F492986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1321 | 472 | 2642 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0244649|Ga0501067_0244649_287_925 |
| Length | 212 |
| Sequence | MHQARPDCAGPDSAYIETATPPRERALMSQPTTDSWHGTTIISVRKGPKVVIAGDGQVSIGQTVMKHNARKVRPLSNGSVIAGFAGATADAFTLFERLEKKLEQYPGQLTRACVELAKDWRTDRYLRRLEALMIVADKSTSLVLTGNGDVLEPEGGVAAIGSGGNYALAAGRALYDSDLDAEAIARKAMKIAAEICVYTNDQVTLESLDTVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 125 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 205 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 209 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 223 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 260 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 270 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 271 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 275 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 276 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 278 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 279 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 280 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 281 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 282 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 283 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 284 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 372 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 373 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 374 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 401 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 402 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 404 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 405 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 411 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 412 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 413 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 414 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 423 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 442 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 444 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 445 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 447 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 448 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 450 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 452 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 466 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 467 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 468 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 469 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 470 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 471 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 472 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 0.76 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.9 |
| Nodule | 0 |
| Rhizoplane | 2.5 |
| Rhizosphere | 89.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501067_0244649 | 3300049583 | Bacteria | 998 |
| 2 | JGI24746J21847_1003728 | 3300001977 | Bacteria | 2408 |
| 3 | JGI25153J46596_10005049 | 3300003215 | Bacteria | 6981 |
| 4 | Ga0065712_10158226 | 3300005290 | Bacteria | 1320 |
| 5 | Ga0065715_10148475 | 3300005293 | Bacteria | 1758 |
| 6 | Ga0070658_10026748 | 3300005327 | Bacteria | 4631 |
| 7 | Ga0070658_10079821 | 3300005327 | Bacteria | 2687 |
| 8 | Ga0070658_10277732 | 3300005327 | Bacteria | 1425 |
