F493272

General Info

Members Datasets Scaffolds Average Seq Length
1354 567 2708 171

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0210033|Ga0395898_0210033_122_721
Length 199
Sequence LTASIASSKLPAARLQPFIEGQGIMAEFTVNPTRFDPYKNFKFRVKWDGQYVAAVSKVSALKRTTEVIEHREGGDPSTPRLSPGRTKFEAITLERGVTHDPAFEQWAAKVWNLGGGLGAEVSLKDFRKDIVIEVFNEAGQLVLAYKVFRCWVSEYQALPDLDANADAVMIEHIKLENEGWERDTTVVEPLEPSFAKGSA

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
228 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
231 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
265 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
284 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
285 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
286 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
290 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
291 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
292 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
293 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
296 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
297 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
298 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
299 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
300 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
301 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
302 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
303 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
304 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
305 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
306 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
307 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
308 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
309 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
310 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
311 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
312 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
313 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
314 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
315 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
316 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
317 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
318 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
319 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
320 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
321 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
322 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
323 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
324 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
325 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
326 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
327 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
328 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
329 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
330 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
331 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
332 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
333 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
344 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
345 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
348 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
352 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
368 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
369 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
370 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
371 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
372 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
373 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
377 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
378 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
379 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
380 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
381 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
382 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
383 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
384 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
385 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
386 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
395 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
396 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
397 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
400 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
401 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
402 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
403 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
406 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
407 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
408 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
409 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
410 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
411 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
414 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
418 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
419 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
420 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
421 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
428 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
429 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
433 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
434 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
435 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
438 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
439 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
440 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
441 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
442 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
443 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
444 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
445 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
446 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
447 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
448 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
449 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
450 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
451 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
470 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
471 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
472 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
473 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
474 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
475 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
476 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
477 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
478 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
479 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
480 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
481 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
482 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
483 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
484 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
485 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
486 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
487 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
488 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
489 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
490 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
491 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
492 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
493 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
494 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
495 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
496 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
497 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
498 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
499 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
500 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
501 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
502 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
503 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
504 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
505 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
506 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
507 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
508 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
509 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
513 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
514 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
515 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
516 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
517 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
518 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
519 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
520 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
521 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
522 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
523 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
524 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
525 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
526 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
527 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
528 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
529 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
530 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
531 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
532 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
533 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
534 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
535 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
536 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
537 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
538 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
539 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
540 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
541 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
542 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
543 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
544 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
545 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
546 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
547 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
548 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
549 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
550 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
551 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
553 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
554 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
555 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
556 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
557 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
558 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
559 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
560 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
561 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
562 2902582711 Micromonospora sp. AP08 Isolate Unclassified
563 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
564 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
565 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
566 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
567 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1.03
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0.15
Rhizoplane 5.1
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0210033 3300037466 Bacteria 1857
2 CNAas_1004002 3300000532 Bacteria 956
3 JGI24735J21928_10092228 3300002067 Bacteria 869
4 JGI25156J39149_1007267 3300002705 Bacteria 2932
5 JGI25157J39369_1003833 3300002741 Bacteria 2932
6 JGI25406J46586_10000010 3300003203 Bacteria 109792
7 JGI25406J46586_10008789 3300003203 Bacteria 4548
8 Ga0055540_1017344 3300003792 Bacteria 2014
9 Ga0055540_1020312 3300003792 Bacteria 1760
10 Ga0058859_11603680 3300004798 Bacteria 943
11 Ga0058863_11854324 3300004799 Bacteria 938
12 Ga0058861_11844294 3300004800 Bacteria 1002
13 Ga0058860_11738728 3300004801 Bacteria 940
14 Ga0058860_11924803 3300004801 Bacteria 686
15 Ga0058860_12076197 3300004801 Bacteria 684
16 Ga0058862_12208179 3300004803 Bacteria 1317
17 Ga0065704_10090112 3300005289 Bacteria 2811
18 Ga0065704_10100036 3300005289 Bacteria 2288
19 Ga0065712_10207421 3300005290 Bacteria 1085
20 Ga0065715_10209158 3300005293 Bacteria 1322
21 Ga0065715_10216462 3300005293 Bacteria 1291
22 Ga0065707_10085147 3300005295 Bacteria 6411
23 Ga0065707_10922474 3300005295 Bacteria 560
24 Ga0070658_10040185 3300005327 Bacteria 3774
25 Ga0070658_10151983 3300005327 Bacteria 1939
26 Ga0070658_10246230 3300005327 Bacteria 1516
27 Ga0070676_10817220 3300005328 Bacteria 689
28 Ga0070683_100014912 3300005329 Bacteria 6811
29 Ga0070683_100086029 3300005329 Bacteria 2948
30 Ga0070683_100827423 3300005329 Bacteria 888
31 Ga0070683_101483235 3300005329 Bacteria 652
32 Ga0070690_100093419 3300005330 Bacteria 1984
33 Ga0070690_100162746 3300005330 Bacteria 1530
34 Ga0070690_100182772 3300005330 Bacteria 1450
35 Ga0070670_100010861 3300005331 Bacteria 7779
36 Ga0070670_100452415 3300005331 Bacteria 1138
37 Ga0070677_10001124 3300005333 Bacteria 8603
38 Ga0068869_100261886 3300005334 Bacteria 1384
39 Ga0070666_10498570 3300005335 Bacteria 883
40 Ga0070680_100011730 3300005336 Bacteria 6793
41 Ga0070680_100014807 3300005336 Bacteria 6099
42 Ga0070682_100025094 3300005337 Bacteria 3555
43 Ga0070682_100067299 3300005337 Bacteria 2281
44 Ga0068868_100000525 3300005338 Bacteria 25646
45 Ga0068868_100302307 3300005338 Bacteria 1359
46 Ga0070660_100295294 3300005339 Bacteria 1328
47 Ga0070660_100614145 3300005339 Unclassified 910
48 Ga0070689_100000226 3300005340 Bacteria 33805
49 Ga0070689_100157580 3300005340 Bacteria 1834
50 Ga0070689_100449850 3300005340 Bacteria 1096
51 Ga0070689_101152478 3300005340 Unclassified 694
52 Ga0070687_100116565 3300005343 Bacteria 1521
53 Ga0070661_100119021 3300005344 Bacteria 1977
54 Ga0070661_100327116 3300005344 Bacteria 1198
55 Ga0070668_100009781 3300005347 Bacteria 7108
56 Ga0070668_100024777 3300005347 Bacteria 4547
57 Ga0070668_100954375 3300005347 Bacteria 769
58 Ga0070669_100015421 3300005353 Bacteria 5446
59 Ga0070669_100424422 3300005353 Bacteria 1092
60 Ga0070669_100851872 3300005353 Bacteria 777
61 Ga0070675_100007932 3300005354 Bacteria 8230
62 Ga0070671_100018395 3300005355 Bacteria 5675
63 Ga0070671_100049277 3300005355 Bacteria 3504
64 Ga0070671_100059317 3300005355 Bacteria 3184
65 Ga0070671_100093279 3300005355 Bacteria 2523
66 Ga0070671_100344446 3300005355 Bacteria 1272
67 Ga0070671_100470122 3300005355 Bacteria 1080
68 Ga0070674_100029504 3300005356 Bacteria 3614
69 Ga0070674_100338863 3300005356 Bacteria 1211
70 Ga0070688_100000038 3300005365 Bacteria 60923
71 Ga0070688_100530030 3300005365 Bacteria 892
72 Ga0070659_100023497 3300005366 Bacteria 4717
73 Ga0070667_100251471 3300005367 Bacteria 1580
74 Ga0070709_10757814 3300005434 Bacteria 759
75 Ga0070714_100362752 3300005435 Unclassified 1362
76 Ga0070714_100801801 3300005435 Bacteria 912
77 Ga0070713_100012168 3300005436 Bacteria 6302
78 Ga0070713_100047332 3300005436 Bacteria 3534
79 Ga0070713_100069706 3300005436 Bacteria 2966
80 Ga0070713_100782707 3300005436 Bacteria 914
81 Ga0070710_10000737 3300005437 Bacteria 15575
82 Ga0070710_10481687 3300005437 Bacteria 846
83 Ga0070710_10640751 3300005437 Bacteria 744
84 Ga0070701_10628074 3300005438 Bacteria 715
85 Ga0070711_100001753 3300005439 Bacteria 12050
86 Ga0070711_100327369 3300005439 Bacteria 1226
87 Ga0070705_100172809 3300005440 Bacteria 1456
88 Ga0070705_100235543 3300005440 Bacteria 1276
89 Ga0070700_100654939 3300005441 Bacteria 830
90 Ga0070694_100001269 3300005444 Bacteria 14667
91 Ga0070694_100004587 3300005444 Bacteria 8307
92 Ga0070694_100039353 3300005444 Bacteria 3147
93 Ga0070694_100282396 3300005444 Bacteria 1266
94 Ga0070694_100451075 3300005444 Unclassified 1015
95 Ga0070708_100000237 3300005445 Bacteria 40825
96 Ga0070708_100015706 3300005445 Bacteria 6257
97 Ga0070663_100370469 3300005455 Bacteria 1164
98 Ga0070663_100447624 3300005455 Bacteria 1064
99 Ga0070663_100786182 3300005455 Bacteria 815
100 Ga0070678_100021178 3300005456 Bacteria 4282
101 Ga0070678_100047483 3300005456 Bacteria 3085
102 Ga0070678_100327429 3300005456 Bacteria 1310
103 Ga0070678_100502799 3300005456 Bacteria 1069
104 Ga0070678_100796864 3300005456 Bacteria 858
105 Ga0070662_100056400 3300005457 Bacteria 2852
106 Ga0070662_100159473 3300005457 Bacteria 1764
107 Ga0070662_100270926 3300005457 Bacteria 1371
108 Ga0070681_10004421 3300005458 Bacteria 13391
109 Ga0070681_10090798 3300005458 Bacteria 3005
110 Ga0070681_10093332 3300005458 Bacteria 2958
111 Ga0070681_10102841 3300005458 Bacteria 2802
112 Ga0068867_100823348 3300005459 Bacteria 830
113 Ga0070685_10380938 3300005466 Bacteria 972
114 Ga0070707_100000239 3300005468 Bacteria 54793
115 Ga0070707_100072302 3300005468 Bacteria 3324
116 Ga0070707_100099741 3300005468 Bacteria 2814
117 Ga0070707_100523106 3300005468 Bacteria 1148
118 Ga0070707_101677378 3300005468 Bacteria 603
119 Ga0070698_100002637 3300005471 Bacteria 19755
120 Ga0070698_100048344 3300005471 Bacteria 4346
121 Ga0070698_100089292 3300005471 Bacteria 3066
122 Ga0070698_100301896 3300005471 Bacteria 1532
123 Ga0070698_100576845 3300005471 Bacteria 1065
124 Ga0070699_100011849 3300005518 Bacteria 7525
125 Ga0070699_100050964 3300005518 Bacteria 3584
126 Ga0070699_100077704 3300005518 Bacteria 2890
127 Ga0070699_100147008 3300005518 Bacteria 2083
128 Ga0070699_100682690 3300005518 Bacteria 938
129 Ga0070679_100002006 3300005530 Bacteria 18266
130 Ga0070679_100010620 3300005530 Bacteria 8738
131 Ga0070679_100016572 3300005530 Bacteria 7114
132 Ga0070679_100482497 3300005530 Bacteria 1184
133 Ga0070679_100807759 3300005530 Bacteria 881
134 Ga0070679_100957189 3300005530 Bacteria 800
135 Ga0070684_100038327 3300005535 Unclassified 4117
136 Ga0070684_100044887 3300005535 Bacteria 3825
137 Ga0070684_100269382 3300005535 Bacteria 1559
138 Ga0070697_100069815 3300005536 Bacteria 2879
139 Ga0070697_100074798 3300005536 Bacteria 2784
140 Ga0068853_100000427 3300005539 Bacteria 28683
141 Ga0068853_101039661 3300005539 Bacteria 789
142 Ga0068853_101573678 3300005539 Bacteria 637
143 Ga0070672_100001493 3300005543 Bacteria 14515
144 Ga0070672_100699250 3300005543 Bacteria 888
145 Ga0070672_100785065 3300005543 Bacteria 837
146 Ga0070672_101136034 3300005543 Bacteria 695
147 Ga0070686_100062583 3300005544 Bacteria 2408
148 Ga0070686_100106638 3300005544 Bacteria 1902
149 Ga0070686_100499915 3300005544 Bacteria 943
150 Ga0070695_100355807 3300005545 Bacteria 1098
151 Ga0070695_100371126 3300005545 Unclassified 1077
152 Ga0070696_100024052 3300005546 Bacteria 4141
153 Ga0070696_100070370 3300005546 Unclassified 2461
154 Ga0070696_100110970 3300005546 Bacteria 1975
155 Ga0070696_100270891 3300005546 Bacteria 1291
156 Ga0070693_100011117 3300005547 Bacteria 4530
157 Ga0070693_100116709 3300005547 Bacteria 1650
158 Ga0070665_100006034 3300005548 Bacteria 12380
159 Ga0070665_100018589 3300005548 Bacteria 6965
160 Ga0070665_100150114 3300005548 Bacteria 2333
161 Ga0070665_100257240 3300005548 Bacteria 1747
162 Ga0070665_100414013 3300005548 Bacteria 1356
163 Ga0070665_100441161 3300005548 Bacteria 1311
164 Ga0070665_101209221 3300005548 Bacteria 766
165 Ga0070665_101589587 3300005548 Bacteria 662
166 Ga0070704_100752094 3300005549 Bacteria 868
167 Ga0070704_101221077 3300005549 Bacteria 686
168 Ga0068855_100060062 3300005563 Bacteria 4447
169 Ga0068855_100077079 3300005563 Bacteria 3868
170 Ga0070664_100050270 3300005564 Bacteria 3528
171 Ga0070664_100066190 3300005564 Bacteria 3085
172 Ga0070664_100146805 3300005564 Bacteria 2080
173 Ga0070664_100244648 3300005564 Bacteria 1611
174 Ga0070664_100309431 3300005564 Bacteria 1429
175 Ga0068857_100003463 3300005577 Bacteria 13171
176 Ga0068857_100068756 3300005577 Bacteria 3153
177 Ga0068857_100104257 3300005577 Bacteria 2546
178 Ga0068857_100522091 3300005577 Bacteria 1116
179 Ga0068857_101252312 3300005577 Bacteria 719
180 Ga0068857_101295965 3300005577 Unclassified 707
181 Ga0068854_100712463 3300005578 Bacteria 867
182 Ga0068854_100800870 3300005578 Bacteria 821
183 Ga0068854_101226603 3300005578 Bacteria 673
184 Ga0068856_100018429 3300005614 Bacteria 6766
185 Ga0068856_100107804 3300005614 Bacteria 2781
186 Ga0068856_100472507 3300005614 Bacteria 1275
187 Ga0070702_100494869 3300005615 Bacteria 896
188 Ga0068859_100005606 3300005617 Bacteria 12793
189 Ga0068859_100071916 3300005617 Bacteria 3494
190 Ga0068859_100239070 3300005617 Bacteria 1905
191 Ga0068864_100002788 3300005618 Bacteria 14430
192 Ga0068864_100064984 3300005618 Bacteria 3165
193 Ga0068864_100160645 3300005618 Bacteria 2042
194 Ga0068864_100174375 3300005618 Bacteria 1962
195 Ga0068864_100433300 3300005618 Bacteria 1255
196 Ga0068864_100741806 3300005618 Bacteria 962
197 Ga0068864_101293238 3300005618 Bacteria 729
198 Ga0068866_10650128 3300005718 Bacteria 718
199 Ga0068861_100346996 3300005719 Unclassified 1301
200 Ga0068861_100778050 3300005719 Bacteria 896
201 Ga0068851_10351263 3300005834 Bacteria 858
202 Ga0068863_100041601 3300005841 Bacteria 4370
203 Ga0068863_100043177 3300005841 Bacteria 4280
204 Ga0068863_100043287 3300005841 Bacteria 4275
205 Ga0068863_100131930 3300005841 Bacteria 2385
206 Ga0068863_100479384 3300005841 Bacteria 1223
207 Ga0068863_100668702 3300005841 Bacteria 1031
208 Ga0068858_100383239 3300005842 Bacteria 1349
209 Ga0068858_100625171 3300005842 Bacteria 1046
210 Ga0068858_100822420 3300005842 Bacteria 907
211 Ga0068858_101211710 3300005842 Unclassified 742
212 Ga0068860_100036750 3300005843 Bacteria 4690
213 Ga0068860_100761740 3300005843 Bacteria 980
214 Ga0068860_101413238 3300005843 Bacteria 717
215 Ga0068860_101570719 3300005843 Bacteria 680
216 Ga0068862_100014830 3300005844 Bacteria 6473
217 Ga0068862_100202569 3300005844 Bacteria 1790
218 Ga0068862_100245488 3300005844 Bacteria 1630
219 Ga0068862_100523773 3300005844 Bacteria 1128
220 Ga0081455_10328273 3300005937 Bacteria 1087
221 Ga0081538_10008601 3300005981 Bacteria 8637
222 Ga0081540_1088867 3300005983 Bacteria 1365
223 Ga0081539_10000003 3300005985 Bacteria 594833
224 Ga0081539_10000346 3300005985 Bacteria 101962
225 Ga0081539_10012442 3300005985 Bacteria 6559
226 Ga0081539_10193063 3300005985 Bacteria 946
227 Ga0070717_10154099 3300006028 Bacteria 1989
228 Ga0070717_10327410 3300006028 Bacteria 1366
229 Ga0070717_10762421 3300006028 Unclassified 880
230 Ga0075365_10016131 3300006038 Bacteria 4535
231 Ga0075365_10102255 3300006038 Bacteria 1963
232 Ga0075368_10004650 3300006042 Bacteria 4670
233 Ga0075368_10041948 3300006042 Bacteria 1799
234 Ga0075368_10071246 3300006042 Bacteria 1404
235 Ga0075368_10076377 3300006042 Bacteria 1359
236 Ga0075363_100053470 3300006048 Bacteria 2158
237 Ga0075363_100091523 3300006048 Bacteria 1674
238 Ga0075363_100139908 3300006048 Bacteria 1362
239 Ga0075364_10003451 3300006051 Bacteria 8994
240 Ga0075364_10019486 3300006051 Bacteria 4259
241 Ga0075364_10064789 3300006051 Bacteria 2399
242 Ga0075432_10161220 3300006058 Bacteria 867
243 Ga0070715_10632920 3300006163 Bacteria 631
244 Ga0070716_100011786 3300006173 Bacteria 4410
245 Ga0070716_100040477 3300006173 Bacteria 2593
246 Ga0070712_100032208 3300006175 Bacteria 3538
247 Ga0070712_101071439 3300006175 Bacteria 699
248 Ga0075362_10225478 3300006177 Bacteria 917
249 Ga0075367_10019688 3300006178 Bacteria 3746
250 Ga0075367_10020460 3300006178 Bacteria 3686
251 Ga0075367_10057257 3300006178 Bacteria 2318
252 Ga0075367_10070419 3300006178 Bacteria 2102
253 Ga0075367_10189341 3300006178 Bacteria 1284
254 Ga0075367_10266956 3300006178 Bacteria 1075
255 Ga0075367_10475074 3300006178 Bacteria 792
256 Ga0075369_10091204 3300006186 Bacteria 1360
257 Ga0075366_10009393 3300006195 Bacteria 5459
258 Ga0075366_10052816 3300006195 Bacteria 2414
259 Ga0075366_10061096 3300006195 Bacteria 2239
260 Ga0075366_10338233 3300006195 Bacteria 923
261 Ga0097621_100113883 3300006237 Bacteria 2287
262 Ga0097621_100350295 3300006237 Bacteria 1313
263 Ga0075370_10002181 3300006353 Bacteria 8986
264 Ga0075370_10012926 3300006353 Bacteria 4425
265 Ga0075370_10013329 3300006353 Bacteria 4365
266 Ga0075370_10163258 3300006353 Bacteria 1308
267 Ga0075370_10605547 3300006353 Bacteria 664
268 Ga0068871_100222846 3300006358 Bacteria 1635
269 Ga0068871_100252542 3300006358 Bacteria 1536
270 Ga0068871_100427329 3300006358 Bacteria 1184
271 Ga0068871_100433588 3300006358 Bacteria 1175
272 Ga0068871_100843462 3300006358 Bacteria 847
273 Ga0068871_100863105 3300006358 Bacteria 837
274 Ga0075428_100017272 3300006844 Bacteria 7973
275 Ga0075428_100502573 3300006844 Bacteria 1297
276 Ga0075428_101493254 3300006844 Bacteria 708
277 Ga0075430_100028642 3300006846 Bacteria 4731
278 Ga0075430_100156406 3300006846 Bacteria 1898
279 Ga0075430_100690990 3300006846 Bacteria 841
280 Ga0075431_100043836 3300006847 Bacteria 4614
281 Ga0075431_100271134 3300006847 Bacteria 1720
282 Ga0075431_100379509 3300006847 Bacteria 1418
283 Ga0075433_10058338 3300006852 Bacteria 3376
284 Ga0075433_10191017 3300006852 Bacteria 1822
285 Ga0075433_11119736 3300006852 Bacteria 684
286 Ga0075434_100015294 3300006871 Bacteria 7354
287 Ga0075434_100049816 3300006871 Bacteria 4160
288 Ga0075434_100454676 3300006871 Bacteria 1302
289 Ga0075434_100661105 3300006871 Bacteria 1063
290 Ga0075434_100706109 3300006871 Bacteria 1026
291 Ga0075429_100237703 3300006880 Bacteria 1596
292 Ga0068865_100001272 3300006881 Bacteria 14683
293 Ga0068865_100452620 3300006881 Bacteria 1062
294 Ga0068865_100787492 3300006881 Bacteria 819
295 Ga0075436_100188202 3300006914 Bacteria 1460
296 Ga0097620_100005606 3300006931 Bacteria 12793
297 Ga0097620_100071915 3300006931 Bacteria 3494
298 Ga0097620_100239042 3300006931 Bacteria 1905
299 Ga0075435_100014528 3300007076 Bacteria 5889
300 Ga0075435_100552806 3300007076 Bacteria 997
301 Ga0099794_10353221 3300007265 Bacteria 765
302 Ga0105240_10103772 3300009093 Bacteria 3453
303 Ga0105240_10990527 3300009093 Unclassified 899
304 Ga0111539_10003504 3300009094 Bacteria 20691
305 Ga0111539_10022534 3300009094 Bacteria 7737
306 Ga0111539_10042358 3300009094 Bacteria 5468
307 Ga0111539_10049952 3300009094 Bacteria 4984
308 Ga0111539_10257027 3300009094 Unclassified 2034
309 Ga0105245_10493826 3300009098 Bacteria 1239
310 Ga0105245_10807139 3300009098 Bacteria 977
311 Ga0105247_10227955 3300009101 Bacteria 1264
312 Ga0105247_10344493 3300009101 Bacteria 1046
313 Ga0105247_10680063 3300009101 Bacteria 772
314 Ga0114129_10119779 3300009147 Bacteria 3625
315 Ga0114129_10436978 3300009147 Unclassified 1719
316 Ga0114129_11108676 3300009147 Bacteria 990
317 Ga0105243_10526630 3300009148 Bacteria 1125
318 Ga0105243_10808955 3300009148 Bacteria 924
319 Ga0105243_10990212 3300009148 Bacteria 842
320 Ga0105243_11401465 3300009148 Bacteria 719
321 Ga0105241_10040133 3300009174 Bacteria 3533
322 Ga0105241_10073261 3300009174 Unclassified 2664
323 Ga0105241_10194450 3300009174 Bacteria 1690
324 Ga0105241_10966345 3300009174 Bacteria 795
325 Ga0105241_10999164 3300009174 Unclassified 783
326 Ga0105241_11228106 3300009174 Bacteria 711
327 Ga0105242_10169898 3300009176 Bacteria 1915
328 Ga0105242_10727088 3300009176 Bacteria 974
329 Ga0105242_11268987 3300009176 Bacteria 759
330 Ga0105242_11325761 3300009176 Bacteria 744
331 Ga0105242_11934108 3300009176 Bacteria 631
332 Ga0105248_10001957 3300009177 Bacteria 22903
333 Ga0105248_10022278 3300009177 Bacteria 7024
334 Ga0105248_10059986 3300009177 Bacteria 4272
335 Ga0105248_10112372 3300009177 Bacteria 3072
336 Ga0105248_10119519 3300009177 Bacteria 2972
337 Ga0105248_10119532 3300009177 Bacteria 2972
338 Ga0105248_10218137 3300009177 Bacteria 2148
339 Ga0105248_10376167 3300009177 Bacteria 1599
340 Ga0105248_10512838 3300009177 Bacteria 1352
341 Ga0105248_11035499 3300009177 Bacteria 927
342 Ga0105248_11368471 3300009177 Bacteria 801
343 Ga0105237_10083727 3300009545 Bacteria 3180
344 Ga0105237_10109525 3300009545 Bacteria 2754
345 Ga0105237_10432546 3300009545 Bacteria 1322
346 Ga0105237_11023447 3300009545 Bacteria 833
347 Ga0105237_11173966 3300009545 Bacteria 774
348 Ga0105237_11227813 3300009545 Bacteria 756
349 Ga0105238_10111151 3300009551 Bacteria 2721
350 Ga0105238_10116908 3300009551 Bacteria 2647
351 Ga0105238_10393550 3300009551 Bacteria 1378
352 Ga0105249_10045948 3300009553 Bacteria 3973
353 Ga0105249_10220242 3300009553 Bacteria 1867
354 Ga0105249_10313282 3300009553 Bacteria 1578
355 Ga0105239_10018055 3300010375 Bacteria 7803
356 Ga0105239_10029804 3300010375 Bacteria 6000
357 Ga0105239_10313205 3300010375 Bacteria 1769
358 Ga0105239_10424038 3300010375 Bacteria 1507
359 Ga0105239_11023041 3300010375 Bacteria 950
360 Ga0105246_10268324 3300011119 Bacteria 1363
361 Ga0105246_10836704 3300011119 Bacteria 820
362 Ga0157373_10283330 3300013100 Bacteria 1175
363 Ga0157370_10314544 3300013104 Bacteria 1445
364 Ga0157370_10728599 3300013104 Bacteria 904
365 Ga0157369_10072655 3300013105 Bacteria 3692
366 Ga0157369_10523991 3300013105 Bacteria 1226
367 Ga0157369_10901694 3300013105 Bacteria 907
368 Ga0157369_10970687 3300013105 Bacteria 870
369 Ga0157374_10031830 3300013296 Viruses 4798
370 Ga0157374_10060993 3300013296 Bacteria 3531
371 Ga0157374_10100534 3300013296 Bacteria 2772
372 Ga0157374_10212883 3300013296 Bacteria 1895
373 Ga0157374_10861698 3300013296 Bacteria 923
374 Ga0157378_10326093 3300013297 Bacteria 1493
375 Ga0157378_10447392 3300013297 Bacteria 1281
376 Ga0157378_12257621 3300013297 Bacteria 596
377 Ga0163162_10033581 3300013306 Bacteria 5099
378 Ga0163162_10238432 3300013306 Bacteria 1949
379 Ga0163162_10309085 3300013306 Bacteria 1713
380 Ga0163162_10542850 3300013306 Bacteria 1291
381 Ga0163162_10804837 3300013306 Bacteria 1057
382 Ga0163162_10918316 3300013306 Bacteria 988
383 Ga0163162_10937522 3300013306 Bacteria 977
384 Ga0163162_11439754 3300013306 Bacteria 784
385 Ga0163162_11563681 3300013306 Bacteria 752
386 Ga0157372_10019830 3300013307 Bacteria 7246
387 Ga0157372_10060434 3300013307 Bacteria 4241
388 Ga0157372_10090692 3300013307 Bacteria 3475
389 Ga0157372_10194122 3300013307 Bacteria 2352
390 Ga0157372_10292483 3300013307 Bacteria 1894
391 Ga0157372_11037586 3300013307 Unclassified 949
392 Ga0157372_11515434 3300013307 Bacteria 772
393 Ga0157375_10079664 3300013308 Bacteria 3312
394 Ga0157375_10263607 3300013308 Bacteria 1885
395 Ga0157375_11207821 3300013308 Bacteria 887
396 Ga0157375_11657834 3300013308 Bacteria 757
397 Ga0163163_10074915 3300014325 Bacteria 3378
398 Ga0163163_10090395 3300014325 Bacteria 3075
399 Ga0163163_10096115 3300014325 Bacteria 2983
400 Ga0163163_10290728 3300014325 Bacteria 1686
401 Ga0163163_10752752 3300014325 Bacteria 1038
402 Ga0163163_10795224 3300014325 Bacteria 1009
403 Ga0163163_10863915 3300014325 Bacteria 968
404 Ga0157380_10019554 3300014326 Bacteria 5048
405 Ga0157380_10099011 3300014326 Bacteria 2424
406 Ga0157380_10414949 3300014326 Bacteria 1282
407 Ga0157380_10545998 3300014326 Unclassified 1136
408 Ga0157380_10742204 3300014326 Bacteria 992
409 Ga0157380_11238853 3300014326 Bacteria 791
410 Ga0157380_11332854 3300014326 Bacteria 766
411 Ga0157377_10131636 3300014745 Bacteria 1528
412 Ga0157377_10246367 3300014745 Bacteria 1156
413 Ga0157379_10027114 3300014968 Bacteria 5099
414 Ga0157379_10947718 3300014968 Bacteria 818
415 Ga0157379_11238136 3300014968 Bacteria 719
416 Ga0157376_10835963 3300014969 Bacteria 935
417 Ga0157376_10870292 3300014969 Bacteria 917
418 Ga0163161_10576125 3300017792 Bacteria 925
419 Ga0163161_10758443 3300017792 Bacteria 812
420 Ga0163161_10967278 3300017792 Bacteria 725
421 Ga0197907_10250064 3300020069 Bacteria 1621
422 Ga0206356_10835401 3300020070 Bacteria 3665
423 Ga0206352_11263230 3300020078 Bacteria 875
424 Ga0206350_10254172 3300020080 Bacteria 788
425 Ga0154015_1216348 3300020610 Bacteria 799
426 Ga0213876_10069700 3300021384 Bacteria 1857
427 Ga0213875_10004794 3300021388 Bacteria 7352
428 Ga0209646_1005277 3300025246 Bacteria 2270
429 Ga0209026_1001118 3300025250 Bacteria 12743
430 Ga0209759_1001219 3300025256 Bacteria 15749
431 Ga0209050_1065246 3300025298 Bacteria 839
432 Ga0209051_1000772 3300025303 Bacteria 33982
433 Ga0209051_1023639 3300025303 Bacteria 2549
434 Ga0209051_1024759 3300025303 Bacteria 2460
435 Ga0207697_10226645 3300025315 Bacteria 825
436 Ga0207656_10099209 3300025321 Bacteria 1333
437 Ga0207682_10000542 3300025893 Bacteria 17400
438 Ga0207692_10000651 3300025898 Bacteria 12233
439 Ga0207692_10140432 3300025898 Bacteria 1374
440 Ga0207692_10456028 3300025898 Bacteria 805
441 Ga0207692_10599884 3300025898 Bacteria 708
442 Ga0207692_10804841 3300025898 Bacteria 615
443 Ga0207710_10074763 3300025900 Bacteria 1560
444 Ga0207688_10038134 3300025901 Bacteria 2666
445 Ga0207680_10123163 3300025903 Bacteria 1699
446 Ga0207680_10462627 3300025903 Bacteria 901
447 Ga0207647_10020107 3300025904 Bacteria 4482
448 Ga0207647_10620308 3300025904 Bacteria 595
449 Ga0207647_10623765 3300025904 Bacteria 593
450 Ga0207699_10000194 3300025906 Bacteria 36380
451 Ga0207645_10112689 3300025907 Bacteria 1762
452 Ga0207705_10053688 3300025909 Bacteria 2904
453 Ga0207705_10055357 3300025909 Bacteria 2860
454 Ga0207654_10048227 3300025911 Unclassified 2436
455 Ga0207654_10114069 3300025911 Bacteria 1686
456 Ga0207654_10159068 3300025911 Bacteria 1457
457 Ga0207654_10599717 3300025911 Unclassified 786
458 Ga0207654_11145552 3300025911 Bacteria 567
459 Ga0207707_10063588 3300025912 Bacteria 3212
460 Ga0207707_10140082 3300025912 Bacteria 2115
461 Ga0207707_10247833 3300025912 Bacteria 1548
462 Ga0207695_10936018 3300025913 Bacteria 746
463 Ga0207671_10193280 3300025914 Bacteria 1587
464 Ga0207671_10687608 3300025914 Bacteria 814
465 Ga0207671_10771588 3300025914 Bacteria 763
466 Ga0207693_10043037 3300025915 Bacteria 3555
467 Ga0207693_10320999 3300025915 Bacteria 1212
468 Ga0207663_10003668 3300025916 Bacteria 7547
469 Ga0207663_10421442 3300025916 Bacteria 1025
470 Ga0207663_10726502 3300025916 Unclassified 788
471 Ga0207663_10905286 3300025916 Bacteria 705
472 Ga0207660_10024051 3300025917 Bacteria 4120
473 Ga0207660_10026227 3300025917 Bacteria 3967
474 Ga0207660_10389556 3300025917 Bacteria 1121
475 Ga0207660_10418892 3300025917 Bacteria 1080
476 Ga0207662_10119875 3300025918 Bacteria 1649
477 Ga0207657_10000952 3300025919 Bacteria 30667
478 Ga0207657_10505653 3300025919 Unclassified 946
479 Ga0207657_10508960 3300025919 Bacteria 943
480 Ga0207649_10316650 3300025920 Bacteria 1145
481 Ga0207649_11248938 3300025920 Unclassified 587
482 Ga0207652_10002763 3300025921 Bacteria 14740
483 Ga0207652_10099865 3300025921 Bacteria 2561
484 Ga0207652_10416559 3300025921 Bacteria 1212
485 Ga0207646_10011382 3300025922 Bacteria 8628
486 Ga0207646_10117032 3300025922 Bacteria 2394
487 Ga0207681_10206063 3300025923 Bacteria 1513
488 Ga0207681_10226090 3300025923 Bacteria 1450
489 Ga0207681_10974220 3300025923 Bacteria 711
490 Ga0207694_10001305 3300025924 Bacteria 21455
491 Ga0207694_10272448 3300025924 Bacteria 1389
492 Ga0207694_10332518 3300025924 Bacteria 1255
493 Ga0207650_10036850 3300025925 Bacteria 3560
494 Ga0207650_10779971 3300025925 Bacteria 810
495 Ga0207650_10782575 3300025925 Bacteria 808
496 Ga0207650_10934191 3300025925 Bacteria 737
497 Ga0207659_10070253 3300025926 Bacteria 2553
498 Ga0207659_10074883 3300025926 Bacteria 2482
499 Ga0207659_11268183 3300025926 Bacteria 633
500 Ga0207687_10516820 3300025927 Bacteria 998
501 Ga0207687_11090538 3300025927 Bacteria 686
502 Ga0207700_10074521 3300025928 Bacteria 2626
503 Ga0207700_10089288 3300025928 Bacteria 2429
504 Ga0207700_10249808 3300025928 Bacteria 1515
505 Ga0207700_11142953 3300025928 Bacteria 696
506 Ga0207664_10778060 3300025929 Unclassified 861
507 Ga0207664_10791670 3300025929 Bacteria 853
508 Ga0207644_10033525 3300025931 Bacteria 3589
509 Ga0207644_10067322 3300025931 Bacteria 2610
510 Ga0207644_10160307 3300025931 Bacteria 1748
511 Ga0207644_10832476 3300025931 Bacteria 772
512 Ga0207690_10057850 3300025932 Bacteria 2621
513 Ga0207690_10232272 3300025932 Bacteria 1417
514 Ga0207706_10000849 3300025933 Bacteria 31433
515 Ga0207706_10015018 3300025933 Bacteria 7012
516 Ga0207706_10187810 3300025933 Bacteria 1814
517 Ga0207706_10194881 3300025933 Bacteria 1777
518 Ga0207706_10633837 3300025933 Unclassified 916
519 Ga0207706_10934419 3300025933 Bacteria 731
520 Ga0207686_10962600 3300025934 Bacteria 691
521 Ga0207709_10317752 3300025935 Bacteria 1164
522 Ga0207709_10462752 3300025935 Bacteria 982
523 Ga0207670_10000448 3300025936 Bacteria 23148
524 Ga0207669_10019579 3300025937 Bacteria 3528
525 Ga0207704_10000435 3300025938 Bacteria 18647
526 Ga0207704_10340450 3300025938 Bacteria 1164
527 Ga0207704_10872519 3300025938 Bacteria 755
528 Ga0207704_11320302 3300025938 Bacteria 617
529 Ga0207665_10021480 3300025939 Bacteria 4245
530 Ga0207665_10054108 3300025939 Bacteria 2706
531 Ga0207665_10240803 3300025939 Bacteria 1333
532 Ga0207665_10493483 3300025939 Bacteria 945
533 Ga0207691_10004521 3300025940 Bacteria 13455
534 Ga0207691_10230530 3300025940 Bacteria 1604
535 Ga0207691_10720325 3300025940 Bacteria 841
536 Ga0207711_10001596 3300025941 Bacteria 20956
537 Ga0207711_10030078 3300025941 Bacteria 4580
538 Ga0207711_10156249 3300025941 Bacteria 2061
539 Ga0207711_10239513 3300025941 Bacteria 1663
540 Ga0207711_10245493 3300025941 Bacteria 1643
541 Ga0207711_10329176 3300025941 Bacteria 1413
542 Ga0207711_10399407 3300025941 Bacteria 1277
543 Ga0207711_10754049 3300025941 Bacteria 907
544 Ga0207689_10268342 3300025942 Bacteria 1413
545 Ga0207661_10186781 3300025944 Bacteria 1814
546 Ga0207661_10705911 3300025944 Bacteria 928
547 Ga0207661_11073606 3300025944 Bacteria 741
548 Ga0207661_11252047 3300025944 Bacteria 682
549 Ga0207661_11282534 3300025944 Bacteria 673
550 Ga0207679_10032054 3300025945 Bacteria 3685
551 Ga0207679_10275799 3300025945 Bacteria 1440
552 Ga0207679_10392247 3300025945 Bacteria 1219
553 Ga0207679_10685209 3300025945 Bacteria 929
554 Ga0207667_10227574 3300025949 Bacteria 1910
555 Ga0207667_10416537 3300025949 Bacteria 1367
556 Ga0207667_10670620 3300025949 Bacteria 1041
557 Ga0207667_10844423 3300025949 Bacteria 910
558 Ga0207712_10217066 3300025961 Bacteria 1527
559 Ga0207712_10279948 3300025961 Bacteria 1361
560 Ga0207712_10511435 3300025961 Bacteria 1028
561 Ga0207712_11142392 3300025961 Bacteria 694
562 Ga0207668_10002784 3300025972 Bacteria 10220
563 Ga0207668_10033380 3300025972 Bacteria 3409
564 Ga0207668_10428850 3300025972 Bacteria 1124
565 Ga0207668_10642862 3300025972 Bacteria 928
566 Ga0207668_10690681 3300025972 Bacteria 896
567 Ga0207668_10802545 3300025972 Bacteria 833
568 Ga0207640_10241540 3300025981 Bacteria 1396
569 Ga0207640_10612802 3300025981 Bacteria 923
570 Ga0207640_10897843 3300025981 Bacteria 774
571 Ga0207677_10000069 3300026023 Bacteria 85177
572 Ga0207677_10642603 3300026023 Bacteria 936
573 Ga0207703_10270090 3300026035 Bacteria 1540
574 Ga0207703_10558340 3300026035 Bacteria 1080
575 Ga0207703_10853474 3300026035 Bacteria 871
576 Ga0207639_10000936 3300026041 Bacteria 19751
577 Ga0207639_10044506 3300026041 Bacteria 3339
578 Ga0207639_10253489 3300026041 Bacteria 1536
579 Ga0207639_10418932 3300026041 Bacteria 1210
580 Ga0207639_10595617 3300026041 Bacteria 1019
581 Ga0207639_10620402 3300026041 Bacteria 998
582 Ga0207639_10930015 3300026041 Bacteria 813
583 Ga0207678_10034267 3300026067 Bacteria 4422
584 Ga0207678_10145742 3300026067 Bacteria 2021
585 Ga0207678_10347643 3300026067 Bacteria 1279
586 Ga0207678_10530678 3300026067 Bacteria 1028
587 Ga0207708_10182093 3300026075 Bacteria 1668
588 Ga0207708_10782379 3300026075 Bacteria 820
589 Ga0207702_10097679 3300026078 Bacteria 2585
590 Ga0207702_10136729 3300026078 Bacteria 2212
591 Ga0207702_10363357 3300026078 Bacteria 1388
592 Ga0207702_10990215 3300026078 Bacteria 834
593 Ga0207641_10046055 3300026088 Bacteria 3676
594 Ga0207641_10098214 3300026088 Bacteria 2575
595 Ga0207641_10166814 3300026088 Bacteria 2006
596 Ga0207641_10420196 3300026088 Bacteria 1287
597 Ga0207641_10949849 3300026088 Bacteria 855
598 Ga0207641_11359649 3300026088 Bacteria 711
599 Ga0207641_11616182 3300026088 Bacteria 650
600 Ga0207641_12019031 3300026088 Bacteria 578
601 Ga0207648_10853437 3300026089 Bacteria 849
602 Ga0207648_11682561 3300026089 Bacteria 596
603 Ga0207676_10002300 3300026095 Bacteria 13708
604 Ga0207676_10010779 3300026095 Bacteria 6520
605 Ga0207676_10066825 3300026095 Bacteria 2869
606 Ga0207676_10168228 3300026095 Bacteria 1907
607 Ga0207676_10637500 3300026095 Bacteria 1027
608 Ga0207674_10006167 3300026116 Bacteria 14153
609 Ga0207674_10011453 3300026116 Bacteria 9965
610 Ga0207674_10253498 3300026116 Bacteria 1707
611 Ga0207674_10518147 3300026116 Bacteria 1152
612 Ga0207674_10705282 3300026116 Bacteria 974
613 Ga0207675_100259286 3300026118 Bacteria 1684
614 Ga0207675_100410990 3300026118 Unclassified 1335
615 Ga0207675_100820356 3300026118 Bacteria 944
616 Ga0207683_10046102 3300026121 Bacteria 3813
617 Ga0207683_10065177 3300026121 Bacteria 3211
618 Ga0207683_10190797 3300026121 Bacteria 1860
619 Ga0207683_10197404 3300026121 Bacteria 1828
620 Ga0207683_10209690 3300026121 Bacteria 1773
621 Ga0207683_10599503 3300026121 Bacteria 1019
622 Ga0207698_10181741 3300026142 Bacteria 1864
623 Ga0207698_10501225 3300026142 Bacteria 1182
624 Ga0207698_10994659 3300026142 Bacteria 849
625 Ga0207698_11084122 3300026142 Bacteria 813
626 Ga0209588_1201530 3300027671 Bacteria 620
627 Ga0209813_10015168 3300027866 Bacteria 2083
628 Ga0209813_10016619 3300027866 Bacteria 2010
629 Ga0209813_10034278 3300027866 Bacteria 1514
630 Ga0207428_10015869 3300027907 Bacteria 6498
631 Ga0207428_10190787 3300027907 Bacteria 1545
632 Ga0207428_10236053 3300027907 Bacteria 1367
633 Ga0207428_10360977 3300027907 Bacteria 1068
634 Ga0268266_10033801 3300028379 Bacteria 4346
635 Ga0268266_10294203 3300028379 Bacteria 1513
636 Ga0268265_10009031 3300028380 Bacteria 6741
637 Ga0268265_10060507 3300028380 Bacteria 2903
638 Ga0268265_10198244 3300028380 Bacteria 1739
639 Ga0268265_11116452 3300028380 Bacteria 783
640 Ga0268264_10035100 3300028381 Bacteria 4129
641 Ga0268264_10768508 3300028381 Bacteria 961
642 Ga0268264_10942713 3300028381 Bacteria 868
643 Ga0268264_11011008 3300028381 Bacteria 838
644 Ga0265334_10003926 3300028573 Bacteria 6697
645 Ga0265318_10000016 3300028577 Bacteria 184782
646 Ga0307515_10086670 3300028794 Bacteria 3988
647 Ga0307515_10463390 3300028794 Bacteria 881
648 Ga0265338_10189069 3300028800 Bacteria 1562
649 Ga0265338_10814281 3300028800 Bacteria 639
650 Ga0265324_10013329 3300029957 Bacteria 3070
651 Ga0265767_108251 3300030836 Bacteria 674
652 Ga0265332_10030665 3300031238 Bacteria 2348
653 Ga0265328_10000019 3300031239 Bacteria 130536
654 Ga0265328_10007021 3300031239 Bacteria 4723
655 Ga0265320_10003281 3300031240 Bacteria 10923
656 Ga0265339_10382783 3300031249 Bacteria 659
657 Ga0265331_10025888 3300031250 Bacteria 2957
658 Ga0265316_10110709 3300031344 Bacteria 2079
659 Ga0265316_10939340 3300031344 Bacteria 603
660 Ga0307513_10084886 3300031456 Bacteria 3251
661 Ga0307513_10127195 3300031456 Bacteria 2501
662 Ga0307408_100008603 3300031548 Bacteria 6740
663 Ga0307408_100042714 3300031548 Bacteria 3222
664 Ga0307408_100106374 3300031548 Bacteria 2146
665 Ga0307408_100111336 3300031548 Bacteria 2103
666 Ga0307408_100144442 3300031548 Bacteria 1871
667 Ga0307408_100336488 3300031548 Bacteria 1276
668 Ga0265313_10002768 3300031595 Bacteria 14786
669 Ga0307508_10096487 3300031616 Bacteria 2548
670 Ga0307508_10323461 3300031616 Bacteria 1134
671 Ga0316579_10013022 3300031691 Bacteria 3573
672 Ga0265314_10000596 3300031711 Bacteria 45506
673 Ga0316576_10348290 3300031727 Bacteria 1102
674 Ga0316578_10052128 3300031728 Bacteria 2397
675 Ga0316578_10124084 3300031728 Bacteria 1553
676 Ga0307516_10002446 3300031730 Bacteria 24850
677 Ga0307516_10008341 3300031730 Bacteria 11744
678 Ga0307516_10009998 3300031730 Bacteria 10504
679 Ga0307516_10420643 3300031730 Bacteria 994
680 Ga0307405_10003502 3300031731 Bacteria 7225
681 Ga0307405_10084737 3300031731 Bacteria 2081
682 Ga0307405_10098809 3300031731 Bacteria 1952
683 Ga0307405_10280897 3300031731 Bacteria 1253
684 Ga0307413_10002867 3300031824 Bacteria 7116
685 Ga0307413_10027727 3300031824 Bacteria 3144
686 Ga0307413_10091708 3300031824 Bacteria 1980
687 Ga0307413_10388108 3300031824 Bacteria 1090
688 Ga0307410_10006693 3300031852 Bacteria 6242
689 Ga0307410_10007880 3300031852 Bacteria 5867
690 Ga0307410_10065252 3300031852 Bacteria 2504
691 Ga0307410_10107092 3300031852 Bacteria 2016
692 Ga0307410_10122219 3300031852 Bacteria 1900
693 Ga0307410_10243065 3300031852 Bacteria 1396
694 Ga0307410_10701516 3300031852 Bacteria 853
695 Ga0307406_10003830 3300031901 Bacteria 8190
696 Ga0307407_10001158 3300031903 Bacteria 9257
697 Ga0307407_10034240 3300031903 Bacteria 2779
698 Ga0307407_10397934 3300031903 Bacteria 987
699 Ga0307412_10150729 3300031911 Bacteria 1715
700 Ga0307412_10345644 3300031911 Bacteria 1192
701 Ga0307412_10395974 3300031911 Bacteria 1123
702 Ga0307412_10471288 3300031911 Bacteria 1039
703 Ga0307409_100003996 3300031995 Bacteria 8179
704 Ga0307409_100013589 3300031995 Bacteria 5250
705 Ga0307409_100047015 3300031995 Bacteria 3271
706 Ga0307409_100241018 3300031995 Bacteria 1646
707 Ga0307409_100426045 3300031995 Bacteria 1274
708 Ga0307409_100542967 3300031995 Bacteria 1140
709 Ga0307416_100006864 3300032002 Bacteria 7164
710 Ga0307416_100015598 3300032002 Bacteria 5253
711 Ga0307416_100062445 3300032002 Bacteria 3046
712 Ga0307416_100258211 3300032002 Bacteria 1701
713 Ga0307416_100575719 3300032002 Bacteria 1202
714 Ga0307416_101390618 3300032002 Bacteria 807
715 Ga0307416_101558741 3300032002 Unclassified 766
716 Ga0307414_10018888 3300032004 Bacteria 4259
717 Ga0307414_10035853 3300032004 Bacteria 3305
718 Ga0307414_10076263 3300032004 Bacteria 2436
719 Ga0307411_10002709 3300032005 Bacteria 7943
720 Ga0307411_10018142 3300032005 Bacteria 4030
721 Ga0307411_10030603 3300032005 Bacteria 3301
722 Ga0307411_10034726 3300032005 Bacteria 3141
723 Ga0307411_10237776 3300032005 Bacteria 1424
724 Ga0307411_10255728 3300032005 Bacteria 1380
725 Ga0307411_11459179 3300032005 Bacteria 628
726 Ga0307415_100055513 3300032126 Bacteria 2711
727 Ga0307415_100067894 3300032126 Bacteria 2493
728 Ga0307415_100118379 3300032126 Bacteria 1980
729 Ga0307415_100121128 3300032126 Bacteria 1962
730 Ga0307415_100267440 3300032126 Bacteria 1399
731 Ga0307415_100489996 3300032126 Bacteria 1072
732 Ga0373948_0108667 3300034817 Bacteria 660
733 Ga0373923_0092188 3300035111 Bacteria 1326
734 Ga0373936_0000302 3300035113 Bacteria 16524
735 Ga0373939_0101425 3300035114 Bacteria 988
736 Ga0373945_0004590 3300035116 Bacteria 4392
737 Ga0373945_0141998 3300035116 Bacteria 969
738 Ga0373953_0001387 3300035117 Bacteria 6968
739 Ga0373954_0001462 3300035118 Bacteria 9600
740 Ga0373956_0104761 3300035119 Bacteria 1314
741 Ga0373956_0133312 3300035119 Bacteria 1164
742 Ga0373956_0457155 3300035119 Bacteria 609
743 Ga0373957_0001060 3300035120 Bacteria 7254
744 Ga0373943_0096528 3300035170 Bacteria 1539
745 Ga0373946_0001689 3300035171 Bacteria 7694
746 Ga0373946_0386887 3300035171 Bacteria 704
747 Ga0373955_0000030 3300035172 Bacteria 56889
748 Ga0373955_0136641 3300035172 Bacteria 1434
749 Ga0373962_0168592 3300035242 Bacteria 726
750 Ga0316574_0130501 3300035398 Bacteria 1617
751 Ga0373931_0007107 3300035691 Bacteria 5263
752 Ga0373931_0315580 3300035691 Bacteria 969
753 Ga0373935_0000187 3300035692 Bacteria 29255
754 Ga0373935_0057356 3300035692 Bacteria 2484
755 Ga0373935_0261567 3300035692 Bacteria 1214
756 Ga0373927_0057722 3300035695 Bacteria 2510
757 Ga0373927_0069442 3300035695 Bacteria 2280
758 Ga0373927_0253441 3300035695 Bacteria 1157
759 Ga0373933_0002169 3300035724 Bacteria 11234
760 Ga0373933_0301542 3300035724 Bacteria 1037
761 Ga0373947_0000376 3300035725 Bacteria 25253
762 Ga0373947_0105686 3300035725 Bacteria 1774
763 Ga0373947_0355314 3300035725 Bacteria 984
764 Ga0373937_0000004 3300036401 Bacteria 212269
765 Ga0373937_0155255 3300036401 Bacteria 2145
766 Ga0373937_0413261 3300036401 Bacteria 1280
767 Ga0373937_0490766 3300036401 Bacteria 1167
768 Ga0316582_0038470 3300036647 Bacteria 2973
769 Ga0316582_0256180 3300036647 Bacteria 1199
770 Ga0316584_0285895 3300036712 Bacteria 1197
771 Ga0373925_0000095 3300037068 Bacteria 95071
772 Ga0373925_0040021 3300037068 Bacteria 3469
773 Ga0373925_0179948 3300037068 Bacteria 1673
774 Ga0373925_0364512 3300037068 Bacteria 1175
775 Ga0373925_0533927 3300037068 Bacteria 964
776 Ga0395899_0299799 3300037312 Bacteria 1088
777 Ga0395898_0116607 3300037466 Unclassified 2559
778 Ga0395898_0837125 3300037466 Bacteria 860
779 Ga0395905_0124177 3300037471 Bacteria 2427
780 Ga0395905_0252221 3300037471 Bacteria 1648
781 Ga0316581_0002183 3300037588 Bacteria 4621
782 Ga0316581_0014742 3300037588 Bacteria 2227
783 Ga0436364_0093884 3300037853 Bacteria 7447
784 Ga0395901_0000076 3300038443 Bacteria 138169
785 Ga0395901_0261083 3300038443 Bacteria 1803
786 Ga0395901_0602987 3300038443 Bacteria 1107
787 Ga0395901_1170767 3300038443 Bacteria 736
788 Ga0400490_48312 3300038726 Bacteria 4689
789 Ga0400485_19896 3300038735 Bacteria 4174
790 Ga0400488_62281 3300038741 Bacteria 5616
791 Ga0400483_108538 3300039062 Bacteria 5326
792 Ga0436365_0727857 3300039437 Bacteria 4779
793 Ga0436365_0858454 3300039437 Bacteria 2893
794 Ga0436365_1236325 3300039437 Bacteria 1675
795 Ga0436363_0415220 3300039450 Bacteria 4051
796 Ga0439436_0001347 3300041404 Bacteria 7065
797 Ga0439436_0125249 3300041404 Bacteria 719
798 Ga0439438_001161 3300041405 Bacteria 11692
799 Ga0439439_0040254 3300041406 Bacteria 1209
800 Ga0439447_000738 3300041407 Bacteria 12106
801 Ga0439447_027904 3300041407 Bacteria 1438
802 Ga0439453_0008205 3300041408 Bacteria 1673
803 Ga0439466_0003579 3300041411 Bacteria 6006
804 Ga0439465_0003601 3300041413 Bacteria 5057
805 Ga0451807_2035927 3300041486 Bacteria 624
806 Ga0439431_0054414 3300041997 Bacteria 1044
807 Ga0439431_0108336 3300041997 Bacteria 768
808 Ga0439437_001050 3300042000 Bacteria 2894
809 Ga0439437_001357 3300042000 Bacteria 2573
810 Ga0439442_006004 3300042002 Bacteria 2434
811 Ga0439443_098706 3300042003 Bacteria 558
812 Ga0439448_0073009 3300042005 Bacteria 1144
813 Ga0439432_043948 3300042006 Bacteria 1408
814 Ga0439452_007612 3300042010 Bacteria 3311
815 Ga0439455_0028953 3300042012 Bacteria 1367
816 Ga0439455_0037931 3300042012 Bacteria 1224
817 Ga0439456_045989 3300042013 Bacteria 950
818 Ga0439462_0002090 3300042015 Bacteria 4581
819 Ga0450911_000004 3300042115 Bacteria 234537
820 Ga0450912_001939 3300042116 Bacteria 1334
821 Ga0450913_000050 3300042117 Bacteria 2681
822 Ga0450913_011032 3300042117 Bacteria 731
823 Ga0450917_000165 3300042120 Bacteria 4491
824 Ga0450888_001082 3300042126 Bacteria 2578
825 Ga0450890_000388 3300042127 Bacteria 6445
826 Ga0450890_023809 3300042127 Unclassified 843
827 Ga0450891_000011 3300042129 Bacteria 14278
828 Ga0450892_000573 3300042130 Bacteria 4224
829 Ga0450894_011519 3300042131 Bacteria 1152
830 Ga0450894_031496 3300042131 Bacteria 741
831 Ga0450896_016470 3300042133 Bacteria 1062
832 Ga0450898_024920 3300042134 Bacteria 1071
833 Ga0450904_000040 3300042139 Bacteria 29183
834 Ga0450889_000398 3300042144 Bacteria 4843
835 Ga0450906_001797 3300042145 Bacteria 4709
836 Ga0450906_021416 3300042145 Bacteria 1155
837 Ga0439446_0001360 3300042156 Bacteria 5520
838 Ga0439446_0020338 3300042156 Bacteria 1869
839 Ga0450909_003075 3300042185 Bacteria 2372
840 Ga0439434_0018991 3300042435 Bacteria 2060
841 Ga0439435_0005821 3300042436 Bacteria 2733
842 Ga0439435_0007076 3300042436 Bacteria 2550
843 Ga0439435_0031705 3300042436 Bacteria 1439
844 Ga0439444_0063457 3300042437 Bacteria 776
845 Ga0439459_0007596 3300042438 Bacteria 1835
846 Ga0439459_0010685 3300042438 Bacteria 1605
847 Ga0439460_0129142 3300042461 Bacteria 832
848 Ga0439460_0210068 3300042461 Bacteria 665
849 Ga0450916_000704 3300042530 Bacteria 3049
850 Ga0450893_0001119 3300042532 Bacteria 4033
851 Ga0450893_0008316 3300042532 Bacteria 1687
852 Ga0450901_004880 3300042533 Bacteria 1381
853 Ga0451577_0179793 3300042876 Bacteria 1907
854 Ga0451577_0259557 3300042876 Bacteria 1573
855 Ga0451577_0498538 3300042876 Bacteria 1106
856 Ga0451577_1054026 3300042876 Bacteria 729
857 Ga0451577_1127112 3300042876 Bacteria 701
858 Ga0466963_0088821 3300044694 Bacteria 2102
859 Ga0453684_0175604 3300044712 Bacteria 2520
860 Ga0451576_0058799 3300045051 Bacteria 4015
861 Ga0451576_0066178 3300045051 Bacteria 3762
862 Ga0451576_1356304 3300045051 Bacteria 741
863 Ga0466958_0005307 3300045836 Bacteria 6916
864 Ga0466958_0028824 3300045836 Bacteria 3294
865 Ga0466967_0093324 3300045976 Bacteria 2738
866 Ga0466967_1023737 3300045976 Bacteria 822
867 Ga0466967_1686557 3300045976 Bacteria 631
868 Ga0495617_101072 3300046452 Bacteria 937
869 Ga0495592_0000029 3300046454 Bacteria 131879
870 Ga0495603_0394666 3300046455 Bacteria 793
871 Ga0495603_0550613 3300046455 Bacteria 661
872 Ga0495590_0028274 3300046457 Bacteria 1966
873 Ga0495590_0068834 3300046457 Bacteria 1241
874 Ga0495629_0000008 3300046459 Bacteria 352138
875 Ga0495629_0036618 3300046459 Bacteria 3462
876 Ga0495629_0084638 3300046459 Bacteria 2213
877 Ga0495629_0598033 3300046459 Unclassified 738
878 Ga0495638_0000093 3300046460 Bacteria 142356
879 Ga0495638_0000277 3300046460 Bacteria 69421
880 Ga0495638_0001726 3300046460 Bacteria 19228
881 Ga0495638_0145934 3300046460 Bacteria 1376
882 Ga0495638_0322298 3300046460 Bacteria 825
883 Ga0495641_0036067 3300046461 Bacteria 2326
884 Ga0495641_0152737 3300046461 Bacteria 1032
885 Ga0495651_0000535 3300046462 Bacteria 29302
886 Ga0495653_0000045 3300046463 Bacteria 115410
887 Ga0495653_0267786 3300046463 Bacteria 1127
888 Ga0495580_0000217 3300046472 Bacteria 44487
889 Ga0495582_0271961 3300046473 Bacteria 972
890 Ga0495582_0362881 3300046473 Bacteria 834
891 Ga0495605_0021305 3300046474 Bacteria 3435
892 Ga0495639_0005034 3300046475 Bacteria 5673
893 Ga0495639_0146514 3300046475 Bacteria 1137
894 Ga0495664_0000004 3300046477 Bacteria 489411
895 Ga0495664_0779174 3300046477 Bacteria 563
896 Ga0495584_0000028 3300046491 Bacteria 111816
897 Ga0495584_0035496 3300046491 Bacteria 2520
898 Ga0495584_0151269 3300046491 Bacteria 1179
899 Ga0495585_0000086 3300046492 Bacteria 97481
900 Ga0495585_0015642 3300046492 Bacteria 4406
901 Ga0495585_0098215 3300046492 Bacteria 1569
902 Ga0495594_0403129 3300046499 Bacteria 778
903 Ga0495596_0001610 3300046500 Bacteria 12832
904 Ga0495607_0002640 3300046501 Bacteria 14394
905 Ga0495607_0009005 3300046501 Bacteria 6789
906 Ga0495607_0134664 3300046501 Bacteria 1281
907 Ga0495583_0000419 3300046506 Bacteria 64108
908 Ga0495606_0001218 3300046507 Bacteria 36043
909 Ga0495606_0001429 3300046507 Bacteria 32047
910 Ga0495608_0000017 3300046511 Bacteria 192929
911 Ga0495608_0452007 3300046511 Bacteria 782
912 Ga0495610_0150433 3300046512 Bacteria 993
913 Ga0495610_0155377 3300046512 Bacteria 972
914 Ga0495616_0002066 3300046513 Bacteria 13492
915 Ga0495616_0102973 3300046513 Bacteria 1337
916 Ga0495616_0142254 3300046513 Bacteria 1091
917 Ga0495618_0000006 3300046514 Bacteria 229906
918 Ga0495618_0089042 3300046514 Bacteria 1974
919 Ga0495620_0046771 3300046515 Bacteria 1866
920 Ga0495620_0214544 3300046515 Bacteria 738
921 Ga0495628_0000001 3300046516 Bacteria 917742
922 Ga0495630_0006296 3300046517 Bacteria 8430
923 Ga0495630_0053954 3300046517 Bacteria 3011
924 Ga0495632_0000570 3300046519 Bacteria 34221
925 Ga0495632_0000731 3300046519 Bacteria 29723
926 Ga0495632_0029701 3300046519 Bacteria 2843
927 Ga0495632_0031178 3300046519 Bacteria 2759
928 Ga0495632_0079065 3300046519 Bacteria 1570
929 Ga0495637_0010875 3300046520 Bacteria 4385
930 Ga0495637_0180576 3300046520 Bacteria 783
931 Ga0495643_0000081 3300046522 Bacteria 160004
932 Ga0495644_0158070 3300046523 Bacteria 869
933 Ga0495648_0000199 3300046524 Bacteria 69421
934 Ga0495648_0056420 3300046524 Bacteria 2363
935 Ga0495652_0000002 3300046529 Bacteria 946606
936 Ga0495654_0017098 3300046530 Bacteria 3819
937 Ga0495654_0062230 3300046530 Bacteria 1790
938 Ga0495665_0139553 3300046531 Bacteria 1267
939 Ga0495640_0000001 3300046533 Bacteria 853827
940 Ga0495586_0004691 3300046535 Bacteria 7308
941 Ga0495587_0000008 3300046536 Bacteria 271097
942 Ga0495598_0165594 3300046537 Bacteria 780
943 Ga0495598_0178513 3300046537 Unclassified 756
944 Ga0495609_0014617 3300046538 Bacteria 3686
945 Ga0495609_0019454 3300046538 Bacteria 3142
946 Ga0495597_0008372 3300046542 Bacteria 5184
947 Ga0495645_0000002 3300046543 Bacteria 651644
948 Ga0495633_0002816 3300046558 Bacteria 12034
949 Ga0495633_0051413 3300046558 Bacteria 1942
950 Ga0495667_0000029 3300046559 Bacteria 151568
951 Ga0495667_0036406 3300046559 Bacteria 3286
952 Ga0495656_0039189 3300046615 Bacteria 1967
953 Ga0495656_0068632 3300046615 Bacteria 1568
954 Ga0495668_0032304 3300046616 Bacteria 2946
955 Ga0495668_0094138 3300046616 Bacteria 1640
956 Ga0495634_0031220 3300046642 Bacteria 3671
957 Ga0495634_0096485 3300046642 Bacteria 1914
958 Ga0495611_0009558 3300046648 Bacteria 4096
959 Ga0495625_0016828 3300046660 Bacteria 5741
960 Ga0495625_0076835 3300046660 Bacteria 2334
961 Ga0495625_0288009 3300046660 Bacteria 1055
962 Ga0495625_0367167 3300046660 Bacteria 906
963 Ga0495635_0000002 3300046663 Bacteria 490490
964 Ga0495635_0063635 3300046663 Bacteria 2533
965 Ga0495635_0290095 3300046663 Bacteria 1098
966 Ga0495588_0156501 3300046674 Bacteria 1205
967 Ga0495588_0223040 3300046674 Bacteria 995
968 Ga0495657_0000064 3300046675 Bacteria 94324
969 Ga0495599_0000064 3300046678 Bacteria 73422
970 Ga0495623_0000065 3300046679 Bacteria 65151
971 Ga0495623_0318766 3300046679 Bacteria 854
972 Ga0495646_0000023 3300046680 Bacteria 110212
973 Ga0495658_0067051 3300046683 Bacteria 2075
974 Ga0495658_0351691 3300046683 Bacteria 936
975 Ga0495658_0462480 3300046683 Unclassified 811
976 Ga0495669_0000752 3300046684 Bacteria 13940
977 Ga0495669_0019290 3300046684 Bacteria 2942
978 Ga0495669_0128409 3300046684 Bacteria 1192
979 Ga0495669_0295081 3300046684 Bacteria 781
980 Ga0495613_0025068 3300046689 Bacteria 4445
981 Ga0495613_0070714 3300046689 Bacteria 2544
982 Ga0495613_0073985 3300046689 Bacteria 2482
983 Ga0495613_0155767 3300046689 Bacteria 1628
984 Ga0495624_0017097 3300046690 Bacteria 4874
985 Ga0495670_0055136 3300046691 Bacteria 1993
986 Ga0495671_0000124 3300046692 Bacteria 70221
987 Ga0495671_0000135 3300046692 Bacteria 65732
988 Ga0495671_0000963 3300046692 Bacteria 20154
989 Ga0495671_0068246 3300046692 Bacteria 1748
990 Ga0495649_0000561 3300046694 Bacteria 31476
991 Ga0495649_0017156 3300046694 Bacteria 4089
992 Ga0495649_0027931 3300046694 Bacteria 3128
993 Ga0495649_0031668 3300046694 Bacteria 2915
994 Ga0495589_0064793 3300046794 Bacteria 1792
995 Ga0495600_0000010 3300046809 Bacteria 143675
996 Ga0495660_0288443 3300046810 Bacteria 748
997 Ga0495581_0039058 3300047315 Bacteria 2748
998 Ga0495581_0186301 3300047315 Bacteria 1214
999 Ga0495604_0000009 3300047317 Bacteria 326341
1000 Ga0495636_0000111 3300047318 Bacteria 34245
1001 Ga0495674_0000002 3300047319 Bacteria 642785
1002 Ga0495674_0024508 3300047319 Bacteria 5542
1003 Ga0495674_0154218 3300047319 Bacteria 1925
1004 Ga0495672_0111118 3300047320 Bacteria 1471
1005 Ga0495676_0454338 3300047321 Bacteria 845
1006 Ga0495680_0001344 3300047322 Bacteria 26713
1007 Ga0495680_0009855 3300047322 Bacteria 8564
1008 Ga0495683_0000076 3300047323 Bacteria 97809
1009 Ga0495683_0014312 3300047323 Bacteria 4133
1010 Ga0495683_0061713 3300047323 Bacteria 1856
1011 Ga0495683_0269666 3300047323 Bacteria 740
1012 Ga0495675_0000178 3300047444 Bacteria 46542
1013 Ga0495673_0000303 3300047469 Bacteria 65717
1014 Ga0495673_0162509 3300047469 Bacteria 856
1015 Ga0495681_0030908 3300047470 Bacteria 2720
1016 Ga0495684_0000006 3300047471 Bacteria 247568
1017 Ga0495684_0162200 3300047471 Bacteria 1667
1018 Ga0495686_0099455 3300047472 Bacteria 1756
1019 Ga0495593_0002369 3300047673 Bacteria 11323
1020 Ga0495593_0389454 3300047673 Bacteria 697
1021 Ga0495593_0443219 3300047673 Bacteria 650
1022 Ga0495602_0000005 3300048088 Bacteria 325957
1023 Ga0495602_0155380 3300048088 Bacteria 1792
1024 Ga0495615_0000004 3300048090 Bacteria 102268
1025 Ga0495626_0000444 3300048091 Bacteria 42261
1026 Ga0495626_0009839 3300048091 Bacteria 5141
1027 Ga0496100_0056972 3300048903 Bacteria 2558
1028 Ga0496100_0101820 3300048903 Bacteria 1981
1029 Ga0496100_0105464 3300048903 Bacteria 1949
1030 Ga0496101_0011508 3300048904 Bacteria 5874
1031 Ga0496101_0217225 3300048904 Bacteria 1483
1032 Ga0496101_0313485 3300048904 Bacteria 1230
1033 Ga0496101_0746871 3300048904 Bacteria 772
1034 Ga0496102_0361388 3300048905 Bacteria 1367
1035 Ga0496103_0224677 3300048906 Bacteria 1207
1036 Ga0496103_0335606 3300048906 Unclassified 972
1037 Ga0496104_0018658 3300048907 Bacteria 6332
1038 Ga0496104_0032785 3300048907 Bacteria 4836
1039 Ga0496104_0040433 3300048907 Bacteria 4370
1040 Ga0496104_1017378 3300048907 Bacteria 732
1041 Ga0496105_0038328 3300048908 Bacteria 3948
1042 Ga0496105_0087705 3300048908 Bacteria 2571
1043 Ga0496105_0208525 3300048908 Bacteria 1593
1044 Ga0496105_0638658 3300048908 Bacteria 822
1045 Ga0496105_0757756 3300048908 Bacteria 741
1046 Ga0496105_0819841 3300048908 Bacteria 706
1047 Ga0496106_0099763 3300048909 Bacteria 2251
1048 Ga0496106_0157711 3300048909 Bacteria 1793
1049 Ga0496106_0181293 3300048909 Bacteria 1672
1050 Ga0496106_0339336 3300048909 Bacteria 1207
1051 Ga0496106_0916712 3300048909 Unclassified 691
1052 Ga0496106_1104953 3300048909 Bacteria 621
1053 Ga0496107_0023422 3300048910 Bacteria 4366
1054 Ga0496107_0060646 3300048910 Bacteria 2738
1055 Ga0496107_0077406 3300048910 Bacteria 2423
1056 Ga0496107_0577757 3300048910 Bacteria 831
1057 Ga0496107_0617898 3300048910 Bacteria 800
1058 Ga0496108_0015389 3300048911 Bacteria 6240
1059 Ga0496108_0061105 3300048911 Bacteria 3170
1060 Ga0496108_0165929 3300048911 Bacteria 1909
1061 Ga0496108_0408006 3300048911 Bacteria 1187
1062 Ga0496109_0024989 3300048912 Bacteria 5318
1063 Ga0496109_0025994 3300048912 Bacteria 5217
1064 Ga0496109_0260557 3300048912 Bacteria 1633
1065 Ga0496109_0282430 3300048912 Bacteria 1564
1066 Ga0496109_0508877 3300048912 Bacteria 1137
1067 Ga0496110_0014036 3300048913 Bacteria 6639
1068 Ga0496110_0124434 3300048913 Bacteria 2326
1069 Ga0496110_0245051 3300048913 Bacteria 1631
1070 Ga0496110_0810344 3300048913 Bacteria 841
1071 Ga0496110_1079391 3300048913 Unclassified 711
1072 Ga0496111_0016470 3300048914 Bacteria 5093
1073 Ga0496111_0320544 3300048914 Bacteria 1148
1074 Ga0496111_0423799 3300048914 Bacteria 983
1075 Ga0496112_0009723 3300048915 Bacteria 8681
1076 Ga0496112_0105727 3300048915 Bacteria 2784
1077 Ga0496112_0114033 3300048915 Bacteria 2673
1078 Ga0496112_0168535 3300048915 Bacteria 2156
1079 Ga0496112_0279217 3300048915 Bacteria 1618
1080 Ga0496112_0457632 3300048915 Bacteria 1213
1081 Ga0496112_0625390 3300048915 Bacteria 1007
1082 Ga0496112_1437087 3300048915 Bacteria 604
1083 Ga0496113_0004304 3300048916 Bacteria 8723
1084 Ga0496113_0016246 3300048916 Bacteria 5138
1085 Ga0496113_0039668 3300048916 Bacteria 3467
1086 Ga0496113_0078110 3300048916 Bacteria 2532
1087 Ga0496113_0154979 3300048916 Bacteria 1808
1088 Ga0496113_0302076 3300048916 Bacteria 1282
1089 Ga0496114_0199679 3300048917 Bacteria 1751
1090 Ga0496114_0418979 3300048917 Bacteria 1186
1091 Ga0496114_0670973 3300048917 Bacteria 910
1092 Ga0496114_0904148 3300048917 Bacteria 764
1093 Ga0496115_0354246 3300048918 Bacteria 1197
1094 Ga0496115_0557336 3300048918 Bacteria 915
1095 Ga0496118_0362095 3300048921 Bacteria 768
1096 Ga0496122_0000929 3300048925 Bacteria 53417
1097 Ga0496123_0000798 3300048926 Bacteria 50960
1098 Ga0496124_0004446 3300048927 Bacteria 16344
1099 Ga0496125_0032291 3300048928 Bacteria 4652
1100 Ga0496125_0036215 3300048928 Bacteria 4313
1101 Ga0496126_0485011 3300048929 Bacteria 990
1102 Ga0495678_004092 3300049459 Bacteria 8644
1103 Ga0495678_007647 3300049459 Bacteria 5575
1104 Ga0495682_0084249 3300049460 Bacteria 1143
1105 Ga0495682_0091400 3300049460 Bacteria 1093
1106 Ga0495682_0228697 3300049460 Bacteria 658
1107 Ga0501291_008616 3300049514 Bacteria 1413
1108 Ga0501291_028190 3300049514 Bacteria 934
1109 Ga0501292_006605 3300049515 Viruses 1654
1110 Ga0501293_008645 3300049516 Bacteria 858
1111 Ga0501294_002875 3300049517 Bacteria 1628
1112 Ga0501296_003944 3300049519 Bacteria 1602
1113 Ga0501298_007937 3300049521 Bacteria 1772
1114 Ga0501299_006449 3300049522 Bacteria 1841
1115 Ga0501299_008861 3300049522 Bacteria 1646
1116 Ga0501299_066669 3300049522 Bacteria 773
1117 Ga0501300_015381 3300049523 Bacteria 1117
1118 Ga0501031_0000443 3300049568 Bacteria 23880
1119 Ga0501031_0009136 3300049568 Bacteria 6446
1120 Ga0501031_0011507 3300049568 Bacteria 5768
1121 Ga0501031_0459064 3300049568 Bacteria 823
1122 Ga0501032_0010096 3300049569 Bacteria 6816
1123 Ga0501032_0082900 3300049569 Bacteria 2133
1124 Ga0501032_0115286 3300049569 Bacteria 1777
1125 Ga0501033_0221325 3300049570 Bacteria 1347
1126 Ga0501034_0006511 3300049571 Bacteria 12559
1127 Ga0501034_0007288 3300049571 Bacteria 11791
1128 Ga0501036_0000230 3300049572 Bacteria 37374
1129 Ga0501036_0164742 3300049572 Archaea 1869
1130 Ga0501036_0308011 3300049572 Bacteria 1324
1131 Ga0501036_1000038 3300049572 Bacteria 685
1132 Ga0501037_0004342 3300049573 Bacteria 10291
1133 Ga0501037_0027855 3300049573 Bacteria 4175
1134 Ga0501037_0082094 3300049573 Bacteria 2336
1135 Ga0501037_0326387 3300049573 Archaea 1062
1136 Ga0501038_0010658 3300049574 Bacteria 8405
1137 Ga0501038_0156847 3300049574 Bacteria 1853
1138 Ga0501038_0511115 3300049574 Bacteria 918
1139 Ga0501038_0760795 3300049574 Unclassified 722
1140 Ga0501039_0000557 3300049575 Bacteria 26996
1141 Ga0501039_0001390 3300049575 Bacteria 17776
1142 Ga0501039_0358018 3300049575 Bacteria 1147
1143 Ga0501040_0000331 3300049576 Bacteria 27776
1144 Ga0501040_0062828 3300049576 Unclassified 2555
1145 Ga0501040_0093710 3300049576 Bacteria 2089
1146 Ga0501040_0101404 3300049576 Bacteria 2008
1147 Ga0501040_0193210 3300049576 Bacteria 1445
1148 Ga0501041_0000256 3300049577 Bacteria 25091
1149 Ga0501041_0006710 3300049577 Bacteria 6745
1150 Ga0501041_0016032 3300049577 Bacteria 4453
1151 Ga0501041_0125086 3300049577 Unclassified 1600
1152 Ga0501041_0128813 3300049577 Bacteria 1576
1153 Ga0501041_0527579 3300049577 Bacteria 752
1154 Ga0501042_0004679 3300049578 Bacteria 8730
1155 Ga0501042_0010292 3300049578 Bacteria 6262
1156 Ga0501042_0089132 3300049578 Bacteria 2213
1157 Ga0501042_0301164 3300049578 Bacteria 1158
1158 Ga0501046_0000618 3300049580 Bacteria 34970
1159 Ga0501046_0014890 3300049580 Bacteria 6545
1160 Ga0501046_0277103 3300049580 Bacteria 1229
1161 Ga0501047_0128166 3300049581 Bacteria 2417
1162 Ga0501048_0000179 3300049582 Bacteria 40163
1163 Ga0501048_0183356 3300049582 Unclassified 1484
1164 Ga0501048_0387647 3300049582 Bacteria 998
1165 Ga0501068_0021192 3300049584 Bacteria 3794
1166 Ga0501068_0021809 3300049584 Bacteria 3743
1167 Ga0501068_0134569 3300049584 Bacteria 1547
1168 Ga0501070_0188471 3300049586 Bacteria 1696
1169 Ga0501071_0000665 3300049587 Bacteria 17910
1170 Ga0501071_0030549 3300049587 Archaea 3812
1171 Ga0501071_0190926 3300049587 Bacteria 1536
1172 Ga0501071_0554094 3300049587 Bacteria 883
1173 Ga0501072_0001546 3300049588 Bacteria 17200
1174 Ga0501072_0107365 3300049588 Archaea 2220
1175 Ga0501072_0459501 3300049588 Bacteria 1008
1176 Ga0501072_0682377 3300049588 Bacteria 808
1177 Ga0501073_0272587 3300049589 Bacteria 1168
1178 Ga0501074_0001783 3300049590 Bacteria 14714
1179 Ga0501074_0207875 3300049590 Bacteria 1395
1180 Ga0501075_0000833 3300049591 Bacteria 19419
1181 Ga0501075_0003400 3300049591 Bacteria 10645
1182 Ga0501076_0000188 3300049592 Bacteria 36912
1183 Ga0501076_0438950 3300049592 Bacteria 1075
1184 Ga0501076_0785922 3300049592 Bacteria 785
1185 Ga0501076_1001817 3300049592 Bacteria 688
1186 Ga0501077_0004501 3300049593 Bacteria 8467
1187 Ga0501077_0006741 3300049593 Bacteria 7067
1188 Ga0501199_004511 3300049650 Viruses 1373
1189 Ga0501199_004863 3300049650 Bacteria 1337
1190 Ga0501201_001179 3300049651 Bacteria 2448
1191 Ga0501202_036395 3300049652 Bacteria 1048
1192 Ga0501207_007049 3300049654 Bacteria 1594
1193 Ga0501208_004835 3300049655 Bacteria 1616
1194 Ga0501211_010183 3300049658 Bacteria 921
1195 Ga0501217_017932 3300049661 Bacteria 1637
1196 Ga0501217_049691 3300049661 Bacteria 1092
1197 Ga0501222_001860 3300049662 Bacteria 2924
1198 Ga0501223_021102 3300049663 Bacteria 1275
1199 Ga0501227_025559 3300049665 Bacteria 1386
1200 Ga0501233_018791 3300049668 Bacteria 1457
1201 Ga0501233_020186 3300049668 Bacteria 1420
1202 Ga0501235_021193 3300049669 Bacteria 1444
1203 Ga0501243_039351 3300049675 Unclassified 827
1204 Ga0501247_016410 3300049677 Bacteria 931
1205 Ga0501249_052262 3300049679 Bacteria 939
1206 Ga0501250_009639 3300049680 Viruses 1091
1207 Ga0501257_149176 3300049686 Unclassified 644
1208 Ga0501259_090689 3300049688 Unclassified 686
1209 Ga0501221_004693 3300049704 Bacteria 2267
1210 Ga0501225_0021888 3300049705 Viruses 1764
1211 Ga0501079_0000792 3300049741 Bacteria 21536
1212 Ga0501079_0275315 3300049741 Bacteria 1316
1213 Ga0501080_0005633 3300049742 Bacteria 11191
1214 Ga0501080_0033872 3300049742 Bacteria 4769
1215 Ga0501080_0224108 3300049742 Bacteria 1720
1216 Ga0501080_0364869 3300049742 Bacteria 1303
1217 Ga0501080_0368765 3300049742 Bacteria 1295
1218 Ga0501080_0777405 3300049742 Bacteria 841
1219 Ga0501081_0023524 3300049743 Bacteria 4130
1220 Ga0501081_0218502 3300049743 Bacteria 1386
1221 Ga0501081_0371320 3300049743 Bacteria 1056
1222 Ga0501081_0633557 3300049743 Bacteria 801
1223 Ga0501083_0010454 3300049744 Bacteria 6535
1224 Ga0501232_000316 3300049757 Bacteria 3088
1225 Ga0501262_006551 3300049759 Bacteria 1395
1226 Ga0501267_000505 3300049764 Bacteria 3048
1227 Ga0501271_021899 3300049768 Bacteria 745
1228 Ga0501272_001325 3300049769 Bacteria 2329
1229 Ga0501273_008544 3300049770 Bacteria 1229
1230 Ga0501274_024193 3300049771 Unclassified 649
1231 Ga0501280_023887 3300049776 Bacteria 924
1232 Ga0501282_004766 3300049778 Bacteria 1448
1233 Ga0501283_012568 3300049779 Bacteria 1274
1234 Ga0501035_0049175 3300049822 Bacteria 3780
1235 Ga0501035_0052578 3300049822 Bacteria 3645
1236 Ga0501035_0355395 3300049822 Bacteria 1225
1237 Ga0501044_0103822 3300049823 Bacteria 2857
1238 Ga0501044_0256057 3300049823 Bacteria 1690
1239 Ga0501045_0002959 3300049824 Bacteria 11619
1240 Ga0501045_0088674 3300049824 Bacteria 2285
1241 Ga0501045_0305123 3300049824 Bacteria 1185
1242 Ga0501045_0417022 3300049824 Bacteria 999
1243 Ga0501226_000003 3300049853 Bacteria 358977
1244 nmdc:mga03683_239099_c1 3300050489 Bacteria 841
1245 nmdc:mga03683_369582_c1 3300050489 Bacteria 681
1246 nmdc:mga03n38_99342_c1 3300050490 Bacteria 1401
1247 nmdc:mga00v17_21823_c1 3300050491 Bacteria 3686
1248 nmdc:mga00v17_50934_c1 3300050491 Bacteria 2517
1249 nmdc:mga00v17_91649_c1 3300050491 Bacteria 1910
1250 nmdc:mga0yw44_328519_c1 3300050492 Bacteria 1028
1251 nmdc:mga0yw44_37334_c1 3300050492 Bacteria 2868
1252 nmdc:mga0k408_106382_c1 3300050493 Unclassified 1657
1253 nmdc:mga0k408_11684_c1 3300050493 Bacteria 4786
1254 nmdc:mga0k408_12312_c1 3300050493 Bacteria 2827
1255 nmdc:mga0k408_97938_c1 3300050493 Bacteria 1728
1256 nmdc:mga06z11_157568_c1 3300050494 Bacteria 1295
1257 nmdc:mga06z11_2682_c1 3300050494 Bacteria 6817
1258 nmdc:mga06z11_307930_c1 3300050494 Bacteria 943
1259 nmdc:mga06z11_37103_c1 3300050494 Bacteria 2411
1260 nmdc:mga06z11_3804_c1 3300050494 Bacteria 5877
1261 nmdc:mga06z11_7267_c1 3300050494 Bacteria 4547
1262 nmdc:mga04h51_14549_c1 3300050495 Bacteria 2250
1263 nmdc:mga04h51_28972_c1 3300050495 Bacteria 1731
1264 nmdc:mga07m45_104889_c1 3300050496 Bacteria 1625
1265 nmdc:mga07m45_1316_c1 3300050496 Bacteria 11316
1266 nmdc:mga07m45_66103_c1 3300050496 Bacteria 2054
1267 nmdc:mga05p37_953940_c1 3300050507 Bacteria 917
1268 nmdc:mga05p37_989043_c1 3300050507 Bacteria 895
1269 nmdc:mga09592_102960_c1 3300050508 Bacteria 2446
1270 nmdc:mga09592_1190625_c1 3300050508 Bacteria 630
1271 nmdc:mga0qj67_29970_c1 3300050509 Bacteria 4230
1272 nmdc:mga0qj67_43561_c1 3300050509 Bacteria 3534
1273 nmdc:mga06r32_148837_c1 3300050510 Bacteria 2319
1274 nmdc:mga06r32_1527683_c1 3300050510 Bacteria 607
1275 nmdc:mga06r32_155969_c1 3300050510 Bacteria 2264
1276 nmdc:mga06r32_500393_c1 3300050510 Bacteria 1192
1277 nmdc:mga06r32_56095_c1 3300050510 Bacteria 3780
1278 nmdc:mga08y16_16096_c1 3300050511 Bacteria 7865
1279 nmdc:mga08y16_27352_c1 3300050511 Bacteria 4313
1280 nmdc:mga08y16_43807_c1 3300050511 Bacteria 4689
1281 nmdc:mga08y16_494051_c1 3300050511 Bacteria 1244
1282 nmdc:mga08y16_54145_c1 3300050511 Bacteria 4193
1283 nmdc:mga0n895_464217_c1 3300050512 Unclassified 1278
1284 nmdc:mga0n895_466202_c1 3300050512 Bacteria 1274
1285 nmdc:mga0n895_76931_c1 3300050512 Bacteria 3318
1286 nmdc:mga0rr50_152308_c1 3300050513 Bacteria 1870
1287 nmdc:mga0rr50_387363_c1 3300050513 Bacteria 1179
1288 nmdc:mga08x19_7633_c1 3300050514 Bacteria 6425
1289 nmdc:mga0a205_1010611_c1 3300050515 Unclassified 679
1290 nmdc:mga0a205_450047_c1 3300050515 Bacteria 1148
1291 nmdc:mga0a205_679692_c1 3300050515 Bacteria 880
1292 nmdc:mga0a205_926474_c1 3300050515 Bacteria 718
1293 Ga0495601_0000002 3300053077 Bacteria 528704
1294 Ga0495612_0000010 3300053078 Bacteria 227618
1295 Ga0500610_0009419 3300053079 Bacteria 4329
1296 Ga0500610_0071228 3300053079 Bacteria 1813
1297 Ga0495655_0001360 3300053083 Bacteria 3760
1298 Ga0495595_0000020 3300053084 Bacteria 115983
1299 Ga0495595_0062939 3300053084 Bacteria 1741
1300 Ga0495619_0000110 3300053085 Bacteria 61419
1301 Ga0500578_0040662 3300053086 Bacteria 2988
1302 Ga0500651_0013688 3300053093 Bacteria 4950
1303 Ga0500651_0522050 3300053093 Bacteria 652
1304 Ga0500566_0002361 3300053094 Bacteria 11170
1305 Ga0500566_0179531 3300053094 Bacteria 1087
1306 Ga0500650_0164049 3300053098 Bacteria 1024
1307 Ga0500594_0004368 3300053118 Bacteria 3115
1308 Ga0500559_0101334 3300053136 Bacteria 1327
1309 Ga0500559_0313279 3300053136 Bacteria 736
1310 Ga0500568_0081361 3300053139 Bacteria 1229
1311 Ga0500577_0085938 3300053142 Bacteria 1263
1312 Ga0500588_0278953 3300053146 Bacteria 631
1313 Ga0500604_0070952 3300053151 Bacteria 1111
1314 Ga0500604_0178675 3300053151 Bacteria 727
1315 Ga0500616_0002794 3300053153 Bacteria 14058
1316 Ga0500616_0037526 3300053153 Bacteria 2622
1317 Ga0500627_0064691 3300053158 Bacteria 1613
1318 Ga0500627_0170563 3300053158 Bacteria 980
1319 Ga0500611_036731 3300053727 Bacteria 1051
1320 Ga0500599_015621 3300053736 Bacteria 1044
1321 Ga0501084_0008839 3300054114 Bacteria 8337
1322 Ga0501084_0290798 3300054114 Bacteria 1380
1323 Ga0501084_0547373 3300054114 Bacteria 978
1324 Ga0501084_0784437 3300054114 Bacteria 803
1325 Ga0501084_0939321 3300054114 Bacteria 727
1326 Ga0501084_1187529 3300054114 Bacteria 640
1327 Ga0587084_030607 3300059477 Bacteria 864
1328 Ga0501082_0000049 3300060353 Bacteria 84011
1329 Ga0501082_0002023 3300060353 Bacteria 17825
1330 Ga0501082_0057783 3300060353 Unclassified 3342
1331 Ga0501082_0265781 3300060353 Bacteria 1493
1332 Ga0501082_0386585 3300060353 Bacteria 1221
1333 Ga0501082_0756606 3300060353 Bacteria 850
1334 Ga0501082_1151389 3300060353 Bacteria 678
1335 Ga0466962_0386676 3300061719 Bacteria 699
1336 Ga0530510_0000068 3300061734 Bacteria 51899
1337 Ga0530510_0007312 3300061734 Bacteria 7685
1338 Ga0530510_0033779 3300061734 Bacteria 3683
1339 Ga0530510_0079841 3300061734 Bacteria 2380
1340 Ga0530510_0558331 3300061734 Bacteria 870
1341 Ga0530510_0834026 3300061734 Unclassified 704
1342 2513701298 2513237102 Bacteria 7703324
1343 2535518126 2534681796 Bacteria 7146037
1344 2552107569 2551306166 Bacteria 9731570
1345 2739288533 2738543020 Bacteria 5718238
1346 2739293845 2738543021 Bacteria 5718241
1347 2808903834 2808606373 Bacteria 4423627
1348 2885193908 2885192300 Bacteria 5882526
1349 2902585178 2902582711 Bacteria 6187705
1350 2906637957 2906635258 Bacteria 8601019
1351 2915360280 2915358134 Bacteria 6050864
1352 2939585690 2939582691 Bacteria 7088898
1353 3003932077 3003930520 Bacteria 5667563
1354 8005549010 8005542996 Bacteria 7077758
1355 Ga0395898_0210033
1356 CNAas_1004002
1357 JGI24735J21928_10092228
1358 JGI25156J39149_1007267
1359 JGI25157J39369_1003833
1360 JGI25406J46586_10000010
1361 JGI25406J46586_10008789
1362 Ga0055540_1017344
1363 Ga0055540_1020312
1364 Ga0058859_11603680
1365 Ga0058863_11854324
1366 Ga0058861_11844294
1367 Ga0058860_11738728
1368 Ga0058860_11924803
1369 Ga0058860_12076197
1370 Ga0058862_12208179
1371 Ga0065704_10090112
1372 Ga0065704_10100036
1373 Ga0065712_10207421
1374 Ga0065715_10209158
1375 Ga0065715_10216462
1376 Ga0065707_10085147
1377 Ga0065707_10922474
1378 Ga0070658_10040185
1379 Ga0070658_10151983
1380 Ga0070658_10246230
1381 Ga0070676_10817220
1382 Ga0070683_100014912
1383 Ga0070683_100086029
1384 Ga0070683_100827423
1385 Ga0070683_101483235
1386 Ga0070690_100093419
1387 Ga0070690_100162746
1388 Ga0070690_100182772
1389 Ga0070670_100010861
1390 Ga0070670_100452415
1391 Ga0070677_10001124
1392 Ga0068869_100261886
1393 Ga0070666_10498570
1394 Ga0070680_100011730
1395 Ga0070680_100014807
1396 Ga0070682_100025094
1397 Ga0070682_100067299
1398 Ga0068868_100000525
1399 Ga0068868_100302307
1400 Ga0070660_100295294
1401 Ga0070660_100614145
1402 Ga0070689_100000226
1403 Ga0070689_100157580
1404 Ga0070689_100449850
1405 Ga0070689_101152478
1406 Ga0070687_100116565
1407 Ga0070661_100119021
1408 Ga0070661_100327116
1409 Ga0070668_100009781
1410 Ga0070668_100024777
1411 Ga0070668_100954375
1412 Ga0070669_100015421
1413 Ga0070669_100424422
1414 Ga0070669_100851872
1415 Ga0070675_100007932
1416 Ga0070671_100018395
1417 Ga0070671_100049277
1418 Ga0070671_100059317
1419 Ga0070671_100093279
1420 Ga0070671_100344446
1421 Ga0070671_100470122
1422 Ga0070674_100029504
1423 Ga0070674_100338863
1424 Ga0070688_100000038
1425 Ga0070688_100530030
1426 Ga0070659_100023497
1427 Ga0070667_100251471
1428 Ga0070709_10757814
1429 Ga0070714_100362752
1430 Ga0070714_100801801
1431 Ga0070713_100012168
1432 Ga0070713_100047332
1433 Ga0070713_100069706
1434 Ga0070713_100782707
1435 Ga0070710_10000737
1436 Ga0070710_10481687
1437 Ga0070710_10640751
1438 Ga0070701_10628074
1439 Ga0070711_100001753
1440 Ga0070711_100327369
1441 Ga0070705_100172809
1442 Ga0070705_100235543
1443 Ga0070700_100654939
1444 Ga0070694_100001269
1445 Ga0070694_100004587
1446 Ga0070694_100039353
1447 Ga0070694_100282396
1448 Ga0070694_100451075
1449 Ga0070708_100000237
1450 Ga0070708_100015706
1451 Ga0070663_100370469
1452 Ga0070663_100447624
1453 Ga0070663_100786182
1454 Ga0070678_100021178
1455 Ga0070678_100047483
1456 Ga0070678_100327429
1457 Ga0070678_100502799
1458 Ga0070678_100796864
1459 Ga0070662_100056400
1460 Ga0070662_100159473
1461 Ga0070662_100270926
1462 Ga0070681_10004421
1463 Ga0070681_10090798
1464 Ga0070681_10093332
1465 Ga0070681_10102841
1466 Ga0068867_100823348
1467 Ga0070685_10380938
1468 Ga0070707_100000239
1469 Ga0070707_100072302
1470 Ga0070707_100099741
1471 Ga0070707_100523106
1472 Ga0070707_101677378
1473 Ga0070698_100002637
1474 Ga0070698_100048344
1475 Ga0070698_100089292
1476 Ga0070698_100301896
1477 Ga0070698_100576845
1478 Ga0070699_100011849
1479 Ga0070699_100050964
1480 Ga0070699_100077704
1481 Ga0070699_100147008
1482 Ga0070699_100682690
1483 Ga0070679_100002006
1484 Ga0070679_100010620
1485 Ga0070679_100016572
1486 Ga0070679_100482497
1487 Ga0070679_100807759
1488 Ga0070679_100957189
1489 Ga0070684_100038327
1490 Ga0070684_100044887
1491 Ga0070684_100269382
1492 Ga0070697_100069815
1493 Ga0070697_100074798
1494 Ga0068853_100000427
1495 Ga0068853_101039661
1496 Ga0068853_101573678
1497 Ga0070672_100001493
1498 Ga0070672_100699250
1499 Ga0070672_100785065
1500 Ga0070672_101136034
1501 Ga0070686_100062583
1502 Ga0070686_100106638
1503 Ga0070686_100499915
1504 Ga0070695_100355807
1505 Ga0070695_100371126
1506 Ga0070696_100024052
1507 Ga0070696_100070370
1508 Ga0070696_100110970
1509 Ga0070696_100270891
1510 Ga0070693_100011117
1511 Ga0070693_100116709
1512 Ga0070665_100006034
1513 Ga0070665_100018589
1514 Ga0070665_100150114
1515 Ga0070665_100257240
1516 Ga0070665_100414013
1517 Ga0070665_100441161
1518 Ga0070665_101209221
1519 Ga0070665_101589587
1520 Ga0070704_100752094
1521 Ga0070704_101221077
1522 Ga0068855_100060062
1523 Ga0068855_100077079
1524 Ga0070664_100050270
1525 Ga0070664_100066190
1526 Ga0070664_100146805
1527 Ga0070664_100244648
1528 Ga0070664_100309431
1529 Ga0068857_100003463
1530 Ga0068857_100068756
1531 Ga0068857_100104257
1532 Ga0068857_100522091
1533 Ga0068857_101252312
1534 Ga0068857_101295965
1535 Ga0068854_100712463
1536 Ga0068854_100800870
1537 Ga0068854_101226603
1538 Ga0068856_100018429
1539 Ga0068856_100107804
1540 Ga0068856_100472507
1541 Ga0070702_100494869
1542 Ga0068859_100005606
1543 Ga0068859_100071916
1544 Ga0068859_100239070
1545 Ga0068864_100002788
1546 Ga0068864_100064984
1547 Ga0068864_100160645
1548 Ga0068864_100174375
1549 Ga0068864_100433300
1550 Ga0068864_100741806
1551 Ga0068864_101293238
1552 Ga0068866_10650128
1553 Ga0068861_100346996
1554 Ga0068861_100778050
1555 Ga0068851_10351263
1556 Ga0068863_100041601
1557 Ga0068863_100043177
1558 Ga0068863_100043287
1559 Ga0068863_100131930
1560 Ga0068863_100479384
1561 Ga0068863_100668702
1562 Ga0068858_100383239
1563 Ga0068858_100625171
1564 Ga0068858_100822420
1565 Ga0068858_101211710
1566 Ga0068860_100036750
1567 Ga0068860_100761740
1568 Ga0068860_101413238
1569 Ga0068860_101570719
1570 Ga0068862_100014830
1571 Ga0068862_100202569
1572 Ga0068862_100245488
1573 Ga0068862_100523773
1574 Ga0081455_10328273
1575 Ga0081538_10008601
1576 Ga0081540_1088867
1577 Ga0081539_10000003
1578 Ga0081539_10000346
1579 Ga0081539_10012442
1580 Ga0081539_10193063
1581 Ga0070717_10154099
1582 Ga0070717_10327410
1583 Ga0070717_10762421
1584 Ga0075365_10016131
1585 Ga0075365_10102255
1586 Ga0075368_10004650
1587 Ga0075368_10041948
1588 Ga0075368_10071246
1589 Ga0075368_10076377
1590 Ga0075363_100053470
1591 Ga0075363_100091523
1592 Ga0075363_100139908
1593 Ga0075364_10003451
1594 Ga0075364_10019486
1595 Ga0075364_10064789
1596 Ga0075432_10161220
1597 Ga0070715_10632920
1598 Ga0070716_100011786
1599 Ga0070716_100040477
1600 Ga0070712_100032208
1601 Ga0070712_101071439
1602 Ga0075362_10225478
1603 Ga0075367_10019688
1604 Ga0075367_10020460
1605 Ga0075367_10057257
1606 Ga0075367_10070419
1607 Ga0075367_10189341
1608 Ga0075367_10266956
1609 Ga0075367_10475074
1610 Ga0075369_10091204
1611 Ga0075366_10009393
1612 Ga0075366_10052816
1613 Ga0075366_10061096
1614 Ga0075366_10338233
1615 Ga0097621_100113883
1616 Ga0097621_100350295
1617 Ga0075370_10002181
1618 Ga0075370_10012926
1619 Ga0075370_10013329
1620 Ga0075370_10163258
1621 Ga0075370_10605547
1622 Ga0068871_100222846
1623 Ga0068871_100252542
1624 Ga0068871_100427329
1625 Ga0068871_100433588
1626 Ga0068871_100843462
1627 Ga0068871_100863105
1628 Ga0075428_100017272
1629 Ga0075428_100502573
1630 Ga0075428_101493254
1631 Ga0075430_100028642
1632 Ga0075430_100156406
1633 Ga0075430_100690990
1634 Ga0075431_100043836
1635 Ga0075431_100271134
1636 Ga0075431_100379509
1637 Ga0075433_10058338
1638 Ga0075433_10191017
1639 Ga0075433_11119736
1640 Ga0075434_100015294
1641 Ga0075434_100049816
1642 Ga0075434_100454676
1643 Ga0075434_100661105
1644 Ga0075434_100706109
1645 Ga0075429_100237703
1646 Ga0068865_100001272
1647 Ga0068865_100452620
1648 Ga0068865_100787492
1649 Ga0075436_100188202
1650 Ga0097620_100005606
1651 Ga0097620_100071915
1652 Ga0097620_100239042
1653 Ga0075435_100014528
1654 Ga0075435_100552806
1655 Ga0099794_10353221
1656 Ga0105240_10103772
1657 Ga0105240_10990527
1658 Ga0111539_10003504
1659 Ga0111539_10022534
1660 Ga0111539_10042358
1661 Ga0111539_10049952
1662 Ga0111539_10257027
1663 Ga0105245_10493826
1664 Ga0105245_10807139
1665 Ga0105247_10227955
1666 Ga0105247_10344493
1667 Ga0105247_10680063
1668 Ga0114129_10119779
1669 Ga0114129_10436978
1670 Ga0114129_11108676
1671 Ga0105243_10526630
1672 Ga0105243_10808955
1673 Ga0105243_10990212
1674 Ga0105243_11401465
1675 Ga0105241_10040133
1676 Ga0105241_10073261
1677 Ga0105241_10194450
1678 Ga0105241_10966345
1679 Ga0105241_10999164
1680 Ga0105241_11228106
1681 Ga0105242_10169898
1682 Ga0105242_10727088
1683 Ga0105242_11268987
1684 Ga0105242_11325761
1685 Ga0105242_11934108
1686 Ga0105248_10001957
1687 Ga0105248_10022278
1688 Ga0105248_10059986
1689 Ga0105248_10112372
1690 Ga0105248_10119519
1691 Ga0105248_10119532
1692 Ga0105248_10218137
1693 Ga0105248_10376167
1694 Ga0105248_10512838
1695 Ga0105248_11035499
1696 Ga0105248_11368471
1697 Ga0105237_10083727
1698 Ga0105237_10109525
1699 Ga0105237_10432546
1700 Ga0105237_11023447
1701 Ga0105237_11173966
1702 Ga0105237_11227813
1703 Ga0105238_10111151
1704 Ga0105238_10116908
1705 Ga0105238_10393550
1706 Ga0105249_10045948
1707 Ga0105249_10220242
1708 Ga0105249_10313282
1709 Ga0105239_10018055
1710 Ga0105239_10029804
1711 Ga0105239_10313205
1712 Ga0105239_10424038
1713 Ga0105239_11023041
1714 Ga0105246_10268324
1715 Ga0105246_10836704
1716 Ga0157373_10283330
1717 Ga0157370_10314544
1718 Ga0157370_10728599
1719 Ga0157369_10072655
1720 Ga0157369_10523991
1721 Ga0157369_10901694
1722 Ga0157369_10970687
1723 Ga0157374_10031830
1724 Ga0157374_10060993
1725 Ga0157374_10100534
1726 Ga0157374_10212883
1727 Ga0157374_10861698
1728 Ga0157378_10326093
1729 Ga0157378_10447392
1730 Ga0157378_12257621
1731 Ga0163162_10033581
1732 Ga0163162_10238432
1733 Ga0163162_10309085
1734 Ga0163162_10542850
1735 Ga0163162_10804837
1736 Ga0163162_10918316
1737 Ga0163162_10937522
1738 Ga0163162_11439754
1739 Ga0163162_11563681
1740 Ga0157372_10019830
1741 Ga0157372_10060434
1742 Ga0157372_10090692
1743 Ga0157372_10194122
1744 Ga0157372_10292483
1745 Ga0157372_11037586
1746 Ga0157372_11515434
1747 Ga0157375_10079664
1748 Ga0157375_10263607
1749 Ga0157375_11207821
1750 Ga0157375_11657834
1751 Ga0163163_10074915
1752 Ga0163163_10090395
1753 Ga0163163_10096115
1754 Ga0163163_10290728
1755 Ga0163163_10752752
1756 Ga0163163_10795224
1757 Ga0163163_10863915
1758 Ga0157380_10019554
1759 Ga0157380_10099011
1760 Ga0157380_10414949
1761 Ga0157380_10545998
1762 Ga0157380_10742204
1763 Ga0157380_11238853
1764 Ga0157380_11332854
1765 Ga0157377_10131636
1766 Ga0157377_10246367
1767 Ga0157379_10027114
1768 Ga0157379_10947718
1769 Ga0157379_11238136
1770 Ga0157376_10835963
1771 Ga0157376_10870292
1772 Ga0163161_10576125
1773 Ga0163161_10758443
1774 Ga0163161_10967278
1775 Ga0197907_10250064
1776 Ga0206356_10835401
1777 Ga0206352_11263230
1778 Ga0206350_10254172
1779 Ga0154015_1216348
1780 Ga0213876_10069700
1781 Ga0213875_10004794
1782 Ga0209646_1005277
1783 Ga0209026_1001118
1784 Ga0209759_1001219
1785 Ga0209050_1065246
1786 Ga0209051_1000772
1787 Ga0209051_1023639
1788 Ga0209051_1024759
1789 Ga0207697_10226645
1790 Ga0207656_10099209
1791 Ga0207682_10000542
1792 Ga0207692_10000651
1793 Ga0207692_10140432
1794 Ga0207692_10456028
1795 Ga0207692_10599884
1796 Ga0207692_10804841
1797 Ga0207710_10074763
1798 Ga0207688_10038134
1799 Ga0207680_10123163
1800 Ga0207680_10462627
1801 Ga0207647_10020107
1802 Ga0207647_10620308
1803 Ga0207647_10623765
1804 Ga0207699_10000194
1805 Ga0207645_10112689
1806 Ga0207705_10053688
1807 Ga0207705_10055357
1808 Ga0207654_10048227
1809 Ga0207654_10114069
1810 Ga0207654_10159068
1811 Ga0207654_10599717
1812 Ga0207654_11145552
1813 Ga0207707_10063588
1814 Ga0207707_10140082
1815 Ga0207707_10247833
1816 Ga0207695_10936018
1817 Ga0207671_10193280
1818 Ga0207671_10687608
1819 Ga0207671_10771588
1820 Ga0207693_10043037
1821 Ga0207693_10320999
1822 Ga0207663_10003668
1823 Ga0207663_10421442
1824 Ga0207663_10726502
1825 Ga0207663_10905286
1826 Ga0207660_10024051
1827 Ga0207660_10026227
1828 Ga0207660_10389556
1829 Ga0207660_10418892
1830 Ga0207662_10119875
1831 Ga0207657_10000952
1832 Ga0207657_10505653
1833 Ga0207657_10508960
1834 Ga0207649_10316650
1835 Ga0207649_11248938
1836 Ga0207652_10002763
1837 Ga0207652_10099865
1838 Ga0207652_10416559
1839 Ga0207646_10011382
1840 Ga0207646_10117032
1841 Ga0207681_10206063
1842 Ga0207681_10226090
1843 Ga0207681_10974220
1844 Ga0207694_10001305
1845 Ga0207694_10272448
1846 Ga0207694_10332518
1847 Ga0207650_10036850
1848 Ga0207650_10779971
1849 Ga0207650_10782575
1850 Ga0207650_10934191
1851 Ga0207659_10070253
1852 Ga0207659_10074883
1853 Ga0207659_11268183
1854 Ga0207687_10516820
1855 Ga0207687_11090538
1856 Ga0207700_10074521
1857 Ga0207700_10089288
1858 Ga0207700_10249808
1859 Ga0207700_11142953
1860 Ga0207664_10778060
1861 Ga0207664_10791670
1862 Ga0207644_10033525
1863 Ga0207644_10067322
1864 Ga0207644_10160307
1865 Ga0207644_10832476
1866 Ga0207690_10057850
1867 Ga0207690_10232272
1868 Ga0207706_10000849
1869 Ga0207706_10015018
1870 Ga0207706_10187810
1871 Ga0207706_10194881
1872 Ga0207706_10633837
1873 Ga0207706_10934419
1874 Ga0207686_10962600
1875 Ga0207709_10317752
1876 Ga0207709_10462752
1877 Ga0207670_10000448
1878 Ga0207669_10019579
1879 Ga0207704_10000435
1880 Ga0207704_10340450
1881 Ga0207704_10872519
1882 Ga0207704_11320302
1883 Ga0207665_10021480
1884 Ga0207665_10054108
1885 Ga0207665_10240803
1886 Ga0207665_10493483
1887 Ga0207691_10004521
1888 Ga0207691_10230530
1889 Ga0207691_10720325
1890 Ga0207711_10001596
1891 Ga0207711_10030078
1892 Ga0207711_10156249
1893 Ga0207711_10239513
1894 Ga0207711_10245493
1895 Ga0207711_10329176
1896 Ga0207711_10399407
1897 Ga0207711_10754049
1898 Ga0207689_10268342
1899 Ga0207661_10186781
1900 Ga0207661_10705911
1901 Ga0207661_11073606
1902 Ga0207661_11252047
1903 Ga0207661_11282534
1904 Ga0207679_10032054
1905 Ga0207679_10275799
1906 Ga0207679_10392247
1907 Ga0207679_10685209
1908 Ga0207667_10227574
1909 Ga0207667_10416537
1910 Ga0207667_10670620
1911 Ga0207667_10844423
1912 Ga0207712_10217066
1913 Ga0207712_10279948
1914 Ga0207712_10511435
1915 Ga0207712_11142392
1916 Ga0207668_10002784
1917 Ga0207668_10033380
1918 Ga0207668_10428850
1919 Ga0207668_10642862
1920 Ga0207668_10690681
1921 Ga0207668_10802545
1922 Ga0207640_10241540
1923 Ga0207640_10612802
1924 Ga0207640_10897843
1925 Ga0207677_10000069
1926 Ga0207677_10642603
1927 Ga0207703_10270090
1928 Ga0207703_10558340
1929 Ga0207703_10853474
1930 Ga0207639_10000936
1931 Ga0207639_10044506
1932 Ga0207639_10253489
1933 Ga0207639_10418932
1934 Ga0207639_10595617
1935 Ga0207639_10620402
1936 Ga0207639_10930015
1937 Ga0207678_10034267
1938 Ga0207678_10145742
1939 Ga0207678_10347643
1940 Ga0207678_10530678
1941 Ga0207708_10182093
1942 Ga0207708_10782379
1943 Ga0207702_10097679
1944 Ga0207702_10136729
1945 Ga0207702_10363357
1946 Ga0207702_10990215
1947 Ga0207641_10046055
1948 Ga0207641_10098214
1949 Ga0207641_10166814
1950 Ga0207641_10420196
1951 Ga0207641_10949849
1952 Ga0207641_11359649
1953 Ga0207641_11616182
1954 Ga0207641_12019031
1955 Ga0207648_10853437
1956 Ga0207648_11682561
1957 Ga0207676_10002300
1958 Ga0207676_10010779
1959 Ga0207676_10066825
1960 Ga0207676_10168228
1961 Ga0207676_10637500
1962 Ga0207674_10006167
1963 Ga0207674_10011453
1964 Ga0207674_10253498
1965 Ga0207674_10518147
1966 Ga0207674_10705282
1967 Ga0207675_100259286
1968 Ga0207675_100410990
1969 Ga0207675_100820356
1970 Ga0207683_10046102
1971 Ga0207683_10065177
1972 Ga0207683_10190797
1973 Ga0207683_10197404
1974 Ga0207683_10209690
1975 Ga0207683_10599503
1976 Ga0207698_10181741
1977 Ga0207698_10501225
1978 Ga0207698_10994659
1979 Ga0207698_11084122
1980 Ga0209588_1201530
1981 Ga0209813_10015168
1982 Ga0209813_10016619
1983 Ga0209813_10034278
1984 Ga0207428_10015869
1985 Ga0207428_10190787
1986 Ga0207428_10236053
1987 Ga0207428_10360977
1988 Ga0268266_10033801
1989 Ga0268266_10294203
1990 Ga0268265_10009031
1991 Ga0268265_10060507
1992 Ga0268265_10198244
1993 Ga0268265_11116452
1994 Ga0268264_10035100
1995 Ga0268264_10768508
1996 Ga0268264_10942713
1997 Ga0268264_11011008
1998 Ga0265334_10003926
1999 Ga0265318_10000016
2000 Ga0307515_10086670
2001 Ga0307515_10463390
2002 Ga0265338_10189069
2003 Ga0265338_10814281
2004 Ga0265324_10013329
2005 Ga0265767_108251
2006 Ga0265332_10030665
2007 Ga0265328_10000019
2008 Ga0265328_10007021
2009 Ga0265320_10003281
2010 Ga0265339_10382783
2011 Ga0265331_10025888
2012 Ga0265316_10110709
2013 Ga0265316_10939340
2014 Ga0307513_10084886
2015 Ga0307513_10127195
2016 Ga0307408_100008603
2017 Ga0307408_100042714
2018 Ga0307408_100106374
2019 Ga0307408_100111336
2020 Ga0307408_100144442
2021 Ga0307408_100336488
2022 Ga0265313_10002768
2023 Ga0307508_10096487
2024 Ga0307508_10323461
2025 Ga0316579_10013022
2026 Ga0265314_10000596
2027 Ga0316576_10348290
2028 Ga0316578_10052128
2029 Ga0316578_10124084
2030 Ga0307516_10002446
2031 Ga0307516_10008341
2032 Ga0307516_10009998
2033 Ga0307516_10420643
2034 Ga0307405_10003502
2035 Ga0307405_10084737
2036 Ga0307405_10098809
2037 Ga0307405_10280897
2038 Ga0307413_10002867
2039 Ga0307413_10027727
2040 Ga0307413_10091708
2041 Ga0307413_10388108
2042 Ga0307410_10006693
2043 Ga0307410_10007880
2044 Ga0307410_10065252
2045 Ga0307410_10107092
2046 Ga0307410_10122219
2047 Ga0307410_10243065
2048 Ga0307410_10701516
2049 Ga0307406_10003830
2050 Ga0307407_10001158
2051 Ga0307407_10034240
2052 Ga0307407_10397934
2053 Ga0307412_10150729
2054 Ga0307412_10345644
2055 Ga0307412_10395974
2056 Ga0307412_10471288
2057 Ga0307409_100003996
2058 Ga0307409_100013589
2059 Ga0307409_100047015
2060 Ga0307409_100241018
2061 Ga0307409_100426045
2062 Ga0307409_100542967
2063 Ga0307416_100006864
2064 Ga0307416_100015598
2065 Ga0307416_100062445
2066 Ga0307416_100258211
2067 Ga0307416_100575719
2068 Ga0307416_101390618
2069 Ga0307416_101558741
2070 Ga0307414_10018888
2071 Ga0307414_10035853
2072 Ga0307414_10076263
2073 Ga0307411_10002709
2074 Ga0307411_10018142
2075 Ga0307411_10030603
2076 Ga0307411_10034726
2077 Ga0307411_10237776
2078 Ga0307411_10255728
2079 Ga0307411_11459179
2080 Ga0307415_100055513
2081 Ga0307415_100067894
2082 Ga0307415_100118379
2083 Ga0307415_100121128
2084 Ga0307415_100267440
2085 Ga0307415_100489996
2086 Ga0373948_0108667
2087 Ga0373923_0092188
2088 Ga0373936_0000302
2089 Ga0373939_0101425
2090 Ga0373945_0004590
2091 Ga0373945_0141998
2092 Ga0373953_0001387
2093 Ga0373954_0001462
2094 Ga0373956_0104761
2095 Ga0373956_0133312
2096 Ga0373956_0457155
2097 Ga0373957_0001060
2098 Ga0373943_0096528
2099 Ga0373946_0001689
2100 Ga0373946_0386887
2101 Ga0373955_0000030
2102 Ga0373955_0136641
2103 Ga0373962_0168592
2104 Ga0316574_0130501
2105 Ga0373931_0007107
2106 Ga0373931_0315580
2107 Ga0373935_0000187
2108 Ga0373935_0057356
2109 Ga0373935_0261567
2110 Ga0373927_0057722
2111 Ga0373927_0069442
2112 Ga0373927_0253441
2113 Ga0373933_0002169
2114 Ga0373933_0301542
2115 Ga0373947_0000376
2116 Ga0373947_0105686
2117 Ga0373947_0355314
2118 Ga0373937_0000004
2119 Ga0373937_0155255
2120 Ga0373937_0413261
2121 Ga0373937_0490766
2122 Ga0316582_0038470
2123 Ga0316582_0256180
2124 Ga0316584_0285895
2125 Ga0373925_0000095
2126 Ga0373925_0040021
2127 Ga0373925_0179948
2128 Ga0373925_0364512
2129 Ga0373925_0533927
2130 Ga0395899_0299799
2131 Ga0395898_0116607
2132 Ga0395898_0837125
2133 Ga0395905_0124177
2134 Ga0395905_0252221
2135 Ga0316581_0002183
2136 Ga0316581_0014742
2137 Ga0436364_0093884
2138 Ga0395901_0000076
2139 Ga0395901_0261083
2140 Ga0395901_0602987
2141 Ga0395901_1170767
2142 Ga0400490_48312
2143 Ga0400485_19896
2144 Ga0400488_62281
2145 Ga0400483_108538
2146 Ga0436365_0727857
2147 Ga0436365_0858454
2148 Ga0436365_1236325
2149 Ga0436363_0415220
2150 Ga0439436_0001347
2151 Ga0439436_0125249
2152 Ga0439438_001161
2153 Ga0439439_0040254
2154 Ga0439447_000738
2155 Ga0439447_027904
2156 Ga0439453_0008205
2157 Ga0439466_0003579
2158 Ga0439465_0003601
2159 Ga0451807_2035927
2160 Ga0439431_0054414
2161 Ga0439431_0108336
2162 Ga0439437_001050
2163 Ga0439437_001357
2164 Ga0439442_006004
2165 Ga0439443_098706
2166 Ga0439448_0073009
2167 Ga0439432_043948
2168 Ga0439452_007612
2169 Ga0439455_0028953
2170 Ga0439455_0037931
2171 Ga0439456_045989
2172 Ga0439462_0002090
2173 Ga0450911_000004
2174 Ga0450912_001939
2175 Ga0450913_000050
2176 Ga0450913_011032
2177 Ga0450917_000165
2178 Ga0450888_001082
2179 Ga0450890_000388
2180 Ga0450890_023809
2181 Ga0450891_000011
2182 Ga0450892_000573
2183 Ga0450894_011519
2184 Ga0450894_031496
2185 Ga0450896_016470
2186 Ga0450898_024920
2187 Ga0450904_000040
2188 Ga0450889_000398
2189 Ga0450906_001797
2190 Ga0450906_021416
2191 Ga0439446_0001360
2192 Ga0439446_0020338
2193 Ga0450909_003075
2194 Ga0439434_0018991
2195 Ga0439435_0005821
2196 Ga0439435_0007076
2197 Ga0439435_0031705
2198 Ga0439444_0063457
2199 Ga0439459_0007596
2200 Ga0439459_0010685
2201 Ga0439460_0129142
2202 Ga0439460_0210068
2203 Ga0450916_000704
2204 Ga0450893_0001119
2205 Ga0450893_0008316
2206 Ga0450901_004880
2207 Ga0451577_0179793
2208 Ga0451577_0259557
2209 Ga0451577_0498538
2210 Ga0451577_1054026
2211 Ga0451577_1127112
2212 Ga0466963_0088821
2213 Ga0453684_0175604
2214 Ga0451576_0058799
2215 Ga0451576_0066178
2216 Ga0451576_1356304
2217 Ga0466958_0005307
2218 Ga0466958_0028824
2219 Ga0466967_0093324
2220 Ga0466967_1023737
2221 Ga0466967_1686557
2222 Ga0495617_101072
2223 Ga0495592_0000029
2224 Ga0495603_0394666
2225 Ga0495603_0550613
2226 Ga0495590_0028274
2227 Ga0495590_0068834
2228 Ga0495629_0000008
2229 Ga0495629_0036618
2230 Ga0495629_0084638
2231 Ga0495629_0598033
2232 Ga0495638_0000093
2233 Ga0495638_0000277
2234 Ga0495638_0001726
2235 Ga0495638_0145934
2236 Ga0495638_0322298
2237 Ga0495641_0036067
2238 Ga0495641_0152737
2239 Ga0495651_0000535
2240 Ga0495653_0000045
2241 Ga0495653_0267786
2242 Ga0495580_0000217
2243 Ga0495582_0271961
2244 Ga0495582_0362881
2245 Ga0495605_0021305
2246 Ga0495639_0005034
2247 Ga0495639_0146514
2248 Ga0495664_0000004
2249 Ga0495664_0779174
2250 Ga0495584_0000028
2251 Ga0495584_0035496
2252 Ga0495584_0151269
2253 Ga0495585_0000086
2254 Ga0495585_0015642
2255 Ga0495585_0098215
2256 Ga0495594_0403129
2257 Ga0495596_0001610
2258 Ga0495607_0002640
2259 Ga0495607_0009005
2260 Ga0495607_0134664
2261 Ga0495583_0000419
2262 Ga0495606_0001218
2263 Ga0495606_0001429
2264 Ga0495608_0000017
2265 Ga0495608_0452007
2266 Ga0495610_0150433
2267 Ga0495610_0155377
2268 Ga0495616_0002066
2269 Ga0495616_0102973
2270 Ga0495616_0142254
2271 Ga0495618_0000006
2272 Ga0495618_0089042
2273 Ga0495620_0046771
2274 Ga0495620_0214544
2275 Ga0495628_0000001
2276 Ga0495630_0006296
2277 Ga0495630_0053954
2278 Ga0495632_0000570
2279 Ga0495632_0000731
2280 Ga0495632_0029701
2281 Ga0495632_0031178
2282 Ga0495632_0079065
2283 Ga0495637_0010875
2284 Ga0495637_0180576
2285 Ga0495643_0000081
2286 Ga0495644_0158070
2287 Ga0495648_0000199
2288 Ga0495648_0056420
2289 Ga0495652_0000002
2290 Ga0495654_0017098
2291 Ga0495654_0062230
2292 Ga0495665_0139553
2293 Ga0495640_0000001
2294 Ga0495586_0004691
2295 Ga0495587_0000008
2296 Ga0495598_0165594
2297 Ga0495598_0178513
2298 Ga0495609_0014617
2299 Ga0495609_0019454
2300 Ga0495597_0008372
2301 Ga0495645_0000002
2302 Ga0495633_0002816
2303 Ga0495633_0051413
2304 Ga0495667_0000029
2305 Ga0495667_0036406
2306 Ga0495656_0039189
2307 Ga0495656_0068632
2308 Ga0495668_0032304
2309 Ga0495668_0094138
2310 Ga0495634_0031220
2311 Ga0495634_0096485
2312 Ga0495611_0009558
2313 Ga0495625_0016828
2314 Ga0495625_0076835
2315 Ga0495625_0288009
2316 Ga0495625_0367167
2317 Ga0495635_0000002
2318 Ga0495635_0063635
2319 Ga0495635_0290095
2320 Ga0495588_0156501
2321 Ga0495588_0223040
2322 Ga0495657_0000064
2323 Ga0495599_0000064
2324 Ga0495623_0000065
2325 Ga0495623_0318766
2326 Ga0495646_0000023
2327 Ga0495658_0067051
2328 Ga0495658_0351691
2329 Ga0495658_0462480
2330 Ga0495669_0000752
2331 Ga0495669_0019290
2332 Ga0495669_0128409
2333 Ga0495669_0295081
2334 Ga0495613_0025068
2335 Ga0495613_0070714
2336 Ga0495613_0073985
2337 Ga0495613_0155767
2338 Ga0495624_0017097
2339 Ga0495670_0055136
2340 Ga0495671_0000124
2341 Ga0495671_0000135
2342 Ga0495671_0000963
2343 Ga0495671_0068246
2344 Ga0495649_0000561
2345 Ga0495649_0017156
2346 Ga0495649_0027931
2347 Ga0495649_0031668
2348 Ga0495589_0064793
2349 Ga0495600_0000010
2350 Ga0495660_0288443
2351 Ga0495581_0039058
2352 Ga0495581_0186301
2353 Ga0495604_0000009
2354 Ga0495636_0000111
2355 Ga0495674_0000002
2356 Ga0495674_0024508
2357 Ga0495674_0154218
2358 Ga0495672_0111118
2359 Ga0495676_0454338
2360 Ga0495680_0001344
2361 Ga0495680_0009855
2362 Ga0495683_0000076
2363 Ga0495683_0014312
2364 Ga0495683_0061713
2365 Ga0495683_0269666
2366 Ga0495675_0000178
2367 Ga0495673_0000303
2368 Ga0495673_0162509
2369 Ga0495681_0030908
2370 Ga0495684_0000006
2371 Ga0495684_0162200
2372 Ga0495686_0099455
2373 Ga0495593_0002369
2374 Ga0495593_0389454
2375 Ga0495593_0443219
2376 Ga0495602_0000005
2377 Ga0495602_0155380
2378 Ga0495615_0000004
2379 Ga0495626_0000444
2380 Ga0495626_0009839
2381 Ga0496100_0056972
2382 Ga0496100_0101820
2383 Ga0496100_0105464
2384 Ga0496101_0011508
2385 Ga0496101_0217225
2386 Ga0496101_0313485
2387 Ga0496101_0746871
2388 Ga0496102_0361388
2389 Ga0496103_0224677
2390 Ga0496103_0335606
2391 Ga0496104_0018658
2392 Ga0496104_0032785
2393 Ga0496104_0040433
2394 Ga0496104_1017378
2395 Ga0496105_0038328
2396 Ga0496105_0087705
2397 Ga0496105_0208525
2398 Ga0496105_0638658
2399 Ga0496105_0757756
2400 Ga0496105_0819841
2401 Ga0496106_0099763
2402 Ga0496106_0157711
2403 Ga0496106_0181293
2404 Ga0496106_0339336
2405 Ga0496106_0916712
2406 Ga0496106_1104953
2407 Ga0496107_0023422
2408 Ga0496107_0060646
2409 Ga0496107_0077406
2410 Ga0496107_0577757
2411 Ga0496107_0617898
2412 Ga0496108_0015389
2413 Ga0496108_0061105
2414 Ga0496108_0165929
2415 Ga0496108_0408006
2416 Ga0496109_0024989
2417 Ga0496109_0025994
2418 Ga0496109_0260557
2419 Ga0496109_0282430
2420 Ga0496109_0508877
2421 Ga0496110_0014036
2422 Ga0496110_0124434
2423 Ga0496110_0245051
2424 Ga0496110_0810344
2425 Ga0496110_1079391
2426 Ga0496111_0016470
2427 Ga0496111_0320544
2428 Ga0496111_0423799
2429 Ga0496112_0009723
2430 Ga0496112_0105727
2431 Ga0496112_0114033
2432 Ga0496112_0168535
2433 Ga0496112_0279217
2434 Ga0496112_0457632
2435 Ga0496112_0625390
2436 Ga0496112_1437087
2437 Ga0496113_0004304
2438 Ga0496113_0016246
2439 Ga0496113_0039668
2440 Ga0496113_0078110
2441 Ga0496113_0154979
2442 Ga0496113_0302076
2443 Ga0496114_0199679
2444 Ga0496114_0418979
2445 Ga0496114_0670973
2446 Ga0496114_0904148
2447 Ga0496115_0354246
2448 Ga0496115_0557336
2449 Ga0496118_0362095
2450 Ga0496122_0000929
2451 Ga0496123_0000798
2452 Ga0496124_0004446
2453 Ga0496125_0032291
2454 Ga0496125_0036215
2455 Ga0496126_0485011
2456 Ga0495678_004092
2457 Ga0495678_007647
2458 Ga0495682_0084249
2459 Ga0495682_0091400
2460 Ga0495682_0228697
2461 Ga0501291_008616
2462 Ga0501291_028190
2463 Ga0501292_006605
2464 Ga0501293_008645
2465 Ga0501294_002875
2466 Ga0501296_003944
2467 Ga0501298_007937
2468 Ga0501299_006449
2469 Ga0501299_008861
2470 Ga0501299_066669
2471 Ga0501300_015381
2472 Ga0501031_0000443
2473 Ga0501031_0009136
2474 Ga0501031_0011507
2475 Ga0501031_0459064
2476 Ga0501032_0010096
2477 Ga0501032_0082900
2478 Ga0501032_0115286
2479 Ga0501033_0221325
2480 Ga0501034_0006511
2481 Ga0501034_0007288
2482 Ga0501036_0000230
2483 Ga0501036_0164742
2484 Ga0501036_0308011
2485 Ga0501036_1000038
2486 Ga0501037_0004342
2487 Ga0501037_0027855
2488 Ga0501037_0082094
2489 Ga0501037_0326387
2490 Ga0501038_0010658
2491 Ga0501038_0156847
2492 Ga0501038_0511115
2493 Ga0501038_0760795
2494 Ga0501039_0000557
2495 Ga0501039_0001390
2496 Ga0501039_0358018
2497 Ga0501040_0000331
2498 Ga0501040_0062828
2499 Ga0501040_0093710
2500 Ga0501040_0101404
2501 Ga0501040_0193210
2502 Ga0501041_0000256
2503 Ga0501041_0006710
2504 Ga0501041_0016032
2505 Ga0501041_0125086
2506 Ga0501041_0128813
2507 Ga0501041_0527579
2508 Ga0501042_0004679
2509 Ga0501042_0010292
2510 Ga0501042_0089132
2511 Ga0501042_0301164
2512 Ga0501046_0000618
2513 Ga0501046_0014890
2514 Ga0501046_0277103
2515 Ga0501047_0128166
2516 Ga0501048_0000179
2517 Ga0501048_0183356
2518 Ga0501048_0387647
2519 Ga0501068_0021192
2520 Ga0501068_0021809
2521 Ga0501068_0134569
2522 Ga0501070_0188471
2523 Ga0501071_0000665
2524 Ga0501071_0030549
2525 Ga0501071_0190926
2526 Ga0501071_0554094
2527 Ga0501072_0001546
2528 Ga0501072_0107365
2529 Ga0501072_0459501
2530 Ga0501072_0682377
2531 Ga0501073_0272587
2532 Ga0501074_0001783
2533 Ga0501074_0207875
2534 Ga0501075_0000833
2535 Ga0501075_0003400
2536 Ga0501076_0000188
2537 Ga0501076_0438950
2538 Ga0501076_0785922
2539 Ga0501076_1001817
2540 Ga0501077_0004501
2541 Ga0501077_0006741
2542 Ga0501199_004511
2543 Ga0501199_004863
2544 Ga0501201_001179
2545 Ga0501202_036395
2546 Ga0501207_007049
2547 Ga0501208_004835
2548 Ga0501211_010183
2549 Ga0501217_017932
2550 Ga0501217_049691
2551 Ga0501222_001860
2552 Ga0501223_021102
2553 Ga0501227_025559
2554 Ga0501233_018791
2555 Ga0501233_020186
2556 Ga0501235_021193
2557 Ga0501243_039351
2558 Ga0501247_016410
2559 Ga0501249_052262
2560 Ga0501250_009639
2561 Ga0501257_149176
2562 Ga0501259_090689
2563 Ga0501221_004693
2564 Ga0501225_0021888
2565 Ga0501079_0000792
2566 Ga0501079_0275315
2567 Ga0501080_0005633
2568 Ga0501080_0033872
2569 Ga0501080_0224108
2570 Ga0501080_0364869
2571 Ga0501080_0368765
2572 Ga0501080_0777405
2573 Ga0501081_0023524
2574 Ga0501081_0218502
2575 Ga0501081_0371320
2576 Ga0501081_0633557
2577 Ga0501083_0010454
2578 Ga0501232_000316
2579 Ga0501262_006551
2580 Ga0501267_000505
2581 Ga0501271_021899
2582 Ga0501272_001325
2583 Ga0501273_008544
2584 Ga0501274_024193
2585 Ga0501280_023887
2586 Ga0501282_004766
2587 Ga0501283_012568
2588 Ga0501035_0049175
2589 Ga0501035_0052578
2590 Ga0501035_0355395
2591 Ga0501044_0103822
2592 Ga0501044_0256057
2593 Ga0501045_0002959
2594 Ga0501045_0088674
2595 Ga0501045_0305123
2596 Ga0501045_0417022
2597 Ga0501226_000003
2598 nmdc:mga03683_239099_c1
2599 nmdc:mga03683_369582_c1
2600 nmdc:mga03n38_99342_c1
2601 nmdc:mga00v17_21823_c1
2602 nmdc:mga00v17_50934_c1
2603 nmdc:mga00v17_91649_c1
2604 nmdc:mga0yw44_328519_c1
2605 nmdc:mga0yw44_37334_c1
2606 nmdc:mga0k408_106382_c1
2607 nmdc:mga0k408_11684_c1
2608 nmdc:mga0k408_12312_c1
2609 nmdc:mga0k408_97938_c1
2610 nmdc:mga06z11_157568_c1
2611 nmdc:mga06z11_2682_c1
2612 nmdc:mga06z11_307930_c1
2613 nmdc:mga06z11_37103_c1
2614 nmdc:mga06z11_3804_c1
2615 nmdc:mga06z11_7267_c1
2616 nmdc:mga04h51_14549_c1
2617 nmdc:mga04h51_28972_c1
2618 nmdc:mga07m45_104889_c1
2619 nmdc:mga07m45_1316_c1
2620 nmdc:mga07m45_66103_c1
2621 nmdc:mga05p37_953940_c1
2622 nmdc:mga05p37_989043_c1
2623 nmdc:mga09592_102960_c1
2624 nmdc:mga09592_1190625_c1
2625 nmdc:mga0qj67_29970_c1
2626 nmdc:mga0qj67_43561_c1
2627 nmdc:mga06r32_148837_c1
2628 nmdc:mga06r32_1527683_c1
2629 nmdc:mga06r32_155969_c1
2630 nmdc:mga06r32_500393_c1
2631 nmdc:mga06r32_56095_c1
2632 nmdc:mga08y16_16096_c1
2633 nmdc:mga08y16_27352_c1
2634 nmdc:mga08y16_43807_c1
2635 nmdc:mga08y16_494051_c1
2636 nmdc:mga08y16_54145_c1
2637 nmdc:mga0n895_464217_c1
2638 nmdc:mga0n895_466202_c1
2639 nmdc:mga0n895_76931_c1
2640 nmdc:mga0rr50_152308_c1
2641 nmdc:mga0rr50_387363_c1
2642 nmdc:mga08x19_7633_c1
2643 nmdc:mga0a205_1010611_c1
2644 nmdc:mga0a205_450047_c1
2645 nmdc:mga0a205_679692_c1
2646 nmdc:mga0a205_926474_c1
2647 Ga0495601_0000002
2648 Ga0495612_0000010
2649 Ga0500610_0009419
2650 Ga0500610_0071228
2651 Ga0495655_0001360
2652 Ga0495595_0000020
2653 Ga0495595_0062939
2654 Ga0495619_0000110
2655 Ga0500578_0040662
2656 Ga0500651_0013688
2657 Ga0500651_0522050
2658 Ga0500566_0002361
2659 Ga0500566_0179531
2660 Ga0500650_0164049
2661 Ga0500594_0004368
2662 Ga0500559_0101334
2663 Ga0500559_0313279
2664 Ga0500568_0081361
2665 Ga0500577_0085938
2666 Ga0500588_0278953
2667 Ga0500604_0070952
2668 Ga0500604_0178675
2669 Ga0500616_0002794
2670 Ga0500616_0037526
2671 Ga0500627_0064691
2672 Ga0500627_0170563
2673 Ga0500611_036731
2674 Ga0500599_015621
2675 Ga0501084_0008839
2676 Ga0501084_0290798
2677 Ga0501084_0547373
2678 Ga0501084_0784437
2679 Ga0501084_0939321
2680 Ga0501084_1187529
2681 Ga0587084_030607
2682 Ga0501082_0000049
2683 Ga0501082_0002023
2684 Ga0501082_0057783
2685 Ga0501082_0265781
2686 Ga0501082_0386585
2687 Ga0501082_0756606
2688 Ga0501082_1151389
2689 Ga0466962_0386676
2690 Ga0530510_0000068
2691 Ga0530510_0007312
2692 Ga0530510_0033779
2693 Ga0530510_0079841
2694 Ga0530510_0558331
2695 Ga0530510_0834026
2696 2513701298
2697 2535518126
2698 2552107569
2699 2739288533
2700 2739293845
2701 2808903834
2702 2885193908
2703 2902585178
2704 2906637957
2705 2915360280
2706 2939585690
2707 3003932077
2708 8005549010

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

39

181

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0b-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state 0.7024 9 158
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6883 8 158
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6801 8 158
6j0n-assembly1.cif.gz_n cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6779 17 157
7adz-assembly1.cif.gz_1a cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.6757 12 158
ID Description Score Start End Superfamily
af_Q54PM7_5_120_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7949 104 123 3.30.420.40
af_P15081_4_110_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.7646 102 124 3.90.1010.10
af_Q9VF86_1_117_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7455 104 123 3.30.420.40
af_P23917_1_103_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.732 104 123 1.10.520.10
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6372 103 123 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1A9HS85-F1-model_v4 Phage tail protein 0.8346 31 159 GO:0005198
AF-A0A660LBY8-F1-model_v4 Phage tail-like protein 0.8341 20 158 GO:0005198
AF-A0A1Q8CNY0-F1-model_v4 Phage tail protein 0.8224 20 158 GO:0005198
AF-A0A533J2Z9-F1-model_v4 deleted 0.818 18 166
AF-A0A6N7YPR4-F1-model_v4 Phage tail protein 0.8123 10 159 GO:0005198

Map