558331 | 3300061734 | Bacteria | 870 |
| 1341 | Ga0530510_0834026 | 3300061734 | Unclassified | 704 |
| 1342 | 2513701298 | 2513237102 | Bacteria | 7703324 |
| 1343 | 2535518126 | 2534681796 | Bacteria | 7146037 |
| 1344 | 2552107569 | 2551306166 | Bacteria | 9731570 |
| 1345 | 2739288533 | 2738543020 | Bacteria | 5718238 |
| 1346 | 2739293845 | 2738543021 | Bacteria | 5718241 |
| 1347 | 2808903834 | 2808606373 | Bacteria | 4423627 |
| 1348 | 2885193908 | 2885192300 | Bacteria | 5882526 |
| 1349 | 2902585178 | 2902582711 | Bacteria | 6187705 |
| 1350 | 2906637957 | 2906635258 | Bacteria | 8601019 |
| 1351 | 2915360280 | 2915358134 | Bacteria | 6050864 |
| 1352 | 2939585690 | 2939582691 | Bacteria | 7088898 |
| 1353 | 3003932077 | 3003930520 | Bacteria | 5667563 |
| 1354 | 8005549010 | 8005542996 | Bacteria | 7077758 |
| 1355 | Ga0395898_0210033 | |||
| 1356 | CNAas_1004002 | |||
| 1357 | JGI24735J21928_10092228 | |||
| 1358 | JGI25156J39149_1007267 | |||
| 1359 | JGI25157J39369_1003833 | |||
| 1360 | JGI25406J46586_10000010 | |||
| 1361 | JGI25406J46586_10008789 | |||
| 1362 | Ga0055540_1017344 | |||
| 1363 | Ga0055540_1020312 | |||
| 1364 | Ga0058859_11603680 | |||
| 1365 | Ga0058863_11854324 | |||
| 1366 | Ga0058861_11844294 | |||
| 1367 | Ga0058860_11738728 | |||
| 1368 | Ga0058860_11924803 | |||
| 1369 | Ga0058860_12076197 | |||
| 1370 | Ga0058862_12208179 | |||
| 1371 | Ga0065704_10090112 | |||
| 1372 | Ga0065704_10100036 | |||
| 1373 | Ga0065712_10207421 | |||
| 1374 | Ga0065715_10209158 | |||
| 1375 | Ga0065715_10216462 | |||
| 1376 | Ga0065707_10085147 | |||
| 1377 | Ga0065707_10922474 | |||
| 1378 | Ga0070658_10040185 | |||
| 1379 | Ga0070658_10151983 | |||
| 1380 | Ga0070658_10246230 | |||
| 1381 | Ga0070676_10817220 | |||
| 1382 | Ga0070683_100014912 | |||
| 1383 | Ga0070683_100086029 | |||
| 1384 | Ga0070683_100827423 | |||
| 1385 | Ga0070683_101483235 | |||
| 1386 | Ga0070690_100093419 | |||
| 1387 | Ga0070690_100162746 | |||
| 1388 | Ga0070690_100182772 | |||
| 1389 | Ga0070670_100010861 | |||
| 1390 | Ga0070670_100452415 | |||
| 1391 | Ga0070677_10001124 | |||
| 1392 | Ga0068869_100261886 | |||
| 1393 | Ga0070666_10498570 | |||
| 1394 | Ga0070680_100011730 | |||
| 1395 | Ga0070680_100014807 | |||
| 1396 | Ga0070682_100025094 | |||
| 1397 | Ga0070682_100067299 | |||
| 1398 | Ga0068868_100000525 | |||
| 1399 | Ga0068868_100302307 | |||
| 1400 | Ga0070660_100295294 | |||
| 1401 | Ga0070660_100614145 | |||
| 1402 | Ga0070689_100000226 | |||
| 1403 | Ga0070689_100157580 | |||
| 1404 | Ga0070689_100449850 | |||
| 1405 | Ga0070689_101152478 | |||
| 1406 | Ga0070687_100116565 | |||
| 1407 | Ga0070661_100119021 | |||
| 1408 | Ga0070661_100327116 | |||
| 1409 | Ga0070668_100009781 | |||
| 1410 | Ga0070668_100024777 | |||
| 1411 | Ga0070668_100954375 | |||
| 1412 | Ga0070669_100015421 | |||
| 1413 | Ga0070669_100424422 | |||
| 1414 | Ga0070669_100851872 | |||
| 1415 | Ga0070675_100007932 | |||
| 1416 | Ga0070671_100018395 | |||
| 1417 | Ga0070671_100049277 | |||
| 1418 | Ga0070671_100059317 | |||
| 1419 | Ga0070671_100093279 | |||
| 1420 | Ga0070671_100344446 | |||
| 1421 | Ga0070671_100470122 | |||
| 1422 | Ga0070674_100029504 | |||
| 1423 | Ga0070674_100338863 | |||
| 1424 | Ga0070688_100000038 | |||
| 1425 | Ga0070688_100530030 | |||
| 1426 | Ga0070659_100023497 | |||
| 1427 | Ga0070667_100251471 | |||
| 1428 | Ga0070709_10757814 | |||
| 1429 | Ga0070714_100362752 | |||
| 1430 | Ga0070714_100801801 | |||
| 1431 | Ga0070713_100012168 | |||
| 1432 | Ga0070713_100047332 | |||
| 1433 | Ga0070713_100069706 | |||
| 1434 | Ga0070713_100782707 | |||
| 1435 | Ga0070710_10000737 | |||
| 1436 | Ga0070710_10481687 | |||
| 1437 | Ga0070710_10640751 | |||
| 1438 | Ga0070701_10628074 | |||
| 1439 | Ga0070711_100001753 | |||
| 1440 | Ga0070711_100327369 | |||
| 1441 | Ga0070705_100172809 | |||
| 1442 | Ga0070705_100235543 | |||
| 1443 | Ga0070700_100654939 | |||
| 1444 | Ga0070694_100001269 | |||
| 1445 | Ga0070694_100004587 | |||
| 1446 | Ga0070694_100039353 | |||
| 1447 | Ga0070694_100282396 | |||
| 1448 | Ga0070694_100451075 | |||
| 1449 | Ga0070708_100000237 | |||
| 1450 | Ga0070708_100015706 | |||
| 1451 | Ga0070663_100370469 | |||
| 1452 | Ga0070663_100447624 | |||
| 1453 | Ga0070663_100786182 | |||
| 1454 | Ga0070678_100021178 | |||
| 1455 | Ga0070678_100047483 | |||
| 1456 | Ga0070678_100327429 | |||
| 1457 | Ga0070678_100502799 | |||
| 1458 | Ga0070678_100796864 | |||
| 1459 | Ga0070662_100056400 | |||
| 1460 | Ga0070662_100159473 | |||
| 1461 | Ga0070662_100270926 | |||
| 1462 | Ga0070681_10004421 | |||
| 1463 | Ga0070681_10090798 | |||
| 1464 | Ga0070681_10093332 | |||
| 1465 | Ga0070681_10102841 | |||
| 1466 | Ga0068867_100823348 | |||
| 1467 | Ga0070685_10380938 | |||
| 1468 | Ga0070707_100000239 | |||
| 1469 | Ga0070707_100072302 | |||
| 1470 | Ga0070707_100099741 | |||
| 1471 | Ga0070707_100523106 | |||
| 1472 | Ga0070707_101677378 | |||
| 1473 | Ga0070698_100002637 | |||
| 1474 | Ga0070698_100048344 | |||
| 1475 | Ga0070698_100089292 | |||
| 1476 | Ga0070698_100301896 | |||
| 1477 | Ga0070698_100576845 | |||
| 1478 | Ga0070699_100011849 | |||
| 1479 | Ga0070699_100050964 | |||
| 1480 | Ga0070699_100077704 | |||
| 1481 | Ga0070699_100147008 | |||
| 1482 | Ga0070699_100682690 | |||
| 1483 | Ga0070679_100002006 | |||
| 1484 | Ga0070679_100010620 | |||
| 1485 | Ga0070679_100016572 | |||
| 1486 | Ga0070679_100482497 | |||
| 1487 | Ga0070679_100807759 | |||
| 1488 | Ga0070679_100957189 | |||
| 1489 | Ga0070684_100038327 | |||
| 1490 | Ga0070684_100044887 | |||
| 1491 | Ga0070684_100269382 | |||
| 1492 | Ga0070697_100069815 | |||
| 1493 | Ga0070697_100074798 | |||
| 1494 | Ga0068853_100000427 | |||
| 1495 | Ga0068853_101039661 | |||
| 1496 | Ga0068853_101573678 | |||
| 1497 | Ga0070672_100001493 | |||
| 1498 | Ga0070672_100699250 | |||
| 1499 | Ga0070672_100785065 | |||
| 1500 | Ga0070672_101136034 | |||
| 1501 | Ga0070686_100062583 | |||
| 1502 | Ga0070686_100106638 | |||
| 1503 | Ga0070686_100499915 | |||
| 1504 | Ga0070695_100355807 | |||
| 1505 | Ga0070695_100371126 | |||
| 1506 | Ga0070696_100024052 | |||
| 1507 | Ga0070696_100070370 | |||
| 1508 | Ga0070696_100110970 | |||
| 1509 | Ga0070696_100270891 | |||
| 1510 | Ga0070693_100011117 | |||
| 1511 | Ga0070693_100116709 | |||
| 1512 | Ga0070665_100006034 | |||
| 1513 | Ga0070665_100018589 | |||
| 1514 | Ga0070665_100150114 | |||
| 1515 | Ga0070665_100257240 | |||
| 1516 | Ga0070665_100414013 | |||
| 1517 | Ga0070665_100441161 | |||
| 1518 | Ga0070665_101209221 | |||
| 1519 | Ga0070665_101589587 | |||
| 1520 | Ga0070704_100752094 | |||
| 1521 | Ga0070704_101221077 | |||
| 1522 | Ga0068855_100060062 | |||
| 1523 | Ga0068855_100077079 | |||
| 1524 | Ga0070664_100050270 | |||
| 1525 | Ga0070664_100066190 | |||
| 1526 | Ga0070664_100146805 | |||
| 1527 | Ga0070664_100244648 | |||
| 1528 | Ga0070664_100309431 | |||
| 1529 | Ga0068857_100003463 | |||
| 1530 | Ga0068857_100068756 | |||
| 1531 | Ga0068857_100104257 | |||
| 1532 | Ga0068857_100522091 | |||
| 1533 | Ga0068857_101252312 | |||
| 1534 | Ga0068857_101295965 | |||
| 1535 | Ga0068854_100712463 | |||
| 1536 | Ga0068854_100800870 | |||
| 1537 | Ga0068854_101226603 | |||
| 1538 | Ga0068856_100018429 | |||
| 1539 | Ga0068856_100107804 | |||
| 1540 | Ga0068856_100472507 | |||
| 1541 | Ga0070702_100494869 | |||
| 1542 | Ga0068859_100005606 | |||
| 1543 | Ga0068859_100071916 | |||
| 1544 | Ga0068859_100239070 | |||
| 1545 | Ga0068864_100002788 | |||
| 1546 | Ga0068864_100064984 | |||
| 1547 | Ga0068864_100160645 | |||
| 1548 | Ga0068864_100174375 | |||
| 1549 | Ga0068864_100433300 | |||
| 1550 | Ga0068864_100741806 | |||
| 1551 | Ga0068864_101293238 | |||
| 1552 | Ga0068866_10650128 | |||
| 1553 | Ga0068861_100346996 | |||
| 1554 | Ga0068861_100778050 | |||
| 1555 | Ga0068851_10351263 | |||
| 1556 | Ga0068863_100041601 | |||
| 1557 | Ga0068863_100043177 | |||
| 1558 | Ga0068863_100043287 | |||
| 1559 | Ga0068863_100131930 | |||
| 1560 | Ga0068863_100479384 | |||
| 1561 | Ga0068863_100668702 | |||
| 1562 | Ga0068858_100383239 | |||
| 1563 | Ga0068858_100625171 | |||
| 1564 | Ga0068858_100822420 | |||
| 1565 | Ga0068858_101211710 | |||
| 1566 | Ga0068860_100036750 | |||
| 1567 | Ga0068860_100761740 | |||
| 1568 | Ga0068860_101413238 | |||
| 1569 | Ga0068860_101570719 | |||
| 1570 | Ga0068862_100014830 | |||
| 1571 | Ga0068862_100202569 | |||
| 1572 | Ga0068862_100245488 | |||
| 1573 | Ga0068862_100523773 | |||
| 1574 | Ga0081455_10328273 | |||
| 1575 | Ga0081538_10008601 | |||
| 1576 | Ga0081540_1088867 | |||
| 1577 | Ga0081539_10000003 | |||
| 1578 | Ga0081539_10000346 | |||
| 1579 | Ga0081539_10012442 | |||
| 1580 | Ga0081539_10193063 | |||
| 1581 | Ga0070717_10154099 | |||
| 1582 | Ga0070717_10327410 | |||
| 1583 | Ga0070717_10762421 | |||
| 1584 | Ga0075365_10016131 | |||
| 1585 | Ga0075365_10102255 | |||
| 1586 | Ga0075368_10004650 | |||
| 1587 | Ga0075368_10041948 | |||
| 1588 | Ga0075368_10071246 | |||
| 1589 | Ga0075368_10076377 | |||
| 1590 | Ga0075363_100053470 | |||
| 1591 | Ga0075363_100091523 | |||
| 1592 | Ga0075363_100139908 | |||
| 1593 | Ga0075364_10003451 | |||
| 1594 | Ga0075364_10019486 | |||
| 1595 | Ga0075364_10064789 | |||
| 1596 | Ga0075432_10161220 | |||
| 1597 | Ga0070715_10632920 | |||
| 1598 | Ga0070716_100011786 | |||
| 1599 | Ga0070716_100040477 | |||
| 1600 | Ga0070712_100032208 | |||
| 1601 | Ga0070712_101071439 | |||
| 1602 | Ga0075362_10225478 | |||
| 1603 | Ga0075367_10019688 | |||
| 1604 | Ga0075367_10020460 | |||
| 1605 | Ga0075367_10057257 | |||
| 1606 | Ga0075367_10070419 | |||
| 1607 | Ga0075367_10189341 | |||
| 1608 | Ga0075367_10266956 | |||
| 1609 | Ga0075367_10475074 | |||
| 1610 | Ga0075369_10091204 | |||
| 1611 | Ga0075366_10009393 | |||
| 1612 | Ga0075366_10052816 | |||
| 1613 | Ga0075366_10061096 | |||
| 1614 | Ga0075366_10338233 | |||
| 1615 | Ga0097621_100113883 | |||
| 1616 | Ga0097621_100350295 | |||
| 1617 | Ga0075370_10002181 | |||
| 1618 | Ga0075370_10012926 | |||
| 1619 | Ga0075370_10013329 | |||
| 1620 | Ga0075370_10163258 | |||
| 1621 | Ga0075370_10605547 | |||
| 1622 | Ga0068871_100222846 | |||
| 1623 | Ga0068871_100252542 | |||
| 1624 | Ga0068871_100427329 | |||
| 1625 | Ga0068871_100433588 | |||
| 1626 | Ga0068871_100843462 | |||
| 1627 | Ga0068871_100863105 | |||
| 1628 | Ga0075428_100017272 | |||
| 1629 | Ga0075428_100502573 | |||
| 1630 | Ga0075428_101493254 | |||
| 1631 | Ga0075430_100028642 | |||
| 1632 | Ga0075430_100156406 | |||
| 1633 | Ga0075430_100690990 | |||
| 1634 | Ga0075431_100043836 | |||
| 1635 | Ga0075431_100271134 | |||
| 1636 | Ga0075431_100379509 | |||
| 1637 | Ga0075433_10058338 | |||
| 1638 | Ga0075433_10191017 | |||
| 1639 | Ga0075433_11119736 | |||
| 1640 | Ga0075434_100015294 | |||
| 1641 | Ga0075434_100049816 | |||
| 1642 | Ga0075434_100454676 | |||
| 1643 | Ga0075434_100661105 | |||
| 1644 | Ga0075434_100706109 | |||
| 1645 | Ga0075429_100237703 | |||
| 1646 | Ga0068865_100001272 | |||
| 1647 | Ga0068865_100452620 | |||
| 1648 | Ga0068865_100787492 | |||
| 1649 | Ga0075436_100188202 | |||
| 1650 | Ga0097620_100005606 | |||
| 1651 | Ga0097620_100071915 | |||
| 1652 | Ga0097620_100239042 | |||
| 1653 | Ga0075435_100014528 | |||
| 1654 | Ga0075435_100552806 | |||
| 1655 | Ga0099794_10353221 | |||
| 1656 | Ga0105240_10103772 | |||
| 1657 | Ga0105240_10990527 | |||
| 1658 | Ga0111539_10003504 | |||
| 1659 | Ga0111539_10022534 | |||
| 1660 | Ga0111539_10042358 | |||
| 1661 | Ga0111539_10049952 | |||
| 1662 | Ga0111539_10257027 | |||
| 1663 | Ga0105245_10493826 | |||
| 1664 | Ga0105245_10807139 | |||
| 1665 | Ga0105247_10227955 | |||
| 1666 | Ga0105247_10344493 | |||
| 1667 | Ga0105247_10680063 | |||
| 1668 | Ga0114129_10119779 | |||
| 1669 | Ga0114129_10436978 | |||
| 1670 | Ga0114129_11108676 | |||
| 1671 | Ga0105243_10526630 | |||
| 1672 | Ga0105243_10808955 | |||
| 1673 | Ga0105243_10990212 | |||
| 1674 | Ga0105243_11401465 | |||
| 1675 | Ga0105241_10040133 | |||
| 1676 | Ga0105241_10073261 | |||
| 1677 | Ga0105241_10194450 | |||
| 1678 | Ga0105241_10966345 | |||
| 1679 | Ga0105241_10999164 | |||
| 1680 | Ga0105241_11228106 | |||
| 1681 | Ga0105242_10169898 | |||
| 1682 | Ga0105242_10727088 | |||
| 1683 | Ga0105242_11268987 | |||
| 1684 | Ga0105242_11325761 | |||
| 1685 | Ga0105242_11934108 | |||
| 1686 | Ga0105248_10001957 | |||
| 1687 | Ga0105248_10022278 | |||
| 1688 | Ga0105248_10059986 | |||
| 1689 | Ga0105248_10112372 | |||
| 1690 | Ga0105248_10119519 | |||
| 1691 | Ga0105248_10119532 | |||
| 1692 | Ga0105248_10218137 | |||
| 1693 | Ga0105248_10376167 | |||
| 1694 | Ga0105248_10512838 | |||
| 1695 | Ga0105248_11035499 | |||
| 1696 | Ga0105248_11368471 | |||
| 1697 | Ga0105237_10083727 | |||
| 1698 | Ga0105237_10109525 | |||
| 1699 | Ga0105237_10432546 | |||
| 1700 | Ga0105237_11023447 | |||
| 1701 | Ga0105237_11173966 | |||
| 1702 | Ga0105237_11227813 | |||
| 1703 | Ga0105238_10111151 | |||
| 1704 | Ga0105238_10116908 | |||
| 1705 | Ga0105238_10393550 | |||
| 1706 | Ga0105249_10045948 | |||
| 1707 | Ga0105249_10220242 | |||
| 1708 | Ga0105249_10313282 | |||
| 1709 | Ga0105239_10018055 | |||
| 1710 | Ga0105239_10029804 | |||
| 1711 | Ga0105239_10313205 | |||
| 1712 | Ga0105239_10424038 | |||
| 1713 | Ga0105239_11023041 | |||
| 1714 | Ga0105246_10268324 | |||
| 1715 | Ga0105246_10836704 | |||
| 1716 | Ga0157373_10283330 | |||
| 1717 | Ga0157370_10314544 | |||
| 1718 | Ga0157370_10728599 | |||
| 1719 | Ga0157369_10072655 | |||
| 1720 | Ga0157369_10523991 | |||
| 1721 | Ga0157369_10901694 | |||
| 1722 | Ga0157369_10970687 | |||
| 1723 | Ga0157374_10031830 | |||
| 1724 | Ga0157374_10060993 | |||
| 1725 | Ga0157374_10100534 | |||
| 1726 | Ga0157374_10212883 | |||
| 1727 | Ga0157374_10861698 | |||
| 1728 | Ga0157378_10326093 | |||
| 1729 | Ga0157378_10447392 | |||
| 1730 | Ga0157378_12257621 | |||
| 1731 | Ga0163162_10033581 | |||
| 1732 | Ga0163162_10238432 | |||
| 1733 | Ga0163162_10309085 | |||
| 1734 | Ga0163162_10542850 | |||
| 1735 | Ga0163162_10804837 | |||
| 1736 | Ga0163162_10918316 | |||
| 1737 | Ga0163162_10937522 | |||
| 1738 | Ga0163162_11439754 | |||
| 1739 | Ga0163162_11563681 | |||
| 1740 | Ga0157372_10019830 | |||
| 1741 | Ga0157372_10060434 | |||
| 1742 | Ga0157372_10090692 | |||
| 1743 | Ga0157372_10194122 | |||
| 1744 | Ga0157372_10292483 | |||
| 1745 | Ga0157372_11037586 | |||
| 1746 | Ga0157372_11515434 | |||
| 1747 | Ga0157375_10079664 | |||
| 1748 | Ga0157375_10263607 | |||
| 1749 | Ga0157375_11207821 | |||
| 1750 | Ga0157375_11657834 | |||
| 1751 | Ga0163163_10074915 | |||
| 1752 | Ga0163163_10090395 | |||
| 1753 | Ga0163163_10096115 | |||
| 1754 | Ga0163163_10290728 | |||
| 1755 | Ga0163163_10752752 | |||
| 1756 | Ga0163163_10795224 | |||
| 1757 | Ga0163163_10863915 | |||
| 1758 | Ga0157380_10019554 | |||
| 1759 | Ga0157380_10099011 | |||
| 1760 | Ga0157380_10414949 | |||
| 1761 | Ga0157380_10545998 | |||
| 1762 | Ga0157380_10742204 | |||
| 1763 | Ga0157380_11238853 | |||
| 1764 | Ga0157380_11332854 | |||
| 1765 | Ga0157377_10131636 | |||
| 1766 | Ga0157377_10246367 | |||
| 1767 | Ga0157379_10027114 | |||
| 1768 | Ga0157379_10947718 | |||
| 1769 | Ga0157379_11238136 | |||
| 1770 | Ga0157376_10835963 | |||
| 1771 | Ga0157376_10870292 | |||
| 1772 | Ga0163161_10576125 | |||
| 1773 | Ga0163161_10758443 | |||
| 1774 | Ga0163161_10967278 | |||
| 1775 | Ga0197907_10250064 | |||
| 1776 | Ga0206356_10835401 | |||
| 1777 | Ga0206352_11263230 | |||
| 1778 | Ga0206350_10254172 | |||
| 1779 | Ga0154015_1216348 | |||
| 1780 | Ga0213876_10069700 | |||
| 1781 | Ga0213875_10004794 | |||
| 1782 | Ga0209646_1005277 | |||
| 1783 | Ga0209026_1001118 | |||
| 1784 | Ga0209759_1001219 | |||
| 1785 | Ga0209050_1065246 | |||
| 1786 | Ga0209051_1000772 | |||
| 1787 | Ga0209051_1023639 | |||
| 1788 | Ga0209051_1024759 | |||
| 1789 | Ga0207697_10226645 | |||
| 1790 | Ga0207656_10099209 | |||
| 1791 | Ga0207682_10000542 | |||
| 1792 | Ga0207692_10000651 | |||
| 1793 | Ga0207692_10140432 | |||
| 1794 | Ga0207692_10456028 | |||
| 1795 | Ga0207692_10599884 | |||
| 1796 | Ga0207692_10804841 | |||
| 1797 | Ga0207710_10074763 | |||
| 1798 | Ga0207688_10038134 | |||
| 1799 | Ga0207680_10123163 | |||
| 1800 | Ga0207680_10462627 | |||
| 1801 | Ga0207647_10020107 | |||
| 1802 | Ga0207647_10620308 | |||
| 1803 | Ga0207647_10623765 | |||
| 1804 | Ga0207699_10000194 | |||
| 1805 | Ga0207645_10112689 | |||
| 1806 | Ga0207705_10053688 | |||
| 1807 | Ga0207705_10055357 | |||
| 1808 | Ga0207654_10048227 | |||
| 1809 | Ga0207654_10114069 | |||
| 1810 | Ga0207654_10159068 | |||
| 1811 | Ga0207654_10599717 | |||
| 1812 | Ga0207654_11145552 | |||
| 1813 | Ga0207707_10063588 | |||
| 1814 | Ga0207707_10140082 | |||
| 1815 | Ga0207707_10247833 | |||
| 1816 | Ga0207695_10936018 | |||
| 1817 | Ga0207671_10193280 | |||
| 1818 | Ga0207671_10687608 | |||
| 1819 | Ga0207671_10771588 | |||
| 1820 | Ga0207693_10043037 | |||
| 1821 | Ga0207693_10320999 | |||
| 1822 | Ga0207663_10003668 | |||
| 1823 | Ga0207663_10421442 | |||
| 1824 | Ga0207663_10726502 | |||
| 1825 | Ga0207663_10905286 | |||
| 1826 | Ga0207660_10024051 | |||
| 1827 | Ga0207660_10026227 | |||
| 1828 | Ga0207660_10389556 | |||
| 1829 | Ga0207660_10418892 | |||
| 1830 | Ga0207662_10119875 | |||
| 1831 | Ga0207657_10000952 | |||
| 1832 | Ga0207657_10505653 | |||
| 1833 | Ga0207657_10508960 | |||
| 1834 | Ga0207649_10316650 | |||
| 1835 | Ga0207649_11248938 | |||
| 1836 | Ga0207652_10002763 | |||
| 1837 | Ga0207652_10099865 | |||
| 1838 | Ga0207652_10416559 | |||
| 1839 | Ga0207646_10011382 | |||
| 1840 | Ga0207646_10117032 | |||
| 1841 | Ga0207681_10206063 | |||
| 1842 | Ga0207681_10226090 | |||
| 1843 | Ga0207681_10974220 | |||
| 1844 | Ga0207694_10001305 | |||
| 1845 | Ga0207694_10272448 | |||
| 1846 | Ga0207694_10332518 | |||
| 1847 | Ga0207650_10036850 | |||
| 1848 | Ga0207650_10779971 | |||
| 1849 | Ga0207650_10782575 | |||
| 1850 | Ga0207650_10934191 | |||
| 1851 | Ga0207659_10070253 | |||
| 1852 | Ga0207659_10074883 | |||
| 1853 | Ga0207659_11268183 | |||
| 1854 | Ga0207687_10516820 | |||
| 1855 | Ga0207687_11090538 | |||
| 1856 | Ga0207700_10074521 | |||
| 1857 | Ga0207700_10089288 | |||
| 1858 | Ga0207700_10249808 | |||
| 1859 | Ga0207700_11142953 | |||
| 1860 | Ga0207664_10778060 | |||
| 1861 | Ga0207664_10791670 | |||
| 1862 | Ga0207644_10033525 | |||
| 1863 | Ga0207644_10067322 | |||
| 1864 | Ga0207644_10160307 | |||
| 1865 | Ga0207644_10832476 | |||
| 1866 | Ga0207690_10057850 | |||
| 1867 | Ga0207690_10232272 | |||
| 1868 | Ga0207706_10000849 | |||
| 1869 | Ga0207706_10015018 | |||
| 1870 | Ga0207706_10187810 | |||
| 1871 | Ga0207706_10194881 | |||
| 1872 | Ga0207706_10633837 | |||
| 1873 | Ga0207706_10934419 | |||
| 1874 | Ga0207686_10962600 | |||
| 1875 | Ga0207709_10317752 | |||
| 1876 | Ga0207709_10462752 | |||
| 1877 | Ga0207670_10000448 | |||
| 1878 | Ga0207669_10019579 | |||
| 1879 | Ga0207704_10000435 | |||
| 1880 | Ga0207704_10340450 | |||
| 1881 | Ga0207704_10872519 | |||
| 1882 | Ga0207704_11320302 | |||
| 1883 | Ga0207665_10021480 | |||
| 1884 | Ga0207665_10054108 | |||
| 1885 | Ga0207665_10240803 | |||
| 1886 | Ga0207665_10493483 | |||
| 1887 | Ga0207691_10004521 | |||
| 1888 | Ga0207691_10230530 | |||
| 1889 | Ga0207691_10720325 | |||
| 1890 | Ga0207711_10001596 | |||
| 1891 | Ga0207711_10030078 | |||
| 1892 | Ga0207711_10156249 | |||
| 1893 | Ga0207711_10239513 | |||
| 1894 | Ga0207711_10245493 | |||
| 1895 | Ga0207711_10329176 | |||
| 1896 | Ga0207711_10399407 | |||
| 1897 | Ga0207711_10754049 | |||
| 1898 | Ga0207689_10268342 | |||
| 1899 | Ga0207661_10186781 | |||
| 1900 | Ga0207661_10705911 | |||
| 1901 | Ga0207661_11073606 | |||
| 1902 | Ga0207661_11252047 | |||
| 1903 | Ga0207661_11282534 | |||
| 1904 | Ga0207679_10032054 | |||
| 1905 | Ga0207679_10275799 | |||
| 1906 | Ga0207679_10392247 | |||
| 1907 | Ga0207679_10685209 | |||
| 1908 | Ga0207667_10227574 | |||
| 1909 | Ga0207667_10416537 | |||
| 1910 | Ga0207667_10670620 | |||
| 1911 | Ga0207667_10844423 | |||
| 1912 | Ga0207712_10217066 | |||
| 1913 | Ga0207712_10279948 | |||
| 1914 | Ga0207712_10511435 | |||
| 1915 | Ga0207712_11142392 | |||
| 1916 | Ga0207668_10002784 | |||
| 1917 | Ga0207668_10033380 | |||
| 1918 | Ga0207668_10428850 | |||
| 1919 | Ga0207668_10642862 | |||
| 1920 | Ga0207668_10690681 | |||
| 1921 | Ga0207668_10802545 | |||
| 1922 | Ga0207640_10241540 | |||
| 1923 | Ga0207640_10612802 | |||
| 1924 | Ga0207640_10897843 | |||
| 1925 | Ga0207677_10000069 | |||
| 1926 | Ga0207677_10642603 | |||
| 1927 | Ga0207703_10270090 | |||
| 1928 | Ga0207703_10558340 | |||
| 1929 | Ga0207703_10853474 | |||
| 1930 | Ga0207639_10000936 | |||
| 1931 | Ga0207639_10044506 | |||
| 1932 | Ga0207639_10253489 | |||
| 1933 | Ga0207639_10418932 | |||
| 1934 | Ga0207639_10595617 | |||
| 1935 | Ga0207639_10620402 | |||
| 1936 | Ga0207639_10930015 | |||
| 1937 | Ga0207678_10034267 | |||
| 1938 | Ga0207678_10145742 | |||
| 1939 | Ga0207678_10347643 | |||
| 1940 | Ga0207678_10530678 | |||
| 1941 | Ga0207708_10182093 | |||
| 1942 | Ga0207708_10782379 | |||
| 1943 | Ga0207702_10097679 | |||
| 1944 | Ga0207702_10136729 | |||
| 1945 | Ga0207702_10363357 | |||
| 1946 | Ga0207702_10990215 | |||
| 1947 | Ga0207641_10046055 | |||
| 1948 | Ga0207641_10098214 | |||
| 1949 | Ga0207641_10166814 | |||
| 1950 | Ga0207641_10420196 | |||
| 1951 | Ga0207641_10949849 | |||
| 1952 | Ga0207641_11359649 | |||
| 1953 | Ga0207641_11616182 | |||
| 1954 | Ga0207641_12019031 | |||
| 1955 | Ga0207648_10853437 | |||
| 1956 | Ga0207648_11682561 | |||
| 1957 | Ga0207676_10002300 | |||
| 1958 | Ga0207676_10010779 | |||
| 1959 | Ga0207676_10066825 | |||
| 1960 | Ga0207676_10168228 | |||
| 1961 | Ga0207676_10637500 | |||
| 1962 | Ga0207674_10006167 | |||
| 1963 | Ga0207674_10011453 | |||
| 1964 | Ga0207674_10253498 | |||
| 1965 | Ga0207674_10518147 | |||
| 1966 | Ga0207674_10705282 | |||
| 1967 | Ga0207675_100259286 | |||
| 1968 | Ga0207675_100410990 | |||
| 1969 | Ga0207675_100820356 | |||
| 1970 | Ga0207683_10046102 | |||
| 1971 | Ga0207683_10065177 | |||
| 1972 | Ga0207683_10190797 | |||
| 1973 | Ga0207683_10197404 | |||
| 1974 | Ga0207683_10209690 | |||
| 1975 | Ga0207683_10599503 | |||
| 1976 | Ga0207698_10181741 | |||
| 1977 | Ga0207698_10501225 | |||
| 1978 | Ga0207698_10994659 | |||
| 1979 | Ga0207698_11084122 | |||
| 1980 | Ga0209588_1201530 | |||
| 1981 | Ga0209813_10015168 | |||
| 1982 | Ga0209813_10016619 | |||
| 1983 | Ga0209813_10034278 | |||
| 1984 | Ga0207428_10015869 | |||
| 1985 | Ga0207428_10190787 | |||
| 1986 | Ga0207428_10236053 | |||
| 1987 | Ga0207428_10360977 | |||
| 1988 | Ga0268266_10033801 | |||
| 1989 | Ga0268266_10294203 | |||
| 1990 | Ga0268265_10009031 | |||
| 1991 | Ga0268265_10060507 | |||
| 1992 | Ga0268265_10198244 | |||
| 1993 | Ga0268265_11116452 | |||
| 1994 | Ga0268264_10035100 | |||
| 1995 | Ga0268264_10768508 | |||
| 1996 | Ga0268264_10942713 | |||
| 1997 | Ga0268264_11011008 | |||
| 1998 | Ga0265334_10003926 | |||
| 1999 | Ga0265318_10000016 | |||
| 2000 | Ga0307515_10086670 | |||
| 2001 | Ga0307515_10463390 | |||
| 2002 | Ga0265338_10189069 | |||
| 2003 | Ga0265338_10814281 | |||
| 2004 | Ga0265324_10013329 | |||
| 2005 | Ga0265767_108251 | |||
| 2006 | Ga0265332_10030665 | |||
| 2007 | Ga0265328_10000019 | |||
| 2008 | Ga0265328_10007021 | |||
| 2009 | Ga0265320_10003281 | |||
| 2010 | Ga0265339_10382783 | |||
| 2011 | Ga0265331_10025888 | |||
| 2012 | Ga0265316_10110709 | |||
| 2013 | Ga0265316_10939340 | |||
| 2014 | Ga0307513_10084886 | |||
| 2015 | Ga0307513_10127195 | |||
| 2016 | Ga0307408_100008603 | |||
| 2017 | Ga0307408_100042714 | |||
| 2018 | Ga0307408_100106374 | |||
| 2019 | Ga0307408_100111336 | |||
| 2020 | Ga0307408_100144442 | |||
| 2021 | Ga0307408_100336488 | |||
| 2022 | Ga0265313_10002768 | |||
| 2023 | Ga0307508_10096487 | |||
| 2024 | Ga0307508_10323461 | |||
| 2025 | Ga0316579_10013022 | |||
| 2026 | Ga0265314_10000596 | |||
| 2027 | Ga0316576_10348290 | |||
| 2028 | Ga0316578_10052128 | |||
| 2029 | Ga0316578_10124084 | |||
| 2030 | Ga0307516_10002446 | |||
| 2031 | Ga0307516_10008341 | |||
| 2032 | Ga0307516_10009998 | |||
| 2033 | Ga0307516_10420643 | |||
| 2034 | Ga0307405_10003502 | |||
| 2035 | Ga0307405_10084737 | |||
| 2036 | Ga0307405_10098809 | |||
| 2037 | Ga0307405_10280897 | |||
| 2038 | Ga0307413_10002867 | |||
| 2039 | Ga0307413_10027727 | |||
| 2040 | Ga0307413_10091708 | |||
| 2041 | Ga0307413_10388108 | |||
| 2042 | Ga0307410_10006693 | |||
| 2043 | Ga0307410_10007880 | |||
| 2044 | Ga0307410_10065252 | |||
| 2045 | Ga0307410_10107092 | |||
| 2046 | Ga0307410_10122219 | |||
| 2047 | Ga0307410_10243065 | |||
| 2048 | Ga0307410_10701516 | |||
| 2049 | Ga0307406_10003830 | |||
| 2050 | Ga0307407_10001158 | |||
| 2051 | Ga0307407_10034240 | |||
| 2052 | Ga0307407_10397934 | |||
| 2053 | Ga0307412_10150729 | |||
| 2054 | Ga0307412_10345644 | |||
| 2055 | Ga0307412_10395974 | |||
| 2056 | Ga0307412_10471288 | |||
| 2057 | Ga0307409_100003996 | |||
| 2058 | Ga0307409_100013589 | |||
| 2059 | Ga0307409_100047015 | |||
| 2060 | Ga0307409_100241018 | |||
| 2061 | Ga0307409_100426045 | |||
| 2062 | Ga0307409_100542967 | |||
| 2063 | Ga0307416_100006864 | |||
| 2064 | Ga0307416_100015598 | |||
| 2065 | Ga0307416_100062445 | |||
| 2066 | Ga0307416_100258211 | |||
| 2067 | Ga0307416_100575719 | |||
| 2068 | Ga0307416_101390618 | |||
| 2069 | Ga0307416_101558741 | |||
| 2070 | Ga0307414_10018888 | |||
| 2071 | Ga0307414_10035853 | |||
| 2072 | Ga0307414_10076263 | |||
| 2073 | Ga0307411_10002709 | |||
| 2074 | Ga0307411_10018142 | |||
| 2075 | Ga0307411_10030603 | |||
| 2076 | Ga0307411_10034726 | |||
| 2077 | Ga0307411_10237776 | |||
| 2078 | Ga0307411_10255728 | |||
| 2079 | Ga0307411_11459179 | |||
| 2080 | Ga0307415_100055513 | |||
| 2081 | Ga0307415_100067894 | |||
| 2082 | Ga0307415_100118379 | |||
| 2083 | Ga0307415_100121128 | |||
| 2084 | Ga0307415_100267440 | |||
| 2085 | Ga0307415_100489996 | |||
| 2086 | Ga0373948_0108667 | |||
| 2087 | Ga0373923_0092188 | |||
| 2088 | Ga0373936_0000302 | |||
| 2089 | Ga0373939_0101425 | |||
| 2090 | Ga0373945_0004590 | |||
| 2091 | Ga0373945_0141998 | |||
| 2092 | Ga0373953_0001387 | |||
| 2093 | Ga0373954_0001462 | |||
| 2094 | Ga0373956_0104761 | |||
| 2095 | Ga0373956_0133312 | |||
| 2096 | Ga0373956_0457155 | |||
| 2097 | Ga0373957_0001060 | |||
| 2098 | Ga0373943_0096528 | |||
| 2099 | Ga0373946_0001689 | |||
| 2100 | Ga0373946_0386887 | |||
| 2101 | Ga0373955_0000030 | |||
| 2102 | Ga0373955_0136641 | |||
| 2103 | Ga0373962_0168592 | |||
| 2104 | Ga0316574_0130501 | |||
| 2105 | Ga0373931_0007107 | |||
| 2106 | Ga0373931_0315580 | |||
| 2107 | Ga0373935_0000187 | |||
| 2108 | Ga0373935_0057356 | |||
| 2109 | Ga0373935_0261567 | |||
| 2110 | Ga0373927_0057722 | |||
| 2111 | Ga0373927_0069442 | |||
| 2112 | Ga0373927_0253441 | |||
| 2113 | Ga0373933_0002169 | |||
| 2114 | Ga0373933_0301542 | |||
| 2115 | Ga0373947_0000376 | |||
| 2116 | Ga0373947_0105686 | |||
| 2117 | Ga0373947_0355314 | |||
| 2118 | Ga0373937_0000004 | |||
| 2119 | Ga0373937_0155255 | |||
| 2120 | Ga0373937_0413261 | |||
| 2121 | Ga0373937_0490766 | |||
| 2122 | Ga0316582_0038470 | |||
| 2123 | Ga0316582_0256180 | |||
| 2124 | Ga0316584_0285895 | |||
| 2125 | Ga0373925_0000095 | |||
| 2126 | Ga0373925_0040021 | |||
| 2127 | Ga0373925_0179948 | |||
| 2128 | Ga0373925_0364512 | |||
| 2129 | Ga0373925_0533927 | |||
| 2130 | Ga0395899_0299799 | |||
| 2131 | Ga0395898_0116607 | |||
| 2132 | Ga0395898_0837125 | |||
| 2133 | Ga0395905_0124177 | |||
| 2134 | Ga0395905_0252221 | |||
| 2135 | Ga0316581_0002183 | |||
| 2136 | Ga0316581_0014742 | |||
| 2137 | Ga0436364_0093884 | |||
| 2138 | Ga0395901_0000076 | |||
| 2139 | Ga0395901_0261083 | |||
| 2140 | Ga0395901_0602987 | |||
| 2141 | Ga0395901_1170767 | |||
| 2142 | Ga0400490_48312 | |||
| 2143 | Ga0400485_19896 | |||
| 2144 | Ga0400488_62281 | |||
| 2145 | Ga0400483_108538 | |||
| 2146 | Ga0436365_0727857 | |||
| 2147 | Ga0436365_0858454 | |||
| 2148 | Ga0436365_1236325 | |||
| 2149 | Ga0436363_0415220 | |||
| 2150 | Ga0439436_0001347 | |||
| 2151 | Ga0439436_0125249 | |||
| 2152 | Ga0439438_001161 | |||
| 2153 | Ga0439439_0040254 | |||
| 2154 | Ga0439447_000738 | |||
| 2155 | Ga0439447_027904 | |||
| 2156 | Ga0439453_0008205 | |||
| 2157 | Ga0439466_0003579 | |||
| 2158 | Ga0439465_0003601 | |||
| 2159 | Ga0451807_2035927 | |||
| 2160 | Ga0439431_0054414 | |||
| 2161 | Ga0439431_0108336 | |||
| 2162 | Ga0439437_001050 | |||
| 2163 | Ga0439437_001357 | |||
| 2164 | Ga0439442_006004 | |||
| 2165 | Ga0439443_098706 | |||
| 2166 | Ga0439448_0073009 | |||
| 2167 | Ga0439432_043948 | |||
| 2168 | Ga0439452_007612 | |||
| 2169 | Ga0439455_0028953 | |||
| 2170 | Ga0439455_0037931 | |||
| 2171 | Ga0439456_045989 | |||
| 2172 | Ga0439462_0002090 | |||
| 2173 | Ga0450911_000004 | |||
| 2174 | Ga0450912_001939 | |||
| 2175 | Ga0450913_000050 | |||
| 2176 | Ga0450913_011032 | |||
| 2177 | Ga0450917_000165 | |||
| 2178 | Ga0450888_001082 | |||
| 2179 | Ga0450890_000388 | |||
| 2180 | Ga0450890_023809 | |||
| 2181 | Ga0450891_000011 | |||
| 2182 | Ga0450892_000573 | |||
| 2183 | Ga0450894_011519 | |||
| 2184 | Ga0450894_031496 | |||
| 2185 | Ga0450896_016470 | |||
| 2186 | Ga0450898_024920 | |||
| 2187 | Ga0450904_000040 | |||
| 2188 | Ga0450889_000398 | |||
| 2189 | Ga0450906_001797 | |||
| 2190 | Ga0450906_021416 | |||
| 2191 | Ga0439446_0001360 | |||
| 2192 | Ga0439446_0020338 | |||
| 2193 | Ga0450909_003075 | |||
| 2194 | Ga0439434_0018991 | |||
| 2195 | Ga0439435_0005821 | |||
| 2196 | Ga0439435_0007076 | |||
| 2197 | Ga0439435_0031705 | |||
| 2198 | Ga0439444_0063457 | |||
| 2199 | Ga0439459_0007596 | |||
| 2200 | Ga0439459_0010685 | |||
| 2201 | Ga0439460_0129142 | |||
| 2202 | Ga0439460_0210068 | |||
| 2203 | Ga0450916_000704 | |||
| 2204 | Ga0450893_0001119 | |||
| 2205 | Ga0450893_0008316 | |||
| 2206 | Ga0450901_004880 | |||
| 2207 | Ga0451577_0179793 | |||
| 2208 | Ga0451577_0259557 | |||
| 2209 | Ga0451577_0498538 | |||
| 2210 | Ga0451577_1054026 | |||
| 2211 | Ga0451577_1127112 | |||
| 2212 | Ga0466963_0088821 | |||
| 2213 | Ga0453684_0175604 | |||
| 2214 | Ga0451576_0058799 | |||
| 2215 | Ga0451576_0066178 | |||
| 2216 | Ga0451576_1356304 | |||
| 2217 | Ga0466958_0005307 | |||
| 2218 | Ga0466958_0028824 | |||
| 2219 | Ga0466967_0093324 | |||
| 2220 | Ga0466967_1023737 | |||
| 2221 | Ga0466967_1686557 | |||
| 2222 | Ga0495617_101072 | |||
| 2223 | Ga0495592_0000029 | |||
| 2224 | Ga0495603_0394666 | |||
| 2225 | Ga0495603_0550613 | |||
| 2226 | Ga0495590_0028274 | |||
| 2227 | Ga0495590_0068834 | |||
| 2228 | Ga0495629_0000008 | |||
| 2229 | Ga0495629_0036618 | |||
| 2230 | Ga0495629_0084638 | |||
| 2231 | Ga0495629_0598033 | |||
| 2232 | Ga0495638_0000093 | |||
| 2233 | Ga0495638_0000277 | |||
| 2234 | Ga0495638_0001726 | |||
| 2235 | Ga0495638_0145934 | |||
| 2236 | Ga0495638_0322298 | |||
| 2237 | Ga0495641_0036067 | |||
| 2238 | Ga0495641_0152737 | |||
| 2239 | Ga0495651_0000535 | |||
| 2240 | Ga0495653_0000045 | |||
| 2241 | Ga0495653_0267786 | |||
| 2242 | Ga0495580_0000217 | |||
| 2243 | Ga0495582_0271961 | |||
| 2244 | Ga0495582_0362881 | |||
| 2245 | Ga0495605_0021305 | |||
| 2246 | Ga0495639_0005034 | |||
| 2247 | Ga0495639_0146514 | |||
| 2248 | Ga0495664_0000004 | |||
| 2249 | Ga0495664_0779174 | |||
| 2250 | Ga0495584_0000028 | |||
| 2251 | Ga0495584_0035496 | |||
| 2252 | Ga0495584_0151269 | |||
| 2253 | Ga0495585_0000086 | |||
| 2254 | Ga0495585_0015642 | |||
| 2255 | Ga0495585_0098215 | |||
| 2256 | Ga0495594_0403129 | |||
| 2257 | Ga0495596_0001610 | |||
| 2258 | Ga0495607_0002640 | |||
| 2259 | Ga0495607_0009005 | |||
| 2260 | Ga0495607_0134664 | |||
| 2261 | Ga0495583_0000419 | |||
| 2262 | Ga0495606_0001218 | |||
| 2263 | Ga0495606_0001429 | |||
| 2264 | Ga0495608_0000017 | |||
| 2265 | Ga0495608_0452007 | |||
| 2266 | Ga0495610_0150433 | |||
| 2267 | Ga0495610_0155377 | |||
| 2268 | Ga0495616_0002066 | |||
| 2269 | Ga0495616_0102973 | |||
| 2270 | Ga0495616_0142254 | |||
| 2271 | Ga0495618_0000006 | |||
| 2272 | Ga0495618_0089042 | |||
| 2273 | Ga0495620_0046771 | |||
| 2274 | Ga0495620_0214544 | |||
| 2275 | Ga0495628_0000001 | |||
| 2276 | Ga0495630_0006296 | |||
| 2277 | Ga0495630_0053954 | |||
| 2278 | Ga0495632_0000570 | |||
| 2279 | Ga0495632_0000731 | |||
| 2280 | Ga0495632_0029701 | |||
| 2281 | Ga0495632_0031178 | |||
| 2282 | Ga0495632_0079065 | |||
| 2283 | Ga0495637_0010875 | |||
| 2284 | Ga0495637_0180576 | |||
| 2285 | Ga0495643_0000081 | |||
| 2286 | Ga0495644_0158070 | |||
| 2287 | Ga0495648_0000199 | |||
| 2288 | Ga0495648_0056420 | |||
| 2289 | Ga0495652_0000002 | |||
| 2290 | Ga0495654_0017098 | |||
| 2291 | Ga0495654_0062230 | |||
| 2292 | Ga0495665_0139553 | |||
| 2293 | Ga0495640_0000001 | |||
| 2294 | Ga0495586_0004691 | |||
| 2295 | Ga0495587_0000008 | |||
| 2296 | Ga0495598_0165594 | |||
| 2297 | Ga0495598_0178513 | |||
| 2298 | Ga0495609_0014617 | |||
| 2299 | Ga0495609_0019454 | |||
| 2300 | Ga0495597_0008372 | |||
| 2301 | Ga0495645_0000002 | |||
| 2302 | Ga0495633_0002816 | |||
| 2303 | Ga0495633_0051413 | |||
| 2304 | Ga0495667_0000029 | |||
| 2305 | Ga0495667_0036406 | |||
| 2306 | Ga0495656_0039189 | |||
| 2307 | Ga0495656_0068632 | |||
| 2308 | Ga0495668_0032304 | |||
| 2309 | Ga0495668_0094138 | |||
| 2310 | Ga0495634_0031220 | |||
| 2311 | Ga0495634_0096485 | |||
| 2312 | Ga0495611_0009558 | |||
| 2313 | Ga0495625_0016828 | |||
| 2314 | Ga0495625_0076835 | |||
| 2315 | Ga0495625_0288009 | |||
| 2316 | Ga0495625_0367167 | |||
| 2317 | Ga0495635_0000002 | |||
| 2318 | Ga0495635_0063635 | |||
| 2319 | Ga0495635_0290095 | |||
| 2320 | Ga0495588_0156501 | |||
| 2321 | Ga0495588_0223040 | |||
| 2322 | Ga0495657_0000064 | |||
| 2323 | Ga0495599_0000064 | |||
| 2324 | Ga0495623_0000065 | |||
| 2325 | Ga0495623_0318766 | |||
| 2326 | Ga0495646_0000023 | |||
| 2327 | Ga0495658_0067051 | |||
| 2328 | Ga0495658_0351691 | |||
| 2329 | Ga0495658_0462480 | |||
| 2330 | Ga0495669_0000752 | |||
| 2331 | Ga0495669_0019290 | |||
| 2332 | Ga0495669_0128409 | |||
| 2333 | Ga0495669_0295081 | |||
| 2334 | Ga0495613_0025068 | |||
| 2335 | Ga0495613_0070714 | |||
| 2336 | Ga0495613_0073985 | |||
| 2337 | Ga0495613_0155767 | |||
| 2338 | Ga0495624_0017097 | |||
| 2339 | Ga0495670_0055136 | |||
| 2340 | Ga0495671_0000124 | |||
| 2341 | Ga0495671_0000135 | |||
| 2342 | Ga0495671_0000963 | |||
| 2343 | Ga0495671_0068246 | |||
| 2344 | Ga0495649_0000561 | |||
| 2345 | Ga0495649_0017156 | |||
| 2346 | Ga0495649_0027931 | |||
| 2347 | Ga0495649_0031668 | |||
| 2348 | Ga0495589_0064793 | |||
| 2349 | Ga0495600_0000010 | |||
| 2350 | Ga0495660_0288443 | |||
| 2351 | Ga0495581_0039058 | |||
| 2352 | Ga0495581_0186301 | |||
| 2353 | Ga0495604_0000009 | |||
| 2354 | Ga0495636_0000111 | |||
| 2355 | Ga0495674_0000002 | |||
| 2356 | Ga0495674_0024508 | |||
| 2357 | Ga0495674_0154218 | |||
| 2358 | Ga0495672_0111118 | |||
| 2359 | Ga0495676_0454338 | |||
| 2360 | Ga0495680_0001344 | |||
| 2361 | Ga0495680_0009855 | |||
| 2362 | Ga0495683_0000076 | |||
| 2363 | Ga0495683_0014312 | |||
| 2364 | Ga0495683_0061713 | |||
| 2365 | Ga0495683_0269666 | |||
| 2366 | Ga0495675_0000178 | |||
| 2367 | Ga0495673_0000303 | |||
| 2368 | Ga0495673_0162509 | |||
| 2369 | Ga0495681_0030908 | |||
| 2370 | Ga0495684_0000006 | |||
| 2371 | Ga0495684_0162200 | |||
| 2372 | Ga0495686_0099455 | |||
| 2373 | Ga0495593_0002369 | |||
| 2374 | Ga0495593_0389454 | |||
| 2375 | Ga0495593_0443219 | |||
| 2376 | Ga0495602_0000005 | |||
| 2377 | Ga0495602_0155380 | |||
| 2378 | Ga0495615_0000004 | |||
| 2379 | Ga0495626_0000444 | |||
| 2380 | Ga0495626_0009839 | |||
| 2381 | Ga0496100_0056972 | |||
| 2382 | Ga0496100_0101820 | |||
| 2383 | Ga0496100_0105464 | |||
| 2384 | Ga0496101_0011508 | |||
| 2385 | Ga0496101_0217225 | |||
| 2386 | Ga0496101_0313485 | |||
| 2387 | Ga0496101_0746871 | |||
| 2388 | Ga0496102_0361388 | |||
| 2389 | Ga0496103_0224677 | |||
| 2390 | Ga0496103_0335606 | |||
| 2391 | Ga0496104_0018658 | |||
| 2392 | Ga0496104_0032785 | |||
| 2393 | Ga0496104_0040433 | |||
| 2394 | Ga0496104_1017378 | |||
| 2395 | Ga0496105_0038328 | |||
| 2396 | Ga0496105_0087705 | |||
| 2397 | Ga0496105_0208525 | |||
| 2398 | Ga0496105_0638658 | |||
| 2399 | Ga0496105_0757756 | |||
| 2400 | Ga0496105_0819841 | |||
| 2401 | Ga0496106_0099763 | |||
| 2402 | Ga0496106_0157711 | |||
| 2403 | Ga0496106_0181293 | |||
| 2404 | Ga0496106_0339336 | |||
| 2405 | Ga0496106_0916712 | |||
| 2406 | Ga0496106_1104953 | |||
| 2407 | Ga0496107_0023422 | |||
| 2408 | Ga0496107_0060646 | |||
| 2409 | Ga0496107_0077406 | |||
| 2410 | Ga0496107_0577757 | |||
| 2411 | Ga0496107_0617898 | |||
| 2412 | Ga0496108_0015389 | |||
| 2413 | Ga0496108_0061105 | |||
| 2414 | Ga0496108_0165929 | |||
| 2415 | Ga0496108_0408006 | |||
| 2416 | Ga0496109_0024989 | |||
| 2417 | Ga0496109_0025994 | |||
| 2418 | Ga0496109_0260557 | |||
| 2419 | Ga0496109_0282430 | |||
| 2420 | Ga0496109_0508877 | |||
| 2421 | Ga0496110_0014036 | |||
| 2422 | Ga0496110_0124434 | |||
| 2423 | Ga0496110_0245051 | |||
| 2424 | Ga0496110_0810344 | |||
| 2425 | Ga0496110_1079391 | |||
| 2426 | Ga0496111_0016470 | |||
| 2427 | Ga0496111_0320544 | |||
| 2428 | Ga0496111_0423799 | |||
| 2429 | Ga0496112_0009723 | |||
| 2430 | Ga0496112_0105727 | |||
| 2431 | Ga0496112_0114033 | |||
| 2432 | Ga0496112_0168535 | |||
| 2433 | Ga0496112_0279217 | |||
| 2434 | Ga0496112_0457632 | |||
| 2435 | Ga0496112_0625390 | |||
| 2436 | Ga0496112_1437087 | |||
| 2437 | Ga0496113_0004304 | |||
| 2438 | Ga0496113_0016246 | |||
| 2439 | Ga0496113_0039668 | |||
| 2440 | Ga0496113_0078110 | |||
| 2441 | Ga0496113_0154979 | |||
| 2442 | Ga0496113_0302076 | |||
| 2443 | Ga0496114_0199679 | |||
| 2444 | Ga0496114_0418979 | |||
| 2445 | Ga0496114_0670973 | |||
| 2446 | Ga0496114_0904148 | |||
| 2447 | Ga0496115_0354246 | |||
| 2448 | Ga0496115_0557336 | |||
| 2449 | Ga0496118_0362095 | |||
| 2450 | Ga0496122_0000929 | |||
| 2451 | Ga0496123_0000798 | |||
| 2452 | Ga0496124_0004446 | |||
| 2453 | Ga0496125_0032291 | |||
| 2454 | Ga0496125_0036215 | |||
| 2455 | Ga0496126_0485011 | |||
| 2456 | Ga0495678_004092 | |||
| 2457 | Ga0495678_007647 | |||
| 2458 | Ga0495682_0084249 | |||
| 2459 | Ga0495682_0091400 | |||
| 2460 | Ga0495682_0228697 | |||
| 2461 | Ga0501291_008616 | |||
| 2462 | Ga0501291_028190 | |||
| 2463 | Ga0501292_006605 | |||
| 2464 | Ga0501293_008645 | |||
| 2465 | Ga0501294_002875 | |||
| 2466 | Ga0501296_003944 | |||
| 2467 | Ga0501298_007937 | |||
| 2468 | Ga0501299_006449 | |||
| 2469 | Ga0501299_008861 | |||
| 2470 | Ga0501299_066669 | |||
| 2471 | Ga0501300_015381 | |||
| 2472 | Ga0501031_0000443 | |||
| 2473 | Ga0501031_0009136 | |||
| 2474 | Ga0501031_0011507 | |||
| 2475 | Ga0501031_0459064 | |||
| 2476 | Ga0501032_0010096 | |||
| 2477 | Ga0501032_0082900 | |||
| 2478 | Ga0501032_0115286 | |||
| 2479 | Ga0501033_0221325 | |||
| 2480 | Ga0501034_0006511 | |||
| 2481 | Ga0501034_0007288 | |||
| 2482 | Ga0501036_0000230 | |||
| 2483 | Ga0501036_0164742 | |||
| 2484 | Ga0501036_0308011 | |||
| 2485 | Ga0501036_1000038 | |||
| 2486 | Ga0501037_0004342 | |||
| 2487 | Ga0501037_0027855 | |||
| 2488 | Ga0501037_0082094 | |||
| 2489 | Ga0501037_0326387 | |||
| 2490 | Ga0501038_0010658 | |||
| 2491 | Ga0501038_0156847 | |||
| 2492 | Ga0501038_0511115 | |||
| 2493 | Ga0501038_0760795 | |||
| 2494 | Ga0501039_0000557 | |||
| 2495 | Ga0501039_0001390 | |||
| 2496 | Ga0501039_0358018 | |||
| 2497 | Ga0501040_0000331 | |||
| 2498 | Ga0501040_0062828 | |||
| 2499 | Ga0501040_0093710 | |||
| 2500 | Ga0501040_0101404 | |||
| 2501 | Ga0501040_0193210 | |||
| 2502 | Ga0501041_0000256 | |||
| 2503 | Ga0501041_0006710 | |||
| 2504 | Ga0501041_0016032 | |||
| 2505 | Ga0501041_0125086 | |||
| 2506 | Ga0501041_0128813 | |||
| 2507 | Ga0501041_0527579 | |||
| 2508 | Ga0501042_0004679 | |||
| 2509 | Ga0501042_0010292 | |||
| 2510 | Ga0501042_0089132 | |||
| 2511 | Ga0501042_0301164 | |||
| 2512 | Ga0501046_0000618 | |||
| 2513 | Ga0501046_0014890 | |||
| 2514 | Ga0501046_0277103 | |||
| 2515 | Ga0501047_0128166 | |||
| 2516 | Ga0501048_0000179 | |||
| 2517 | Ga0501048_0183356 | |||
| 2518 | Ga0501048_0387647 | |||
| 2519 | Ga0501068_0021192 | |||
| 2520 | Ga0501068_0021809 | |||
| 2521 | Ga0501068_0134569 | |||
| 2522 | Ga0501070_0188471 | |||
| 2523 | Ga0501071_0000665 | |||
| 2524 | Ga0501071_0030549 | |||
| 2525 | Ga0501071_0190926 | |||
| 2526 | Ga0501071_0554094 | |||
| 2527 | Ga0501072_0001546 | |||
| 2528 | Ga0501072_0107365 | |||
| 2529 | Ga0501072_0459501 | |||
| 2530 | Ga0501072_0682377 | |||
| 2531 | Ga0501073_0272587 | |||
| 2532 | Ga0501074_0001783 | |||
| 2533 | Ga0501074_0207875 | |||
| 2534 | Ga0501075_0000833 | |||
| 2535 | Ga0501075_0003400 | |||
| 2536 | Ga0501076_0000188 | |||
| 2537 | Ga0501076_0438950 | |||
| 2538 | Ga0501076_0785922 | |||
| 2539 | Ga0501076_1001817 | |||
| 2540 | Ga0501077_0004501 | |||
| 2541 | Ga0501077_0006741 | |||
| 2542 | Ga0501199_004511 | |||
| 2543 | Ga0501199_004863 | |||
| 2544 | Ga0501201_001179 | |||
| 2545 | Ga0501202_036395 | |||
| 2546 | Ga0501207_007049 | |||
| 2547 | Ga0501208_004835 | |||
| 2548 | Ga0501211_010183 | |||
| 2549 | Ga0501217_017932 | |||
| 2550 | Ga0501217_049691 | |||
| 2551 | Ga0501222_001860 | |||
| 2552 | Ga0501223_021102 | |||
| 2553 | Ga0501227_025559 | |||
| 2554 | Ga0501233_018791 | |||
| 2555 | Ga0501233_020186 | |||
| 2556 | Ga0501235_021193 | |||
| 2557 | Ga0501243_039351 | |||
| 2558 | Ga0501247_016410 | |||
| 2559 | Ga0501249_052262 | |||
| 2560 | Ga0501250_009639 | |||
| 2561 | Ga0501257_149176 | |||
| 2562 | Ga0501259_090689 | |||
| 2563 | Ga0501221_004693 | |||
| 2564 | Ga0501225_0021888 | |||
| 2565 | Ga0501079_0000792 | |||
| 2566 | Ga0501079_0275315 | |||
| 2567 | Ga0501080_0005633 | |||
| 2568 | Ga0501080_0033872 | |||
| 2569 | Ga0501080_0224108 | |||
| 2570 | Ga0501080_0364869 | |||
| 2571 | Ga0501080_0368765 | |||
| 2572 | Ga0501080_0777405 | |||
| 2573 | Ga0501081_0023524 | |||
| 2574 | Ga0501081_0218502 | |||
| 2575 | Ga0501081_0371320 | |||
| 2576 | Ga0501081_0633557 | |||
| 2577 | Ga0501083_0010454 | |||
| 2578 | Ga0501232_000316 | |||
| 2579 | Ga0501262_006551 | |||
| 2580 | Ga0501267_000505 | |||
| 2581 | Ga0501271_021899 | |||
| 2582 | Ga0501272_001325 | |||
| 2583 | Ga0501273_008544 | |||
| 2584 | Ga0501274_024193 | |||
| 2585 | Ga0501280_023887 | |||
| 2586 | Ga0501282_004766 | |||
| 2587 | Ga0501283_012568 | |||
| 2588 | Ga0501035_0049175 | |||
| 2589 | Ga0501035_0052578 | |||
| 2590 | Ga0501035_0355395 | |||
| 2591 | Ga0501044_0103822 | |||
| 2592 | Ga0501044_0256057 | |||
| 2593 | Ga0501045_0002959 | |||
| 2594 | Ga0501045_0088674 | |||
| 2595 | Ga0501045_0305123 | |||
| 2596 | Ga0501045_0417022 | |||
| 2597 | Ga0501226_000003 | |||
| 2598 | nmdc:mga03683_239099_c1 | |||
| 2599 | nmdc:mga03683_369582_c1 | |||
| 2600 | nmdc:mga03n38_99342_c1 | |||
| 2601 | nmdc:mga00v17_21823_c1 | |||
| 2602 | nmdc:mga00v17_50934_c1 | |||
| 2603 | nmdc:mga00v17_91649_c1 | |||
| 2604 | nmdc:mga0yw44_328519_c1 | |||
| 2605 | nmdc:mga0yw44_37334_c1 | |||
| 2606 | nmdc:mga0k408_106382_c1 | |||
| 2607 | nmdc:mga0k408_11684_c1 | |||
| 2608 | nmdc:mga0k408_12312_c1 | |||
| 2609 | nmdc:mga0k408_97938_c1 | |||
| 2610 | nmdc:mga06z11_157568_c1 | |||
| 2611 | nmdc:mga06z11_2682_c1 | |||
| 2612 | nmdc:mga06z11_307930_c1 | |||
| 2613 | nmdc:mga06z11_37103_c1 | |||
| 2614 | nmdc:mga06z11_3804_c1 | |||
| 2615 | nmdc:mga06z11_7267_c1 | |||
| 2616 | nmdc:mga04h51_14549_c1 | |||
| 2617 | nmdc:mga04h51_28972_c1 | |||
| 2618 | nmdc:mga07m45_104889_c1 | |||
| 2619 | nmdc:mga07m45_1316_c1 | |||
| 2620 | nmdc:mga07m45_66103_c1 | |||
| 2621 | nmdc:mga05p37_953940_c1 | |||
| 2622 | nmdc:mga05p37_989043_c1 | |||
| 2623 | nmdc:mga09592_102960_c1 | |||
| 2624 | nmdc:mga09592_1190625_c1 | |||
| 2625 | nmdc:mga0qj67_29970_c1 | |||
| 2626 | nmdc:mga0qj67_43561_c1 | |||
| 2627 | nmdc:mga06r32_148837_c1 | |||
| 2628 | nmdc:mga06r32_1527683_c1 | |||
| 2629 | nmdc:mga06r32_155969_c1 | |||
| 2630 | nmdc:mga06r32_500393_c1 | |||
| 2631 | nmdc:mga06r32_56095_c1 | |||
| 2632 | nmdc:mga08y16_16096_c1 | |||
| 2633 | nmdc:mga08y16_27352_c1 | |||
| 2634 | nmdc:mga08y16_43807_c1 | |||
| 2635 | nmdc:mga08y16_494051_c1 | |||
| 2636 | nmdc:mga08y16_54145_c1 | |||
| 2637 | nmdc:mga0n895_464217_c1 | |||
| 2638 | nmdc:mga0n895_466202_c1 | |||
| 2639 | nmdc:mga0n895_76931_c1 | |||
| 2640 | nmdc:mga0rr50_152308_c1 | |||
| 2641 | nmdc:mga0rr50_387363_c1 | |||
| 2642 | nmdc:mga08x19_7633_c1 | |||
| 2643 | nmdc:mga0a205_1010611_c1 | |||
| 2644 | nmdc:mga0a205_450047_c1 | |||
| 2645 | nmdc:mga0a205_679692_c1 | |||
| 2646 | nmdc:mga0a205_926474_c1 | |||
| 2647 | Ga0495601_0000002 | |||
| 2648 | Ga0495612_0000010 | |||
| 2649 | Ga0500610_0009419 | |||
| 2650 | Ga0500610_0071228 | |||
| 2651 | Ga0495655_0001360 | |||
| 2652 | Ga0495595_0000020 | |||
| 2653 | Ga0495595_0062939 | |||
| 2654 | Ga0495619_0000110 | |||
| 2655 | Ga0500578_0040662 | |||
| 2656 | Ga0500651_0013688 | |||
| 2657 | Ga0500651_0522050 | |||
| 2658 | Ga0500566_0002361 | |||
| 2659 | Ga0500566_0179531 | |||
| 2660 | Ga0500650_0164049 | |||
| 2661 | Ga0500594_0004368 | |||
| 2662 | Ga0500559_0101334 | |||
| 2663 | Ga0500559_0313279 | |||
| 2664 | Ga0500568_0081361 | |||
| 2665 | Ga0500577_0085938 | |||
| 2666 | Ga0500588_0278953 | |||
| 2667 | Ga0500604_0070952 | |||
| 2668 | Ga0500604_0178675 | |||
| 2669 | Ga0500616_0002794 | |||
| 2670 | Ga0500616_0037526 | |||
| 2671 | Ga0500627_0064691 | |||
| 2672 | Ga0500627_0170563 | |||
| 2673 | Ga0500611_036731 | |||
| 2674 | Ga0500599_015621 | |||
| 2675 | Ga0501084_0008839 | |||
| 2676 | Ga0501084_0290798 | |||
| 2677 | Ga0501084_0547373 | |||
| 2678 | Ga0501084_0784437 | |||
| 2679 | Ga0501084_0939321 | |||
| 2680 | Ga0501084_1187529 | |||
| 2681 | Ga0587084_030607 | |||
| 2682 | Ga0501082_0000049 | |||
| 2683 | Ga0501082_0002023 | |||
| 2684 | Ga0501082_0057783 | |||
| 2685 | Ga0501082_0265781 | |||
| 2686 | Ga0501082_0386585 | |||
| 2687 | Ga0501082_0756606 | |||
| 2688 | Ga0501082_1151389 | |||
| 2689 | Ga0466962_0386676 | |||
| 2690 | Ga0530510_0000068 | |||
| 2691 | Ga0530510_0007312 | |||
| 2692 | Ga0530510_0033779 | |||
| 2693 | Ga0530510_0079841 | |||
| 2694 | Ga0530510_0558331 | |||
| 2695 | Ga0530510_0834026 | |||
| 2696 | 2513701298 | |||
| 2697 | 2535518126 | |||
| 2698 | 2552107569 | |||
| 2699 | 2739288533 | |||
| 2700 | 2739293845 | |||
| 2701 | 2808903834 | |||
| 2702 | 2885193908 | |||
| 2703 | 2902585178 | |||
| 2704 | 2906637957 | |||
| 2705 | 2915360280 | |||
| 2706 | 2939585690 | |||
| 2707 | 3003932077 | |||
| 2708 | 8005549010 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j0b-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state | 0.7024 | 9 | 158 |
| 6j0f-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state | 0.6883 | 8 | 158 |
| 6j0f-assembly1.cif.gz_a | cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state | 0.6801 | 8 | 158 |
| 6j0n-assembly1.cif.gz_n | cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry | 0.6779 | 17 | 157 |
| 7adz-assembly1.cif.gz_1a | cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. | 0.6757 | 12 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54PM7_5_120_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7949 | 104 | 123 | 3.30.420.40 |
| af_P15081_4_110_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.7646 | 102 | 124 | 3.90.1010.10 |
| af_Q9VF86_1_117_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7455 | 104 | 123 | 3.30.420.40 |
| af_P23917_1_103_1.10.520.10 | Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; | 0.732 | 104 | 123 | 1.10.520.10 |
| 1y9wB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6372 | 103 | 123 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A9HS85-F1-model_v4 | Phage tail protein | 0.8346 | 31 | 159 |
GO:0005198
|
| AF-A0A660LBY8-F1-model_v4 | Phage tail-like protein | 0.8341 | 20 | 158 |
GO:0005198
|
| AF-A0A1Q8CNY0-F1-model_v4 | Phage tail protein | 0.8224 | 20 | 158 |
GO:0005198
|
| AF-A0A533J2Z9-F1-model_v4 | deleted | 0.818 | 18 | 166 |
|
| AF-A0A6N7YPR4-F1-model_v4 | Phage tail protein | 0.8123 | 10 | 159 |
GO:0005198
|