| 9 | Ga0070658_10290689 | 3300005327 | Bacteria | 1392 |
| 10 | Ga0070658_10433046 | 3300005327 | Bacteria | 1132 |
| 11 | Ga0070658_10621901 | 3300005327 | Bacteria | 936 |
| 12 | Ga0070658_10828065 | 3300005327 | Bacteria | 804 |
| 13 | Ga0070676_10023356 | 3300005328 | Bacteria | 3475 |
| 14 | Ga0070676_10078023 | 3300005328 | Bacteria | 2003 |
| 15 | Ga0070690_100011597 | 3300005330 | Bacteria | 5159 |
| 16 | Ga0070690_100051906 | 3300005330 | Bacteria | 2620 |
| 17 | Ga0070670_100001209 | 3300005331 | Bacteria | 20518 |
| 18 | Ga0070670_100524578 | 3300005331 | Bacteria | 1055 |
| 19 | Ga0070677_10004816 | 3300005333 | Bacteria | 4427 |
| 20 | Ga0070666_10002037 | 3300005335 | Bacteria | 12275 |
| 21 | Ga0070666_10076575 | 3300005335 | Bacteria | 2282 |
| 22 | Ga0070680_100008432 | 3300005336 | Bacteria | 7893 |
| 23 | Ga0070680_100200812 | 3300005336 | Bacteria | 1681 |
| 24 | Ga0070680_100401167 | 3300005336 | Bacteria | 1169 |
| 25 | Ga0070682_100003228 | 3300005337 | Bacteria | 9039 |
| 26 | Ga0070682_100039711 | 3300005337 | Bacteria | 2893 |
| 27 | Ga0068868_100017842 | 3300005338 | Bacteria | 5294 |
| 28 | Ga0070660_100001596 | 3300005339 | Bacteria | 15568 |
| 29 | Ga0070660_100012544 | 3300005339 | Bacteria | 6054 |
| 30 | Ga0070660_100154606 | 3300005339 | Bacteria | 1846 |
| 31 | Ga0070660_100187241 | 3300005339 | Bacteria | 1676 |
| 32 | Ga0070660_100203887 | 3300005339 | Bacteria | 1605 |
| 33 | Ga0070689_100051517 | 3300005340 | Bacteria | 3182 |
| 34 | Ga0070689_100054341 | 3300005340 | Bacteria | 3100 |
| 35 | Ga0070689_100072706 | 3300005340 | Bacteria | 2688 |
| 36 | Ga0070689_100072843 | 3300005340 | Bacteria | 2685 |
| 37 | Ga0070689_100636335 | 3300005340 | Bacteria | 927 |
| 38 | Ga0070689_100775201 | 3300005340 | Bacteria | 842 |
| 39 | Ga0070687_100000651 | 3300005343 | Bacteria | 11519 |
| 40 | Ga0070661_100012203 | 3300005344 | Bacteria | 6007 |
| 41 | Ga0070661_100026608 | 3300005344 | Bacteria | 4161 |
| 42 | Ga0070661_100133466 | 3300005344 | Bacteria | 1866 |
| 43 | Ga0070661_100327957 | 3300005344 | Bacteria | 1197 |
| 44 | Ga0070661_100447708 | 3300005344 | Bacteria | 1027 |
| 45 | Ga0070668_100135892 | 3300005347 | Bacteria | 1977 |
| 46 | Ga0070668_100362925 | 3300005347 | Bacteria | 1229 |
| 47 | Ga0070669_100145047 | 3300005353 | Bacteria | 1833 |
| 48 | Ga0070669_100455798 | 3300005353 | Bacteria | 1055 |
| 49 | Ga0070669_100648620 | 3300005353 | Bacteria | 888 |
| 50 | Ga0070675_100045786 | 3300005354 | Bacteria | 3580 |
| 51 | Ga0070675_100357881 | 3300005354 | Bacteria | 1295 |
| 52 | Ga0070675_100583733 | 3300005354 | Bacteria | 1013 |
| 53 | Ga0070671_100006150 | 3300005355 | Bacteria | 9559 |
| 54 | Ga0070671_100006644 | 3300005355 | Bacteria | 9247 |
| 55 | Ga0070671_100019015 | 3300005355 | Bacteria | 5587 |
| 56 | Ga0070671_100053667 | 3300005355 | Bacteria | 3351 |
| 57 | Ga0070671_100151005 | 3300005355 | Bacteria | 1962 |
| 58 | Ga0070674_100011744 | 3300005356 | Bacteria | 5344 |
| 59 | Ga0070674_100048468 | 3300005356 | Bacteria | 2916 |
| 60 | Ga0070674_100073361 | 3300005356 | Bacteria | 2426 |
| 61 | Ga0070673_100005472 | 3300005364 | Bacteria | 8129 |
| 62 | Ga0070673_100034218 | 3300005364 | Bacteria | 3842 |
| 63 | Ga0070673_100147415 | 3300005364 | Bacteria | 1990 |
| 64 | Ga0070673_101213387 | 3300005364 | Bacteria | 707 |
| 65 | Ga0070688_100003838 | 3300005365 | Bacteria | 7792 |
| 66 | Ga0070688_100040814 | 3300005365 | Bacteria | 2845 |
| 67 | Ga0070688_100060496 | 3300005365 | Bacteria | 2392 |
| 68 | Ga0070659_100004346 | 3300005366 | Bacteria | 10114 |
| 69 | Ga0070659_100103715 | 3300005366 | Bacteria | 2291 |
| 70 | Ga0070659_100253681 | 3300005366 | Bacteria | 1458 |
| 71 | Ga0070659_100441516 | 3300005366 | Bacteria | 1103 |
| 72 | Ga0070659_100604003 | 3300005366 | Bacteria | 943 |
| 73 | Ga0070667_100006803 | 3300005367 | Bacteria | 9498 |
| 74 | Ga0070667_100014101 | 3300005367 | Bacteria | 6604 |
| 75 | Ga0070667_100220929 | 3300005367 | Bacteria | 1686 |
| 76 | Ga0070667_100315983 | 3300005367 | Bacteria | 1409 |
| 77 | Ga0070667_100379827 | 3300005367 | Bacteria | 1283 |
| 78 | Ga0070667_100542108 | 3300005367 | Bacteria | 1069 |
| 79 | Ga0070714_100112087 | 3300005435 | Bacteria | 2417 |
| 80 | Ga0070714_100387490 | 3300005435 | Bacteria | 1319 |
| 81 | Ga0070713_101010065 | 3300005436 | Bacteria | 802 |
| 82 | Ga0070701_10052318 | 3300005438 | Bacteria | 2121 |
| 83 | Ga0070711_100035525 | 3300005439 | Bacteria | 3333 |
| 84 | Ga0070711_100038432 | 3300005439 | Bacteria | 3219 |
| 85 | Ga0070705_100381098 | 3300005440 | Bacteria | 1038 |
| 86 | Ga0070700_100060070 | 3300005441 | Bacteria | 2395 |
| 87 | Ga0070708_100445673 | 3300005445 | Bacteria | 1221 |
| 88 | Ga0070663_100015534 | 3300005455 | Bacteria | 4919 |
| 89 | Ga0070663_100263224 | 3300005455 | Bacteria | 1368 |
| 90 | Ga0070663_100563559 | 3300005455 | Bacteria | 954 |
| 91 | Ga0070678_100097787 | 3300005456 | Bacteria | 2268 |
| 92 | Ga0070678_100218922 | 3300005456 | Bacteria | 1582 |
| 93 | Ga0070662_100002053 | 3300005457 | Bacteria | 12335 |
| 94 | Ga0070662_100091919 | 3300005457 | Bacteria | 2280 |
| 95 | Ga0070662_100110580 | 3300005457 | Bacteria | 2093 |
| 96 | Ga0070662_100124062 | 3300005457 | Bacteria | 1982 |
| 97 | Ga0070662_100274790 | 3300005457 | Bacteria | 1361 |
| 98 | Ga0070662_100739849 | 3300005457 | Bacteria | 833 |
| 99 | Ga0070662_100760893 | 3300005457 | Bacteria | 822 |
| 100 | Ga0070681_10004156 | 3300005458 | Bacteria | 13699 |
| 101 | Ga0070681_10012342 | 3300005458 | Bacteria | 8472 |
| 102 | Ga0070681_10082436 | 3300005458 | Bacteria | 3171 |
| 103 | Ga0070681_10091185 | 3300005458 | Bacteria | 2998 |
| 104 | Ga0068867_100030511 | 3300005459 | Bacteria | 3889 |
| 105 | Ga0070685_10003942 | 3300005466 | Bacteria | 7496 |
| 106 | Ga0070698_100847963 | 3300005471 | Bacteria | 859 |
| 107 | Ga0070699_100444522 | 3300005518 | Bacteria | 1175 |
| 108 | Ga0070679_100010255 | 3300005530 | Bacteria | 8882 |
| 109 | Ga0070679_100076980 | 3300005530 | Bacteria | 3324 |
| 110 | Ga0070679_100137701 | 3300005530 | Bacteria | 2422 |
| 111 | Ga0070679_100403330 | 3300005530 | Bacteria | 1313 |
| 112 | Ga0070679_100515271 | 3300005530 | Bacteria | 1140 |
| 113 | Ga0070684_100096416 | 3300005535 | Bacteria | 2636 |
| 114 | Ga0070684_100475154 | 3300005535 | Bacteria | 1157 |
| 115 | Ga0068853_100001120 | 3300005539 | Bacteria | 18964 |
| 116 | Ga0068853_100010459 | 3300005539 | Bacteria | 7510 |
| 117 | Ga0068853_100115026 | 3300005539 | Bacteria | 2393 |
| 118 | Ga0068853_100115890 | 3300005539 | Bacteria | 2385 |
| 119 | Ga0068853_100153069 | 3300005539 | Bacteria | 2077 |
| 120 | Ga0068853_100158870 | 3300005539 | Bacteria | 2038 |
| 121 | Ga0068853_100219835 | 3300005539 | Bacteria | 1735 |
| 122 | Ga0068853_100302828 | 3300005539 | Bacteria | 1478 |
| 123 | Ga0070672_100153303 | 3300005543 | Bacteria | 1907 |
| 124 | Ga0070672_100256829 | 3300005543 | Bacteria | 1473 |
| 125 | Ga0070686_100005413 | 3300005544 | Bacteria | 7070 |
| 126 | Ga0070686_100116042 | 3300005544 | Bacteria | 1832 |
| 127 | Ga0070686_100197760 | 3300005544 | Bacteria | 1439 |
| 128 | Ga0070686_100445865 | 3300005544 | Bacteria | 994 |
| 129 | Ga0070695_100005458 | 3300005545 | Bacteria | 7482 |
| 130 | Ga0070695_100140405 | 3300005545 | Bacteria | 1675 |
| 131 | Ga0070696_100043974 | 3300005546 | Bacteria | 3092 |
| 132 | Ga0070696_100430025 | 3300005546 | Bacteria | 1038 |
| 133 | Ga0070693_100082656 | 3300005547 | Bacteria | 1918 |
| 134 | Ga0070665_100159096 | 3300005548 | Bacteria | 2260 |
| 135 | Ga0070665_100349553 | 3300005548 | Bacteria | 1484 |
| 136 | Ga0070704_100106130 | 3300005549 | Bacteria | 2128 |
| 137 | Ga0070704_100120698 | 3300005549 | Bacteria | 2013 |
| 138 | Ga0070704_100148959 | 3300005549 | Bacteria | 1837 |
| 139 | Ga0070704_100485195 | 3300005549 | Bacteria | 1070 |
| 140 | Ga0070704_101182971 | 3300005549 | Bacteria | 697 |
| 141 | Ga0068855_100062365 | 3300005563 | Bacteria | 4352 |
| 142 | Ga0068855_100135698 | 3300005563 | Bacteria | 2808 |
| 143 | Ga0068855_100202226 | 3300005563 | Bacteria | 2236 |
| 144 | Ga0068855_100271286 | 3300005563 | Bacteria | 1886 |
| 145 | Ga0070664_100003030 | 3300005564 | Bacteria | 13583 |
| 146 | Ga0070664_100003245 | 3300005564 | Bacteria | 13138 |
| 147 | Ga0070664_100029345 | 3300005564 | Bacteria | 4586 |
| 148 | Ga0070664_100112874 | 3300005564 | Bacteria | 2374 |
| 149 | Ga0068857_100122892 | 3300005577 | Bacteria | 2339 |
| 150 | Ga0068857_100226885 | 3300005577 | Bacteria | 1707 |
| 151 | Ga0068857_100274643 | 3300005577 | Bacteria | 1549 |
| 152 | Ga0068857_100333353 | 3300005577 | Bacteria | 1403 |
| 153 | Ga0068857_100669314 | 3300005577 | Bacteria | 985 |
| 154 | Ga0068854_100007527 | 3300005578 | Bacteria | 6960 |
| 155 | Ga0068854_100474538 | 3300005578 | Bacteria | 1049 |
| 156 | Ga0068854_100595590 | 3300005578 | Bacteria | 943 |
| 157 | Ga0068854_100725891 | 3300005578 | Bacteria | 860 |
| 158 | Ga0068856_100002582 | 3300005614 | Bacteria | 18651 |
| 159 | Ga0068856_100091866 | 3300005614 | Bacteria | 3020 |
| 160 | Ga0068856_100529572 | 3300005614 | Bacteria | 1199 |
| 161 | Ga0068856_100590493 | 3300005614 | Bacteria | 1132 |
| 162 | Ga0070702_100089235 | 3300005615 | Bacteria | 1866 |
| 163 | Ga0068852_100012732 | 3300005616 | Bacteria | 6403 |
| 164 | Ga0068852_100376593 | 3300005616 | Bacteria | 1392 |
| 165 | Ga0068852_100377720 | 3300005616 | Bacteria | 1389 |
| 166 | Ga0068852_100474068 | 3300005616 | Bacteria | 1243 |
| 167 | Ga0068852_100505728 | 3300005616 | Bacteria | 1204 |
| 168 | Ga0068852_100527839 | 3300005616 | Bacteria | 1178 |
| 169 | Ga0068859_100041148 | 3300005617 | Bacteria | 4642 |
| 170 | Ga0068859_100061003 | 3300005617 | Bacteria | 3800 |
| 171 | Ga0068859_100456926 | 3300005617 | Bacteria | 1373 |
| 172 | Ga0068864_100342635 | 3300005618 | Bacteria | 1409 |
| 173 | Ga0068866_10131091 | 3300005718 | Bacteria | 1426 |
| 174 | Ga0068861_100180074 | 3300005719 | Bacteria | 1759 |
| 175 | Ga0068870_10017187 | 3300005840 | Bacteria | 3472 |
| 176 | Ga0068863_100013225 | 3300005841 | Bacteria | 7960 |
| 177 | Ga0068858_100001220 | 3300005842 | Bacteria | 26659 |
| 178 | Ga0068858_100070910 | 3300005842 | Bacteria | 3230 |
| 179 | Ga0068858_100072857 | 3300005842 | Bacteria | 3188 |
| 180 | Ga0068858_100090683 | 3300005842 | Bacteria | 2845 |
| 181 | Ga0068858_100100260 | 3300005842 | Bacteria | 2701 |
| 182 | Ga0068858_100437848 | 3300005842 | Bacteria | 1259 |
| 183 | Ga0068860_100077456 | 3300005843 | Bacteria | 3162 |
| 184 | Ga0068860_100079166 | 3300005843 | Bacteria | 3125 |
| 185 | Ga0068860_100091007 | 3300005843 | Bacteria | 2906 |
| 186 | Ga0068860_100172293 | 3300005843 | Bacteria | 2091 |
| 187 | Ga0068860_100204438 | 3300005843 | Bacteria | 1915 |
| 188 | Ga0068862_100001900 | 3300005844 | Bacteria | 18964 |
| 189 | Ga0068862_100002109 | 3300005844 | Bacteria | 17924 |
| 190 | Ga0068862_100228872 | 3300005844 | Bacteria | 1686 |
| 191 | Ga0081455_10032634 | 3300005937 | Bacteria | 4690 |
| 192 | Ga0081455_10046241 | 3300005937 | Bacteria | 3778 |
| 193 | Ga0081455_10351898 | 3300005937 | Bacteria | 1039 |
| 194 | Ga0081538_10071824 | 3300005981 | Bacteria | 1901 |
| 195 | Ga0070717_10036746 | 3300006028 | Bacteria | 3974 |
| 196 | Ga0070717_10073587 | 3300006028 | Bacteria | 2856 |
| 197 | Ga0070717_10460708 | 3300006028 | Bacteria | 1146 |
| 198 | Ga0075365_10028316 | 3300006038 | Bacteria | 3573 |
| 199 | Ga0075365_10261733 | 3300006038 | Bacteria | 1216 |
| 200 | Ga0075368_10000154 | 3300006042 | Bacteria | 18483 |
| 201 | Ga0075368_10141865 | 3300006042 | Bacteria | 1001 |
| 202 | Ga0075363_100009861 | 3300006048 | Bacteria | 4506 |
| 203 | Ga0075363_100031864 | 3300006048 | Bacteria | 2735 |
| 204 | Ga0075363_100083791 | 3300006048 | Bacteria | 1747 |
| 205 | Ga0075364_10010820 | 3300006051 | Bacteria | 5523 |
| 206 | Ga0075364_10206662 | 3300006051 | Bacteria | 1331 |
| 207 | Ga0075364_10513097 | 3300006051 | Bacteria | 819 |
| 208 | Ga0070712_100073308 | 3300006175 | Bacteria | 2455 |
| 209 | Ga0070712_100623008 | 3300006175 | Bacteria | 915 |
| 210 | Ga0075362_10001229 | 3300006177 | Bacteria | 8066 |
| 211 | Ga0075362_10283668 | 3300006177 | Bacteria | 819 |
| 212 | Ga0075367_10018545 | 3300006178 | Bacteria | 3843 |
| 213 | Ga0075367_10371473 | 3300006178 | Bacteria | 903 |
| 214 | Ga0075369_10013093 | 3300006186 | Bacteria | 3285 |
| 215 | Ga0075366_10004924 | 3300006195 | Bacteria | 7204 |
| 216 | Ga0075366_10041243 | 3300006195 | Bacteria | 2733 |
| 217 | Ga0075366_10046259 | 3300006195 | Bacteria | 2578 |
| 218 | Ga0075366_10337864 | 3300006195 | Bacteria | 923 |
| 219 | Ga0097621_100165643 | 3300006237 | Bacteria | 1903 |
| 220 | Ga0075370_10047926 | 3300006353 | Bacteria | 2420 |
| 221 | Ga0075370_10097232 | 3300006353 | Bacteria | 1702 |
| 222 | Ga0075370_10283848 | 3300006353 | Bacteria | 983 |
| 223 | Ga0068871_100216729 | 3300006358 | Bacteria | 1657 |
| 224 | Ga0068871_100400195 | 3300006358 | Bacteria | 1223 |
| 225 | Ga0068871_100528608 | 3300006358 | Bacteria | 1066 |
| 226 | Ga0068871_100647239 | 3300006358 | Bacteria | 965 |
| 227 | Ga0068871_101179939 | 3300006358 | Bacteria | 718 |
| 228 | Ga0075428_100000606 | 3300006844 | Bacteria | 36554 |
| 229 | Ga0075428_100001030 | 3300006844 | Bacteria | 29513 |
| 230 | Ga0075428_100016563 | 3300006844 | Bacteria | 8138 |
| 231 | Ga0075428_100053354 | 3300006844 | Bacteria | 4429 |
| 232 | Ga0075428_100079887 | 3300006844 | Bacteria | 3569 |
| 233 | Ga0075428_101017656 | 3300006844 | Bacteria | 877 |
| 234 | Ga0075430_100002000 | 3300006846 | Bacteria | 16792 |
| 235 | Ga0075430_100157001 | 3300006846 | Bacteria | 1894 |
| 236 | Ga0075430_100343936 | 3300006846 | Bacteria | 1232 |
| 237 | Ga0075430_100354083 | 3300006846 | Bacteria | 1212 |
| 238 | Ga0075431_100000032 | 3300006847 | Bacteria | 72293 |
| 239 | Ga0075431_100007296 | 3300006847 | Bacteria | 11010 |
| 240 | Ga0075431_100010360 | 3300006847 | Bacteria | 9367 |
| 241 | Ga0075431_100118643 | 3300006847 | Bacteria | 2730 |
| 242 | Ga0075431_100630812 | 3300006847 | Bacteria | 1053 |
| 243 | Ga0075433_10130756 | 3300006852 | Bacteria | 2230 |
| 244 | Ga0075434_100069291 | 3300006871 | Bacteria | 3517 |
| 245 | Ga0075429_100009118 | 3300006880 | Bacteria | 8612 |
| 246 | Ga0075429_100059469 | 3300006880 | Bacteria | 3329 |
| 247 | Ga0075429_100083653 | 3300006880 | Bacteria | 2782 |
| 248 | Ga0068865_100065024 | 3300006881 | Bacteria | 2569 |
| 249 | Ga0068865_100102026 | 3300006881 | Bacteria | 2102 |
| 250 | Ga0075436_100039986 | 3300006914 | Bacteria | 3235 |
| 251 | Ga0075436_100177303 | 3300006914 | Bacteria | 1506 |
| 252 | Ga0097620_100041150 | 3300006931 | Bacteria | 4642 |
| 253 | Ga0097620_100061002 | 3300006931 | Bacteria | 3800 |
| 254 | Ga0097620_100456949 | 3300006931 | Bacteria | 1373 |
| 255 | Ga0075435_100069623 | 3300007076 | Bacteria | 2870 |
| 256 | Ga0075435_100696545 | 3300007076 | Bacteria | 883 |
| 257 | Ga0099795_10033761 | 3300007788 | Bacteria | 1779 |
| 258 | Ga0105240_10319701 | 3300009093 | Bacteria | 1770 |
| 259 | Ga0111539_10001089 | 3300009094 | Bacteria | 35899 |
| 260 | Ga0111539_10132368 | 3300009094 | Bacteria | 2920 |
| 261 | Ga0111539_10532037 | 3300009094 | Bacteria | 1369 |
| 262 | Ga0105245_10097484 | 3300009098 | Bacteria | 2715 |
| 263 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 264 | Ga0114129_10070132 | 3300009147 | Bacteria | 4886 |
| 265 | Ga0114129_10481588 | 3300009147 | Bacteria | 1623 |
| 266 | Ga0114129_10489248 | 3300009147 | Bacteria | 1608 |
| 267 | Ga0105243_10685993 | 3300009148 | Bacteria | 997 |
| 268 | Ga0105241_10358619 | 3300009174 | Bacteria | 1268 |
| 269 | Ga0105242_10102160 | 3300009176 | Bacteria | 2431 |
| 270 | Ga0105242_10127241 | 3300009176 | Bacteria | 2194 |
| 271 | Ga0105242_10373575 | 3300009176 | Bacteria | 1323 |
| 272 | Ga0105248_10000575 | 3300009177 | Bacteria | 41822 |
| 273 | Ga0105248_10032460 | 3300009177 | Bacteria | 5836 |
| 274 | Ga0105248_10052459 | 3300009177 | Bacteria | 4577 |
| 275 | Ga0105248_11304190 | 3300009177 | Bacteria | 821 |
| 276 | Ga0105238_10445675 | 3300009551 | Bacteria | 1291 |
| 277 | Ga0105249_10004484 | 3300009553 | Bacteria | 12070 |
| 278 | Ga0105249_10126386 | 3300009553 | Bacteria | 2435 |
| 279 | Ga0105249_10443846 | 3300009553 | Bacteria | 1335 |
| 280 | Ga0099796_10026974 | 3300010159 | Bacteria | 1830 |
| 281 | Ga0105239_10160754 | 3300010375 | Bacteria | 2509 |
| 282 | Ga0105246_10214319 | 3300011119 | Bacteria | 1505 |
| 283 | Ga0157373_10034223 | 3300013100 | Bacteria | 3649 |
| 284 | Ga0157371_10002512 | 3300013102 | Bacteria | 17426 |
| 285 | Ga0157371_10040000 | 3300013102 | Bacteria | 3351 |
| 286 | Ga0157371_10083091 | 3300013102 | Bacteria | 2268 |
| 287 | Ga0157371_10182576 | 3300013102 | Bacteria | 1501 |
| 288 | Ga0157370_10103179 | 3300013104 | Bacteria | 2670 |
| 289 | Ga0157370_10228130 | 3300013104 | Bacteria | 1724 |
| 290 | Ga0157370_10327032 | 3300013104 | Bacteria | 1414 |
| 291 | Ga0157369_10038667 | 3300013105 | Bacteria | 5217 |
| 292 | Ga0157369_10415943 | 3300013105 | Bacteria | 1394 |
| 293 | Ga0157378_10712262 | 3300013297 | Bacteria | 1024 |
| 294 | Ga0163162_10015418 | 3300013306 | Bacteria | 7466 |
| 295 | Ga0157372_10005708 | 3300013307 | Bacteria | 13246 |
| 296 | Ga0157372_10062690 | 3300013307 | Bacteria | 4166 |
| 297 | Ga0157372_10203158 | 3300013307 | Bacteria | 2296 |
| 298 | Ga0157372_10302849 | 3300013307 | Bacteria | 1859 |
| 299 | Ga0157372_10743667 | 3300013307 | Bacteria | 1140 |
| 300 | Ga0157375_10010448 | 3300013308 | Bacteria | 8168 |
| 301 | Ga0157375_10153878 | 3300013308 | Bacteria | 2437 |
| 302 | Ga0157375_10287312 | 3300013308 | Bacteria | 1808 |
| 303 | Ga0157375_10620111 | 3300013308 | Bacteria | 1240 |
| 304 | Ga0157375_11793722 | 3300013308 | Bacteria | 727 |
| 305 | Ga0163163_10019652 | 3300014325 | Bacteria | 6346 |
| 306 | Ga0163163_10104340 | 3300014325 | Bacteria | 2860 |
| 307 | Ga0163163_10142267 | 3300014325 | Bacteria | 2441 |
| 308 | Ga0163163_10608301 | 3300014325 | Bacteria | 1156 |
| 309 | Ga0163163_10612577 | 3300014325 | Bacteria | 1152 |
| 310 | Ga0163163_10974549 | 3300014325 | Bacteria | 911 |
| 311 | Ga0157380_10093638 | 3300014326 | Bacteria | 2484 |
| 312 | Ga0157380_10192704 | 3300014326 | Bacteria | 1801 |
| 313 | Ga0157380_11475569 | 3300014326 | Unclassified | 732 |
| 314 | Ga0157377_10003094 | 3300014745 | Bacteria | 7476 |
| 315 | Ga0157379_10025431 | 3300014968 | Bacteria | 5259 |
| 316 | Ga0157379_10370252 | 3300014968 | Bacteria | 1314 |
| 317 | Ga0157379_10573192 | 3300014968 | Bacteria | 1052 |
| 318 | Ga0157376_10231232 | 3300014969 | Bacteria | 1718 |
| 319 | Ga0163161_10036976 | 3300017792 | Bacteria | 3499 |
| 320 | Ga0163161_10165871 | 3300017792 | Bacteria | 1686 |
| 321 | Ga0213876_10077378 | 3300021384 | Bacteria | 1757 |
| 322 | Ga0213876_10237236 | 3300021384 | Bacteria | 969 |
| 323 | Ga0213875_10082656 | 3300021388 | Bacteria | 1499 |
| 324 | Ga0213875_10112131 | 3300021388 | Bacteria | 1274 |
| 325 | Ga0224571_108629 | 3300022734 | Bacteria | 694 |
| 326 | Ga0207673_1012565 | 3300025290 | Bacteria | 1105 |
| 327 | Ga0209758_1000686 | 3300025297 | Bacteria | 50478 |
| 328 | Ga0209758_1091124 | 3300025297 | Bacteria | 892 |
| 329 | Ga0207697_10000027 | 3300025315 | Bacteria | 51720 |
| 330 | Ga0207697_10084005 | 3300025315 | Bacteria | 1344 |
| 331 | Ga0207682_10000609 | 3300025893 | Bacteria | 16628 |
| 332 | Ga0207682_10161214 | 3300025893 | Bacteria | 1016 |
| 333 | Ga0207642_10205557 | 3300025899 | Bacteria | 1091 |
| 334 | Ga0207688_10000041 | 3300025901 | Bacteria | 44495 |
| 335 | Ga0207680_10000656 | 3300025903 | Bacteria | 16342 |
| 336 | Ga0207680_10224303 | 3300025903 | Bacteria | 1289 |
| 337 | Ga0207680_10269620 | 3300025903 | Bacteria | 1180 |
| 338 | Ga0207647_10001581 | 3300025904 | Bacteria | 17475 |
| 339 | Ga0207645_10005539 | 3300025907 | Bacteria | 9140 |
| 340 | Ga0207645_10019866 | 3300025907 | Bacteria | 4399 |
| 341 | Ga0207645_10088321 | 3300025907 | Bacteria | 1993 |
| 342 | Ga0207643_10001947 | 3300025908 | Bacteria | 11417 |
| 343 | Ga0207705_10001911 | 3300025909 | Bacteria | 16282 |
| 344 | Ga0207705_10418290 | 3300025909 | Bacteria | 1037 |
| 345 | Ga0207705_10757681 | 3300025909 | Bacteria | 754 |
| 346 | Ga0207654_10563484 | 3300025911 | Bacteria | 810 |
| 347 | Ga0207707_10011717 | 3300025912 | Bacteria | 7630 |
| 348 | Ga0207707_10050953 | 3300025912 | Bacteria | 3605 |
| 349 | Ga0207707_10198634 | 3300025912 | Bacteria | 1749 |
| 350 | Ga0207695_10200398 | 3300025913 | Bacteria | 1910 |
| 351 | Ga0207671_10062172 | 3300025914 | Bacteria | 2772 |
| 352 | Ga0207693_10339422 | 3300025915 | Bacteria | 1176 |
| 353 | Ga0207693_10755157 | 3300025915 | Bacteria | 751 |
| 354 | Ga0207663_10883540 | 3300025916 | Bacteria | 714 |
| 355 | Ga0207660_11083128 | 3300025917 | Bacteria | 653 |
| 356 | Ga0207662_10253307 | 3300025918 | Bacteria | 1156 |
| 357 | Ga0207657_10000513 | 3300025919 | Bacteria | 41016 |
| 358 | Ga0207657_10005300 | 3300025919 | Bacteria | 13511 |
| 359 | Ga0207657_10073837 | 3300025919 | Bacteria | 2881 |
| 360 | Ga0207657_10122173 | 3300025919 | Bacteria | 2142 |
| 361 | Ga0207657_10186478 | 3300025919 | Bacteria | 1675 |
| 362 | Ga0207649_10003140 | 3300025920 | Bacteria | 9063 |
| 363 | Ga0207649_10013372 | 3300025920 | Bacteria | 4581 |
| 364 | Ga0207649_10081466 | 3300025920 | Bacteria | 2096 |
| 365 | Ga0207649_10095587 | 3300025920 | Bacteria | 1955 |
| 366 | Ga0207649_10121030 | 3300025920 | Bacteria | 1764 |
| 367 | Ga0207652_10014456 | 3300025921 | Bacteria | 6395 |
| 368 | Ga0207652_10018941 | 3300025921 | Bacteria | 5651 |
| 369 | Ga0207652_10031974 | 3300025921 | Bacteria | 4420 |
| 370 | Ga0207652_10040820 | 3300025921 | Bacteria | 3942 |
| 371 | Ga0207652_10056340 | 3300025921 | Bacteria | 3384 |
| 372 | Ga0207652_10089135 | 3300025921 | Bacteria | 2708 |
| 373 | Ga0207652_10146388 | 3300025921 | Bacteria | 2114 |
| 374 | Ga0207652_10310698 | 3300025921 | Bacteria | 1423 |
| 375 | Ga0207681_10079414 | 3300025923 | Bacteria | 2311 |
| 376 | Ga0207681_10270397 | 3300025923 | Bacteria | 1334 |
| 377 | Ga0207681_10516260 | 3300025923 | Bacteria | 980 |
| 378 | Ga0207650_10007967 | 3300025925 | Bacteria | 7222 |
| 379 | Ga0207650_10035373 | 3300025925 | Bacteria | 3626 |
| 380 | Ga0207659_10011179 | 3300025926 | Bacteria | 5663 |
| 381 | Ga0207659_10032556 | 3300025926 | Bacteria | 3580 |
| 382 | Ga0207659_10300793 | 3300025926 | Bacteria | 1318 |
| 383 | Ga0207687_10046755 | 3300025927 | Bacteria | 2997 |
| 384 | Ga0207687_10408401 | 3300025927 | Bacteria | 1118 |
| 385 | Ga0207700_10215050 | 3300025928 | Bacteria | 1627 |
| 386 | Ga0207700_10302608 | 3300025928 | Bacteria | 1381 |
| 387 | Ga0207700_10601631 | 3300025928 | Bacteria | 978 |
| 388 | Ga0207664_10064285 | 3300025929 | Bacteria | 2934 |
| 389 | Ga0207664_10085719 | 3300025929 | Bacteria | 2572 |
| 390 | Ga0207644_10005027 | 3300025931 | Bacteria | 8634 |
| 391 | Ga0207644_10019791 | 3300025931 | Bacteria | 4569 |
| 392 | Ga0207644_10030690 | 3300025931 | Bacteria | 3740 |
| 393 | Ga0207644_10087128 | 3300025931 | Bacteria | 2320 |
| 394 | Ga0207644_10609447 | 3300025931 | Bacteria | 907 |
| 395 | Ga0207690_10001108 | 3300025932 | Bacteria | 17166 |
| 396 | Ga0207690_10260573 | 3300025932 | Bacteria | 1343 |
| 397 | Ga0207706_10003288 | 3300025933 | Bacteria | 15471 |
| 398 | Ga0207706_10005146 | 3300025933 | Bacteria | 12209 |
| 399 | Ga0207706_10027521 | 3300025933 | Bacteria | 5083 |
| 400 | Ga0207706_10027851 | 3300025933 | Bacteria | 5051 |
| 401 | Ga0207706_10200301 | 3300025933 | Bacteria | 1751 |
| 402 | Ga0207706_10353698 | 3300025933 | Bacteria | 1277 |
| 403 | Ga0207706_10372932 | 3300025933 | Bacteria | 1239 |
| 404 | Ga0207709_10936548 | 3300025935 | Bacteria | 705 |
| 405 | Ga0207670_10010868 | 3300025936 | Bacteria | 5255 |
| 406 | Ga0207670_10020783 | 3300025936 | Bacteria | 4039 |
| 407 | Ga0207670_10052483 | 3300025936 | Bacteria | 2742 |
| 408 | Ga0207670_10562344 | 3300025936 | Bacteria | 933 |
| 409 | Ga0207669_10012258 | 3300025937 | Bacteria | 4210 |
| 410 | Ga0207669_10048958 | 3300025937 | Bacteria | 2515 |
| 411 | Ga0207704_10241588 | 3300025938 | Bacteria | 1350 |
| 412 | Ga0207704_10351094 | 3300025938 | Bacteria | 1148 |
| 413 | Ga0207704_10441272 | 3300025938 | Bacteria | 1037 |
| 414 | Ga0207691_10000239 | 3300025940 | Bacteria | 53779 |
| 415 | Ga0207691_10143694 | 3300025940 | Bacteria | 2101 |
| 416 | