F493186

General Info

Members Datasets Scaffolds Average Seq Length
1345 475 1345 132

Family's Representative Sequence

Representative Sequence 3300006194|Ga0075427_10004740|Ga0075427_100047403
Length 143
Sequence MFRVLGDNAMRPIPVGAKGSYTLRVLPAHLANQFKDAALPPVFATPMMVTAMENAALNAVRDYLDPGESAVGTEVNIQHLAATPVGHRVAAEAVVTKVEGRRIEFNVSARDETEEIGRGTHARMIVDLPRLHQRLAAKARSQS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
147 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
148 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
149 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
150 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
151 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
152 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
253 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
254 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
255 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
264 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
265 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
266 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
267 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
268 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
269 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
275 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
276 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
277 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
278 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
279 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
281 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
283 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
284 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
285 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
286 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
287 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
288 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
289 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
290 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
291 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
292 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
293 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
294 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
295 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
300 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
307 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
308 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
309 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
310 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
311 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
312 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
313 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
316 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
317 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
318 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
319 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
320 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
333 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
337 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
338 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
339 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
340 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
344 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
345 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
351 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
383 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
384 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
397 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
398 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
401 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
402 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
403 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
404 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
405 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
430 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
431 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
432 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
433 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
434 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
435 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
436 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
437 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
438 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
439 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
454 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
455 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
456 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
457 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
458 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
459 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
460 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
463 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
464 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
465 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
466 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
467 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
468 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
469 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
470 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
471 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
472 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
473 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
474 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
475 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 5.58
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1467100 2162886007 Bacteria 1254
2 2214800752 2209111006 Bacteria 11233
3 ARcpr5oldR_c000050 3300000041 Bacteria 21744
4 ARSoilYngRDRAFT_c00100 3300000042 Bacteria 14842
5 ARcpr5yngRDRAFT_c000088 3300000043 Bacteria 14865
6 ARSoilOldRDRAFT_c000014 3300000044 Bacteria 41686
7 ARCol0oldRDRAFT_c00172 3300000045 Bacteria 5882
8 ARCol0yngRDRAFT_1000033 3300000652 Bacteria 23926
9 JGI24752J21851_1003681 3300001976 Unclassified 2019
10 JGI24746J21847_1005165 3300001977 Unclassified 2042
11 JGI24746J21847_1005687 3300001977 Unclassified 1944
12 JGI24747J21853_1000157 3300001978 Bacteria 3380
13 JGI24739J22299_10001254 3300001989 Bacteria 9511
14 JGI24739J22299_10208932 3300001989 Unclassified 572
15 JGI24737J22298_10001401 3300001990 Bacteria 8549
16 JGI24737J22298_10007012 3300001990 Bacteria 3820
17 JGI24745J21846_1000686 3300002073 Unclassified 3065
18 JGI24748J21848_1003430 3300002074 Bacteria 1810
19 JGI24738J21930_10002690 3300002075 Unclassified 4581
20 JGI24749J21850_1001148 3300002076 Bacteria 3762
21 JGI24035J26624_1000056 3300002126 Bacteria 8777
22 JGI24033J26618_1006460 3300002155 Unclassified 1316
23 JGI24034J26672_10000779 3300002239 Bacteria 4119
24 JGI24034J26672_10017214 3300002239 Bacteria 1118
25 JGI24742J22300_10000762 3300002244 Bacteria 4900
26 JGI24751J29686_10020676 3300002459 Unclassified 1363
27 JGI26129J50193_1011006 3300003349 Bacteria 660
28 JGI25405J52794_10014532 3300003911 Unclassified 1539
29 Ga0065717_1003762 3300005276 Bacteria 1185
30 Ga0065704_10002687 3300005289 Bacteria 4836
31 Ga0065704_10283553 3300005289 Unclassified 917
32 Ga0065712_10001483 3300005290 Bacteria 6567
33 Ga0065715_10001223 3300005293 Bacteria 8806
34 Ga0065715_10089298 3300005293 Bacteria 11384
35 Ga0065707_10085662 3300005295 Bacteria 5985
36 Ga0070676_10004374 3300005328 Bacteria 7427
37 Ga0070676_10028242 3300005328 Bacteria 3186
38 Ga0070683_100002372 3300005329 Bacteria 14956
39 Ga0070683_100013424 3300005329 Bacteria 7144
40 Ga0070683_100134501 3300005329 Bacteria 2341
41 Ga0070683_100256425 3300005329 Bacteria 1663
42 Ga0070683_100292327 3300005329 Bacteria 1550
43 Ga0070690_100031922 3300005330 Bacteria 3285
44 Ga0070690_100047499 3300005330 Bacteria 2731
45 Ga0070690_100619280 3300005330 Unclassified 823
46 Ga0070670_100045770 3300005331 Bacteria 3762
47 Ga0070670_100125297 3300005331 Bacteria 2217
48 Ga0070677_10001660 3300005333 Bacteria 7036
49 Ga0068869_100013986 3300005334 Bacteria 5352
50 Ga0068869_100069513 3300005334 Bacteria 2604
51 Ga0068869_100310531 3300005334 Bacteria 1276
52 Ga0068869_100610655 3300005334 Bacteria 922
53 Ga0070666_10005392 3300005335 Bacteria 7839
54 Ga0070666_10014933 3300005335 Bacteria 4947
55 Ga0070680_100009637 3300005336 Bacteria 7427
56 Ga0070680_100023842 3300005336 Bacteria 4884
57 Ga0070680_100051961 3300005336 Unclassified 3345
58 Ga0070680_100340184 3300005336 Unclassified 1275
59 Ga0070682_100003966 3300005337 Bacteria 8219
60 Ga0070682_100134388 3300005337 Bacteria 1678
61 Ga0070682_100154886 3300005337 Bacteria 1576
62 Ga0070682_100402988 3300005337 Bacteria 1035
63 Ga0070682_100831757 3300005337 Bacteria 753
64 Ga0068868_100006892 3300005338 Bacteria 8071
65 Ga0068868_100024999 3300005338 Bacteria 4537
66 Ga0068868_100471257 3300005338 Unclassified 1095
67 Ga0070660_100007163 3300005339 Bacteria 7756
68 Ga0070660_100108279 3300005339 Bacteria 2209
69 Ga0070660_101042291 3300005339 Unclassified 692
70 Ga0070660_101317589 3300005339 Unclassified 613
71 Ga0070689_100001580 3300005340 Bacteria 14528
72 Ga0070689_100024447 3300005340 Bacteria 4531
73 Ga0070689_100213176 3300005340 Unclassified 1581
74 Ga0070691_10010791 3300005341 Bacteria 4167
75 Ga0070691_10252909 3300005341 Bacteria 946
76 Ga0070691_10706364 3300005341 Bacteria 606
77 Ga0070687_100001243 3300005343 Bacteria 8855
78 Ga0070687_100048668 3300005343 Bacteria 2180
79 Ga0070687_100254430 3300005343 Bacteria 1093
80 Ga0070661_100003777 3300005344 Bacteria 10436
81 Ga0070661_100078490 3300005344 Bacteria 2435
82 Ga0070661_100260457 3300005344 Bacteria 1341
83 Ga0070692_10000584 3300005345 Bacteria 11463
84 Ga0070692_10164213 3300005345 Bacteria 1275
85 Ga0070692_10778703 3300005345 Bacteria 651
86 Ga0070668_100006376 3300005347 Bacteria 8743
87 Ga0070668_100059371 3300005347 Unclassified 2960
88 Ga0070668_100126735 3300005347 Bacteria 2045
89 Ga0070669_100008519 3300005353 Bacteria 7321
90 Ga0070669_100053373 3300005353 Bacteria 2958
91 Ga0070675_100006379 3300005354 Bacteria 9057
92 Ga0070675_100185038 3300005354 Bacteria 1802
93 Ga0070675_101176420 3300005354 Bacteria 706
94 Ga0070671_100006758 3300005355 Bacteria 9180
95 Ga0070671_100012390 3300005355 Bacteria 6867
96 Ga0070674_100036237 3300005356 Bacteria 3309
97 Ga0070674_100171472 3300005356 Bacteria 1654
98 Ga0070674_100754702 3300005356 Unclassified 836
99 Ga0070673_100001646 3300005364 Bacteria 13241
100 Ga0070673_100006994 3300005364 Bacteria 7393
101 Ga0070673_100019007 3300005364 Bacteria 4927
102 Ga0070688_100001441 3300005365 Bacteria 11822
103 Ga0070688_100001567 3300005365 Bacteria 11419
104 Ga0070688_100015120 3300005365 Bacteria 4383
105 Ga0070688_100143126 3300005365 Bacteria 1627
106 Ga0070659_100000606 3300005366 Bacteria 26284
107 Ga0070659_100053577 3300005366 Bacteria 3175
108 Ga0070659_100260462 3300005366 Bacteria 1439
109 Ga0070659_100629222 3300005366 Bacteria 924
110 Ga0070659_101411523 3300005366 Bacteria 619
111 Ga0070659_101764434 3300005366 Unclassified 554
112 Ga0070667_100002800 3300005367 Archaea 15053
113 Ga0070667_100026295 3300005367 Bacteria 4840
114 Ga0070667_100208995 3300005367 Bacteria 1734
115 Ga0070667_100377738 3300005367 Bacteria 1287
116 Ga0070667_100515802 3300005367 Unclassified 1097
117 Ga0070703_10045556 3300005406 Bacteria 1384
118 Ga0070709_10001527 3300005434 Bacteria 12492
119 Ga0070709_10005316 3300005434 Bacteria 6971
120 Ga0070709_10310597 3300005434 Bacteria 1154
121 Ga0070709_10710475 3300005434 Unclassified 783
122 Ga0070709_10799184 3300005434 Bacteria 740
123 Ga0070714_100050508 3300005435 Bacteria 3543
124 Ga0070714_100052029 3300005435 Unclassified 3493
125 Ga0070713_100009205 3300005436 Bacteria 7051
126 Ga0070713_100105764 3300005436 Bacteria 2445
127 Ga0070713_100500360 3300005436 Bacteria 1147
128 Ga0070710_10002893 3300005437 Bacteria 8181
129 Ga0070710_10028692 3300005437 Bacteria 2979
130 Ga0070710_10107247 3300005437 Bacteria 1673
131 Ga0070701_10001578 3300005438 Bacteria 8476
132 Ga0070701_10199629 3300005438 Bacteria 1181
133 Ga0070711_100007009 3300005439 Bacteria 6838
134 Ga0070711_100080541 3300005439 Bacteria 2319
135 Ga0070711_100112632 3300005439 Bacteria 1999
136 Ga0070711_100116192 3300005439 Bacteria 1971
137 Ga0070711_100224393 3300005439 Bacteria 1462
138 Ga0070711_100585187 3300005439 Bacteria 929
139 Ga0070711_100744710 3300005439 Bacteria 828
140 Ga0070705_100001050 3300005440 Bacteria 15416
141 Ga0070705_100373715 3300005440 Bacteria 1047
142 Ga0070700_100004229 3300005441 Bacteria 7492
143 Ga0070700_100108201 3300005441 Bacteria 1843
144 Ga0070700_100310251 3300005441 Bacteria 1155
145 Ga0070694_100003017 3300005444 Bacteria 10023
146 Ga0070694_100092626 3300005444 Bacteria 2123
147 Ga0070708_100033618 3300005445 Unclassified 4455
148 Ga0070663_100002491 3300005455 Bacteria 10389
149 Ga0070663_100060359 3300005455 Bacteria 2727
150 Ga0070663_100350311 3300005455 Bacteria 1195
151 Ga0070663_100494471 3300005455 Unclassified 1015
152 Ga0070678_100009108 3300005456 Bacteria 5989
153 Ga0070678_100167626 3300005456 Bacteria 1785
154 Ga0070678_102099513 3300005456 Bacteria 535
155 Ga0070662_100004090 3300005457 Bacteria 9162
156 Ga0070662_100080601 3300005457 Bacteria 2423
157 Ga0070662_100270505 3300005457 Unclassified 1372
158 Ga0070681_10007657 3300005458 Bacteria 10561
159 Ga0070681_10012440 3300005458 Bacteria 8442
160 Ga0070681_10057000 3300005458 Bacteria 3887
161 Ga0070681_10343131 3300005458 Unclassified 1403
162 Ga0070681_10936912 3300005458 Unclassified 785
163 Ga0070681_10991013 3300005458 Bacteria 760
164 Ga0068867_100003281 3300005459 Bacteria 11399
165 Ga0070685_10004728 3300005466 Bacteria 6894
166 Ga0070685_10012746 3300005466 Bacteria 4421
167 Ga0070685_10017824 3300005466 Bacteria 3808
168 Ga0070706_100901819 3300005467 Bacteria 817
169 Ga0070698_100622897 3300005471 Bacteria 1020
170 Ga0070699_100199052 3300005518 Bacteria 1781
171 Ga0070699_100825239 3300005518 Bacteria 849
172 Ga0070679_100007375 3300005530 Bacteria 10276
173 Ga0070679_100028159 3300005530 Bacteria 5537
174 Ga0070679_100089136 3300005530 Bacteria 3072
175 Ga0070679_100090686 3300005530 Unclassified 3045
176 Ga0070679_100141469 3300005530 Bacteria 2385
177 Ga0070679_101856863 3300005530 Unclassified 551
178 Ga0070684_100003410 3300005535 Bacteria 11927
179 Ga0070684_100029686 3300005535 Bacteria 4636
180 Ga0070684_100050707 3300005535 Bacteria 3605
181 Ga0070684_100052923 3300005535 Bacteria 3532
182 Ga0070684_101056453 3300005535 Unclassified 763
183 Ga0070697_100242277 3300005536 Unclassified 1540
184 Ga0070697_100267866 3300005536 Bacteria 1464
185 Ga0068853_100004052 3300005539 Bacteria 11279
186 Ga0068853_100275408 3300005539 Bacteria 1550
187 Ga0070672_100007298 3300005543 Bacteria 7492
188 Ga0070672_100134708 3300005543 Bacteria 2034
189 Ga0070686_100001851 3300005544 Bacteria 11802
190 Ga0070686_100006669 3300005544 Bacteria 6429
191 Ga0070686_100430850 3300005544 Bacteria 1010
192 Ga0070695_100003283 3300005545 Bacteria 9452
193 Ga0070695_100025097 3300005545 Bacteria 3677
194 Ga0070696_100010539 3300005546 Bacteria 6195
195 Ga0070696_100509415 3300005546 Bacteria 959
196 Ga0070693_100007812 3300005547 Bacteria 5244
197 Ga0070665_100106110 3300005548 Bacteria 2811
198 Ga0070665_100390848 3300005548 Unclassified 1399
199 Ga0070665_100564242 3300005548 Bacteria 1151
200 Ga0070665_102642334 3300005548 Unclassified 502
201 Ga0070704_100002531 3300005549 Bacteria 10288
202 Ga0070704_100016428 3300005549 Bacteria 4676
203 Ga0070704_100596817 3300005549 Unclassified 970
204 Ga0070704_100847113 3300005549 Unclassified 819
205 Ga0068855_100026458 3300005563 Bacteria 6939
206 Ga0068855_100035825 3300005563 Bacteria 5909
207 Ga0068855_101003665 3300005563 Bacteria 877
208 Ga0068855_102074773 3300005563 Bacteria 573
209 Ga0070664_100005496 3300005564 Bacteria 10176
210 Ga0070664_100093433 3300005564 Bacteria 2606
211 Ga0070664_100590404 3300005564 Bacteria 1030
212 Ga0068857_100005505 3300005577 Bacteria 10800
213 Ga0068854_100004381 3300005578 Bacteria 8904
214 Ga0068854_100260151 3300005578 Bacteria 1389
215 Ga0068854_100534721 3300005578 Bacteria 992
216 Ga0068854_100592632 3300005578 Bacteria 945
217 Ga0068856_100010806 3300005614 Bacteria 8867
218 Ga0068856_100196667 3300005614 Bacteria 2030
219 Ga0068856_100443645 3300005614 Bacteria 1318
220 Ga0070702_100001550 3300005615 Bacteria 9461
221 Ga0070702_100061047 3300005615 Bacteria 2194
222 Ga0070702_100104263 3300005615 Unclassified 1745
223 Ga0068852_100009158 3300005616 Bacteria 7333
224 Ga0068852_100245781 3300005616 Bacteria 1712
225 Ga0068852_102653265 3300005616 Bacteria 520
226 Ga0068859_100013289 3300005617 Bacteria 8260
227 Ga0068859_100017563 3300005617 Bacteria 7193
228 Ga0068864_100008539 3300005618 Bacteria 8453
229 Ga0068864_100156944 3300005618 Bacteria 2066
230 Ga0068864_100321480 3300005618 Bacteria 1453
231 Ga0068864_100864177 3300005618 Bacteria 892
232 Ga0068866_10000499 3300005718 Bacteria 18097
233 Ga0068866_10029049 3300005718 Bacteria 2640
234 Ga0068861_100005753 3300005719 Bacteria 8409
235 Ga0068861_100572035 3300005719 Unclassified 1033
236 Ga0068851_10033685 3300005834 Unclassified 2554
237 Ga0068870_10000912 3300005840 Bacteria 11564
238 Ga0068863_100012619 3300005841 Bacteria 8151
239 Ga0068863_100279471 3300005841 Bacteria 1617
240 Ga0068863_100338755 3300005841 Bacteria 1463
241 Ga0068858_100021701 3300005842 Bacteria 6000
242 Ga0068858_100026979 3300005842 Bacteria 5335
243 Ga0068858_100170703 3300005842 Bacteria 2051
244 Ga0068858_100264506 3300005842 Bacteria 1635
245 Ga0068860_100014809 3300005843 Bacteria 7628
246 Ga0068860_100372119 3300005843 Bacteria 1409
247 Ga0068860_101896787 3300005843 Bacteria 617
248 Ga0068862_100006001 3300005844 Bacteria 10115
249 Ga0068862_100044677 3300005844 Bacteria 3779
250 Ga0068862_100594225 3300005844 Unclassified 1062
251 Ga0081455_10001814 3300005937 Bacteria 25739
252 Ga0081455_10007996 3300005937 Bacteria 11056
253 Ga0081455_10008059 3300005937 Bacteria 11004
254 Ga0081455_10017479 3300005937 Bacteria 6872
255 Ga0081455_10025454 3300005937 Bacteria 5461
256 Ga0081455_10038785 3300005937 Bacteria 4216
257 Ga0081455_10440539 3300005937 Unclassified 893
258 Ga0081455_10462768 3300005937 Bacteria 863
259 Ga0081455_10647578 3300005937 Bacteria 681
260 Ga0081540_1087314 3300005983 Unclassified 1382
261 Ga0070717_10000378 3300006028 Bacteria 28453
262 Ga0070717_10126997 3300006028 Bacteria 2190
263 Ga0075365_10223353 3300006038 Bacteria 1322
264 Ga0075365_10767402 3300006038 Unclassified 681
265 Ga0075364_10418617 3300006051 Bacteria 914
266 Ga0075432_10061418 3300006058 Archaea 1339
267 Ga0075432_10409927 3300006058 Unclassified 587
268 Ga0070715_10006610 3300006163 Bacteria 3953
269 Ga0070715_10030672 3300006163 Unclassified 2176
270 Ga0070715_10444016 3300006163 Unclassified 731
271 Ga0070716_100003615 3300006173 Bacteria 7307
272 Ga0070716_100034168 3300006173 Unclassified 2786
273 Ga0070712_100045755 3300006175 Bacteria 3023
274 Ga0070712_100216674 3300006175 Unclassified 1513
275 Ga0070712_100302262 3300006175 Bacteria 1295
276 Ga0070712_100337880 3300006175 Bacteria 1229
277 Ga0070712_100339678 3300006175 Bacteria 1226
278 Ga0070712_101433641 3300006175 Bacteria 603
279 Ga0075367_10217362 3300006178 Bacteria 1196
280 Ga0075367_10361317 3300006178 Bacteria 917
281 Ga0075367_11029847 3300006178 Unclassified 526
282 Ga0075427_10004740 3300006194 Unclassified 1918
283 Ga0075366_10243937 3300006195 Unclassified 1095
284 Ga0097621_100002280 3300006237 Bacteria 13142
285 Ga0097621_101070059 3300006237 Unclassified 756
286 Ga0075370_10131402 3300006353 Unclassified 1461
287 Ga0068871_100001765 3300006358 Bacteria 14558
288 Ga0068871_100002303 3300006358 Bacteria 12987
289 Ga0068871_100457677 3300006358 Unclassified 1145
290 Ga0075428_100053255 3300006844 Bacteria 4434
291 Ga0075428_100101747 3300006844 Unclassified 3132
292 Ga0075430_100001229 3300006846 Bacteria 20614
293 Ga0075430_101553668 3300006846 Bacteria 543
294 Ga0075431_100091870 3300006847 Unclassified 3132
295 Ga0075431_100206716 3300006847 Bacteria 2007
296 Ga0075433_10000068 3300006852 Bacteria 45762
297 Ga0075433_10004014 3300006852 Bacteria 11384
298 Ga0075433_10085971 3300006852 Bacteria 2777
299 Ga0075433_10110846 3300006852 Bacteria 2435
300 Ga0075434_100002653 3300006871 Bacteria 15786
301 Ga0075434_100010212 3300006871 Bacteria 8793
302 Ga0075434_100014111 3300006871 Bacteria 7630
303 Ga0075434_100028341 3300006871 Bacteria 5501
304 Ga0075434_100213810 3300006871 Bacteria 1948
305 Ga0075434_100219739 3300006871 Bacteria 1920
306 Ga0075434_100691165 3300006871 Unclassified 1038
307 Ga0075434_100764391 3300006871 Unclassified 983
308 Ga0075429_100001258 3300006880 Bacteria 20614
309 Ga0075429_100705293 3300006880 Bacteria 884
310 Ga0068865_100005830 3300006881 Bacteria 7492
311 Ga0068865_100146986 3300006881 Unclassified 1784
312 Ga0068865_100439947 3300006881 Bacteria 1076
313 Ga0068865_100466636 3300006881 Bacteria 1047
314 Ga0075436_100118739 3300006914 Unclassified 1849
315 Ga0075436_100489350 3300006914 Unclassified 899
316 Ga0097620_100013289 3300006931 Bacteria 8260
317 Ga0097620_100017562 3300006931 Bacteria 7193
318 Ga0075435_100004859 3300007076 Bacteria 9304
319 Ga0075435_100103892 3300007076 Bacteria 2357
320 Ga0075435_100194729 3300007076 Bacteria 1716
321 Ga0075435_100232512 3300007076 Bacteria 1566
322 Ga0075435_100232513 3300007076 Bacteria 1566
323 Ga0075435_100394196 3300007076 Bacteria 1190
324 Ga0099795_10063283 3300007788 Bacteria 1378
325 Ga0105251_10008344 3300009011 Bacteria 6250
326 Ga0105244_10351005 3300009036 Unclassified 680
327 Ga0105250_10081060 3300009092 Unclassified 1315
328 Ga0105250_10208328 3300009092 Bacteria 826
329 Ga0105240_10047824 3300009093 Bacteria 5410
330 Ga0105240_10545760 3300009093 Bacteria 1283
331 Ga0111539_10002321 3300009094 Bacteria 25327
332 Ga0111539_10002993 3300009094 Bacteria 22418
333 Ga0111539_10015631 3300009094 Bacteria 9436
334 Ga0111539_10120763 3300009094 Bacteria 3070
335 Ga0111539_10155897 3300009094 Bacteria 2672
336 Ga0105245_10007695 3300009098 Bacteria 9436
337 Ga0105245_10029765 3300009098 Bacteria 4826
338 Ga0105245_10212986 3300009098 Unclassified 1861
339 Ga0105245_11069843 3300009098 Bacteria 852
340 Ga0105245_11197978 3300009098 Bacteria 807
341 Ga0105247_10006474 3300009101 Bacteria 7247
342 Ga0105247_10071451 3300009101 Unclassified 2171
343 Ga0105247_10113281 3300009101 Bacteria 1748
344 Ga0105247_10150863 3300009101 Bacteria 1531
345 Ga0114129_10008407 3300009147 Bacteria 14700
346 Ga0114129_10080743 3300009147 Bacteria 4520
347 Ga0114129_10196844 3300009147 Unclassified 2732
348 Ga0114129_10887464 3300009147 Unclassified 1131
349 Ga0114129_13017982 3300009147 Unclassified 553
350 Ga0105243_10005397 3300009148 Bacteria 9975
351 Ga0105243_10006140 3300009148 Bacteria 9291
352 Ga0105243_10256229 3300009148 Bacteria 1565
353 Ga0105243_11598695 3300009148 Unclassified 678
354 Ga0105241_10008144 3300009174 Bacteria 7718
355 Ga0105241_10049635 3300009174 Bacteria 3196
356 Ga0105241_10230515 3300009174 Bacteria 1561
357 Ga0105241_10441020 3300009174 Bacteria 1150
358 Ga0105242_10005421 3300009176 Bacteria 9867
359 Ga0105242_10006587 3300009176 Bacteria 8948
360 Ga0105242_10414106 3300009176 Bacteria 1261
361 Ga0105242_11320049 3300009176 Unclassified 746
362 Ga0105248_10004154 3300009177 Bacteria 16015
363 Ga0105248_10015999 3300009177 Bacteria 8258
364 Ga0105248_10032918 3300009177 Bacteria 5790
365 Ga0105248_10059358 3300009177 Bacteria 4296
366 Ga0105237_10015749 3300009545 Bacteria 7863
367 Ga0105237_10031682 3300009545 Bacteria 5355
368 Ga0105237_10090161 3300009545 Bacteria 3056
369 Ga0105237_10352417 3300009545 Bacteria 1476
370 Ga0105237_11340615 3300009545 Bacteria 722
371 Ga0105238_10103993 3300009551 Bacteria 2821
372 Ga0105238_10274994 3300009551 Unclassified 1665
373 Ga0105238_10358086 3300009551 Unclassified 1448
374 Ga0105249_10005322 3300009553 Bacteria 11106
375 Ga0105249_10027545 3300009553 Bacteria 5127
376 Ga0105249_10176707 3300009553 Unclassified 2074
377 Ga0105249_10298016 3300009553 Bacteria 1616
378 Ga0105249_10631915 3300009553 Bacteria 1127
379 Ga0105249_11063740 3300009553 Unclassified 879
380 Ga0105239_10013532 3300010375 Bacteria 9056
381 Ga0105239_10031335 3300010375 Bacteria 5849
382 Ga0105239_10100375 3300010375 Bacteria 3201
383 Ga0105239_10190877 3300010375 Bacteria 2293
384 Ga0105239_10452897 3300010375 Bacteria 1456
385 Ga0105239_12053367 3300010375 Bacteria 664
386 Ga0105246_10003909 3300011119 Bacteria 9025
387 Ga0105246_10050197 3300011119 Bacteria 2861
388 Ga0105246_10702397 3300011119 Bacteria 887
389 Ga0105246_11218447 3300011119 Unclassified 694
390 Ga0157336_1001406 3300012477 Bacteria 1238
391 Ga0157321_1012704 3300012487 Bacteria 676
392 Ga0157335_1003960 3300012492 Unclassified 975
393 Ga0157323_1003499 3300012495 Bacteria 950
394 Ga0157314_1034339 3300012500 Bacteria 585
395 Ga0157342_1000397 3300012507 Bacteria 2568
396 Ga0157342_1037352 3300012507 Unclassified 637
397 Ga0157315_1001012 3300012508 Bacteria 1459
398 Ga0157373_10009648 3300013100 Bacteria 7124
399 Ga0157373_10108489 3300013100 Unclassified 1952
400 Ga0157373_10287163 3300013100 Bacteria 1167
401 Ga0157373_10622569 3300013100 Bacteria 787
402 Ga0157371_10017025 3300013102 Bacteria 5412
403 Ga0157371_10529758 3300013102 Bacteria 872
404 Ga0157371_10595679 3300013102 Bacteria 822
405 Ga0157370_10071837 3300013104 Bacteria 3265
406 Ga0157370_10314991 3300013104 Bacteria 1444
407 Ga0157369_10105324 3300013105 Bacteria 3003
408 Ga0157369_11626012 3300013105 Unclassified 657
409 Ga0157374_10006413 3300013296 Bacteria 9988
410 Ga0157374_10508841 3300013296 Bacteria 1209
411 Ga0157374_11105400 3300013296 Unclassified 813
412 Ga0157378_10006910 3300013297 Bacteria 9908
413 Ga0157378_10015392 3300013297 Bacteria 6699
414 Ga0157378_10407375 3300013297 Bacteria 1341
415 Ga0157378_10430498 3300013297 Bacteria 1306
416 Ga0157378_10774525 3300013297 Bacteria 984
417 Ga0157378_10814595 3300013297 Unclassified 960
418 Ga0157378_12117001 3300013297 Unclassified 613
419 Ga0163162_10011669 3300013306 Bacteria 8566
420 Ga0163162_10120179 3300013306 Bacteria 2731
421 Ga0163162_10951997 3300013306 Unclassified 970
422 Ga0163162_11552189 3300013306 Bacteria 755
423 Ga0157372_10004846 3300013307 Bacteria 14308
424 Ga0157372_10160803 3300013307 Bacteria 2595
425 Ga0157372_10190623 3300013307 Bacteria 2375
426 Ga0157372_10917580 3300013307 Bacteria 1016
427 Ga0157372_11522677 3300013307 Bacteria 770
428 Ga0157375_10067078 3300013308 Bacteria 3584
429 Ga0157375_10070507 3300013308 Bacteria 3505
430 Ga0157375_10544513 3300013308 Bacteria 1323
431 Ga0163163_10004603 3300014325 Bacteria 11774
432 Ga0163163_10007332 3300014325 Bacteria 9726
433 Ga0163163_10405829 3300014325 Bacteria 1421
434 Ga0157380_10004302 3300014326 Bacteria 9871
435 Ga0157380_11360946 3300014326 Bacteria 759
436 Ga0157380_11760902 3300014326 Bacteria 678
437 Ga0182008_10157420 3300014497 Unclassified 1141
438 Ga0157377_10005931 3300014745 Bacteria 5782
439 Ga0157379_10005467 3300014968 Bacteria 10913
440 Ga0157379_10112151 3300014968 Unclassified 2450
441 Ga0157379_10262286 3300014968 Bacteria 1570
442 Ga0157379_10263871 3300014968 Bacteria 1565
443 Ga0157376_10008818 3300014969 Bacteria 7296
444 Ga0157376_10063299 3300014969 Bacteria 3115
445 Ga0157376_10818893 3300014969 Bacteria 945
446 Ga0163161_10006035 3300017792 Bacteria 8396
447 Ga0163161_10031508 3300017792 Unclassified 3778
448 Ga0206356_10901597 3300020070 Bacteria 1025
449 Ga0206353_10640270 3300020082 Bacteria 721
450 Ga0213876_10037068 3300021384 Bacteria 2572
451 Ga0207638_1002335 3300025227 Bacteria 706
452 Ga0207666_1000101 3300025271 Archaea 13529
453 Ga0207666_1003681 3300025271 Bacteria 1892
454 Ga0207673_1000172 3300025290 Bacteria 6401
455 Ga0207697_10001935 3300025315 Bacteria 11000
456 Ga0207697_10044971 3300025315 Bacteria 1817
457 Ga0207656_10014038 3300025321 Bacteria 3077
458 Ga0207656_10044483 3300025321 Unclassified 1896
459 Ga0207656_10144593 3300025321 Bacteria 1123
460 Ga0207713_1096293 3300025735 Bacteria 1030
461 Ga0207653_10001381 3300025885 Bacteria 7883
462 Ga0207653_10020629 3300025885 Bacteria 2086
463 Ga0207682_10001556 3300025893 Bacteria 10529
464 Ga0207692_10004188 3300025898 Bacteria 5694
465 Ga0207692_10013342 3300025898 Bacteria 3562
466 Ga0207692_10031468 3300025898 Bacteria 2541
467 Ga0207692_10066131 3300025898 Bacteria 1889
468 Ga0207692_10189799 3300025898 Bacteria 1202
469 Ga0207642_10000470 3300025899 Bacteria 12339
470 Ga0207642_10065855 3300025899 Bacteria 1704
471 Ga0207642_10219878 3300025899 Bacteria 1061
472 Ga0207710_10003481 3300025900 Bacteria 7006
473 Ga0207710_10018595 3300025900 Bacteria 2957
474 Ga0207710_10072708 3300025900 Bacteria 1580
475 Ga0207688_10000342 3300025901 Bacteria 21582
476 Ga0207688_10035396 3300025901 Bacteria 2766
477 Ga0207688_10252953 3300025901 Bacteria 1067
478 Ga0207680_10005429 3300025903 Bacteria 6091
479 Ga0207680_10008752 3300025903 Bacteria 4986
480 Ga0207680_10323585 3300025903 Unclassified 1079
481 Ga0207680_11162168 3300025903 Bacteria 551
482 Ga0207647_10004199 3300025904 Bacteria 10683
483 Ga0207647_10083330 3300025904 Bacteria 1915
484 Ga0207647_10282049 3300025904 Bacteria 948
485 Ga0207685_10002461 3300025905 Bacteria 4253
486 Ga0207699_10001414 3300025906 Bacteria 11391
487 Ga0207699_10035373 3300025906 Unclassified 2842
488 Ga0207699_10297042 3300025906 Unclassified 1127
489 Ga0207699_10339921 3300025906 Bacteria 1057
490 Ga0207645_10002850 3300025907 Bacteria 13411
491 Ga0207645_10018793 3300025907 Bacteria 4540
492 Ga0207643_10000136 3300025908 Bacteria 49812
493 Ga0207654_10003429 3300025911 Bacteria 8015
494 Ga0207654_10284340 3300025911 Bacteria 1120
495 Ga0207707_10030138 3300025912 Unclassified 4744
496 Ga0207707_10063403 3300025912 Bacteria 3217
497 Ga0207707_10102214 3300025912 Unclassified 2505
498 Ga0207707_10232340 3300025912 Bacteria 1604
499 Ga0207707_10372343 3300025912 Bacteria 1229
500 Ga0207707_10708378 3300025912 Unclassified 845
501 Ga0207671_10048718 3300025914 Unclassified 3136
502 Ga0207671_10268034 3300025914 Bacteria 1345
503 Ga0207693_10009179 3300025915 Bacteria 8077
504 Ga0207693_10021607 3300025915 Bacteria 5115
505 Ga0207693_10061055 3300025915 Unclassified 2953
506 Ga0207693_10119704 3300025915 Unclassified 2068
507 Ga0207693_10189479 3300025915 Unclassified 1619
508 Ga0207663_10009720 3300025916 Bacteria 5091
509 Ga0207663_10036723 3300025916 Bacteria 2949
510 Ga0207663_10046347 3300025916 Bacteria 2678
511 Ga0207663_10053755 3300025916 Bacteria 2518
512 Ga0207663_10206594 3300025916 Bacteria 1420
513 Ga0207663_10233468 3300025916 Bacteria 1345
514 Ga0207663_11092954 3300025916 Bacteria 641
515 Ga0207660_10004279 3300025917 Bacteria 9309
516 Ga0207660_10435182 3300025917 Bacteria 1059
517 Ga0207660_10726507 3300025917 Bacteria 810
518 Ga0207662_10000164 3300025918 Bacteria 31404
519 Ga0207662_10024356 3300025918 Bacteria 3484
520 Ga0207662_10204914 3300025918 Bacteria 1278
521 Ga0207657_10005663 3300025919 Bacteria 13034
522 Ga0207657_10027385 3300025919 Bacteria 5221
523 Ga0207657_10674224 3300025919 Bacteria 804
524 Ga0207657_10859721 3300025919 Bacteria 700
525 Ga0207657_11073575 3300025919 Bacteria 616
526 Ga0207649_10002730 3300025920 Bacteria 9780
527 Ga0207649_10225804 3300025920 Bacteria 1336
528 Ga0207649_10702375 3300025920 Bacteria 784
529 Ga0207649_11525817 3300025920 Unclassified 529
530 Ga0207652_10181184 3300025921 Bacteria 1893
531 Ga0207652_10704129 3300025921 Bacteria 901
532 Ga0207652_11254925 3300025921 Bacteria 643
533 Ga0207681_10005292 3300025923 Bacteria 7930
534 Ga0207681_10183318 3300025923 Bacteria 1596
535 Ga0207694_10093199 3300025924 Bacteria 2379
536 Ga0207694_10228432 3300025924 Unclassified 1519
537 Ga0207694_10845962 3300025924 Bacteria 773
538 Ga0207650_10051528 3300025925 Unclassified 3046
539 Ga0207650_10053379 3300025925 Bacteria 2995
540 Ga0207650_10406167 3300025925 Bacteria 1128
541 Ga0207659_10000171 3300025926 Archaea 38884
542 Ga0207659_10667124 3300025926 Bacteria 889
543 Ga0207659_11311671 3300025926 Unclassified 621
544 Ga0207687_10022923 3300025927 Bacteria 4158
545 Ga0207687_10031580 3300025927 Unclassified 3581
546 Ga0207700_10005138 3300025928 Bacteria 7785
547 Ga0207700_10758390 3300025928 Unclassified 867
548 Ga0207664_10003302 3300025929 Bacteria 10730
549 Ga0207664_10031465 3300025929 Bacteria 4059
550 Ga0207664_10100470 3300025929 Unclassified 2388
551 Ga0207664_10416834 3300025929 Bacteria 1196
552 Ga0207644_10012793 3300025931 Bacteria 5580
553 Ga0207644_10081269 3300025931 Bacteria 2394
554 Ga0207644_10527619 3300025931 Bacteria 976
555 Ga0207690_10006648 3300025932 Bacteria 6850
556 Ga0207690_10224594 3300025932 Bacteria 1439
557 Ga0207690_10566647 3300025932 Bacteria 924
558 Ga0207690_11127237 3300025932 Bacteria 654
559 Ga0207690_11794012 3300025932 Bacteria 512
560 Ga0207706_10008545 3300025933 Bacteria 9436
561 Ga0207706_10026853 3300025933 Bacteria 5154
562 Ga0207706_10130088 3300025933 Bacteria 2214
563 Ga0207686_10000913 3300025934 Archaea 17699
564 Ga0207686_10004054 3300025934 Bacteria 7865
565 Ga0207709_10002060 3300025935 Bacteria 13002
566 Ga0207709_10178573 3300025935 Bacteria 1497
567 Ga0207670_10002654 3300025936 Bacteria 9409
568 Ga0207670_10227278 3300025936 Bacteria 1431
569 Ga0207669_10008376 3300025937 Unclassified 4850
570 Ga0207669_10125532 3300025937 Bacteria 1752
571 Ga0207704_10001376 3300025938 Bacteria 10873
572 Ga0207704_10387912 3300025938 Bacteria 1098
573 Ga0207704_10390942 3300025938 Bacteria 1095
574 Ga0207704_10635714 3300025938 Unclassified 877
575 Ga0207704_11333900 3300025938 Unclassified 614
576 Ga0207665_10005865 3300025939 Bacteria 8173
577 Ga0207665_10038750 3300025939 Unclassified 3175
578 Ga0207665_10074598 3300025939 Bacteria 2322
579 Ga0207665_10449492 3300025939 Bacteria 989
580 Ga0207691_10009289 3300025940 Bacteria 9435
581 Ga0207691_10145597 3300025940 Bacteria 2085
582 Ga0207711_10011703 3300025941 Bacteria 7289
583 Ga0207711_10019793 3300025941 Bacteria 5609
584 Ga0207711_10453758 3300025941 Bacteria 1193
585 Ga0207689_10000427 3300025942 Bacteria 39477
586 Ga0207689_10107566 3300025942 Bacteria 2292
587 Ga0207689_10321757 3300025942 Bacteria 1284
588 Ga0207689_10614138 3300025942 Bacteria 915
589 Ga0207661_10019446 3300025944 Bacteria 5063
590 Ga0207661_10241727 3300025944 Bacteria 1602
591 Ga0207661_10585629 3300025944 Bacteria 1023
592 Ga0207661_10767992 3300025944 Bacteria 887
593 Ga0207679_10001545 3300025945 Archaea 14398
594 Ga0207679_10097690 3300025945 Bacteria 2288
595 Ga0207679_10223805 3300025945 Bacteria 1584
596 Ga0207679_10233071 3300025945 Bacteria 1556
597 Ga0207679_10440125 3300025945 Bacteria 1154
598 Ga0207667_10019679 3300025949 Bacteria 7526
599 Ga0207651_10013019 3300025960 Bacteria 4739
600 Ga0207651_10023538 3300025960 Unclassified 3791
601 Ga0207651_10135376 3300025960 Bacteria 1894
602 Ga0207712_10003331 3300025961 Bacteria 10182
603 Ga0207712_10078407 3300025961 Unclassified 2397
604 Ga0207712_10468467 3300025961 Bacteria 1072
605 Ga0207668_10003213 3300025972 Bacteria 9580
606 Ga0207668_10332722 3300025972 Bacteria 1264
607 Ga0207668_10696600 3300025972 Bacteria 893
608 Ga0207640_10005218 3300025981 Bacteria 7068
609 Ga0207640_10060427 3300025981 Bacteria 2505
610 Ga0207640_10255289 3300025981 Bacteria 1363
611 Ga0207658_10009391 3300025986 Bacteria 6634
612 Ga0207658_10010825 3300025986 Bacteria 6206
613 Ga0207658_10085170 3300025986 Bacteria 2434
614 Ga0207658_10134250 3300025986 Unclassified 1993
615 Ga0207658_10181475 3300025986 Bacteria 1742
616 Ga0207677_10007106 3300026023 Bacteria 6164
617 Ga0207677_10056559 3300026023 Unclassified 2688
618 Ga0207703_10010690 3300026035 Bacteria 7166
619 Ga0207703_10012302 3300026035 Bacteria 6671
620 Ga0207703_10191116 3300026035 Bacteria 1813
621 Ga0207639_10042260 3300026041 Unclassified 3415
622 Ga0207639_10526829 3300026041 Bacteria 1082
623 Ga0207678_10007058 3300026067 Bacteria 9974
624 Ga0207678_10015702 3300026067 Bacteria 6654
625 Ga0207678_10254743 3300026067 Bacteria 1504
626 Ga0207678_10329508 3300026067 Unclassified 1314
627 Ga0207708_10002028 3300026075 Bacteria 14933
628 Ga0207708_10010355 3300026075 Bacteria 6922
629 Ga0207702_10040015 3300026078 Bacteria 3929
630 Ga0207702_10187165 3300026078 Unclassified 1910
631 Ga0207702_10430736 3300026078 Bacteria 1277
632 Ga0207702_12452431 3300026078 Bacteria 508
633 Ga0207641_10011065 3300026088 Bacteria 7401
634 Ga0207641_10032328 3300026088 Bacteria 4343
635 Ga0207641_10759238 3300026088 Bacteria 958
636 Ga0207641_12503976 3300026088 Bacteria 514
637 Ga0207648_10005202 3300026089 Bacteria 13177
638 Ga0207648_11108229 3300026089 Unclassified 742
639 Ga0207676_10010010 3300026095 Bacteria 6747
640 Ga0207676_10028842 3300026095 Bacteria 4150
641 Ga0207676_10335448 3300026095 Unclassified 1393
642 Ga0207676_10531351 3300026095 Bacteria 1121
643 Ga0207674_10006837 3300026116 Bacteria 13378
644 Ga0207675_100007981 3300026118 Bacteria 9975
645 Ga0207675_100018679 3300026118 Bacteria 6471
646 Ga0207675_100291274 3300026118 Bacteria 1588
647 Ga0207683_10001573 3300026121 Bacteria 20555
648 Ga0207683_10007361 3300026121 Bacteria 9436
649 Ga0207683_11584968 3300026121 Bacteria 604
650 Ga0207698_10006198 3300026142 Bacteria 7442
651 Ga0207698_10386879 3300026142 Bacteria 1332
652 Ga0207698_11863981 3300026142 Bacteria 616
653 Ga0209973_1013096 3300027252 Bacteria 1018
654 Ga0209968_1013680 3300027526 Bacteria 1274
655 Ga0210002_1000356 3300027617 Bacteria 6255
656 Ga0209983_1054673 3300027665 Bacteria 876
657 Ga0209971_1075655 3300027682 Bacteria 819
658 Ga0209971_1093603 3300027682 Unclassified 734
659 Ga0209966_1004797 3300027695 Bacteria 2304
660 Ga0209966_1010489 3300027695 Bacteria 1672
661 Ga0209998_10001649 3300027717 Bacteria 5343
662 Ga0209998_10004118 3300027717 Bacteria 3105
663 Ga0209974_10123856 3300027876 Bacteria 918
664 Ga0207428_10001083 3300027907 Bacteria 29663
665 Ga0207428_10002387 3300027907 Archaea 18760
666 Ga0207428_10037257 3300027907 Bacteria 3958
667 Ga0207428_10047768 3300027907 Bacteria 3436
668 Ga0268266_10004945 3300028379 Bacteria 12614
669 Ga0268266_10043157 3300028379 Bacteria 3853
670 Ga0268265_10008346 3300028380 Bacteria 6993
671 Ga0268264_10010503 3300028381 Bacteria 7653
672 Ga0268264_10378234 3300028381 Bacteria 1355
673 Ga0265337_1000084 3300028556 Bacteria 45523
674 Ga0265325_10000004 3300031241 Bacteria 347347
675 Ga0265325_10005342 3300031241 Bacteria 7944
676 Ga0265325_10007231 3300031241 Bacteria 6675
677 Ga0265325_10049126 3300031241 Bacteria 2179
678 Ga0265329_10304196 3300031242 Unclassified 539
679 Ga0265316_10070468 3300031344 Unclassified 2697
680 Ga0265313_10000007 3300031595 Bacteria 178640
681 Ga0265313_10010130 3300031595 Bacteria 6022
682 Ga0265313_10011201 3300031595 Bacteria 5591
683 Ga0265313_10030721 3300031595 Bacteria 2761
684 Ga0265313_10067437 3300031595 Bacteria 1655
685 Ga0265313_10217268 3300031595 Bacteria 789
686 Ga0316579_10019855 3300031691 Bacteria 2973
687 Ga0265314_10005178 3300031711 Bacteria 11840
688 Ga0307413_10575662 3300031824 Bacteria 918
689 Ga0307412_11454220 3300031911 Bacteria 622
690 Ga0307416_100390362 3300032002 Bacteria 1426
691 Ga0307415_100895202 3300032126 Bacteria 818
692 Ga0316583_10119206 3300032133 Bacteria 920
693 Ga0373930_0000522 3300034816 Bacteria 5299
694 Ga0373930_0002381 3300034816 Unclassified 2906
695 Ga0373930_0028702 3300034816 Bacteria 1134
696 Ga0373948_0000207 3300034817 Bacteria 6807
697 Ga0373948_0003259 3300034817 Bacteria 2482
698 Ga0373948_0041570 3300034817 Bacteria 963
699 Ga0373950_0001618 3300034818 Unclassified 2971
700 Ga0373950_0002150 3300034818 Bacteria 2681
701 Ga0373958_0000119 3300034819 Bacteria 8580
702 Ga0373958_0001078 3300034819 Unclassified 3591
703 Ga0373958_0100182 3300034819 Unclassified 679
704 Ga0373959_0015081 3300034820 Bacteria 1415
705 Ga0373938_0000136 3300034957 Bacteria 10533
706 Ga0373938_0001630 3300034957 Unclassified 3597
707 Ga0373938_0007363 3300034957 Bacteria 1934
708 Ga0373938_0224189 3300034957 Bacteria 529
709 Ga0373926_0003042 3300035083 Bacteria 5375
710 Ga0373926_0026246 3300035083 Bacteria 2037
711 Ga0373926_0126310 3300035083 Bacteria 966
712 Ga0373928_0006813 3300035084 Unclassified 2201
713 Ga0373928_0007096 3300035084 Bacteria 2160
714 Ga0373928_0116298 3300035084 Unclassified 712
715 Ga0373929_0013433 3300035085 Bacteria 1569
716 Ga0373929_0020968 3300035085 Unclassified 1321
717 Ga0373934_0033532 3300035086 Bacteria 2015
718 Ga0373934_0057413 3300035086 Unclassified 1549
719 Ga0373940_0000317 3300035088 Bacteria 7033
720 Ga0373940_0001806 3300035088 Bacteria 3998
721 Ga0373940_0023589 3300035088 Bacteria 1589
722 Ga0373944_0002779 3300035089 Bacteria 4476
723 Ga0373944_0003433 3300035089 Bacteria 4089
724 Ga0373944_0014141 3300035089 Bacteria 2224
725 Ga0373949_0020954 3300035090 Bacteria 1500
726 Ga0373949_0025494 3300035090 Unclassified 1380
727 Ga0373949_0030479 3300035090 Unclassified 1282
728 Ga0373949_0042818 3300035090 Bacteria 1118
729 Ga0373949_0066878 3300035090 Bacteria 935
730 Ga0373951_0000352 3300035091 Bacteria 13922
731 Ga0373951_0036923 3300035091 Bacteria 1167
732 Ga0373952_0015624 3300035092 Bacteria 1534
733 Ga0373952_0033637 3300035092 Bacteria 1151
734 Ga0373923_0045342 3300035111 Unclassified 1826
735 Ga0373923_0046149 3300035111 Bacteria 1811
736 Ga0373923_0107756 3300035111 Bacteria 1234
737 Ga0373932_0001597 3300035112 Bacteria 6238
738 Ga0373932_0004213 3300035112 Bacteria 3415
739 Ga0373932_0247962 3300035112 Bacteria 649
740 Ga0373936_0027193 3300035113 Bacteria 2243
741 Ga0373936_0033702 3300035113 Unclassified 2031
742 Ga0373939_0001258 3300035114 Bacteria 6192
743 Ga0373939_0001317 3300035114 Bacteria 6030
744 Ga0373939_0107341 3300035114 Bacteria 967
745 Ga0373939_0114216 3300035114 Bacteria 945
746 Ga0373941_0000684 3300035115 Bacteria 6905
747 Ga0373941_0004179 3300035115 Bacteria 3315
748 Ga0373941_0004362 3300035115 Bacteria 3262
749 Ga0373941_0125768 3300035115 Bacteria 918
750 Ga0373941_0266297 3300035115 Bacteria 674
751 Ga0373941_0290800 3300035115 Bacteria 649
752 Ga0373945_0000444 3300035116 Bacteria 11673
753 Ga0373945_0059620 3300035116 Bacteria 1421
754 Ga0373945_0187170 3300035116 Bacteria 855
755 Ga0373953_0006233 3300035117 Bacteria 3918
756 Ga0373953_0032880 3300035117 Unclassified 2026
757 Ga0373953_0039028 3300035117 Bacteria 1881
758 Ga0373954_0016722 3300035118 Bacteria 3287
759 Ga0373956_0008045 3300035119 Bacteria 4263
760 Ga0373956_0477517 3300035119 Unclassified 595
761 Ga0373960_0002495 3300035121 Unclassified 4138
762 Ga0373960_0013443 3300035121 Bacteria 2054
763 Ga0373960_0109953 3300035121 Bacteria 903
764 Ga0373943_0002844 3300035170 Bacteria 7863
765 Ga0373943_0012748 3300035170 Bacteria 3789
766 Ga0373943_0256957 3300035170 Bacteria 982
767 Ga0373946_0005803 3300035171 Bacteria 4465
768 Ga0373946_0014632 3300035171 Bacteria 2960
769 Ga0373946_0129461 3300035171 Bacteria 1160
770 Ga0373946_0134242 3300035171 Bacteria 1141
771 Ga0373955_0003402 3300035172 Bacteria 6994
772 Ga0373955_0005412 3300035172 Bacteria 5737
773 Ga0373955_0049371 3300035172 Bacteria 2284
774 Ga0373955_0256975 3300035172 Bacteria 1048
775 Ga0373942_0000740 3300035207 Bacteria 9003
776 Ga0373942_0029203 3300035207 Bacteria 1446
777 Ga0373942_0050087 3300035207 Unclassified 1168
778 Ga0373961_0039334 3300035241 Bacteria 1358
779 Ga0373961_0049152 3300035241 Bacteria 1245
780 Ga0373962_0001159 3300035242 Bacteria 6148
781 Ga0373962_0001592 3300035242 Bacteria 5383
782 Ga0373962_0005508 3300035242 Bacteria 3061
783 Ga0373924_0016852 3300035410 Bacteria 2795
784 Ga0373924_0031034 3300035410 Unclassified 2146
785 Ga0373924_0128360 3300035410 Bacteria 1102
786 Ga0373931_0002481 3300035691 Bacteria 8182
787 Ga0373931_0005853 3300035691 Bacteria 5720
788 Ga0373931_0021299 3300035691 Bacteria 3251
789 Ga0373931_0057316 3300035691 Bacteria 2089
790 Ga0373931_0243023 3300035691 Bacteria 1092
791 Ga0373931_0275962 3300035691 Unclassified 1030
792 Ga0373935_0036203 3300035692 Unclassified 3084
793 Ga0373935_0052998 3300035692 Bacteria 2580
794 Ga0373935_0231385 3300035692 Archaea 1287
795 Ga0373935_0313914 3300035692 Bacteria 1111
796 Ga0373935_0514641 3300035692 Bacteria 870
797 Ga0373927_0012644 3300035695 Bacteria 5615
798 Ga0373927_0020155 3300035695 Bacteria 4372
799 Ga0373927_0078654 3300035695 Bacteria 2136
800 Ga0373933_0016859 3300035724 Bacteria 4093
801 Ga0373933_0109696 3300035724 Bacteria 1720
802 Ga0373933_0569480 3300035724 Bacteria 743
803 Ga0373947_0008865 3300035725 Bacteria 5788
804 Ga0373947_0032120 3300035725 Bacteria 3092
805 Ga0373947_0059852 3300035725 Bacteria 2310
806 Ga0373947_0145125 3300035725 Bacteria 1525
807 Ga0373947_0194722 3300035725 Bacteria 1324
808 Ga0373947_0220392 3300035725 Bacteria 1247
809 Ga0373937_0019711 3300036401 Bacteria 6041
810 Ga0373937_0023451 3300036401 Bacteria 5555
811 Ga0373937_0024895 3300036401 Bacteria 5402
812 Ga0373937_0076963 3300036401 Unclassified 3082
813 Ga0373937_0256564 3300036401 Bacteria 1648
814 Ga0373937_1695984 3300036401 Archaea 579
815 Ga0373925_0022568 3300037068 Bacteria 4592
816 Ga0373925_0070220 3300037068 Unclassified 2647
817 Ga0373925_0260651 3300037068 Bacteria 1392
818 Ga0373925_0286607 3300037068 Bacteria 1327
819 Ga0373925_0529961 3300037068 Bacteria 968
820 Ga0395898_0246929 3300037466 Bacteria 1702
821 Ga0395905_0351661 3300037471 Bacteria 1366
822 Ga0395905_0396195 3300037471 Bacteria 1275
823 Ga0395901_0284993 3300038443 Unclassified 1716
824 Ga0436365_0046933 3300039437 Bacteria 9421
825 Ga0436363_0525343 3300039450 Bacteria 817
826 Ga0436363_1559933 3300039450 Bacteria 1304
827 Ga0436362_0203879 3300039453 Bacteria 809
828 Ga0439441_046799 3300042001 Bacteria 881
829 Ga0439443_094701 3300042003 Unclassified 567
830 Ga0439448_0069162 3300042005 Bacteria 1175
831 Ga0439463_047681 3300042016 Bacteria 1091
832 Ga0439458_0159579 3300042157 Bacteria 607
833 Ga0439460_0128340 3300042461 Bacteria 834
834 Ga0450893_0039090 3300042532 Bacteria 865
835 Ga0451577_0218048 3300042876 Bacteria 1724
836 Ga0453683_0831478 3300044673 Unclassified 609
837 Ga0453684_0238266 3300044712 Bacteria 2096
838 Ga0466968_0260058 3300044735 Bacteria 826
839 Ga0466960_1041151 3300044901 Bacteria 504
840 Ga0466959_0766255 3300045049 Bacteria 646
841 Ga0451576_2136156 3300045051 Unclassified 575
842 Ga0466958_1088289 3300045836 Bacteria 522
843 Ga0466967_0796528 3300045976 Bacteria 938
844 Ga0495617_142826 3300046452 Bacteria 764
845 Ga0495627_135117 3300046453 Unclassified 692
846 Ga0495592_0001183 3300046454 Bacteria 18097
847 Ga0495592_0013629 3300046454 Bacteria 6182
848 Ga0495603_0003568 3300046455 Bacteria 9267
849 Ga0495603_0042555 3300046455 Bacteria 2714
850 Ga0495603_0085688 3300046455 Unclassified 1844
851 Ga0495590_0160206 3300046457 Bacteria 818
852 Ga0495590_0255714 3300046457 Bacteria 652
853 Ga0495591_043569 3300046458 Bacteria 1262
854 Ga0495629_0000026 3300046459 Bacteria 134719
855 Ga0495629_0043412 3300046459 Bacteria 3156
856 Ga0495629_0135058 3300046459 Bacteria 1717
857 Ga0495629_0209850 3300046459 Bacteria 1345
858 Ga0495638_0019857 3300046460 Bacteria 4443
859 Ga0495641_0004477 3300046461 Bacteria 9850
860 Ga0495641_0017257 3300046461 Unclassified 3766
861 Ga0495641_0034677 3300046461 Bacteria 2384
862 Ga0495641_0079093 3300046461 Bacteria 1473
863 Ga0495651_0006473 3300046462 Bacteria 8952
864 Ga0495651_0014452 3300046462 Bacteria 6103
865 Ga0495651_0052676 3300046462 Bacteria 3134
866 Ga0495651_0260694 3300046462 Bacteria 1180
867 Ga0495651_0741785 3300046462 Bacteria 609
868 Ga0495653_0001127 3300046463 Bacteria 20582
869 Ga0495653_0006528 3300046463 Bacteria 9571
870 Ga0495653_0072619 3300046463 Unclassified 2569
871 Ga0495653_0084360 3300046463 Unclassified 2340
872 Ga0495653_0226283 3300046463 Bacteria 1254
873 Ga0495653_0360917 3300046463 Bacteria 932
874 Ga0495580_0027297 3300046472 Bacteria 4154
875 Ga0495580_0099536 3300046472 Unclassified 2022
876 Ga0495580_0565596 3300046472 Unclassified 754
877 Ga0495582_0010491 3300046473 Bacteria 5095
878 Ga0495582_0039184 3300046473 Bacteria 2609
879 Ga0495582_0058674 3300046473 Bacteria 2122
880 Ga0495582_0074588 3300046473 Bacteria 1878
881 Ga0495639_0010995 3300046475 Bacteria 3897
882 Ga0495639_0043613 3300046475 Unclassified 2026
883 Ga0495662_0007866 3300046476 Bacteria 5248
884 Ga0495662_0028788 3300046476 Bacteria 2682
885 Ga0495664_0016991 3300046477 Unclassified 4155
886 Ga0495664_0017341 3300046477 Bacteria 4114
887 Ga0495664_0356419 3300046477 Bacteria 880
888 Ga0495584_0027043 3300046491 Bacteria 2907
889 Ga0495584_0034116 3300046491 Unclassified 2575
890 Ga0495584_0392578 3300046491 Bacteria 705
891 Ga0495585_0002589 3300046492 Bacteria 12792
892 Ga0495594_0013609 3300046499 Unclassified 4250
893 Ga0495594_0015595 3300046499 Bacteria 3994
894 Ga0495594_0018783 3300046499 Bacteria 3666
895 Ga0495607_0019758 3300046501 Bacteria 4273
896 Ga0495583_0196776 3300046506 Bacteria 820
897 Ga0495608_0008807 3300046511 Bacteria 7061
898 Ga0495608_0015339 3300046511 Bacteria 5315
899 Ga0495608_0023222 3300046511 Bacteria 4251
900 Ga0495608_0031115 3300046511 Bacteria 3610
901 Ga0495608_0794781 3300046511 Bacteria 559
902 Ga0495618_0004629 3300046514 Bacteria 8424
903 Ga0495618_0020481 3300046514 Bacteria 4070
904 Ga0495618_0110135 3300046514 Bacteria 1763
905 Ga0495618_0275136 3300046514 Bacteria 1051
906 Ga0495628_0022323 3300046516 Bacteria 5199
907 Ga0495628_0073444 3300046516 Bacteria 2665
908 Ga0495630_0022981 3300046517 Bacteria 4607
909 Ga0495630_0038946 3300046517 Bacteria 3555
910 Ga0495630_0057264 3300046517 Bacteria 2921
911 Ga0495630_0434976 3300046517 Bacteria 1005
912 Ga0495630_0553755 3300046517 Unclassified 882
913 Ga0495630_0775097 3300046517 Bacteria 732
914 Ga0495631_0083763 3300046518 Bacteria 1374
915 Ga0495632_0343492 3300046519 Unclassified 657
916 Ga0495637_0234640 3300046520 Bacteria 664
917 Ga0495644_0006337 3300046523 Bacteria 4594
918 Ga0495663_0345211 3300046525 Unclassified 541
919 Ga0495666_0018297 3300046526 Bacteria 3487
920 Ga0495666_0067347 3300046526 Unclassified 1706
921 Ga0495652_0013358 3300046529 Bacteria 7390
922 Ga0495652_0019752 3300046529 Bacteria 5993
923 Ga0495652_0035091 3300046529 Bacteria 4366
924 Ga0495652_0048583 3300046529 Bacteria 3635
925 Ga0495665_0031973 3300046531 Bacteria 2815
926 Ga0495665_0223932 3300046531 Bacteria 972
927 Ga0495640_0011653 3300046533 Bacteria 6750
928 Ga0495640_0062867 3300046533 Bacteria 2516
929 Ga0495640_0069472 3300046533 Bacteria 2369
930 Ga0495640_0350314 3300046533 Bacteria 911
931 Ga0495586_0056472 3300046535 Bacteria 2129
932 Ga0495587_0002158 3300046536 Bacteria 13166
933 Ga0495587_0032108 3300046536 Bacteria 3176
934 Ga0495587_0066135 3300046536 Bacteria 2109
935 Ga0495609_0050504 3300046538 Unclassified 1854
936 Ga0495645_0000368 3300046543 Bacteria 31407
937 Ga0495645_0004873 3300046543 Bacteria 9173
938 Ga0495645_0378984 3300046543 Bacteria 905
939 Ga0495622_0041126 3300046557 Bacteria 2150
940 Ga0495667_0001963 3300046559 Bacteria 13617
941 Ga0495667_0004643 3300046559 Bacteria 9289
942 Ga0495667_0006737 3300046559 Bacteria 7795
943 Ga0495667_0080018 3300046559 Bacteria 2124
944 Ga0495667_0181805 3300046559 Bacteria 1349
945 Ga0495656_0013876 3300046615 Bacteria 3008
946 Ga0495634_0080755 3300046642 Bacteria 2127
947 Ga0495634_0110840 3300046642 Bacteria 1765
948 Ga0495611_0037029 3300046648 Bacteria 2167
949 Ga0495635_0011540 3300046663 Bacteria 6192
950 Ga0495635_0014610 3300046663 Bacteria 5492
951 Ga0495635_0036043 3300046663 Unclassified 3430
952 Ga0495635_0043829 3300046663 Unclassified 3086
953 Ga0495635_0070022 3300046663 Bacteria 2404
954 Ga0495659_0004803 3300046664 Bacteria 4253
955 Ga0495659_0272879 3300046664 Bacteria 709
956 Ga0495659_0451312 3300046664 Bacteria 560
957 Ga0495661_0108429 3300046665 Bacteria 1551
958 Ga0495588_0038816 3300046674 Bacteria 2423
959 Ga0495588_0199469 3300046674 Bacteria 1057
960 Ga0495588_0647046 3300046674 Unclassified 553
961 Ga0495657_0004096 3300046675 Bacteria 11690
962 Ga0495657_0048822 3300046675 Bacteria 2854
963 Ga0495657_0084119 3300046675 Unclassified 2053
964 Ga0495657_0359595 3300046675 Bacteria 860
965 Ga0495599_0036719 3300046678 Bacteria 3077
966 Ga0495599_0053395 3300046678 Unclassified 2531
967 Ga0495599_0060690 3300046678 Bacteria 2364
968 Ga0495599_0293491 3300046678 Bacteria 982
969 Ga0495623_0002369 3300046679 Bacteria 12531
970 Ga0495623_0002592 3300046679 Bacteria 11946
971 Ga0495646_0000441 3300046680 Bacteria 21965
972 Ga0495646_0001551 3300046680 Bacteria 13663
973 Ga0495647_0005283 3300046681 Bacteria 4228
974 Ga0495647_0070237 3300046681 Bacteria 1400
975 Ga0495647_0115474 3300046681 Bacteria 1124
976 Ga0495658_0001832 3300046683 Bacteria 10877
977 Ga0495658_0002039 3300046683 Bacteria 10282
978 Ga0495658_0030197 3300046683 Bacteria 2941
979 Ga0495658_0449558 3300046683 Bacteria 823
980 Ga0495669_0101694 3300046684 Unclassified 1335
981 Ga0495669_0199410 3300046684 Bacteria 956
982 Ga0495613_0045559 3300046689 Bacteria 3243
983 Ga0495613_0056219 3300046689 Bacteria 2889
984 Ga0495613_0244292 3300046689 Bacteria 1254
985 Ga0495613_0304554 3300046689 Bacteria 1102
986 Ga0495624_0007737 3300046690 Bacteria 7539
987 Ga0495670_0001358 3300046691 Bacteria 11948
988 Ga0495671_0044870 3300046692 Bacteria 2215
989 Ga0495589_0134346 3300046794 Bacteria 1187
990 Ga0495589_0290541 3300046794 Bacteria 759
991 Ga0495600_0014244 3300046809 Bacteria 5010
992 Ga0495600_0062857 3300046809 Unclassified 2426
993 Ga0495600_0063449 3300046809 Unclassified 2414
994 Ga0495600_0145651 3300046809 Bacteria 1535
995 Ga0495581_0004822 3300047315 Bacteria 7802
996 Ga0495581_0020165 3300047315 Bacteria 3870
997 Ga0495581_0166135 3300047315 Bacteria 1290
998 Ga0495581_0236563 3300047315 Bacteria 1068
999 Ga0495604_0012226 3300047317 Bacteria 6824
1000 Ga0495604_0027565 3300047317 Bacteria 4516
1001 Ga0495604_0033318 3300047317 Bacteria 4079
1002 Ga0495604_0100659 3300047317 Unclassified 2124
1003 Ga0495674_0018822 3300047319 Bacteria 6422
1004 Ga0495674_0032302 3300047319 Unclassified 4748
1005 Ga0495674_0043888 3300047319 Bacteria 3976
1006 Ga0495674_0115171 3300047319 Bacteria 2275
1007 Ga0495676_0023279 3300047321 Bacteria 5379
1008 Ga0495676_0033941 3300047321 Bacteria 4287
1009 Ga0495676_0073019 3300047321 Unclassified 2632
1010 Ga0495680_0001148 3300047322 Bacteria 29161
1011 Ga0495680_0002496 3300047322 Bacteria 18808
1012 Ga0495680_0002890 3300047322 Bacteria 17261
1013 Ga0495680_0217076 3300047322 Unclassified 1367
1014 Ga0495675_0000903 3300047444 Bacteria 18076
1015 Ga0495675_0020171 3300047444 Unclassified 4237
1016 Ga0495675_0484990 3300047444 Bacteria 711
1017 Ga0495679_036582 3300047446 Bacteria 1550
1018 Ga0495684_0001561 3300047471 Bacteria 18335
1019 Ga0495684_0055037 3300047471 Unclassified 3034
1020 Ga0495684_0214014 3300047471 Bacteria 1416
1021 Ga0495593_0003976 3300047673 Bacteria 8822
1022 Ga0495593_0024539 3300047673 Bacteria 3341
1023 Ga0495593_0116059 3300047673 Bacteria 1364
1024 Ga0495593_0339025 3300047673 Bacteria 751
1025 Ga0495593_0367113 3300047673 Bacteria 719
1026 Ga0495602_0007794 3300048088 Bacteria 11193
1027 Ga0495602_0015488 3300048088 Bacteria 7693
1028 Ga0495602_0154194 3300048088 Bacteria 1801
1029 Ga0495602_0489886 3300048088 Bacteria 861
1030 Ga0495614_0012956 3300048089 Bacteria 3656
1031 Ga0495614_0181055 3300048089 Bacteria 948
1032 Ga0495626_0305292 3300048091 Bacteria 628
1033 Ga0496100_0027252 3300048903 Unclassified 3512
1034 Ga0496100_0071984 3300048903 Bacteria 2309
1035 Ga0496100_0583208 3300048903 Bacteria 867
1036 Ga0496101_0024341 3300048904 Bacteria 4189
1037 Ga0496101_0087092 3300048904 Bacteria 2317
1038 Ga0496101_0209750 3300048904 Bacteria 1509
1039 Ga0496101_1178789 3300048904 Bacteria 600
1040 Ga0496102_0078981 3300048905 Unclassified 3030
1041 Ga0496102_0134912 3300048905 Bacteria 2312
1042 Ga0496102_0172942 3300048905 Bacteria 2033
1043 Ga0496102_0290975 3300048905 Bacteria 1539
1044 Ga0496102_0416756 3300048905 Unclassified 1261
1045 Ga0496102_0815164 3300048905 Bacteria 855
1046 Ga0496103_0014204 3300048906 Bacteria 4727
1047 Ga0496103_0041169 3300048906 Unclassified 2839
1048 Ga0496103_0114562 3300048906 Bacteria 1714
1049 Ga0496104_0036888 3300048907 Unclassified 4570
1050 Ga0496104_0082659 3300048907 Bacteria 3063
1051 Ga0496104_0086099 3300048907 Unclassified 3000
1052 Ga0496104_0158062 3300048907 Bacteria 2175
1053 Ga0496104_0174253 3300048907 Bacteria 2061
1054 Ga0496104_0723911 3300048907 Bacteria 902
1055 Ga0496104_1216550 3300048907 Bacteria 656
1056 Ga0496105_0053793 3300048908 Bacteria 3324
1057 Ga0496105_0054998 3300048908 Bacteria 3286
1058 Ga0496105_0059853 3300048908 Bacteria 3143
1059 Ga0496105_0072068 3300048908 Bacteria 2855
1060 Ga0496105_0108773 3300048908 Bacteria 2289
1061 Ga0496106_0012080 3300048909 Bacteria 6373
1062 Ga0496106_0014266 3300048909 Bacteria 5870
1063 Ga0496106_0028485 3300048909 Bacteria 4160
1064 Ga0496106_0092323 3300048909 Bacteria 2338
1065 Ga0496106_0210637 3300048909 Unclassified 1548
1066 Ga0496107_0017646 3300048910 Bacteria 5020
1067 Ga0496107_0386979 3300048910 Bacteria 1040
1068 Ga0496108_0008337 3300048911 Bacteria 8406
1069 Ga0496108_0024695 3300048911 Unclassified 4950
1070 Ga0496108_0202868 3300048911 Bacteria 1721
1071 Ga0496108_0204929 3300048911 Bacteria 1711
1072 Ga0496109_0001436 3300048912 Archaea 19764
1073 Ga0496109_0010380 3300048912 Bacteria 7954
1074 Ga0496109_0202885 3300048912 Bacteria 1864
1075 Ga0496109_0279765 3300048912 Bacteria 1572
1076 Ga0496110_0028055 3300048913 Bacteria 4831
1077 Ga0496110_0032476 3300048913 Bacteria 4509
1078 Ga0496110_0076100 3300048913 Bacteria 2983
1079 Ga0496110_0267254 3300048913 Bacteria 1557
1080 Ga0496110_0517767 3300048913 Bacteria 1085
1081 Ga0496110_0635743 3300048913 Bacteria 966
1082 Ga0496111_0186539 3300048914 Bacteria 1542
1083 Ga0496111_0241987 3300048914 Bacteria 1340
1084 Ga0496111_0282733 3300048914 Bacteria 1230
1085 Ga0496111_0284447 3300048914 Bacteria 1226
1086 Ga0496112_0000023 3300048915 Bacteria 156144
1087 Ga0496112_0086430 3300048915 Unclassified 3102
1088 Ga0496112_0139851 3300048915 Bacteria 2390
1089 Ga0496112_0216278 3300048915 Unclassified 1873
1090 Ga0496112_0358637 3300048915 Bacteria 1400
1091 Ga0496112_0491151 3300048915 Bacteria 1163
1092 Ga0496112_1232522 3300048915 Unclassified 664
1093 Ga0496112_1288034 3300048915 Unclassified 647
1094 Ga0496113_0016976 3300048916 Bacteria 5041
1095 Ga0496113_0099376 3300048916 Bacteria 2253
1096 Ga0496113_0162329 3300048916 Bacteria 1767
1097 Ga0496113_0249286 3300048916 Bacteria 1417
1098 Ga0496113_0362223 3300048916 Bacteria 1163
1099 Ga0496114_0019963 3300048917 Bacteria 5436
1100 Ga0496114_0027029 3300048917 Bacteria 4700
1101 Ga0496115_0014263 3300048918 Bacteria 6017
1102 Ga0496115_0072542 3300048918 Bacteria 2793
1103 Ga0496115_0078506 3300048918 Bacteria 2686
1104 Ga0496115_0100020 3300048918 Bacteria 2377
1105 Ga0496115_0157288 3300048918 Bacteria 1877
1106 Ga0496115_0246812 3300048918 Unclassified 1470
1107 Ga0496115_0463221 3300048918 Unclassified 1022
1108 Ga0496124_0196048 3300048927 Bacteria 1541
1109 Ga0501031_0119167 3300049568 Bacteria 1724
1110 Ga0501031_0481184 3300049568 Bacteria 801
1111 Ga0501031_0505265 3300049568 Bacteria 779
1112 Ga0501032_0013494 3300049569 Bacteria 5810
1113 Ga0501032_0030048 3300049569 Bacteria 3727
1114 Ga0501032_0030495 3300049569 Bacteria 3700
1115 Ga0501032_0041695 3300049569 Bacteria 3116
1116 Ga0501032_0113306 3300049569 Bacteria 1794
1117 Ga0501032_0893611 3300049569 Bacteria 559
1118 Ga0501033_0018177 3300049570 Bacteria 5312
1119 Ga0501033_0022037 3300049570 Bacteria 4806
1120 Ga0501033_0817258 3300049570 Bacteria 629
1121 Ga0501034_0000119 3300049571 Bacteria 144440
1122 Ga0501034_0000295 3300049571 Bacteria 88435
1123 Ga0501034_0046962 3300049571 Bacteria 4362
1124 Ga0501034_0061324 3300049571 Bacteria 3776
1125 Ga0501034_0094059 3300049571 Bacteria 2994
1126 Ga0501034_0125461 3300049571 Bacteria 2552
1127 Ga0501034_0132868 3300049571 Bacteria 2471
1128 Ga0501034_0162892 3300049571 Bacteria 2200
1129 Ga0501034_0164017 3300049571 Bacteria 2191
1130 Ga0501034_0207434 3300049571 Bacteria 1915
1131 Ga0501034_0215679 3300049571 Unclassified 1873
1132 Ga0501034_0484717 3300049571 Bacteria 1151
1133 Ga0501034_1135518 3300049571 Unclassified 661
1134 Ga0501036_0000217 3300049572 Bacteria 38514
1135 Ga0501036_0015649 3300049572 Bacteria 6336
1136 Ga0501036_0085226 3300049572 Bacteria 2670
1137 Ga0501036_0125828 3300049572 Bacteria 2164
1138 Ga0501037_0005649 3300049573 Bacteria 9113
1139 Ga0501037_0030885 3300049573 Bacteria 3957
1140 Ga0501037_0102725 3300049573 Unclassified 2061
1141 Ga0501037_0181847 3300049573 Bacteria 1491
1142 Ga0501037_0599332 3300049573 Bacteria 740
1143 Ga0501037_1032467 3300049573 Bacteria 534
1144 Ga0501038_0059504 3300049574 Bacteria 3272
1145 Ga0501038_0066167 3300049574 Bacteria 3078
1146 Ga0501038_0070026 3300049574 Bacteria 2978
1147 Ga0501038_0161604 3300049574 Bacteria 1820
1148 Ga0501038_0589856 3300049574 Bacteria 842
1149 Ga0501039_0029800 3300049575 Bacteria 4204
1150 Ga0501039_0032655 3300049575 Bacteria 4014
1151 Ga0501039_0107130 3300049575 Bacteria 2183
1152 Ga0501039_0369114 3300049575 Unclassified 1127
1153 Ga0501040_0201463 3300049576 Bacteria 1413
1154 Ga0501041_0114873 3300049577 Bacteria 1671
1155 Ga0501042_0052453 3300049578 Bacteria 2909
1156 Ga0501042_0421525 3300049578 Bacteria 967
1157 Ga0501043_0003332 3300049579 Bacteria 13236
1158 Ga0501043_0017020 3300049579 Bacteria 5699
1159 Ga0501043_0017410 3300049579 Bacteria 5633
1160 Ga0501043_0026456 3300049579 Bacteria 4551
1161 Ga0501043_0071282 3300049579 Bacteria 2729
1162 Ga0501046_0015683 3300049580 Bacteria 6361
1163 Ga0501046_0062038 3300049580 Bacteria 2921
1164 Ga0501046_0116958 3300049580 Bacteria 2031
1165 Ga0501046_0338984 3300049580 Bacteria 1093
1166 Ga0501046_0361638 3300049580 Bacteria 1052
1167 Ga0501047_0000382 3300049581 Bacteria 49844
1168 Ga0501047_0059632 3300049581 Bacteria 3684
1169 Ga0501047_0084933 3300049581 Bacteria 3042
1170 Ga0501047_0104436 3300049581 Bacteria 2713
1171 Ga0501047_0161333 3300049581 Bacteria 2113
1172 Ga0501047_0187580 3300049581 Bacteria 1932
1173 Ga0501047_0271364 3300049581 Bacteria 1542
1174 Ga0501047_0353268 3300049581 Bacteria 1306
1175 Ga0501047_1084058 3300049581 Unclassified 614
1176 Ga0501048_0000031 3300049582 Bacteria 65561
1177 Ga0501048_0378917 3300049582 Bacteria 1010
1178 Ga0501048_0522484 3300049582 Bacteria 851
1179 Ga0501048_0773744 3300049582 Bacteria 689
1180 Ga0501067_0125630 3300049583 Bacteria 1427
1181 Ga0501067_0370555 3300049583 Bacteria 798
1182 Ga0501068_0014827 3300049584 Bacteria 4462
1183 Ga0501068_0299919 3300049584 Bacteria 1028
1184 Ga0501068_0509073 3300049584 Bacteria 781
1185 Ga0501068_1032069 3300049584 Bacteria 543
1186 Ga0501069_0005180 3300049585 Bacteria 6775
1187 Ga0501069_0085153 3300049585 Bacteria 1783
1188 Ga0501069_0235418 3300049585 Bacteria 1067
1189 Ga0501069_0317846 3300049585 Bacteria 914
1190 Ga0501069_0327607 3300049585 Bacteria 900
1191 Ga0501070_0001016 3300049586 Bacteria 25196
1192 Ga0501070_0002811 3300049586 Bacteria 15192
1193 Ga0501070_0013957 3300049586 Bacteria 6763
1194 Ga0501070_0021765 3300049586 Bacteria 5373
1195 Ga0501070_0029649 3300049586 Bacteria 4586
1196 Ga0501070_0057042 3300049586 Bacteria 3237
1197 Ga0501070_0069542 3300049586 Bacteria 2914
1198 Ga0501070_0089361 3300049586 Bacteria 2549
1199 Ga0501070_0118139 3300049586 Unclassified 2191
1200 Ga0501070_0121700 3300049586 Bacteria 2157
1201 Ga0501070_0982427 3300049586 Bacteria 655
1202 Ga0501070_1172421 3300049586 Bacteria 590
1203 Ga0501071_0030320 3300049587 Bacteria 3825
1204 Ga0501071_0154038 3300049587 Bacteria 1715
1205 Ga0501071_0293684 3300049587 Bacteria 1231
1206 Ga0501071_0663926 3300049587 Bacteria 802
1207 Ga0501072_0022803 3300049588 Bacteria 4858
1208 Ga0501072_0074818 3300049588 Bacteria 2678
1209 Ga0501072_0177808 3300049588 Bacteria 1697
1210 Ga0501073_0080667 3300049589 Bacteria 2263
1211 Ga0501073_0224668 3300049589 Bacteria 1297
1212 Ga0501074_0008300 3300049590 Bacteria 7529
1213 Ga0501074_0185035 3300049590 Bacteria 1485
1214 Ga0501074_0211463 3300049590 Bacteria 1382
1215 Ga0501074_0262757 3300049590 Bacteria 1227
1216 Ga0501074_1219601 3300049590 Bacteria 527
1217 Ga0501075_0077296 3300049591 Bacteria 2519
1218 Ga0501075_0616665 3300049591 Bacteria 827
1219 Ga0501076_0032448 3300049592 Bacteria 4076
1220 Ga0501076_0177319 3300049592 Bacteria 1737
1221 Ga0501076_0882470 3300049592 Bacteria 737
1222 Ga0501077_0404604 3300049593 Bacteria 873
1223 Ga0501077_1018955 3300049593 Bacteria 533
1224 Ga0501079_0067849 3300049741 Bacteria 2752
1225 Ga0501079_0118458 3300049741 Bacteria 2058
1226 Ga0501079_0576486 3300049741 Bacteria 885
1227 Ga0501079_1070154 3300049741 Bacteria 635
1228 Ga0501080_0000478 3300049742 Bacteria 31148
1229 Ga0501080_0018449 3300049742 Bacteria 6457
1230 Ga0501080_0044744 3300049742 Bacteria 4120
1231 Ga0501080_0060557 3300049742 Bacteria 3524
1232 Ga0501080_0078605 3300049742 Bacteria 3067
1233 Ga0501080_0079462 3300049742 Bacteria 3049
1234 Ga0501080_0102716 3300049742 Bacteria 2651
1235 Ga0501080_0182341 3300049742 Bacteria 1931
1236 Ga0501080_0363174 3300049742 Bacteria 1306
1237 Ga0501080_0598674 3300049742 Bacteria 979
1238 Ga0501081_0251132 3300049743 Bacteria 1291
1239 Ga0501081_0335301 3300049743 Bacteria 1113
1240 Ga0501083_0002087 3300049744 Bacteria 13749
1241 Ga0501083_0028276 3300049744 Bacteria 3865
1242 Ga0501083_0035143 3300049744 Bacteria 3424
1243 Ga0501083_0080311 3300049744 Bacteria 2162
1244 Ga0501083_0162264 3300049744 Bacteria 1462
1245 Ga0501083_0333830 3300049744 Unclassified 986
1246 Ga0501083_0562825 3300049744 Bacteria 742
1247 Ga0501035_0000459 3300049822 Bacteria 45702
1248 Ga0501035_0069186 3300049822 Bacteria 3130
1249 Ga0501035_0098973 3300049822 Bacteria 2560
1250 Ga0501035_0137123 3300049822 Bacteria 2129
1251 Ga0501035_0229742 3300049822 Bacteria 1581
1252 Ga0501035_0281305 3300049822 Bacteria 1406
1253 Ga0501035_0282365 3300049822 Bacteria 1403
1254 Ga0501035_0746128 3300049822 Unclassified 786
1255 Ga0501044_0001546 3300049823 Bacteria 26990
1256 Ga0501044_0056322 3300049823 Bacteria 4036
1257 Ga0501044_0059115 3300049823 Bacteria 3929
1258 Ga0501044_0108606 3300049823 Bacteria 2784
1259 Ga0501044_0130294 3300049823 Bacteria 2509
1260 Ga0501044_1031473 3300049823 Bacteria 693
1261 Ga0501045_0174348 3300049824 Bacteria 1602
1262 Ga0501045_0273225 3300049824 Unclassified 1258
1263 Ga0501045_0405780 3300049824 Bacteria 1014
1264 nmdc:mga00v17_745321_c1 3300050491 Bacteria 626
1265 nmdc:mga0yw44_762946_c1 3300050492 Bacteria 657
1266 nmdc:mga0k408_234956_c1 3300050493 Unclassified 1094
1267 nmdc:mga0k408_525763_c1 3300050493 Bacteria 700
1268 nmdc:mga06z11_191541_c1 3300050494 Unclassified 1184
1269 nmdc:mga06z11_488795_c1 3300050494 Bacteria 745
1270 nmdc:mga06z11_699022_c1 3300050494 Bacteria 618
1271 nmdc:mga07m45_54632_c1 3300050496 Unclassified 2256
1272 nmdc:mga05p37_129_c1 3300050507 Bacteria 45745
1273 nmdc:mga05p37_1332594_c1 3300050507 Bacteria 729
1274 nmdc:mga05p37_3739_c1 3300050507 Bacteria 17810
1275 nmdc:mga05p37_87159_c1 3300050507 Bacteria 3848
1276 nmdc:mga09592_4639_c1 3300050508 Bacteria 11130
1277 nmdc:mga09592_756120_c1 3300050508 Bacteria 824
1278 nmdc:mga0qj67_18305_c1 3300050509 Bacteria 5339
1279 nmdc:mga0qj67_325904_c1 3300050509 Bacteria 1243
1280 nmdc:mga06r32_1011_c1 3300050510 Bacteria 25250
1281 nmdc:mga06r32_286080_c1 3300050510 Bacteria 1635
1282 nmdc:mga08y16_30886_c1 3300050511 Bacteria 5634
1283 nmdc:mga08y16_4019_c1 3300050511 Bacteria 15342
1284 nmdc:mga08y16_52584_c1 3300050511 Bacteria 4261
1285 nmdc:mga08y16_546919_c1 3300050511 Bacteria 1172
1286 nmdc:mga08y16_781_c1 3300050511 Archaea 30392
1287 nmdc:mga0n895_1756_c1 3300050512 Bacteria 16406
1288 nmdc:mga0n895_18346_c1 3300050512 Bacteria 6471
1289 nmdc:mga0n895_19530_c1 3300050512 Bacteria 6301
1290 nmdc:mga0n895_210845_c1 3300050512 Bacteria 1973
1291 nmdc:mga0n895_35585_c1 3300050512 Bacteria 4802
1292 nmdc:mga0n895_399608_c1 3300050512 Unclassified 1390
1293 nmdc:mga0n895_557068_c1 3300050512 Bacteria 1152
1294 nmdc:mga0n895_896826_c1 3300050512 Bacteria 872
1295 nmdc:mga0rr50_1485625_c1 3300050513 Unclassified 573
1296 nmdc:mga0rr50_175461_c1 3300050513 Bacteria 1749
1297 nmdc:mga0rr50_19890_c1 3300050513 Bacteria 4544
1298 nmdc:mga0rr50_20798_c1 3300050513 Unclassified 4465
1299 nmdc:mga0rr50_31595_c1 3300050513 Bacteria 3763
1300 nmdc:mga08x19_71606_c1 3300050514 Bacteria 2260
1301 nmdc:mga08x19_791780_c1 3300050514 Bacteria 673
1302 nmdc:mga0a205_106614_c1 3300050515 Bacteria 2700
1303 nmdc:mga0a205_268898_c1 3300050515 Bacteria 1582
1304 nmdc:mga0a205_3891_c1 3300050515 Bacteria 13369
1305 nmdc:mga0a205_6374_c1 3300050515 Bacteria 10660
1306 Ga0495601_0000152 3300053077 Bacteria 38651
1307 Ga0495601_0001120 3300053077 Bacteria 14681
1308 Ga0495601_0004716 3300053077 Bacteria 7902
1309 Ga0495601_0042180 3300053077 Bacteria 2862
1310 Ga0495612_0002232 3300053078 Bacteria 7962
1311 Ga0495612_0024989 3300053078 Bacteria 2398
1312 Ga0495612_0115074 3300053078 Unclassified 1154
1313 Ga0495612_0211842 3300053078 Bacteria 856
1314 Ga0495595_0001653 3300053084 Bacteria 8722
1315 Ga0495595_0001962 3300053084 Bacteria 7990
1316 Ga0495595_0002054 3300053084 Bacteria 7834
1317 Ga0495595_0006148 3300053084 Bacteria 4881
1318 Ga0495595_0210316 3300053084 Bacteria 969
1319 Ga0495619_0000115 3300053085 Bacteria 58866
1320 Ga0495619_0000544 3300053085 Bacteria 24920
1321 Ga0495619_0003936 3300053085 Bacteria 9545
1322 Ga0495619_0005898 3300053085 Bacteria 7761
1323 Ga0495619_0012555 3300053085 Bacteria 5334
1324 Ga0495619_0373407 3300053085 Bacteria 985
1325 Ga0500643_024790 3300053087 Bacteria 1899
1326 Ga0500644_0000392 3300053088 Bacteria 21030
1327 Ga0500566_0091316 3300053094 Bacteria 1683
1328 Ga0500566_0116725 3300053094 Bacteria 1444
1329 Ga0500595_000003 3300053119 Bacteria 419332
1330 Ga0500642_0087265 3300053130 Unclassified 1439
1331 Ga0500616_0000002 3300053153 Bacteria 1611257
1332 Ga0500616_0064588 3300053153 Bacteria 1884
1333 Ga0500657_214389 3300053728 Bacteria 620
1334 Ga0500645_000969 3300053730 Bacteria 16306
1335 Ga0501084_0145205 3300054114 Bacteria 1998
1336 Ga0501084_0172689 3300054114 Bacteria 1825
1337 Ga0501084_0172937 3300054114 Bacteria 1823
1338 Ga0501084_0224315 3300054114 Bacteria 1586
1339 Ga0501084_1647527 3300054114 Bacteria 536
1340 Ga0501082_0105773 3300060353 Bacteria 2434
1341 Ga0501082_0165273 3300060353 Bacteria 1923
1342 Ga0501082_0195920 3300060353 Bacteria 1758
1343 Ga0501082_0784768 3300060353 Bacteria 833
1344 Ga0501082_1065656 3300060353 Bacteria 707
1345 Ga0530510_0487866 3300061734 Bacteria 934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_1032467 Ga0501037_1032467_24_320 95
2 3300049574 Ga0501038_0589856 Ga0501038_0589856_410_760 113
3 3300049581 Ga0501047_0353268 Ga0501047_0353268_916_1275 116
4 3300045049 Ga0466959_0766255 Ga0466959_0766255_48_431 117
5 3300035083 Ga0373926_0026246 Ga0373926_0026246_648_1043 118
6 3300035111 Ga0373923_0045342 Ga0373923_0045342_1359_1715 118
7 3300035116 Ga0373945_0187170 Ga0373945_0187170_347_742 118
8 3300035117 Ga0373953_0032880 Ga0373953_0032880_389_745 118
9 3300035171 Ga0373946_0129461 Ga0373946_0129461_453_848 118
10 3300035172 Ga0373955_0003402 Ga0373955_0003402_1571_1927 118
11 3300035692 Ga0373935_0231385 Ga0373935_0231385_44_400 118
12 3300035692 Ga0373935_0514641 Ga0373935_0514641_363_758 118
13 3300035695 Ga0373927_0012644 Ga0373927_0012644_1691_2086 118
14 3300035724 Ga0373933_0109696 Ga0373933_0109696_672_1028 118
15 3300035725 Ga0373947_0145125 Ga0373947_0145125_972_1367 118
16 3300035725 Ga0373947_0194722 Ga0373947_0194722_641_997 118
17 3300036401 Ga0373937_0076963 Ga0373937_0076963_246_602 118
18 3300036401 Ga0373937_1695984 Ga0373937_1695984_194_550 118
19 3300037068 Ga0373925_0070220 Ga0373925_0070220_1336_1692 118
20 3300037068 Ga0373925_0286607 Ga0373925_0286607_746_1141 118
21 3300046454 Ga0495592_0001183 Ga0495592_0001183_2412_2768 118
22 3300046461 Ga0495641_0079093 Ga0495641_0079093_434_790 118
23 3300046462 Ga0495651_0052676 Ga0495651_0052676_1777_2133 118
24 3300046463 Ga0495653_0084360 Ga0495653_0084360_1356_1712 118
25 3300046473 Ga0495582_0039184 Ga0495582_0039184_380_775 118
26 3300046511 Ga0495608_0008807 Ga0495608_0008807_6052_6408 118
27 3300046516 Ga0495628_0022323 Ga0495628_0022323_4321_4677 118
28 3300046517 Ga0495630_0057264 Ga0495630_0057264_436_831 118
29 3300046529 Ga0495652_0013358 Ga0495652_0013358_2102_2458 118
30 3300046533 Ga0495640_0350314 Ga0495640_0350314_440_796 118
31 3300046536 Ga0495587_0032108 Ga0495587_0032108_1924_2280 118
32 3300046543 Ga0495645_0000368 Ga0495645_0000368_30144_30500 118
33 3300046559 Ga0495667_0006737 Ga0495667_0006737_2508_2864 118
34 3300046663 Ga0495635_0036043 Ga0495635_0036043_2793_3149 118
35 3300046675 Ga0495657_0359595 Ga0495657_0359595_195_551 118
36 3300046678 Ga0495599_0053395 Ga0495599_0053395_826_1182 118
37 3300046679 Ga0495623_0002592 Ga0495623_0002592_9607_9963 118
38 3300046681 Ga0495647_0115474 Ga0495647_0115474_372_767 118
39 3300046683 Ga0495658_0030197 Ga0495658_0030197_1591_1986 118
40 3300046683 Ga0495658_0449558 Ga0495658_0449558_336_692 118
41 3300046809 Ga0495600_0063449 Ga0495600_0063449_493_849 118
42 3300047315 Ga0495581_0236563 Ga0495581_0236563_171_566 118
43 3300047317 Ga0495604_0012226 Ga0495604_0012226_3626_3982 118
44 3300047322 Ga0495680_0001148 Ga0495680_0001148_9463_9819 118
45 3300047444 Ga0495675_0020171 Ga0495675_0020171_2729_3085 118
46 3300047471 Ga0495684_0214014 Ga0495684_0214014_171_527 118
47 3300048088 Ga0495602_0007794 Ga0495602_0007794_3386_3742 118
48 3300048908 Ga0496105_0059853 Ga0496105_0059853_1592_1948 118
49 3300048918 Ga0496115_0100020 Ga0496115_0100020_654_1010 118
50 3300053077 Ga0495601_0000152 Ga0495601_0000152_3495_3851 118
51 3300053078 Ga0495612_0002232 Ga0495612_0002232_3679_4035 118
52 3300053084 Ga0495595_0006148 Ga0495595_0006148_2631_2987 118
53 3300053085 Ga0495619_0005898 Ga0495619_0005898_4077_4433 118
54 3300025972 Ga0207668_10696600 Ga0207668_106966002 120
55 3300034957 Ga0373938_0224189 Ga0373938_0224189_58_420 120
56 3300035084 Ga0373928_0116298 Ga0373928_0116298_261_623 120
57 3300035089 Ga0373944_0014141 Ga0373944_0014141_112_474 120
58 3300035725 Ga0373947_0032120 Ga0373947_0032120_700_1062 120
59 3300045836 Ga0466958_1088289 Ga0466958_1088289_72_440 120
60 3300046455 Ga0495603_0085688 Ga0495603_0085688_489_851 120
61 3300046461 Ga0495641_0017257 Ga0495641_0017257_2177_2539 120
62 3300046472 Ga0495580_0099536 Ga0495580_0099536_1527_1889 120
63 3300046473 Ga0495582_0074588 Ga0495582_0074588_208_570 120
64 3300046499 Ga0495594_0013609 Ga0495594_0013609_1654_2016 120
65 3300046526 Ga0495666_0067347 Ga0495666_0067347_991_1353 120
66 3300046529 Ga0495652_0048583 Ga0495652_0048583_144_506 120
67 3300046533 Ga0495640_0062867 Ga0495640_0062867_521_883 120
68 3300046663 Ga0495635_0043829 Ga0495635_0043829_34_396 120
69 3300047315 Ga0495581_0166135 Ga0495581_0166135_257_619 120
70 3300048089 Ga0495614_0181055 Ga0495614_0181055_516_878 120
71 3300025931 Ga0207644_10527619 Ga0207644_105276192 124
72 3300035086 Ga0373934_0057413 Ga0373934_0057413_877_1275 124
73 3300035119 Ga0373956_0008045 Ga0373956_0008045_3436_3834 124
74 3300035410 Ga0373924_0031034 Ga0373924_0031034_1191_1589 124
75 3300035724 Ga0373933_0569480 Ga0373933_0569480_228_626 124
76 3300046514 Ga0495618_0004629 Ga0495618_0004629_6147_6545 124
77 3300046529 Ga0495652_0019752 Ga0495652_0019752_5508_5906 124
78 3300046559 Ga0495667_0004643 Ga0495667_0004643_4868_5266 124
79 3300046809 Ga0495600_0062857 Ga0495600_0062857_1607_2005 124
80 3300047471 Ga0495684_0055037 Ga0495684_0055037_1362_1760 124
81 3300048907 Ga0496104_0723911 Ga0496104_0723911_417_815 124
82 3300053085 Ga0495619_0373407 Ga0495619_0373407_460_858 124
83 3300005329 Ga0070683_100134501 Ga0070683_1001345012 126
84 3300005616 Ga0068852_102653265 Ga0068852_1026532651 126
85 3300009551 Ga0105238_10358086 Ga0105238_103580862 126
86 3300014325 Ga0163163_10405829 Ga0163163_104058292 126
87 3300014968 Ga0157379_10263871 Ga0157379_102638711 126
88 3300035117 Ga0373953_0006233 Ga0373953_0006233_262_660 126
89 3300035118 Ga0373954_0016722 Ga0373954_0016722_1792_2190 126
90 3300036401 Ga0373937_0023451 Ga0373937_0023451_1262_1660 126
91 3300046462 Ga0495651_0006473 Ga0495651_0006473_6603_7001 126
92 3300046463 Ga0495653_0006528 Ga0495653_0006528_6130_6528 126
93 3300046477 Ga0495664_0017341 Ga0495664_0017341_1550_1948 126
94 3300046511 Ga0495608_0015339 Ga0495608_0015339_1169_1567 126
95 3300046517 Ga0495630_0022981 Ga0495630_0022981_2158_2556 126
96 3300046533 Ga0495640_0011653 Ga0495640_0011653_1537_1935 126
97 3300046536 Ga0495587_0002158 Ga0495587_0002158_3209_3607 126
98 3300046543 Ga0495645_0004873 Ga0495645_0004873_6116_6514 126
99 3300046663 Ga0495635_0011540 Ga0495635_0011540_5572_5970 126
100 3300046664 Ga0495659_0451312 Ga0495659_0451312_65_445 126
101 3300046675 Ga0495657_0004096 Ga0495657_0004096_8631_9029 126
102 3300046678 Ga0495599_0036719 Ga0495599_0036719_679_1077 126
103 3300046679 Ga0495623_0002369 Ga0495623_0002369_4041_4439 126
104 3300046680 Ga0495646_0001551 Ga0495646_0001551_2362_2760 126
105 3300046689 Ga0495613_0304554 Ga0495613_0304554_613_1011 126
106 3300047317 Ga0495604_0027565 Ga0495604_0027565_223_621 126
107 3300047319 Ga0495674_0018822 Ga0495674_0018822_4024_4422 126
108 3300047322 Ga0495680_0002890 Ga0495680_0002890_8779_9177 126
109 3300047444 Ga0495675_0000903 Ga0495675_0000903_11751_12149 126
110 3300047673 Ga0495593_0116059 Ga0495593_0116059_943_1341 126
111 3300048088 Ga0495602_0015488 Ga0495602_0015488_4822_5220 126
112 3300053084 Ga0495595_0002054 Ga0495595_0002054_1262_1660 126
113 3300053728 Ga0500657_214389 Ga0500657_214389_104_502 126
114 3300009094 Ga0111539_10120763 Ga0111539_101207632 127
115 3300049571 Ga0501034_0215679 Ga0501034_0215679_1300_1683 127
116 3300049585 Ga0501069_0235418 Ga0501069_0235418_154_540 127
117 3300049586 Ga0501070_0118139 Ga0501070_0118139_1364_1747 127
118 3300049822 Ga0501035_0282365 Ga0501035_0282365_313_696 127
119 3300050493 nmdc:mga0k408_525763_c1 nmdc:mga0k408_525763_c1_32_433 127
120 3300050508 nmdc:mga09592_756120_c1 nmdc:mga09592_756120_c1_246_647 127
121 3300050510 nmdc:mga06r32_286080_c1 nmdc:mga06r32_286080_c1_436_837 127
122 3300050511 nmdc:mga08y16_52584_c1 nmdc:mga08y16_52584_c1_226_627 127
123 3300050512 nmdc:mga0n895_18346_c1 nmdc:mga0n895_18346_c1_423_824 127
124 3300050515 nmdc:mga0a205_106614_c1 nmdc:mga0a205_106614_c1_1190_1591 127
125 3300005456 Ga0070678_102099513 Ga0070678_1020995131 128
126 3300026121 Ga0207683_11584968 Ga0207683_115849682 128
127 3300048913 Ga0496110_0267254 Ga0496110_0267254_505_900 128
128 3300048914 Ga0496111_0241987 Ga0496111_0241987_817_1212 128
129 3300048915 Ga0496112_0358637 Ga0496112_0358637_815_1210 128
130 3300049582 Ga0501048_0378917 Ga0501048_0378917_378_767 129
131 3300005841 Ga0068863_100338755 Ga0068863_1003387552 131
132 3300005937 Ga0081455_10017479 Ga0081455_1001747911 131
133 3300005937 Ga0081455_10647578 Ga0081455_106475781 131
134 3300006038 Ga0075365_10223353 Ga0075365_102233533 131
135 3300006038 Ga0075365_10767402 Ga0075365_107674022 131
136 3300006175 Ga0070712_101433641 Ga0070712_1014336411 131
137 3300006178 Ga0075367_11029847 Ga0075367_110298472 131
138 3300006237 Ga0097621_101070059 Ga0097621_1010700591 131
139 3300007788 Ga0099795_10063283 Ga0099795_100632831 131
140 3300013297 Ga0157378_10774525 Ga0157378_107745251 131
141 3300025920 Ga0207649_11525817 Ga0207649_115258172 131
142 3300031824 Ga0307413_10575662 Ga0307413_105756622 131
143 3300031911 Ga0307412_11454220 Ga0307412_114542202 131
144 3300032002 Ga0307416_100390362 Ga0307416_1003903623 131
145 3300032126 Ga0307415_100895202 Ga0307415_1008952022 131
146 3300035090 Ga0373949_0066878 Ga0373949_0066878_80_475 131
147 3300035115 Ga0373941_0290800 Ga0373941_0290800_109_504 131
148 3300035121 Ga0373960_0109953 Ga0373960_0109953_286_681 131
149 3300035691 Ga0373931_0057316 Ga0373931_0057316_902_1297 131
150 3300046457 Ga0495590_0160206 Ga0495590_0160206_161_556 131
151 3300046794 Ga0495589_0290541 Ga0495589_0290541_296_691 131
152 3300048907 Ga0496104_0082659 Ga0496104_0082659_280_675 131
153 3300048915 Ga0496112_0000023 Ga0496112_0000023_39359_39772 131
154 3300050492 nmdc:mga0yw44_762946_c1 nmdc:mga0yw44_762946_c1_165_560 131
155 3300050507 nmdc:mga05p37_1332594_c1 nmdc:mga05p37_1332594_c1_186_581 131
156 3300050513 nmdc:mga0rr50_1485625_c1 nmdc:mga0rr50_1485625_c1_115_510 131
157 3300053130 Ga0500642_0087265 Ga0500642_0087265_88_483 131
158 2162886007 SwRhRL2b_contig_1467100 SwRhRL2b_0348.00004460 132
159 2209111006 2214800752 2213830010 132
160 3300000041 ARcpr5oldR_c000050 ARcpr5oldR_00005010 132
161 3300000042 ARSoilYngRDRAFT_c00100 ARSoilYngRDRAFT_001006 132
162 3300000043 ARcpr5yngRDRAFT_c000088 ARcpr5yngRDRAFT_0000886 132
163 3300000044 ARSoilOldRDRAFT_c000014 ARSoilOldRDRAFT_0000149 132
164 3300000045 ARCol0oldRDRAFT_c00172 ARCol0oldRDRAFT_001722 132
165 3300000652 ARCol0yngRDRAFT_1000033 ARCol0yngRDRAFT_100003310 132
166 3300001976 JGI24752J21851_1003681 JGI24752J21851_10036812 132
167 3300001977 JGI24746J21847_1005165 JGI24746J21847_10051652 132
168 3300001977 JGI24746J21847_1005687 JGI24746J21847_10056873 132
169 3300001978 JGI24747J21853_1000157 JGI24747J21853_10001573 132
170 3300001989 JGI24739J22299_10001254 JGI24739J22299_100012545 132
171 3300001989 JGI24739J22299_10208932 JGI24739J22299_102089321 132
172 3300001990 JGI24737J22298_10001401 JGI24737J22298_100014015 132
173 3300001990 JGI24737J22298_10007012 JGI24737J22298_100070123 132
174 3300002073 JGI24745J21846_1000686 JGI24745J21846_10006863 132
175 3300002074 JGI24748J21848_1003430 JGI24748J21848_10034302 132
176 3300002075 JGI24738J21930_10002690 JGI24738J21930_100026902 132
177 3300002076 JGI24749J21850_1001148 JGI24749J21850_10011485 132
178 3300002126 JGI24035J26624_1000056 JGI24035J26624_10000565 132
179 3300002155 JGI24033J26618_1006460 JGI24033J26618_10064602 132
180 3300002239 JGI24034J26672_10000779 JGI24034J26672_100007795 132
181 3300002239 JGI24034J26672_10017214 JGI24034J26672_100172142 132
182 3300002244 JGI24742J22300_10000762 JGI24742J22300_100007626 132
183 3300002459 JGI24751J29686_10020676 JGI24751J29686_100206762 132
184 3300003349 JGI26129J50193_1011006 JGI26129J50193_10110062 132
185 3300003911 JGI25405J52794_10014532 JGI25405J52794_100145322 132
186 3300005276 Ga0065717_1003762 Ga0065717_10037621 132
187 3300005289 Ga0065704_10002687 Ga0065704_100026872 132
188 3300005289 Ga0065704_10283553 Ga0065704_102835532 132
189 3300005290 Ga0065712_10001483 Ga0065712_100014836 132
190 3300005293 Ga0065715_10001223 Ga0065715_100012232 132
191 3300005293 Ga0065715_10089298 Ga0065715_100892986 132
192 3300005295 Ga0065707_10085662 Ga0065707_100856624 132
193 3300005328 Ga0070676_10004374 Ga0070676_100043742 132
194 3300005328 Ga0070676_10028242 Ga0070676_100282423 132
195 3300005329 Ga0070683_100002372 Ga0070683_10000237210 132
196 3300005329 Ga0070683_100013424 Ga0070683_1000134245 132
197 3300005329 Ga0070683_100256425 Ga0070683_1002564251 132
198 3300005329 Ga0070683_100292327 Ga0070683_1002923272 132
199 3300005330 Ga0070690_100031922 Ga0070690_1000319223 132
200 3300005330 Ga0070690_100047499 Ga0070690_1000474992 132
201 3300005330 Ga0070690_100619280 Ga0070690_1006192802 132
202 3300005331 Ga0070670_100045770 Ga0070670_1000457704 132
203 3300005331 Ga0070670_100125297 Ga0070670_1001252973 132
204 3300005333 Ga0070677_10001660 Ga0070677_100016606 132
205 3300005334 Ga0068869_100013986 Ga0068869_1000139862 132
206 3300005334 Ga0068869_100069513 Ga0068869_1000695132 132
207 3300005334 Ga0068869_100310531 Ga0068869_1003105312 132
208 3300005334 Ga0068869_100610655 Ga0068869_1006106551 132
209 3300005335 Ga0070666_10005392 Ga0070666_100053926 132
210 3300005335 Ga0070666_10014933 Ga0070666_100149334 132
211 3300005336 Ga0070680_100009637 Ga0070680_1000096375 132
212 3300005336 Ga0070680_100023842 Ga0070680_1000238424 132
213 3300005336 Ga0070680_100051961 Ga0070680_1000519612 132
214 3300005336 Ga0070680_100340184 Ga0070680_1003401842 132
215 3300005337 Ga0070682_100003966 Ga0070682_1000039664 132
216 3300005337 Ga0070682_100134388 Ga0070682_1001343882 132
217 3300005337 Ga0070682_100154886 Ga0070682_1001548862 132
218 3300005337 Ga0070682_100402988 Ga0070682_1004029881 132
219 3300005337 Ga0070682_100831757 Ga0070682_1008317571 132
220 3300005338 Ga0068868_100006892 Ga0068868_1000068927 132
221 3300005338 Ga0068868_100024999 Ga0068868_1000249993 132
222 3300005338 Ga0068868_100471257 Ga0068868_1004712572 132
223 3300005339 Ga0070660_100007163 Ga0070660_1000071637 132
224 3300005339 Ga0070660_100108279 Ga0070660_1001082793 132
225 3300005339 Ga0070660_101042291 Ga0070660_1010422911 132
226 3300005339 Ga0070660_101317589 Ga0070660_1013175891 132
227 3300005340 Ga0070689_100001580 Ga0070689_1000015808 132
228 3300005340 Ga0070689_100024447 Ga0070689_1000244472 132
229 3300005340 Ga0070689_100213176 Ga0070689_1002131762 132
230 3300005341 Ga0070691_10010791 Ga0070691_100107912 132
231 3300005341 Ga0070691_10252909 Ga0070691_102529091 132
232 3300005341 Ga0070691_10706364 Ga0070691_107063641 132
233 3300005343 Ga0070687_100001243 Ga0070687_1000012434 132
234 3300005343 Ga0070687_100048668 Ga0070687_1000486683 132
235 3300005343 Ga0070687_100254430 Ga0070687_1002544302 132
236 3300005344 Ga0070661_100003777 Ga0070661_1000037776 132
237 3300005344 Ga0070661_100078490 Ga0070661_1000784902 132
238 3300005344 Ga0070661_100260457 Ga0070661_1002604572 132
239 3300005345 Ga0070692_10000584 Ga0070692_100005846 132
240 3300005345 Ga0070692_10164213 Ga0070692_101642132 132
241 3300005345 Ga0070692_10778703 Ga0070692_107787032 132
242 3300005347 Ga0070668_100006376 Ga0070668_1000063762 132
243 3300005347 Ga0070668_100059371 Ga0070668_1000593713 132
244 3300005347 Ga0070668_100126735 Ga0070668_1001267352 132
245 3300005353 Ga0070669_100008519 Ga0070669_1000085196 132
246 3300005353 Ga0070669_100053373 Ga0070669_1000533732 132
247 3300005354 Ga0070675_100006379 Ga0070675_1000063793 132
248 3300005354 Ga0070675_100185038 Ga0070675_1001850382 132
249 3300005354 Ga0070675_101176420 Ga0070675_1011764201 132
250 3300005355 Ga0070671_100006758 Ga0070671_1000067586 132
251 3300005355 Ga0070671_100012390 Ga0070671_1000123904 132
252 3300005356 Ga0070674_100036237 Ga0070674_1000362372 132
253 3300005356 Ga0070674_100171472 Ga0070674_1001714721 132
254 3300005356 Ga0070674_100754702 Ga0070674_1007547021 132
255 3300005364 Ga0070673_100001646 Ga0070673_1000016467 132
256 3300005364 Ga0070673_100006994 Ga0070673_1000069944 132
257 3300005364 Ga0070673_100019007 Ga0070673_1000190074 132
258 3300005365 Ga0070688_100001441 Ga0070688_1000014416 132
259 3300005365 Ga0070688_100001567 Ga0070688_1000015676 132
260 3300005365 Ga0070688_100015120 Ga0070688_1000151203 132
261 3300005365 Ga0070688_100143126 Ga0070688_1001431262 132
262 3300005366 Ga0070659_100000606 Ga0070659_10000060615 132
263 3300005366 Ga0070659_100053577 Ga0070659_1000535772 132
264 3300005366 Ga0070659_100260462 Ga0070659_1002604622 132
265 3300005366 Ga0070659_100629222 Ga0070659_1006292222 132
266 3300005366 Ga0070659_101411523 Ga0070659_1014115231 132
267 3300005366 Ga0070659_101764434 Ga0070659_1017644341 132
268 3300005367 Ga0070667_100002800 Ga0070667_10000280010 132
269 3300005367 Ga0070667_100026295 Ga0070667_1000262955 132
270 3300005367 Ga0070667_100208995 Ga0070667_1002089952 132
271 3300005367 Ga0070667_100377738 Ga0070667_1003777382 132
272 3300005367 Ga0070667_100515802 Ga0070667_1005158022 132
273 3300005406 Ga0070703_10045556 Ga0070703_100455562 132
274 3300005434 Ga0070709_10001527 Ga0070709_100015279 132
275 3300005434 Ga0070709_10005316 Ga0070709_100053165 132
276 3300005434 Ga0070709_10310597 Ga0070709_103105971 132
277 3300005434 Ga0070709_10710475 Ga0070709_107104751 132
278 3300005434 Ga0070709_10799184 Ga0070709_107991841 132
279 3300005435 Ga0070714_100050508 Ga0070714_1000505085 132
280 3300005435 Ga0070714_100052029 Ga0070714_1000520294 132
281 3300005436 Ga0070713_100009205 Ga0070713_1000092055 132
282 3300005436 Ga0070713_100105764 Ga0070713_1001057642 132
283 3300005436 Ga0070713_100500360 Ga0070713_1005003602 132
284 3300005437 Ga0070710_10002893 Ga0070710_100028935 132
285 3300005437 Ga0070710_10028692 Ga0070710_100286923 132
286 3300005437 Ga0070710_10107247 Ga0070710_101072472 132
287 3300005438 Ga0070701_10001578 Ga0070701_100015785 132
288 3300005438 Ga0070701_10199629 Ga0070701_101996292 132
289 3300005439 Ga0070711_100007009 Ga0070711_1000070095 132
290 3300005439 Ga0070711_100080541 Ga0070711_1000805412 132
291 3300005439 Ga0070711_100112632 Ga0070711_1001126322 132
292 3300005439 Ga0070711_100116192 Ga0070711_1001161922 132
293 3300005439 Ga0070711_100224393 Ga0070711_1002243932 132
294 3300005439 Ga0070711_100585187 Ga0070711_1005851872 132
295 3300005439 Ga0070711_100744710 Ga0070711_1007447102 132
296 3300005440 Ga0070705_100001050 Ga0070705_1000010509 132
297 3300005440 Ga0070705_100373715 Ga0070705_1003737152 132
298 3300005441 Ga0070700_100004229 Ga0070700_1000042292 132
299 3300005441 Ga0070700_100108201 Ga0070700_1001082012 132
300 3300005441 Ga0070700_100310251 Ga0070700_1003102512 132
301 3300005444 Ga0070694_100003017 Ga0070694_10000301710 132
302 3300005444 Ga0070694_100092626 Ga0070694_1000926262 132
303 3300005445 Ga0070708_100033618 Ga0070708_1000336185 132
304 3300005455 Ga0070663_100002491 Ga0070663_1000024915 132
305 3300005455 Ga0070663_100060359 Ga0070663_1000603593 132
306 3300005455 Ga0070663_100350311 Ga0070663_1003503111 132
307 3300005455 Ga0070663_100494471 Ga0070663_1004944712 132
308 3300005456 Ga0070678_100009108 Ga0070678_1000091082 132
309 3300005456 Ga0070678_100167626 Ga0070678_1001676262 132
310 3300005457 Ga0070662_100004090 Ga0070662_1000040908 132
311 3300005457 Ga0070662_100080601 Ga0070662_1000806012 132
312 3300005457 Ga0070662_100270505 Ga0070662_1002705052 132
313 3300005458 Ga0070681_10007657 Ga0070681_100076574 132
314 3300005458 Ga0070681_10012440 Ga0070681_100124406 132
315 3300005458 Ga0070681_10057000 Ga0070681_100570003 132
316 3300005458 Ga0070681_10343131 Ga0070681_103431312 132
317 3300005458 Ga0070681_10936912 Ga0070681_109369122 132
318 3300005458 Ga0070681_10991013 Ga0070681_109910132 132
319 3300005459 Ga0068867_100003281 Ga0068867_10000328110 132
320 3300005466 Ga0070685_10004728 Ga0070685_100047282 132
321 3300005466 Ga0070685_10012746 Ga0070685_100127462 132
322 3300005466 Ga0070685_10017824 Ga0070685_100178242 132
323 3300005467 Ga0070706_100901819 Ga0070706_1009018192 132
324 3300005471 Ga0070698_100622897 Ga0070698_1006228972 132
325 3300005518 Ga0070699_100199052 Ga0070699_1001990522 132
326 3300005518 Ga0070699_100825239 Ga0070699_1008252391 132
327 3300005530 Ga0070679_100007375 Ga0070679_1000073757 132
328 3300005530 Ga0070679_100028159 Ga0070679_1000281592 132
329 3300005530 Ga0070679_100089136 Ga0070679_1000891362 132
330 3300005530 Ga0070679_100090686 Ga0070679_1000906862 132
331 3300005530 Ga0070679_100141469 Ga0070679_1001414694 132
332 3300005530 Ga0070679_101856863 Ga0070679_1018568631 132
333 3300005535 Ga0070684_100003410 Ga0070684_1000034106 132
334 3300005535 Ga0070684_100029686 Ga0070684_1000296862 132
335 3300005535 Ga0070684_100050707 Ga0070684_1000507072 132
336 3300005535 Ga0070684_100052923 Ga0070684_1000529232 132
337 3300005535 Ga0070684_101056453 Ga0070684_1010564532 132
338 3300005536 Ga0070697_100242277 Ga0070697_1002422772 132
339 3300005536 Ga0070697_100267866 Ga0070697_1002678662 132
340 3300005539 Ga0068853_100004052 Ga0068853_1000040529 132
341 3300005539 Ga0068853_100275408 Ga0068853_1002754081 132
342 3300005543 Ga0070672_100007298 Ga0070672_1000072982 132
343 3300005543 Ga0070672_100134708 Ga0070672_1001347083 132
344 3300005544 Ga0070686_100001851 Ga0070686_1000018515 132
345 3300005544 Ga0070686_100006669 Ga0070686_1000066693 132
346 3300005544 Ga0070686_100430850 Ga0070686_1004308501 132
347 3300005545 Ga0070695_100003283 Ga0070695_1000032838 132
348 3300005545 Ga0070695_100025097 Ga0070695_1000250971 132
349 3300005546 Ga0070696_100010539 Ga0070696_1000105396 132
350 3300005546 Ga0070696_100509415 Ga0070696_1005094152 132
351 3300005547 Ga0070693_100007812 Ga0070693_1000078126 132
352 3300005548 Ga0070665_100106110 Ga0070665_1001061103 132
353 3300005548 Ga0070665_100390848 Ga0070665_1003908481 132
354 3300005548 Ga0070665_100564242 Ga0070665_1005642422 132
355 3300005548 Ga0070665_102642334 Ga0070665_1026423341 132
356 3300005549 Ga0070704_100002531 Ga0070704_1000025316 132
357 3300005549 Ga0070704_100016428 Ga0070704_1000164285 132
358 3300005549 Ga0070704_100596817 Ga0070704_1005968171 132
359 3300005549 Ga0070704_100847113 Ga0070704_1008471132 132
360 3300005563 Ga0068855_100026458 Ga0068855_1000264587 132
361 3300005563 Ga0068855_100035825 Ga0068855_1000358253 132
362 3300005563 Ga0068855_101003665 Ga0068855_1010036652 132
363 3300005563 Ga0068855_102074773 Ga0068855_1020747731 132
364 3300005564 Ga0070664_100005496 Ga0070664_1000054964 132
365 3300005564 Ga0070664_100093433 Ga0070664_1000934333 132
366 3300005564 Ga0070664_100590404 Ga0070664_1005904042 132
367 3300005577 Ga0068857_100005505 Ga0068857_1000055055 132
368 3300005578 Ga0068854_100004381 Ga0068854_1000043816 132
369 3300005578 Ga0068854_100260151 Ga0068854_1002601511 132
370 3300005578 Ga0068854_100534721 Ga0068854_1005347212 132
371 3300005578 Ga0068854_100592632 Ga0068854_1005926322 132
372 3300005614 Ga0068856_100010806 Ga0068856_1000108066 132
373 3300005614 Ga0068856_100196667 Ga0068856_1001966673 132
374 3300005614 Ga0068856_100443645 Ga0068856_1004436452 132
375 3300005615 Ga0070702_100001550 Ga0070702_1000015506 132
376 3300005615 Ga0070702_100061047 Ga0070702_1000610473 132
377 3300005615 Ga0070702_100104263 Ga0070702_1001042632 132
378 3300005616 Ga0068852_100009158 Ga0068852_1000091586 132
379 3300005616 Ga0068852_100245781 Ga0068852_1002457814 132
380 3300005617 Ga0068859_100013289 Ga0068859_1000132893 132
381 3300005617 Ga0068859_100017563 Ga0068859_1000175637 132
382 3300005618 Ga0068864_100008539 Ga0068864_1000085396 132
383 3300005618 Ga0068864_100156944 Ga0068864_1001569443 132
384 3300005618 Ga0068864_100321480 Ga0068864_1003214802 132
385 3300005618 Ga0068864_100864177 Ga0068864_1008641771 132
386 3300005718 Ga0068866_10000499 Ga0068866_100004997 132
387 3300005718 Ga0068866_10029049 Ga0068866_100290492 132
388 3300005719 Ga0068861_100005753 Ga0068861_1000057535 132
389 3300005719 Ga0068861_100572035 Ga0068861_1005720352 132
390 3300005834 Ga0068851_10033685 Ga0068851_100336852 132
391 3300005840 Ga0068870_10000912 Ga0068870_100009126 132
392 3300005841 Ga0068863_100012619 Ga0068863_1000126197 132
393 3300005841 Ga0068863_100279471 Ga0068863_1002794712 132
394 3300005842 Ga0068858_100021701 Ga0068858_1000217015 132
395 3300005842 Ga0068858_100026979 Ga0068858_1000269796 132
396 3300005842 Ga0068858_100170703 Ga0068858_1001707033 132
397 3300005842 Ga0068858_100264506 Ga0068858_1002645062 132
398 3300005843 Ga0068860_100014809 Ga0068860_1000148093 132
399 3300005843 Ga0068860_100372119 Ga0068860_1003721191 132
400 3300005843 Ga0068860_101896787 Ga0068860_1018967871 132
401 3300005844 Ga0068862_100006001 Ga0068862_1000060016 132
402 3300005844 Ga0068862_100044677 Ga0068862_1000446772 132
403 3300005844 Ga0068862_100594225 Ga0068862_1005942252 132
404 3300005937 Ga0081455_10001814 Ga0081455_1000181418 132
405 3300005937 Ga0081455_10007996 Ga0081455_100079964 132
406 3300005937 Ga0081455_10008059 Ga0081455_1000805911 132
407 3300005937 Ga0081455_10025454 Ga0081455_100254544 132
408 3300005937 Ga0081455_10038785 Ga0081455_100387852 132
409 3300005937 Ga0081455_10440539 Ga0081455_104405392 132
410 3300005937 Ga0081455_10462768 Ga0081455_104627682 132
411 3300005983 Ga0081540_1087314 Ga0081540_10873142 132
412 3300006028 Ga0070717_10000378 Ga0070717_1000037825 132
413 3300006028 Ga0070717_10126997 Ga0070717_101269972 132
414 3300006051 Ga0075364_10418617 Ga0075364_104186172 132
415 3300006058 Ga0075432_10061418 Ga0075432_100614182 132
416 3300006058 Ga0075432_10409927 Ga0075432_104099271 132
417 3300006163 Ga0070715_10006610 Ga0070715_100066104 132
418 3300006163 Ga0070715_10030672 Ga0070715_100306723 132
419 3300006163 Ga0070715_10444016 Ga0070715_104440162 132
420 3300006173 Ga0070716_100003615 Ga0070716_1000036153 132
421 3300006173 Ga0070716_100034168 Ga0070716_1000341682 132
422 3300006175 Ga0070712_100045755 Ga0070712_1000457553 132
423 3300006175 Ga0070712_100216674 Ga0070712_1002166742 132
424 3300006175 Ga0070712_100302262 Ga0070712_1003022622 132
425 3300006175 Ga0070712_100337880 Ga0070712_1003378802 132
426 3300006175 Ga0070712_100339678 Ga0070712_1003396782 132
427 3300006178 Ga0075367_10217362 Ga0075367_102173622 132
428 3300006178 Ga0075367_10361317 Ga0075367_103613172 132
429 3300006194 Ga0075427_10004740 Ga0075427_100047403 132
430 3300006195 Ga0075366_10243937 Ga0075366_102439372 132
431 3300006237 Ga0097621_100002280 Ga0097621_1000022806 132
432 3300006353 Ga0075370_10131402 Ga0075370_101314023 132
433 3300006358 Ga0068871_100001765 Ga0068871_1000017658 132
434 3300006358 Ga0068871_100002303 Ga0068871_1000023039 132
435 3300006358 Ga0068871_100457677 Ga0068871_1004576772 132
436 3300006844 Ga0075428_100053255 Ga0075428_1000532553 132
437 3300006844 Ga0075428_100101747 Ga0075428_1001017473 132
438 3300006846 Ga0075430_100001229 Ga0075430_10000122919 132
439 3300006846 Ga0075430_101553668 Ga0075430_1015536681 132
440 3300006847 Ga0075431_100091870 Ga0075431_1000918704 132
441 3300006847 Ga0075431_100206716 Ga0075431_1002067163 132
442 3300006852 Ga0075433_10000068 Ga0075433_100000683 132
443 3300006852 Ga0075433_10004014 Ga0075433_100040148 132
444 3300006852 Ga0075433_10085971 Ga0075433_100859714 132
445 3300006852 Ga0075433_10110846 Ga0075433_101108462 132
446 3300006871 Ga0075434_100002653 Ga0075434_1000026539 132
447 3300006871 Ga0075434_100010212 Ga0075434_1000102128 132
448 3300006871 Ga0075434_100014111 Ga0075434_1000141117 132
449 3300006871 Ga0075434_100028341 Ga0075434_1000283418 132
450 3300006871 Ga0075434_100213810 Ga0075434_1002138103 132
451 3300006871 Ga0075434_100219739 Ga0075434_1002197392 132
452 3300006871 Ga0075434_100691165 Ga0075434_1006911652 132
453 3300006871 Ga0075434_100764391 Ga0075434_1007643912 132
454 3300006880 Ga0075429_100001258 Ga0075429_1000012583 132
455 3300006880 Ga0075429_100705293 Ga0075429_1007052932 132
456 3300006881 Ga0068865_100005830 Ga0068865_1000058306 132
457 3300006881 Ga0068865_100146986 Ga0068865_1001469862 132
458 3300006881 Ga0068865_100439947 Ga0068865_1004399472 132
459 3300006881 Ga0068865_100466636 Ga0068865_1004666362 132
460 3300006914 Ga0075436_100118739 Ga0075436_1001187392 132
461 3300006914 Ga0075436_100489350 Ga0075436_1004893501 132
462 3300006931 Ga0097620_100013289 Ga0097620_1000132897 132
463 3300006931 Ga0097620_100017562 Ga0097620_1000175627 132
464 3300007076 Ga0075435_100004859 Ga0075435_1000048595 132
465 3300007076 Ga0075435_100103892 Ga0075435_1001038923 132
466 3300007076 Ga0075435_100194729 Ga0075435_1001947291 132
467 3300007076 Ga0075435_100232512 Ga0075435_1002325122 132
468 3300007076 Ga0075435_100232513 Ga0075435_1002325132 132
469 3300007076 Ga0075435_100394196 Ga0075435_1003941962 132
470 3300009011 Ga0105251_10008344 Ga0105251_100083443 132
471 3300009036 Ga0105244_10351005 Ga0105244_103510052 132
472 3300009092 Ga0105250_10081060 Ga0105250_100810601 132
473 3300009092 Ga0105250_10208328 Ga0105250_102083282 132
474 3300009093 Ga0105240_10047824 Ga0105240_100478246 132
475 3300009093 Ga0105240_10545760 Ga0105240_105457602 132
476 3300009094 Ga0111539_10002321 Ga0111539_100023213 132
477 3300009094 Ga0111539_10002993 Ga0111539_1000299322 132
478 3300009094 Ga0111539_10015631 Ga0111539_100156316 132
479 3300009094 Ga0111539_10155897 Ga0111539_101558972 132
480 3300009098 Ga0105245_10007695 Ga0105245_100076956 132
481 3300009098 Ga0105245_10029765 Ga0105245_100297652 132
482 3300009098 Ga0105245_10212986 Ga0105245_102129862 132
483 3300009098 Ga0105245_11069843 Ga0105245_110698432 132
484 3300009098 Ga0105245_11197978 Ga0105245_111979781 132
485 3300009101 Ga0105247_10006474 Ga0105247_100064742 132
486 3300009101 Ga0105247_10071451 Ga0105247_100714512 132
487 3300009101 Ga0105247_10113281 Ga0105247_101132812 132
488 3300009101 Ga0105247_10150863 Ga0105247_101508633 132
489 3300009147 Ga0114129_10008407 Ga0114129_1000840712 132
490 3300009147 Ga0114129_10080743 Ga0114129_100807435 132
491 3300009147 Ga0114129_10196844 Ga0114129_101968443 132
492 3300009147 Ga0114129_10887464 Ga0114129_108874642 132
493 3300009147 Ga0114129_13017982 Ga0114129_130179821 132
494 3300009148 Ga0105243_10005397 Ga0105243_100053976 132
495 3300009148 Ga0105243_10006140 Ga0105243_100061404 132
496 3300009148 Ga0105243_10256229 Ga0105243_102562292 132
497 3300009148 Ga0105243_11598695 Ga0105243_115986952 132
498 3300009174 Ga0105241_10008144 Ga0105241_100081445 132
499 3300009174 Ga0105241_10049635 Ga0105241_100496353 132
500 3300009174 Ga0105241_10230515 Ga0105241_102305152 132
501 3300009174 Ga0105241_10441020 Ga0105241_104410202 132
502 3300009176 Ga0105242_10005421 Ga0105242_100054216 132
503 3300009176 Ga0105242_10006587 Ga0105242_100065874 132
504 3300009176 Ga0105242_10414106 Ga0105242_104141062 132
505 3300009176 Ga0105242_11320049 Ga0105242_113200492 132
506 3300009177 Ga0105248_10004154 Ga0105248_100041548 132
507 3300009177 Ga0105248_10015999 Ga0105248_100159996 132
508 3300009177 Ga0105248_10032918 Ga0105248_100329184 132
509 3300009177 Ga0105248_10059358 Ga0105248_100593582 132
510 3300009545 Ga0105237_10015749 Ga0105237_100157492 132
511 3300009545 Ga0105237_10031682 Ga0105237_100316826 132
512 3300009545 Ga0105237_10090161 Ga0105237_100901612 132
513 3300009545 Ga0105237_10352417 Ga0105237_103524172 132
514 3300009545 Ga0105237_11340615 Ga0105237_113406152 132
515 3300009551 Ga0105238_10103993 Ga0105238_101039932 132
516 3300009551 Ga0105238_10274994 Ga0105238_102749942 132
517 3300009553 Ga0105249_10005322 Ga0105249_100053228 132
518 3300009553 Ga0105249_10027545 Ga0105249_100275454 132
519 3300009553 Ga0105249_10176707 Ga0105249_101767072 132
520 3300009553 Ga0105249_10298016 Ga0105249_102980161 132
521 3300009553 Ga0105249_10631915 Ga0105249_106319152 132
522 3300009553 Ga0105249_11063740 Ga0105249_110637401 132
523 3300010375 Ga0105239_10013532 Ga0105239_100135324 132
524 3300010375 Ga0105239_10031335 Ga0105239_100313356 132
525 3300010375 Ga0105239_10100375 Ga0105239_101003752 132
526 3300010375 Ga0105239_10190877 Ga0105239_101908772 132
527 3300010375 Ga0105239_10452897 Ga0105239_104528972 132
528 3300010375 Ga0105239_12053367 Ga0105239_120533671 132
529 3300011119 Ga0105246_10003909 Ga0105246_100039095 132
530 3300011119 Ga0105246_10050197 Ga0105246_100501973 132
531 3300011119 Ga0105246_10702397 Ga0105246_107023972 132
532 3300011119 Ga0105246_11218447 Ga0105246_112184472 132
533 3300012477 Ga0157336_1001406 Ga0157336_10014062 132
534 3300012487 Ga0157321_1012704 Ga0157321_10127041 132
535 3300012492 Ga0157335_1003960 Ga0157335_10039602 132
536 3300012495 Ga0157323_1003499 Ga0157323_10034991 132
537 3300012500 Ga0157314_1034339 Ga0157314_10343391 132
538 3300012507 Ga0157342_1000397 Ga0157342_10003972 132
539 3300012507 Ga0157342_1037352 Ga0157342_10373521 132
540 3300012508 Ga0157315_1001012 Ga0157315_10010122 132
541 3300013100 Ga0157373_10009648 Ga0157373_1000964812 132
542 3300013100 Ga0157373_10108489 Ga0157373_101084892 132
543 3300013100 Ga0157373_10287163 Ga0157373_102871632 132
544 3300013100 Ga0157373_10622569 Ga0157373_106225692 132
545 3300013102 Ga0157371_10017025 Ga0157371_100170252 132
546 3300013102 Ga0157371_10529758 Ga0157371_105297582 132
547 3300013102 Ga0157371_10595679 Ga0157371_105956792 132
548 3300013104 Ga0157370_10071837 Ga0157370_100718373 132
549 3300013104 Ga0157370_10314991 Ga0157370_103149912 132
550 3300013105 Ga0157369_10105324 Ga0157369_101053242 132
551 3300013105 Ga0157369_11626012 Ga0157369_116260122 132
552 3300013296 Ga0157374_10006413 Ga0157374_100064136 132
553 3300013296 Ga0157374_10508841 Ga0157374_105088411 132
554 3300013296 Ga0157374_11105400 Ga0157374_111054001 132
555 3300013297 Ga0157378_10006910 Ga0157378_100069106 132
556 3300013297 Ga0157378_10015392 Ga0157378_100153925 132
557 3300013297 Ga0157378_10407375 Ga0157378_104073752 132
558 3300013297 Ga0157378_10430498 Ga0157378_104304982 132
559 3300013297 Ga0157378_10814595 Ga0157378_108145952 132
560 3300013297 Ga0157378_12117001 Ga0157378_121170011 132
561 3300013306 Ga0163162_10011669 Ga0163162_100116696 132
562 3300013306 Ga0163162_10120179 Ga0163162_101201792 132
563 3300013306 Ga0163162_10951997 Ga0163162_109519972 132
564 3300013306 Ga0163162_11552189 Ga0163162_115521892 132
565 3300013307 Ga0157372_10004846 Ga0157372_100048468 132
566 3300013307 Ga0157372_10160803 Ga0157372_101608032 132
567 3300013307 Ga0157372_10190623 Ga0157372_101906232 132
568 3300013307 Ga0157372_10917580 Ga0157372_109175802 132
569 3300013307 Ga0157372_11522677 Ga0157372_115226771 132
570 3300013308 Ga0157375_10067078 Ga0157375_100670782 132
571 3300013308 Ga0157375_10070507 Ga0157375_100705073 132
572 3300013308 Ga0157375_10544513 Ga0157375_105445132 132
573 3300014325 Ga0163163_10004603 Ga0163163_100046038 132
574 3300014325 Ga0163163_10007332 Ga0163163_100073322 132
575 3300014326 Ga0157380_10004302 Ga0157380_100043026 132
576 3300014326 Ga0157380_11360946 Ga0157380_113609462 132
577 3300014326 Ga0157380_11760902 Ga0157380_117609022 132
578 3300014497 Ga0182008_10157420 Ga0182008_101574202 132
579 3300014745 Ga0157377_10005931 Ga0157377_100059316 132
580 3300014968 Ga0157379_10005467 Ga0157379_100054678 132
581 3300014968 Ga0157379_10112151 Ga0157379_101121514 132
582 3300014968 Ga0157379_10262286 Ga0157379_102622862 132
583 3300014969 Ga0157376_10008818 Ga0157376_100088184 132
584 3300014969 Ga0157376_10063299 Ga0157376_100632993 132
585 3300014969 Ga0157376_10818893 Ga0157376_108188932 132
586 3300017792 Ga0163161_10006035 Ga0163161_100060356 132
587 3300017792 Ga0163161_10031508 Ga0163161_100315083 132
588 3300020070 Ga0206356_10901597 Ga0206356_109015972 132
589 3300020082 Ga0206353_10640270 Ga0206353_106402701 132
590 3300021384 Ga0213876_10037068 Ga0213876_100370682 132
591 3300025227 Ga0207638_1002335 Ga0207638_10023352 132
592 3300025271 Ga0207666_1000101 Ga0207666_100010110 132
593 3300025271 Ga0207666_1003681 Ga0207666_10036812 132
594 3300025290 Ga0207673_1000172 Ga0207673_10001723 132
595 3300025315 Ga0207697_10001935 Ga0207697_100019355 132
596 3300025315 Ga0207697_10044971 Ga0207697_100449712 132
597 3300025321 Ga0207656_10014038 Ga0207656_100140383 132
598 3300025321 Ga0207656_10044483 Ga0207656_100444832 132
599 3300025321 Ga0207656_10144593 Ga0207656_101445932 132
600 3300025735 Ga0207713_1096293 Ga0207713_10962932 132
601 3300025885 Ga0207653_10001381 Ga0207653_100013814 132
602 3300025885 Ga0207653_10020629 Ga0207653_100206292 132
603 3300025893 Ga0207682_10001556 Ga0207682_100015566 132
604 3300025898 Ga0207692_10004188 Ga0207692_100041885 132
605 3300025898 Ga0207692_10013342 Ga0207692_100133424 132
606 3300025898 Ga0207692_10031468 Ga0207692_100314682 132
607 3300025898 Ga0207692_10066131 Ga0207692_100661312 132
608 3300025898 Ga0207692_10189799 Ga0207692_101897992 132
609 3300025899 Ga0207642_10000470 Ga0207642_100004709 132
610 3300025899 Ga0207642_10065855 Ga0207642_100658552 132
611 3300025899 Ga0207642_10219878 Ga0207642_102198782 132
612 3300025900 Ga0207710_10003481 Ga0207710_100034815 132
613 3300025900 Ga0207710_10018595 Ga0207710_100185954 132
614 3300025900 Ga0207710_10072708 Ga0207710_100727082 132
615 3300025901 Ga0207688_10000342 Ga0207688_100003425 132
616 3300025901 Ga0207688_10035396 Ga0207688_100353962 132
617 3300025901 Ga0207688_10252953 Ga0207688_102529532 132
618 3300025903 Ga0207680_10005429 Ga0207680_100054293 132
619 3300025903 Ga0207680_10008752 Ga0207680_100087523 132
620 3300025903 Ga0207680_10323585 Ga0207680_103235852 132
621 3300025903 Ga0207680_11162168 Ga0207680_111621681 132
622 3300025904 Ga0207647_10004199 Ga0207647_100041996 132
623 3300025904 Ga0207647_10083330 Ga0207647_100833302 132
624 3300025904 Ga0207647_10282049 Ga0207647_102820492 132
625 3300025905 Ga0207685_10002461 Ga0207685_100024612 132
626 3300025906 Ga0207699_10001414 Ga0207699_100014145 132
627 3300025906 Ga0207699_10035373 Ga0207699_100353733 132
628 3300025906 Ga0207699_10297042 Ga0207699_102970422 132
629 3300025906 Ga0207699_10339921 Ga0207699_103399212 132
630 3300025907 Ga0207645_10002850 Ga0207645_100028508 132
631 3300025907 Ga0207645_10018793 Ga0207645_100187932 132
632 3300025908 Ga0207643_10000136 Ga0207643_100001368 132
633 3300025911 Ga0207654_10003429 Ga0207654_100034296 132
634 3300025911 Ga0207654_10284340 Ga0207654_102843402 132
635 3300025912 Ga0207707_10030138 Ga0207707_100301384 132
636 3300025912 Ga0207707_10063403 Ga0207707_100634032 132
637 3300025912 Ga0207707_10102214 Ga0207707_101022142 132
638 3300025912 Ga0207707_10232340 Ga0207707_102323402 132
639 3300025912 Ga0207707_10372343 Ga0207707_103723432 132
640 3300025912 Ga0207707_10708378 Ga0207707_107083782 132
641 3300025914 Ga0207671_10048718 Ga0207671_100487183 132
642 3300025914 Ga0207671_10268034 Ga0207671_102680342 132
643 3300025915 Ga0207693_10009179 Ga0207693_100091797 132
644 3300025915 Ga0207693_10021607 Ga0207693_100216075 132
645 3300025915 Ga0207693_10061055 Ga0207693_100610553 132
646 3300025915 Ga0207693_10119704 Ga0207693_101197042 132
647 3300025915 Ga0207693_10189479 Ga0207693_101894791 132
648 3300025916 Ga0207663_10009720 Ga0207663_100097205 132
649 3300025916 Ga0207663_10036723 Ga0207663_100367232 132
650 3300025916 Ga0207663_10046347 Ga0207663_100463473 132
651 3300025916 Ga0207663_10053755 Ga0207663_100537553 132
652 3300025916 Ga0207663_10206594 Ga0207663_102065942 132
653 3300025916 Ga0207663_10233468 Ga0207663_102334682 132
654 3300025916 Ga0207663_11092954 Ga0207663_110929542 132
655 3300025917 Ga0207660_10004279 Ga0207660_100042794 132
656 3300025917 Ga0207660_10435182 Ga0207660_104351822 132
657 3300025917 Ga0207660_10726507 Ga0207660_107265072 132
658 3300025918 Ga0207662_10000164 Ga0207662_100001647 132
659 3300025918 Ga0207662_10024356 Ga0207662_100243564 132
660 3300025918 Ga0207662_10204914 Ga0207662_102049142 132
661 3300025919 Ga0207657_10005663 Ga0207657_100056637 132
662 3300025919 Ga0207657_10027385 Ga0207657_100273852 132
663 3300025919 Ga0207657_10674224 Ga0207657_106742242 132
664 3300025919 Ga0207657_10859721 Ga0207657_108597211 132
665 3300025919 Ga0207657_11073575 Ga0207657_110735752 132
666 3300025920 Ga0207649_10002730 Ga0207649_100027306 132
667 3300025920 Ga0207649_10225804 Ga0207649_102258042 132
668 3300025920 Ga0207649_10702375 Ga0207649_107023752 132
669 3300025921 Ga0207652_10181184 Ga0207652_101811842 132
670 3300025921 Ga0207652_10704129 Ga0207652_107041292 132
671 3300025921 Ga0207652_11254925 Ga0207652_112549251 132
672 3300025923 Ga0207681_10005292 Ga0207681_100052927 132
673 3300025923 Ga0207681_10183318 Ga0207681_101833182 132
674 3300025924 Ga0207694_10093199 Ga0207694_100931992 132
675 3300025924 Ga0207694_10228432 Ga0207694_102284322 132
676 3300025924 Ga0207694_10845962 Ga0207694_108459622 132
677 3300025925 Ga0207650_10051528 Ga0207650_100515283 132
678 3300025925 Ga0207650_10053379 Ga0207650_100533793 132
679 3300025925 Ga0207650_10406167 Ga0207650_104061672 132
680 3300025926 Ga0207659_10000171 Ga0207659_1000017141 132
681 3300025926 Ga0207659_10667124 Ga0207659_106671241 132
682 3300025926 Ga0207659_11311671 Ga0207659_113116712 132
683 3300025927 Ga0207687_10022923 Ga0207687_100229232 132
684 3300025927 Ga0207687_10031580 Ga0207687_100315802 132
685 3300025928 Ga0207700_10005138 Ga0207700_100051384 132
686 3300025928 Ga0207700_10758390 Ga0207700_107583902 132
687 3300025929 Ga0207664_10003302 Ga0207664_100033023 132
688 3300025929 Ga0207664_10031465 Ga0207664_100314655 132
689 3300025929 Ga0207664_10100470 Ga0207664_101004702 132
690 3300025929 Ga0207664_10416834 Ga0207664_104168342 132
691 3300025931 Ga0207644_10012793 Ga0207644_100127936 132
692 3300025931 Ga0207644_10081269 Ga0207644_100812692 132
693 3300025932 Ga0207690_10006648 Ga0207690_100066486 132
694 3300025932 Ga0207690_10224594 Ga0207690_102245941 132
695 3300025932 Ga0207690_10566647 Ga0207690_105666472 132
696 3300025932 Ga0207690_11127237 Ga0207690_111272371 132
697 3300025932 Ga0207690_11794012 Ga0207690_117940121 132
698 3300025933 Ga0207706_10008545 Ga0207706_100085455 132
699 3300025933 Ga0207706_10026853 Ga0207706_100268534 132
700 3300025933 Ga0207706_10130088 Ga0207706_101300882 132
701 3300025934 Ga0207686_10000913 Ga0207686_100009136 132
702 3300025934 Ga0207686_10004054 Ga0207686_100040545 132
703 3300025935 Ga0207709_10002060 Ga0207709_100020609 132
704 3300025935 Ga0207709_10178573 Ga0207709_101785732 132
705 3300025936 Ga0207670_10002654 Ga0207670_100026546 132
706 3300025936 Ga0207670_10227278 Ga0207670_102272782 132
707 3300025937 Ga0207669_10008376 Ga0207669_100083763 132
708 3300025937 Ga0207669_10125532 Ga0207669_101255322 132
709 3300025938 Ga0207704_10001376 Ga0207704_100013768 132
710 3300025938 Ga0207704_10387912 Ga0207704_103879122 132
711 3300025938 Ga0207704_10390942 Ga0207704_103909422 132
712 3300025938 Ga0207704_10635714 Ga0207704_106357142 132
713 3300025938 Ga0207704_11333900 Ga0207704_113339002 132
714 3300025939 Ga0207665_10005865 Ga0207665_100058657 132
715 3300025939 Ga0207665_10038750 Ga0207665_100387503 132
716 3300025939 Ga0207665_10074598 Ga0207665_100745982 132
717 3300025939 Ga0207665_10449492 Ga0207665_104494922 132
718 3300025940 Ga0207691_10009289 Ga0207691_100092896 132
719 3300025940 Ga0207691_10145597 Ga0207691_101455973 132
720 3300025941 Ga0207711_10011703 Ga0207711_100117035 132
721 3300025941 Ga0207711_10019793 Ga0207711_100197934 132
722 3300025941 Ga0207711_10453758 Ga0207711_104537582 132
723 3300025942 Ga0207689_10000427 Ga0207689_100004279 132
724 3300025942 Ga0207689_10107566 Ga0207689_101075662 132
725 3300025942 Ga0207689_10321757 Ga0207689_103217572 132
726 3300025942 Ga0207689_10614138 Ga0207689_106141382 132
727 3300025944 Ga0207661_10019446 Ga0207661_100194465 132
728 3300025944 Ga0207661_10241727 Ga0207661_102417273 132
729 3300025944 Ga0207661_10585629 Ga0207661_105856291 132
730 3300025944 Ga0207661_10767992 Ga0207661_107679922 132
731 3300025945 Ga0207679_10001545 Ga0207679_1000154515 132
732 3300025945 Ga0207679_10097690 Ga0207679_100976903 132
733 3300025945 Ga0207679_10223805 Ga0207679_102238052 132
734 3300025945 Ga0207679_10233071 Ga0207679_102330712 132
735 3300025945 Ga0207679_10440125 Ga0207679_104401252 132
736 3300025949 Ga0207667_10019679 Ga0207667_100196793 132
737 3300025960 Ga0207651_10013019 Ga0207651_100130192 132
738 3300025960 Ga0207651_10023538 Ga0207651_100235385 132
739 3300025960 Ga0207651_10135376 Ga0207651_101353763 132
740 3300025961 Ga0207712_10003331 Ga0207712_100033317 132
741 3300025961 Ga0207712_10078407 Ga0207712_100784073 132
742 3300025961 Ga0207712_10468467 Ga0207712_104684672 132
743 3300025972 Ga0207668_10003213 Ga0207668_100032136 132
744 3300025972 Ga0207668_10332722 Ga0207668_103327222 132
745 3300025981 Ga0207640_10005218 Ga0207640_100052186 132
746 3300025981 Ga0207640_10060427 Ga0207640_100604272 132
747 3300025981 Ga0207640_10255289 Ga0207640_102552891 132
748 3300025986 Ga0207658_10009391 Ga0207658_100093912 132
749 3300025986 Ga0207658_10010825 Ga0207658_100108255 132
750 3300025986 Ga0207658_10085170 Ga0207658_100851703 132
751 3300025986 Ga0207658_10134250 Ga0207658_101342502 132
752 3300025986 Ga0207658_10181475 Ga0207658_101814752 132
753 3300026023 Ga0207677_10007106 Ga0207677_100071064 132
754 3300026023 Ga0207677_10056559 Ga0207677_100565592 132
755 3300026035 Ga0207703_10010690 Ga0207703_100106905 132
756 3300026035 Ga0207703_10012302 Ga0207703_100123026 132
757 3300026035 Ga0207703_10191116 Ga0207703_101911162 132
758 3300026041 Ga0207639_10042260 Ga0207639_100422604 132
759 3300026041 Ga0207639_10526829 Ga0207639_105268292 132
760 3300026067 Ga0207678_10007058 Ga0207678_100070585 132
761 3300026067 Ga0207678_10015702 Ga0207678_100157026 132
762 3300026067 Ga0207678_10254743 Ga0207678_102547432 132
763 3300026067 Ga0207678_10329508 Ga0207678_103295082 132
764 3300026075 Ga0207708_10002028 Ga0207708_100020289 132
765 3300026075 Ga0207708_10010355 Ga0207708_100103556 132
766 3300026078 Ga0207702_10040015 Ga0207702_100400155 132
767 3300026078 Ga0207702_10187165 Ga0207702_101871652 132
768 3300026078 Ga0207702_10430736 Ga0207702_104307361 132
769 3300026078 Ga0207702_12452431 Ga0207702_124524311 132
770 3300026088 Ga0207641_10011065 Ga0207641_100110656 132
771 3300026088 Ga0207641_10032328 Ga0207641_100323284 132
772 3300026088 Ga0207641_10759238 Ga0207641_107592382 132
773 3300026088 Ga0207641_12503976 Ga0207641_125039761 132
774 3300026089 Ga0207648_10005202 Ga0207648_100052026 132
775 3300026089 Ga0207648_11108229 Ga0207648_111082292 132
776 3300026095 Ga0207676_10010010 Ga0207676_100100106 132
777 3300026095 Ga0207676_10028842 Ga0207676_100288422 132
778 3300026095 Ga0207676_10335448 Ga0207676_103354482 132
779 3300026095 Ga0207676_10531351 Ga0207676_105313512 132
780 3300026116 Ga0207674_10006837 Ga0207674_100068377 132
781 3300026118 Ga0207675_100007981 Ga0207675_1000079815 132
782 3300026118 Ga0207675_100018679 Ga0207675_1000186796 132
783 3300026118 Ga0207675_100291274 Ga0207675_1002912742 132
784 3300026121 Ga0207683_10001573 Ga0207683_1000157313 132
785 3300026121 Ga0207683_10007361 Ga0207683_100073616 132
786 3300026142 Ga0207698_10006198 Ga0207698_100061985 132
787 3300026142 Ga0207698_10386879 Ga0207698_103868793 132
788 3300026142 Ga0207698_11863981 Ga0207698_118639812 132
789 3300027252 Ga0209973_1013096 Ga0209973_10130962 132
790 3300027526 Ga0209968_1013680 Ga0209968_10136802 132
791 3300027617 Ga0210002_1000356 Ga0210002_10003565 132
792 3300027665 Ga0209983_1054673 Ga0209983_10546732 132
793 3300027682 Ga0209971_1075655 Ga0209971_10756552 132
794 3300027682 Ga0209971_1093603 Ga0209971_10936032 132
795 3300027695 Ga0209966_1004797 Ga0209966_10047972 132
796 3300027695 Ga0209966_1010489 Ga0209966_10104892 132
797 3300027717 Ga0209998_10001649 Ga0209998_100016492 132
798 3300027717 Ga0209998_10004118 Ga0209998_100041182 132
799 3300027876 Ga0209974_10123856 Ga0209974_101238562 132
800 3300027907 Ga0207428_10001083 Ga0207428_1000108335 132
801 3300027907 Ga0207428_10002387 Ga0207428_100023876 132
802 3300027907 Ga0207428_10037257 Ga0207428_100372573 132
803 3300027907 Ga0207428_10047768 Ga0207428_100477682 132
804 3300028379 Ga0268266_10004945 Ga0268266_100049455 132
805 3300028379 Ga0268266_10043157 Ga0268266_100431571 132
806 3300028380 Ga0268265_10008346 Ga0268265_100083466 132
807 3300028381 Ga0268264_10010503 Ga0268264_100105035 132
808 3300028381 Ga0268264_10378234 Ga0268264_103782341 132
809 3300028556 Ga0265337_1000084 Ga0265337_100008418 132
810 3300031241 Ga0265325_10000004 Ga0265325_10000004300 132
811 3300031241 Ga0265325_10005342 Ga0265325_100053423 132
812 3300031241 Ga0265325_10007231 Ga0265325_100072316 132
813 3300031241 Ga0265325_10049126 Ga0265325_100491262 132
814 3300031242 Ga0265329_10304196 Ga0265329_103041961 132
815 3300031344 Ga0265316_10070468 Ga0265316_100704684 132
816 3300031595 Ga0265313_10000007 Ga0265313_100000073 132
817 3300031595 Ga0265313_10010130 Ga0265313_100101303 132
818 3300031595 Ga0265313_10011201 Ga0265313_100112015 132
819 3300031595 Ga0265313_10030721 Ga0265313_100307212 132
820 3300031595 Ga0265313_10067437 Ga0265313_100674372 132
821 3300031595 Ga0265313_10217268 Ga0265313_102172682 132
822 3300031691 Ga0316579_10019855 Ga0316579_100198552 132
823 3300031711 Ga0265314_10005178 Ga0265314_100051787 132
824 3300032133 Ga0316583_10119206 Ga0316583_101192062 132
825 3300034816 Ga0373930_0000522 Ga0373930_0000522_2284_2682 132
826 3300034816 Ga0373930_0002381 Ga0373930_0002381_2141_2539 132
827 3300034816 Ga0373930_0028702 Ga0373930_0028702_319_723 132
828 3300034817 Ga0373948_0000207 Ga0373948_0000207_4225_4623 132
829 3300034817 Ga0373948_0003259 Ga0373948_0003259_530_934 132
830 3300034817 Ga0373948_0041570 Ga0373948_0041570_323_721 132
831 3300034818 Ga0373950_0001618 Ga0373950_0001618_539_937 132
832 3300034818 Ga0373950_0002150 Ga0373950_0002150_522_920 132
833 3300034819 Ga0373958_0000119 Ga0373958_0000119_518_916 132
834 3300034819 Ga0373958_0001078 Ga0373958_0001078_2644_3042 132
835 3300034819 Ga0373958_0100182 Ga0373958_0100182_10_414 132
836 3300034820 Ga0373959_0015081 Ga0373959_0015081_614_1012 132
837 3300034957 Ga0373938_0000136 Ga0373938_0000136_812_1210 132
838 3300034957 Ga0373938_0001630 Ga0373938_0001630_2126_2524 132
839 3300034957 Ga0373938_0007363 Ga0373938_0007363_1477_1881 132
840 3300035083 Ga0373926_0003042 Ga0373926_0003042_4127_4531 132
841 3300035083 Ga0373926_0126310 Ga0373926_0126310_345_743 132
842 3300035084 Ga0373928_0006813 Ga0373928_0006813_1349_1747 132
843 3300035084 Ga0373928_0007096 Ga0373928_0007096_1186_1590 132
844 3300035085 Ga0373929_0013433 Ga0373929_0013433_587_985 132
845 3300035085 Ga0373929_0020968 Ga0373929_0020968_624_1022 132
846 3300035086 Ga0373934_0033532 Ga0373934_0033532_318_722 132
847 3300035088 Ga0373940_0000317 Ga0373940_0000317_6129_6527 132
848 3300035088 Ga0373940_0001806 Ga0373940_0001806_2989_3387 132
849 3300035088 Ga0373940_0023589 Ga0373940_0023589_59_463 132
850 3300035089 Ga0373944_0002779 Ga0373944_0002779_742_1146 132
851 3300035089 Ga0373944_0003433 Ga0373944_0003433_3481_3885 132
852 3300035090 Ga0373949_0020954 Ga0373949_0020954_756_1154 132
853 3300035090 Ga0373949_0025494 Ga0373949_0025494_807_1211 132
854 3300035090 Ga0373949_0030479 Ga0373949_0030479_156_554 132
855 3300035090 Ga0373949_0042818 Ga0373949_0042818_54_452 132
856 3300035091 Ga0373951_0000352 Ga0373951_0000352_1756_2154 132
857 3300035091 Ga0373951_0036923 Ga0373951_0036923_195_599 132
858 3300035092 Ga0373952_0015624 Ga0373952_0015624_552_950 132
859 3300035092 Ga0373952_0033637 Ga0373952_0033637_297_701 132
860 3300035111 Ga0373923_0046149 Ga0373923_0046149_770_1174 132
861 3300035111 Ga0373923_0107756 Ga0373923_0107756_568_966 132
862 3300035112 Ga0373932_0001597 Ga0373932_0001597_4192_4590 132
863 3300035112 Ga0373932_0004213 Ga0373932_0004213_2236_2634 132
864 3300035112 Ga0373932_0247962 Ga0373932_0247962_52_450 132
865 3300035113 Ga0373936_0027193 Ga0373936_0027193_691_1095 132
866 3300035113 Ga0373936_0033702 Ga0373936_0033702_1546_1944 132
867 3300035114 Ga0373939_0001258 Ga0373939_0001258_3146_3544 132
868 3300035114 Ga0373939_0001317 Ga0373939_0001317_697_1095 132
869 3300035114 Ga0373939_0107341 Ga0373939_0107341_411_809 132
870 3300035114 Ga0373939_0114216 Ga0373939_0114216_23_421 132
871 3300035115 Ga0373941_0000684 Ga0373941_0000684_3456_3854 132
872 3300035115 Ga0373941_0004179 Ga0373941_0004179_2904_3302 132
873 3300035115 Ga0373941_0004362 Ga0373941_0004362_63_470 132
874 3300035115 Ga0373941_0125768 Ga0373941_0125768_331_735 132
875 3300035115 Ga0373941_0266297 Ga0373941_0266297_199_597 132
876 3300035116 Ga0373945_0000444 Ga0373945_0000444_11139_11543 132
877 3300035116 Ga0373945_0059620 Ga0373945_0059620_683_1081 132
878 3300035117 Ga0373953_0039028 Ga0373953_0039028_997_1401 132
879 3300035119 Ga0373956_0477517 Ga0373956_0477517_152_553 132
880 3300035121 Ga0373960_0002495 Ga0373960_0002495_3278_3676 132
881 3300035121 Ga0373960_0013443 Ga0373960_0013443_875_1273 132
882 3300035170 Ga0373943_0002844 Ga0373943_0002844_2639_3043 132
883 3300035170 Ga0373943_0012748 Ga0373943_0012748_587_991 132
884 3300035170 Ga0373943_0256957 Ga0373943_0256957_380_778 132
885 3300035171 Ga0373946_0005803 Ga0373946_0005803_1365_1769 132
886 3300035171 Ga0373946_0014632 Ga0373946_0014632_1891_2289 132
887 3300035171 Ga0373946_0134242 Ga0373946_0134242_581_985 132
888 3300035172 Ga0373955_0005412 Ga0373955_0005412_3623_4021 132
889 3300035172 Ga0373955_0049371 Ga0373955_0049371_1298_1702 132
890 3300035172 Ga0373955_0256975 Ga0373955_0256975_98_496 132
891 3300035207 Ga0373942_0000740 Ga0373942_0000740_6618_7016 132
892 3300035207 Ga0373942_0029203 Ga0373942_0029203_786_1190 132
893 3300035207 Ga0373942_0050087 Ga0373942_0050087_392_790 132
894 3300035241 Ga0373961_0039334 Ga0373961_0039334_397_795 132
895 3300035241 Ga0373961_0049152 Ga0373961_0049152_616_1020 132
896 3300035242 Ga0373962_0001159 Ga0373962_0001159_3451_3855 132
897 3300035242 Ga0373962_0001592 Ga0373962_0001592_2457_2855 132
898 3300035242 Ga0373962_0005508 Ga0373962_0005508_2488_2886 132
899 3300035410 Ga0373924_0016852 Ga0373924_0016852_1787_2191 132
900 3300035410 Ga0373924_0128360 Ga0373924_0128360_183_581 132
901 3300035691 Ga0373931_0002481 Ga0373931_0002481_4729_5127 132
902 3300035691 Ga0373931_0005853 Ga0373931_0005853_2258_2662 132
903 3300035691 Ga0373931_0021299 Ga0373931_0021299_639_1037 132
904 3300035691 Ga0373931_0243023 Ga0373931_0243023_104_502 132
905 3300035691 Ga0373931_0275962 Ga0373931_0275962_418_816 132
906 3300035692 Ga0373935_0036203 Ga0373935_0036203_1060_1458 132
907 3300035692 Ga0373935_0052998 Ga0373935_0052998_1940_2344 132
908 3300035692 Ga0373935_0313914 Ga0373935_0313914_499_897 132
909 3300035695 Ga0373927_0020155 Ga0373927_0020155_955_1359 132
910 3300035695 Ga0373927_0078654 Ga0373927_0078654_293_697 132
911 3300035724 Ga0373933_0016859 Ga0373933_0016859_3116_3520 132
912 3300035725 Ga0373947_0008865 Ga0373947_0008865_5114_5518 132
913 3300035725 Ga0373947_0059852 Ga0373947_0059852_132_536 132
914 3300035725 Ga0373947_0220392 Ga0373947_0220392_718_1116 132
915 3300036401 Ga0373937_0019711 Ga0373937_0019711_4951_5349 132
916 3300036401 Ga0373937_0024895 Ga0373937_0024895_1807_2211 132
917 3300036401 Ga0373937_0256564 Ga0373937_0256564_709_1107 132
918 3300037068 Ga0373925_0022568 Ga0373925_0022568_2296_2700 132
919 3300037068 Ga0373925_0260651 Ga0373925_0260651_143_547 132
920 3300037068 Ga0373925_0529961 Ga0373925_0529961_400_798 132
921 3300037466 Ga0395898_0246929 Ga0395898_0246929_206_604 132
922 3300037471 Ga0395905_0351661 Ga0395905_0351661_145_543 132
923 3300037471 Ga0395905_0396195 Ga0395905_0396195_677_1081 132
924 3300038443 Ga0395901_0284993 Ga0395901_0284993_799_1197 132
925 3300039437 Ga0436365_0046933 Ga0436365_0046933_1287_1685 132
926 3300039450 Ga0436363_0525343 Ga0436363_0525343_267_665 132
927 3300039450 Ga0436363_1559933 Ga0436363_1559933_307_714 132
928 3300039453 Ga0436362_0203879 Ga0436362_0203879_40_438 132
929 3300042001 Ga0439441_046799 Ga0439441_046799_136_534 132
930 3300042003 Ga0439443_094701 Ga0439443_094701_143_547 132
931 3300042005 Ga0439448_0069162 Ga0439448_0069162_537_935 132
932 3300042016 Ga0439463_047681 Ga0439463_047681_398_796 132
933 3300042157 Ga0439458_0159579 Ga0439458_0159579_188_586 132
934 3300042461 Ga0439460_0128340 Ga0439460_0128340_296_694 132
935 3300042532 Ga0450893_0039090 Ga0450893_0039090_215_613 132
936 3300042876 Ga0451577_0218048 Ga0451577_0218048_1153_1551 132
937 3300044673 Ga0453683_0831478 Ga0453683_0831478_80_478 132
938 3300044712 Ga0453684_0238266 Ga0453684_0238266_482_880 132
939 3300044735 Ga0466968_0260058 Ga0466968_0260058_120_518 132
940 3300044901 Ga0466960_1041151 Ga0466960_1041151_35_433 132
941 3300045051 Ga0451576_2136156 Ga0451576_2136156_155_553 132
942 3300045976 Ga0466967_0796528 Ga0466967_0796528_309_707 132
943 3300046452 Ga0495617_142826 Ga0495617_142826_329_733 132
944 3300046453 Ga0495627_135117 Ga0495627_135117_108_512 132
945 3300046454 Ga0495592_0013629 Ga0495592_0013629_2335_2739 132
946 3300046455 Ga0495603_0003568 Ga0495603_0003568_3132_3536 132
947 3300046455 Ga0495603_0042555 Ga0495603_0042555_1041_1445 132
948 3300046457 Ga0495590_0255714 Ga0495590_0255714_153_551 132
949 3300046458 Ga0495591_043569 Ga0495591_043569_693_1097 132
950 3300046459 Ga0495629_0000026 Ga0495629_0000026_40041_40445 132
951 3300046459 Ga0495629_0043412 Ga0495629_0043412_2389_2787 132
952 3300046459 Ga0495629_0135058 Ga0495629_0135058_596_1000 132
953 3300046459 Ga0495629_0209850 Ga0495629_0209850_27_452 132
954 3300046460 Ga0495638_0019857 Ga0495638_0019857_1302_1700 132
955 3300046461 Ga0495641_0004477 Ga0495641_0004477_1186_1590 132
956 3300046461 Ga0495641_0034677 Ga0495641_0034677_365_769 132
957 3300046462 Ga0495651_0014452 Ga0495651_0014452_4108_4512 132
958 3300046462 Ga0495651_0260694 Ga0495651_0260694_659_1057 132
959 3300046462 Ga0495651_0741785 Ga0495651_0741785_35_433 132
960 3300046463 Ga0495653_0001127 Ga0495653_0001127_3591_3995 132
961 3300046463 Ga0495653_0072619 Ga0495653_0072619_1252_1650 132
962 3300046463 Ga0495653_0226283 Ga0495653_0226283_809_1207 132
963 3300046463 Ga0495653_0360917 Ga0495653_0360917_359_763 132
964 3300046472 Ga0495580_0027297 Ga0495580_0027297_3608_4012 132
965 3300046472 Ga0495580_0565596 Ga0495580_0565596_293_697 132
966 3300046473 Ga0495582_0010491 Ga0495582_0010491_2646_3050 132
967 3300046473 Ga0495582_0058674 Ga0495582_0058674_1241_1645 132
968 3300046475 Ga0495639_0010995 Ga0495639_0010995_695_1099 132
969 3300046475 Ga0495639_0043613 Ga0495639_0043613_1401_1799 132
970 3300046476 Ga0495662_0007866 Ga0495662_0007866_1828_2232 132
971 3300046476 Ga0495662_0028788 Ga0495662_0028788_2101_2499 132
972 3300046477 Ga0495664_0016991 Ga0495664_0016991_1044_1442 132
973 3300046477 Ga0495664_0356419 Ga0495664_0356419_166_570 132
974 3300046491 Ga0495584_0027043 Ga0495584_0027043_638_1042 132
975 3300046491 Ga0495584_0034116 Ga0495584_0034116_1038_1436 132
976 3300046491 Ga0495584_0392578 Ga0495584_0392578_53_451 132
977 3300046492 Ga0495585_0002589 Ga0495585_0002589_2684_3088 132
978 3300046499 Ga0495594_0015595 Ga0495594_0015595_3561_3965 132
979 3300046499 Ga0495594_0018783 Ga0495594_0018783_1685_2089 132
980 3300046501 Ga0495607_0019758 Ga0495607_0019758_1891_2295 132
981 3300046506 Ga0495583_0196776 Ga0495583_0196776_126_530 132
982 3300046511 Ga0495608_0023222 Ga0495608_0023222_729_1133 132
983 3300046511 Ga0495608_0031115 Ga0495608_0031115_25_450 132
984 3300046511 Ga0495608_0794781 Ga0495608_0794781_51_449 132
985 3300046514 Ga0495618_0020481 Ga0495618_0020481_1466_1870 132
986 3300046514 Ga0495618_0110135 Ga0495618_0110135_661_1059 132
987 3300046514 Ga0495618_0275136 Ga0495618_0275136_559_984 132
988 3300046516 Ga0495628_0073444 Ga0495628_0073444_1906_2310 132
989 3300046517 Ga0495630_0038946 Ga0495630_0038946_3009_3413 132
990 3300046517 Ga0495630_0434976 Ga0495630_0434976_406_831 132
991 3300046517 Ga0495630_0553755 Ga0495630_0553755_382_786 132
992 3300046517 Ga0495630_0775097 Ga0495630_0775097_197_595 132
993 3300046518 Ga0495631_0083763 Ga0495631_0083763_948_1352 132
994 3300046519 Ga0495632_0343492 Ga0495632_0343492_57_461 132
995 3300046520 Ga0495637_0234640 Ga0495637_0234640_110_508 132
996 3300046523 Ga0495644_0006337 Ga0495644_0006337_2132_2536 132
997 3300046525 Ga0495663_0345211 Ga0495663_0345211_53_457 132
998 3300046526 Ga0495666_0018297 Ga0495666_0018297_846_1250 132
999 3300046529 Ga0495652_0035091 Ga0495652_0035091_893_1297 132
1000 3300046531 Ga0495665_0031973 Ga0495665_0031973_940_1344 132
1001 3300046531 Ga0495665_0223932 Ga0495665_0223932_152_550 132
1002 3300046533 Ga0495640_0069472 Ga0495640_0069472_786_1184 132
1003 3300046535 Ga0495586_0056472 Ga0495586_0056472_1203_1601 132
1004 3300046536 Ga0495587_0066135 Ga0495587_0066135_997_1401 132
1005 3300046538 Ga0495609_0050504 Ga0495609_0050504_457_855 132
1006 3300046543 Ga0495645_0378984 Ga0495645_0378984_201_605 132
1007 3300046557 Ga0495622_0041126 Ga0495622_0041126_500_904 132
1008 3300046559 Ga0495667_0001963 Ga0495667_0001963_685_1089 132
1009 3300046559 Ga0495667_0080018 Ga0495667_0080018_1207_1605 132
1010 3300046559 Ga0495667_0181805 Ga0495667_0181805_341_739 132
1011 3300046615 Ga0495656_0013876 Ga0495656_0013876_1509_1913 132
1012 3300046642 Ga0495634_0080755 Ga0495634_0080755_196_594 132
1013 3300046642 Ga0495634_0110840 Ga0495634_0110840_14_412 132
1014 3300046648 Ga0495611_0037029 Ga0495611_0037029_1564_1968 132
1015 3300046663 Ga0495635_0014610 Ga0495635_0014610_2076_2474 132
1016 3300046663 Ga0495635_0070022 Ga0495635_0070022_1131_1535 132
1017 3300046664 Ga0495659_0004803 Ga0495659_0004803_338_742 132
1018 3300046664 Ga0495659_0272879 Ga0495659_0272879_271_669 132
1019 3300046665 Ga0495661_0108429 Ga0495661_0108429_618_1022 132
1020 3300046674 Ga0495588_0038816 Ga0495588_0038816_1171_1575 132
1021 3300046674 Ga0495588_0199469 Ga0495588_0199469_345_743 132
1022 3300046674 Ga0495588_0647046 Ga0495588_0647046_113_517 132
1023 3300046675 Ga0495657_0048822 Ga0495657_0048822_73_477 132
1024 3300046675 Ga0495657_0084119 Ga0495657_0084119_1014_1412 132
1025 3300046678 Ga0495599_0060690 Ga0495599_0060690_1463_1867 132
1026 3300046678 Ga0495599_0293491 Ga0495599_0293491_306_704 132
1027 3300046680 Ga0495646_0000441 Ga0495646_0000441_14784_15188 132
1028 3300046681 Ga0495647_0005283 Ga0495647_0005283_345_749 132
1029 3300046681 Ga0495647_0070237 Ga0495647_0070237_232_630 132
1030 3300046683 Ga0495658_0001832 Ga0495658_0001832_5774_6178 132
1031 3300046683 Ga0495658_0002039 Ga0495658_0002039_951_1355 132
1032 3300046684 Ga0495669_0101694 Ga0495669_0101694_409_807 132
1033 3300046684 Ga0495669_0199410 Ga0495669_0199410_253_657 132
1034 3300046689 Ga0495613_0045559 Ga0495613_0045559_76_474 132
1035 3300046689 Ga0495613_0056219 Ga0495613_0056219_823_1227 132
1036 3300046689 Ga0495613_0244292 Ga0495613_0244292_474_878 132
1037 3300046690 Ga0495624_0007737 Ga0495624_0007737_600_1004 132
1038 3300046691 Ga0495670_0001358 Ga0495670_0001358_11161_11565 132
1039 3300046692 Ga0495671_0044870 Ga0495671_0044870_856_1260 132
1040 3300046794 Ga0495589_0134346 Ga0495589_0134346_758_1162 132
1041 3300046809 Ga0495600_0014244 Ga0495600_0014244_605_1009 132
1042 3300046809 Ga0495600_0145651 Ga0495600_0145651_376_774 132
1043 3300047315 Ga0495581_0004822 Ga0495581_0004822_5174_5578 132
1044 3300047315 Ga0495581_0020165 Ga0495581_0020165_3284_3688 132
1045 3300047317 Ga0495604_0033318 Ga0495604_0033318_3091_3495 132
1046 3300047317 Ga0495604_0100659 Ga0495604_0100659_1388_1786 132
1047 3300047319 Ga0495674_0032302 Ga0495674_0032302_1914_2312 132
1048 3300047319 Ga0495674_0043888 Ga0495674_0043888_3232_3630 132
1049 3300047319 Ga0495674_0115171 Ga0495674_0115171_1272_1676 132
1050 3300047321 Ga0495676_0023279 Ga0495676_0023279_4395_4799 132
1051 3300047321 Ga0495676_0033941 Ga0495676_0033941_132_536 132
1052 3300047321 Ga0495676_0073019 Ga0495676_0073019_1069_1467 132
1053 3300047322 Ga0495680_0002496 Ga0495680_0002496_8760_9164 132
1054 3300047322 Ga0495680_0217076 Ga0495680_0217076_413_811 132
1055 3300047444 Ga0495675_0484990 Ga0495675_0484990_179_583 132
1056 3300047446 Ga0495679_036582 Ga0495679_036582_807_1211 132
1057 3300047471 Ga0495684_0001561 Ga0495684_0001561_10864_11268 132
1058 3300047673 Ga0495593_0003976 Ga0495593_0003976_5148_5552 132
1059 3300047673 Ga0495593_0024539 Ga0495593_0024539_1803_2207 132
1060 3300047673 Ga0495593_0339025 Ga0495593_0339025_108_533 132
1061 3300047673 Ga0495593_0367113 Ga0495593_0367113_121_519 132
1062 3300048088 Ga0495602_0154194 Ga0495602_0154194_1047_1445 132
1063 3300048088 Ga0495602_0489886 Ga0495602_0489886_365_763 132
1064 3300048089 Ga0495614_0012956 Ga0495614_0012956_562_966 132
1065 3300048091 Ga0495626_0305292 Ga0495626_0305292_150_548 132
1066 3300048903 Ga0496100_0027252 Ga0496100_0027252_2770_3168 132
1067 3300048903 Ga0496100_0071984 Ga0496100_0071984_215_619 132
1068 3300048903 Ga0496100_0583208 Ga0496100_0583208_439_843 132
1069 3300048904 Ga0496101_0024341 Ga0496101_0024341_3606_4004 132
1070 3300048904 Ga0496101_0087092 Ga0496101_0087092_865_1269 132
1071 3300048904 Ga0496101_0209750 Ga0496101_0209750_941_1339 132
1072 3300048904 Ga0496101_1178789 Ga0496101_1178789_140_538 132
1073 3300048905 Ga0496102_0078981 Ga0496102_0078981_65_463 132
1074 3300048905 Ga0496102_0134912 Ga0496102_0134912_1656_2060 132
1075 3300048905 Ga0496102_0172942 Ga0496102_0172942_280_678 132
1076 3300048905 Ga0496102_0290975 Ga0496102_0290975_921_1325 132
1077 3300048905 Ga0496102_0416756 Ga0496102_0416756_346_744 132
1078 3300048905 Ga0496102_0815164 Ga0496102_0815164_147_545 132
1079 3300048906 Ga0496103_0014204 Ga0496103_0014204_649_1053 132
1080 3300048906 Ga0496103_0041169 Ga0496103_0041169_1113_1511 132
1081 3300048906 Ga0496103_0114562 Ga0496103_0114562_1062_1460 132
1082 3300048907 Ga0496104_0036888 Ga0496104_0036888_221_619 132
1083 3300048907 Ga0496104_0086099 Ga0496104_0086099_1341_1739 132
1084 3300048907 Ga0496104_0158062 Ga0496104_0158062_560_958 132
1085 3300048907 Ga0496104_0174253 Ga0496104_0174253_921_1325 132
1086 3300048907 Ga0496104_1216550 Ga0496104_1216550_14_418 132
1087 3300048908 Ga0496105_0053793 Ga0496105_0053793_1052_1456 132
1088 3300048908 Ga0496105_0054998 Ga0496105_0054998_2442_2840 132
1089 3300048908 Ga0496105_0072068 Ga0496105_0072068_730_1134 132
1090 3300048908 Ga0496105_0108773 Ga0496105_0108773_1500_1898 132
1091 3300048909 Ga0496106_0012080 Ga0496106_0012080_1344_1742 132
1092 3300048909 Ga0496106_0014266 Ga0496106_0014266_4144_4542 132
1093 3300048909 Ga0496106_0028485 Ga0496106_0028485_921_1325 132
1094 3300048909 Ga0496106_0092323 Ga0496106_0092323_87_491 132
1095 3300048909 Ga0496106_0210637 Ga0496106_0210637_365_763 132
1096 3300048910 Ga0496107_0017646 Ga0496107_0017646_4588_4986 132
1097 3300048910 Ga0496107_0386979 Ga0496107_0386979_134_532 132
1098 3300048911 Ga0496108_0008337 Ga0496108_0008337_3897_4295 132
1099 3300048911 Ga0496108_0024695 Ga0496108_0024695_2236_2634 132
1100 3300048911 Ga0496108_0202868 Ga0496108_0202868_1287_1685 132
1101 3300048911 Ga0496108_0204929 Ga0496108_0204929_583_987 132
1102 3300048912 Ga0496109_0001436 Ga0496109_0001436_17142_17540 132
1103 3300048912 Ga0496109_0010380 Ga0496109_0010380_1285_1683 132
1104 3300048912 Ga0496109_0202885 Ga0496109_0202885_593_997 132
1105 3300048912 Ga0496109_0279765 Ga0496109_0279765_593_997 132
1106 3300048913 Ga0496110_0028055 Ga0496110_0028055_1919_2317 132
1107 3300048913 Ga0496110_0032476 Ga0496110_0032476_3766_4164 132
1108 3300048913 Ga0496110_0076100 Ga0496110_0076100_1869_2273 132
1109 3300048913 Ga0496110_0517767 Ga0496110_0517767_449_847 132
1110 3300048913 Ga0496110_0635743 Ga0496110_0635743_370_774 132
1111 3300048914 Ga0496111_0186539 Ga0496111_0186539_215_613 132
1112 3300048914 Ga0496111_0282733 Ga0496111_0282733_733_1131 132
1113 3300048914 Ga0496111_0284447 Ga0496111_0284447_98_502 132
1114 3300048915 Ga0496112_0086430 Ga0496112_0086430_2395_2793 132
1115 3300048915 Ga0496112_0139851 Ga0496112_0139851_725_1129 132
1116 3300048915 Ga0496112_0216278 Ga0496112_0216278_853_1251 132
1117 3300048915 Ga0496112_0491151 Ga0496112_0491151_199_603 132
1118 3300048915 Ga0496112_1232522 Ga0496112_1232522_130_528 132
1119 3300048915 Ga0496112_1288034 Ga0496112_1288034_20_418 132
1120 3300048916 Ga0496113_0016976 Ga0496113_0016976_1582_1980 132
1121 3300048916 Ga0496113_0099376 Ga0496113_0099376_1288_1692 132
1122 3300048916 Ga0496113_0162329 Ga0496113_0162329_974_1372 132
1123 3300048916 Ga0496113_0249286 Ga0496113_0249286_753_1157 132
1124 3300048916 Ga0496113_0362223 Ga0496113_0362223_309_707 132
1125 3300048917 Ga0496114_0019963 Ga0496114_0019963_1296_1694 132
1126 3300048917 Ga0496114_0027029 Ga0496114_0027029_1049_1453 132
1127 3300048918 Ga0496115_0014263 Ga0496115_0014263_2962_3360 132
1128 3300048918 Ga0496115_0072542 Ga0496115_0072542_1869_2273 132
1129 3300048918 Ga0496115_0078506 Ga0496115_0078506_1077_1475 132
1130 3300048918 Ga0496115_0157288 Ga0496115_0157288_222_626 132
1131 3300048918 Ga0496115_0246812 Ga0496115_0246812_359_757 132
1132 3300048918 Ga0496115_0463221 Ga0496115_0463221_351_749 132
1133 3300048927 Ga0496124_0196048 Ga0496124_0196048_350_754 132
1134 3300049568 Ga0501031_0119167 Ga0501031_0119167_61_468 132
1135 3300049568 Ga0501031_0481184 Ga0501031_0481184_253_657 132
1136 3300049568 Ga0501031_0505265 Ga0501031_0505265_317_718 132
1137 3300049569 Ga0501032_0013494 Ga0501032_0013494_2695_3093 132
1138 3300049569 Ga0501032_0030048 Ga0501032_0030048_3135_3539 132
1139 3300049569 Ga0501032_0030495 Ga0501032_0030495_1750_2157 132
1140 3300049569 Ga0501032_0041695 Ga0501032_0041695_2465_2866 132
1141 3300049569 Ga0501032_0113306 Ga0501032_0113306_27_428 132
1142 3300049569 Ga0501032_0893611 Ga0501032_0893611_16_414 132
1143 3300049570 Ga0501033_0018177 Ga0501033_0018177_3307_3714 132
1144 3300049570 Ga0501033_0022037 Ga0501033_0022037_1588_1989 132
1145 3300049570 Ga0501033_0817258 Ga0501033_0817258_142_549 132
1146 3300049571 Ga0501034_0000119 Ga0501034_0000119_113619_114026 132
1147 3300049571 Ga0501034_0000295 Ga0501034_0000295_43110_43508 132
1148 3300049571 Ga0501034_0046962 Ga0501034_0046962_3130_3528 132
1149 3300049571 Ga0501034_0061324 Ga0501034_0061324_2039_2446 132
1150 3300049571 Ga0501034_0094059 Ga0501034_0094059_2173_2571 132
1151 3300049571 Ga0501034_0125461 Ga0501034_0125461_1493_1894 132
1152 3300049571 Ga0501034_0132868 Ga0501034_0132868_1735_2139 132
1153 3300049571 Ga0501034_0162892 Ga0501034_0162892_146_553 132
1154 3300049571 Ga0501034_0164017 Ga0501034_0164017_134_535 132
1155 3300049571 Ga0501034_0207434 Ga0501034_0207434_142_540 132
1156 3300049571 Ga0501034_0484717 Ga0501034_0484717_625_1032 132
1157 3300049571 Ga0501034_1135518 Ga0501034_1135518_169_570 132
1158 3300049572 Ga0501036_0000217 Ga0501036_0000217_15072_15470 132
1159 3300049572 Ga0501036_0015649 Ga0501036_0015649_2919_3317 132
1160 3300049572 Ga0501036_0085226 Ga0501036_0085226_128_529 132
1161 3300049572 Ga0501036_0125828 Ga0501036_0125828_409_813 132
1162 3300049573 Ga0501037_0005649 Ga0501037_0005649_7757_8155 132
1163 3300049573 Ga0501037_0030885 Ga0501037_0030885_923_1324 132
1164 3300049573 Ga0501037_0102725 Ga0501037_0102725_151_558 132
1165 3300049573 Ga0501037_0181847 Ga0501037_0181847_461_865 132
1166 3300049573 Ga0501037_0599332 Ga0501037_0599332_298_696 132
1167 3300049574 Ga0501038_0059504 Ga0501038_0059504_1706_2113 132
1168 3300049574 Ga0501038_0066167 Ga0501038_0066167_1889_2296 132
1169 3300049574 Ga0501038_0070026 Ga0501038_0070026_1768_2172 132
1170 3300049574 Ga0501038_0161604 Ga0501038_0161604_1389_1787 132
1171 3300049575 Ga0501039_0029800 Ga0501039_0029800_1482_1889 132
1172 3300049575 Ga0501039_0032655 Ga0501039_0032655_980_1378 132
1173 3300049575 Ga0501039_0107130 Ga0501039_0107130_466_870 132
1174 3300049575 Ga0501039_0369114 Ga0501039_0369114_21_422 132
1175 3300049576 Ga0501040_0201463 Ga0501040_0201463_106_513 132
1176 3300049577 Ga0501041_0114873 Ga0501041_0114873_486_884 132
1177 3300049578 Ga0501042_0052453 Ga0501042_0052453_1588_1995 132
1178 3300049578 Ga0501042_0421525 Ga0501042_0421525_55_453 132
1179 3300049579 Ga0501043_0003332 Ga0501043_0003332_4670_5068 132
1180 3300049579 Ga0501043_0017020 Ga0501043_0017020_2822_3229 132
1181 3300049579 Ga0501043_0017410 Ga0501043_0017410_34_438 132
1182 3300049579 Ga0501043_0026456 Ga0501043_0026456_2977_3384 132
1183 3300049579 Ga0501043_0071282 Ga0501043_0071282_1865_2269 132
1184 3300049580 Ga0501046_0015683 Ga0501046_0015683_4787_5185 132
1185 3300049580 Ga0501046_0062038 Ga0501046_0062038_1715_2119 132
1186 3300049580 Ga0501046_0116958 Ga0501046_0116958_1483_1890 132
1187 3300049580 Ga0501046_0338984 Ga0501046_0338984_268_669 132
1188 3300049580 Ga0501046_0361638 Ga0501046_0361638_335_733 132
1189 3300049581 Ga0501047_0000382 Ga0501047_0000382_40739_41137 132
1190 3300049581 Ga0501047_0059632 Ga0501047_0059632_420_818 132
1191 3300049581 Ga0501047_0084933 Ga0501047_0084933_1117_1518 132
1192 3300049581 Ga0501047_0104436 Ga0501047_0104436_1271_1678 132
1193 3300049581 Ga0501047_0161333 Ga0501047_0161333_1249_1653 132
1194 3300049581 Ga0501047_0187580 Ga0501047_0187580_1326_1727 132
1195 3300049581 Ga0501047_0271364 Ga0501047_0271364_994_1401 132
1196 3300049581 Ga0501047_1084058 Ga0501047_1084058_109_516 132
1197 3300049582 Ga0501048_0000031 Ga0501048_0000031_33993_34391 132
1198 3300049582 Ga0501048_0522484 Ga0501048_0522484_356_763 132
1199 3300049582 Ga0501048_0773744 Ga0501048_0773744_198_602 132
1200 3300049583 Ga0501067_0125630 Ga0501067_0125630_1016_1414 132
1201 3300049583 Ga0501067_0370555 Ga0501067_0370555_309_707 132
1202 3300049584 Ga0501068_0014827 Ga0501068_0014827_1995_2402 132
1203 3300049584 Ga0501068_0299919 Ga0501068_0299919_270_677 132
1204 3300049584 Ga0501068_0509073 Ga0501068_0509073_222_626 132
1205 3300049584 Ga0501068_1032069 Ga0501068_1032069_60_458 132
1206 3300049585 Ga0501069_0005180 Ga0501069_0005180_5502_5900 132
1207 3300049585 Ga0501069_0085153 Ga0501069_0085153_1180_1587 132
1208 3300049585 Ga0501069_0317846 Ga0501069_0317846_233_631 132
1209 3300049585 Ga0501069_0327607 Ga0501069_0327607_352_759 132
1210 3300049586 Ga0501070_0001016 Ga0501070_0001016_1288_1686 132
1211 3300049586 Ga0501070_0002811 Ga0501070_0002811_14304_14702 132
1212 3300049586 Ga0501070_0013957 Ga0501070_0013957_3745_4143 132
1213 3300049586 Ga0501070_0021765 Ga0501070_0021765_4015_4416 132
1214 3300049586 Ga0501070_0029649 Ga0501070_0029649_2106_2510 132
1215 3300049586 Ga0501070_0057042 Ga0501070_0057042_1633_2037 132
1216 3300049586 Ga0501070_0069542 Ga0501070_0069542_1690_2097 132
1217 3300049586 Ga0501070_0089361 Ga0501070_0089361_1175_1576 132
1218 3300049586 Ga0501070_0121700 Ga0501070_0121700_1022_1420 132
1219 3300049586 Ga0501070_0982427 Ga0501070_0982427_206_604 132
1220 3300049586 Ga0501070_1172421 Ga0501070_1172421_74_475 132
1221 3300049587 Ga0501071_0030320 Ga0501071_0030320_370_768 132
1222 3300049587 Ga0501071_0154038 Ga0501071_0154038_1047_1454 132
1223 3300049587 Ga0501071_0293684 Ga0501071_0293684_364_768 132
1224 3300049587 Ga0501071_0663926 Ga0501071_0663926_49_447 132
1225 3300049588 Ga0501072_0022803 Ga0501072_0022803_744_1151 132
1226 3300049588 Ga0501072_0074818 Ga0501072_0074818_196_594 132
1227 3300049588 Ga0501072_0177808 Ga0501072_0177808_457_864 132
1228 3300049589 Ga0501073_0080667 Ga0501073_0080667_860_1264 132
1229 3300049589 Ga0501073_0224668 Ga0501073_0224668_715_1113 132
1230 3300049590 Ga0501074_0008300 Ga0501074_0008300_4566_4964 132
1231 3300049590 Ga0501074_0185035 Ga0501074_0185035_113_511 132
1232 3300049590 Ga0501074_0211463 Ga0501074_0211463_552_956 132
1233 3300049590 Ga0501074_0262757 Ga0501074_0262757_529_927 132
1234 3300049590 Ga0501074_1219601 Ga0501074_1219601_63_461 132
1235 3300049591 Ga0501075_0077296 Ga0501075_0077296_350_748 132
1236 3300049591 Ga0501075_0616665 Ga0501075_0616665_259_666 132
1237 3300049592 Ga0501076_0032448 Ga0501076_0032448_1049_1447 132
1238 3300049592 Ga0501076_0177319 Ga0501076_0177319_1265_1672 132
1239 3300049592 Ga0501076_0882470 Ga0501076_0882470_102_500 132
1240 3300049593 Ga0501077_0404604 Ga0501077_0404604_199_606 132
1241 3300049593 Ga0501077_1018955 Ga0501077_1018955_11_409 132
1242 3300049741 Ga0501079_0067849 Ga0501079_0067849_34_441 132
1243 3300049741 Ga0501079_0118458 Ga0501079_0118458_723_1130 132
1244 3300049741 Ga0501079_0576486 Ga0501079_0576486_269_667 132
1245 3300049741 Ga0501079_1070154 Ga0501079_1070154_23_421 132
1246 3300049742 Ga0501080_0000478 Ga0501080_0000478_6513_6911 132
1247 3300049742 Ga0501080_0018449 Ga0501080_0018449_1715_2119 132
1248 3300049742 Ga0501080_0044744 Ga0501080_0044744_1645_2052 132
1249 3300049742 Ga0501080_0060557 Ga0501080_0060557_963_1394 132
1250 3300049742 Ga0501080_0078605 Ga0501080_0078605_154_552 132
1251 3300049742 Ga0501080_0079462 Ga0501080_0079462_1171_1569 132
1252 3300049742 Ga0501080_0102716 Ga0501080_0102716_994_1401 132
1253 3300049742 Ga0501080_0182341 Ga0501080_0182341_53_457 132
1254 3300049742 Ga0501080_0363174 Ga0501080_0363174_435_833 132
1255 3300049742 Ga0501080_0598674 Ga0501080_0598674_203_601 132
1256 3300049743 Ga0501081_0251132 Ga0501081_0251132_825_1232 132
1257 3300049743 Ga0501081_0335301 Ga0501081_0335301_86_484 132
1258 3300049744 Ga0501083_0002087 Ga0501083_0002087_3537_3935 132
1259 3300049744 Ga0501083_0028276 Ga0501083_0028276_1690_2121 132
1260 3300049744 Ga0501083_0035143 Ga0501083_0035143_957_1364 132
1261 3300049744 Ga0501083_0080311 Ga0501083_0080311_120_527 132
1262 3300049744 Ga0501083_0162264 Ga0501083_0162264_759_1157 132
1263 3300049744 Ga0501083_0333830 Ga0501083_0333830_210_608 132
1264 3300049744 Ga0501083_0562825 Ga0501083_0562825_69_467 132
1265 3300049822 Ga0501035_0000459 Ga0501035_0000459_3562_3960 132
1266 3300049822 Ga0501035_0069186 Ga0501035_0069186_1654_2052 132
1267 3300049822 Ga0501035_0098973 Ga0501035_0098973_514_918 132
1268 3300049822 Ga0501035_0137123 Ga0501035_0137123_1356_1757 132
1269 3300049822 Ga0501035_0229742 Ga0501035_0229742_665_1072 132
1270 3300049822 Ga0501035_0281305 Ga0501035_0281305_212_613 132
1271 3300049822 Ga0501035_0746128 Ga0501035_0746128_211_609 132
1272 3300049823 Ga0501044_0001546 Ga0501044_0001546_18836_19234 132
1273 3300049823 Ga0501044_0056322 Ga0501044_0056322_3573_3974 132
1274 3300049823 Ga0501044_0059115 Ga0501044_0059115_1461_1868 132
1275 3300049823 Ga0501044_0108606 Ga0501044_0108606_149_547 132
1276 3300049823 Ga0501044_0130294 Ga0501044_0130294_305_709 132
1277 3300049823 Ga0501044_1031473 Ga0501044_1031473_230_631 132
1278 3300049824 Ga0501045_0174348 Ga0501045_0174348_344_748 132
1279 3300049824 Ga0501045_0273225 Ga0501045_0273225_459_857 132
1280 3300049824 Ga0501045_0405780 Ga0501045_0405780_181_579 132
1281 3300050491 nmdc:mga00v17_745321_c1 nmdc:mga00v17_745321_c1_31_432 132
1282 3300050493 nmdc:mga0k408_234956_c1 nmdc:mga0k408_234956_c1_340_738 132
1283 3300050494 nmdc:mga06z11_191541_c1 nmdc:mga06z11_191541_c1_490_888 132
1284 3300050494 nmdc:mga06z11_488795_c1 nmdc:mga06z11_488795_c1_236_634 132
1285 3300050494 nmdc:mga06z11_699022_c1 nmdc:mga06z11_699022_c1_66_464 132
1286 3300050496 nmdc:mga07m45_54632_c1 nmdc:mga07m45_54632_c1_234_632 132
1287 3300050507 nmdc:mga05p37_129_c1 nmdc:mga05p37_129_c1_44528_44959 132
1288 3300050507 nmdc:mga05p37_3739_c1 nmdc:mga05p37_3739_c1_432_863 132
1289 3300050507 nmdc:mga05p37_87159_c1 nmdc:mga05p37_87159_c1_2242_2640 132
1290 3300050508 nmdc:mga09592_4639_c1 nmdc:mga09592_4639_c1_4301_4732 132
1291 3300050509 nmdc:mga0qj67_18305_c1 nmdc:mga0qj67_18305_c1_2894_3325 132
1292 3300050509 nmdc:mga0qj67_325904_c1 nmdc:mga0qj67_325904_c1_829_1227 132
1293 3300050510 nmdc:mga06r32_1011_c1 nmdc:mga06r32_1011_c1_21090_21521 132
1294 3300050511 nmdc:mga08y16_30886_c1 nmdc:mga08y16_30886_c1_2298_2696 132
1295 3300050511 nmdc:mga08y16_4019_c1 nmdc:mga08y16_4019_c1_14386_14817 132
1296 3300050511 nmdc:mga08y16_546919_c1 nmdc:mga08y16_546919_c1_248_646 132
1297 3300050511 nmdc:mga08y16_781_c1 nmdc:mga08y16_781_c1_17327_17725 132
1298 3300050512 nmdc:mga0n895_1756_c1 nmdc:mga0n895_1756_c1_9377_9808 132
1299 3300050512 nmdc:mga0n895_19530_c1 nmdc:mga0n895_19530_c1_5686_6084 132
1300 3300050512 nmdc:mga0n895_210845_c1 nmdc:mga0n895_210845_c1_803_1201 132
1301 3300050512 nmdc:mga0n895_35585_c1 nmdc:mga0n895_35585_c1_1321_1752 132
1302 3300050512 nmdc:mga0n895_399608_c1 nmdc:mga0n895_399608_c1_489_893 132
1303 3300050512 nmdc:mga0n895_557068_c1 nmdc:mga0n895_557068_c1_349_753 132
1304 3300050512 nmdc:mga0n895_896826_c1 nmdc:mga0n895_896826_c1_459_857 132
1305 3300050513 nmdc:mga0rr50_175461_c1 nmdc:mga0rr50_175461_c1_604_1002 132
1306 3300050513 nmdc:mga0rr50_19890_c1 nmdc:mga0rr50_19890_c1_642_1046 132
1307 3300050513 nmdc:mga0rr50_20798_c1 nmdc:mga0rr50_20798_c1_2196_2627 132
1308 3300050513 nmdc:mga0rr50_31595_c1 nmdc:mga0rr50_31595_c1_292_723 132
1309 3300050514 nmdc:mga08x19_71606_c1 nmdc:mga08x19_71606_c1_1822_2226 132
1310 3300050514 nmdc:mga08x19_791780_c1 nmdc:mga08x19_791780_c1_14_412 132
1311 3300050515 nmdc:mga0a205_268898_c1 nmdc:mga0a205_268898_c1_885_1316 132
1312 3300050515 nmdc:mga0a205_3891_c1 nmdc:mga0a205_3891_c1_6122_6520 132
1313 3300050515 nmdc:mga0a205_6374_c1 nmdc:mga0a205_6374_c1_7188_7619 132
1314 3300053077 Ga0495601_0001120 Ga0495601_0001120_4678_5076 132
1315 3300053077 Ga0495601_0004716 Ga0495601_0004716_317_715 132
1316 3300053077 Ga0495601_0042180 Ga0495601_0042180_1848_2252 132
1317 3300053078 Ga0495612_0024989 Ga0495612_0024989_1416_1820 132
1318 3300053078 Ga0495612_0115074 Ga0495612_0115074_163_561 132
1319 3300053078 Ga0495612_0211842 Ga0495612_0211842_97_495 132
1320 3300053084 Ga0495595_0001653 Ga0495595_0001653_2194_2598 132
1321 3300053084 Ga0495595_0001962 Ga0495595_0001962_2373_2798 132
1322 3300053084 Ga0495595_0210316 Ga0495595_0210316_466_864 132
1323 3300053085 Ga0495619_0000115 Ga0495619_0000115_25372_25797 132
1324 3300053085 Ga0495619_0000544 Ga0495619_0000544_23332_23736 132
1325 3300053085 Ga0495619_0003936 Ga0495619_0003936_4697_5095 132
1326 3300053085 Ga0495619_0012555 Ga0495619_0012555_3338_3742 132
1327 3300053087 Ga0500643_024790 Ga0500643_024790_1048_1446 132
1328 3300053088 Ga0500644_0000392 Ga0500644_0000392_14611_15009 132
1329 3300053094 Ga0500566_0091316 Ga0500566_0091316_902_1306 132
1330 3300053094 Ga0500566_0116725 Ga0500566_0116725_370_768 132
1331 3300053119 Ga0500595_000003 Ga0500595_000003_372955_373353 132
1332 3300053153 Ga0500616_0000002 Ga0500616_0000002_1559578_1559976 132
1333 3300053153 Ga0500616_0064588 Ga0500616_0064588_1136_1534 132
1334 3300053730 Ga0500645_000969 Ga0500645_000969_5877_6275 132
1335 3300054114 Ga0501084_0145205 Ga0501084_0145205_1050_1457 132
1336 3300054114 Ga0501084_0172689 Ga0501084_0172689_549_980 132
1337 3300054114 Ga0501084_0172937 Ga0501084_0172937_1182_1589 132
1338 3300054114 Ga0501084_0224315 Ga0501084_0224315_558_956 132
1339 3300054114 Ga0501084_1647527 Ga0501084_1647527_47_445 132
1340 3300060353 Ga0501082_0105773 Ga0501082_0105773_897_1295 132
1341 3300060353 Ga0501082_0165273 Ga0501082_0165273_249_647 132
1342 3300060353 Ga0501082_0195920 Ga0501082_0195920_1109_1513 132
1343 3300060353 Ga0501082_0784768 Ga0501082_0784768_342_749 132
1344 3300060353 Ga0501082_1065656 Ga0501082_1065656_248_646 132
1345 3300061734 Ga0530510_0487866 Ga0530510_0487866_455_862 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

45

117

0.96

PF22636

FlK

Fluoroacetyl-CoA-specific thioesterase

25

128

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvu-assembly1.cif.gz_A structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa 0.948 5 131
3p3f-assembly2.cif.gz_D crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.94 5 126
3kvi-assembly1.cif.gz_B structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk - t42a mutant in complex with fluoro-acetate 0.9362 5 131
3kx8-assembly1.cif.gz_B structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk 0.9351 3 131
3p3f-assembly3.cif.gz_E crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.9114 11 132
ID Description Score Start End Superfamily
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9607 5 129 3.10.129.10
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9244 5 129 3.10.129.10
3p3iA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9212 1 130 3.10.129.10
3p3iA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9015 1 130 3.10.129.10
3lwgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.896 8 115 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A023XRI1-F1-model_v4 deleted 0.9991 1 129
AF-A0A512J2T6-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9979 1 129
AF-A0A149VQ09-F1-model_v4 Fluoroacetyl-CoA thioesterase (EC 3.1.2.29) 0.9949 1 129 GO:0016787
AF-A0A0U3JB94-F1-model_v4 Thioesterase 0.9947 14 127
AF-A0A537RWP7-F1-model_v4 Thioesterase 0.9936 33 119

Feature Viewer

pLDDT pTM Quality
96.66 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map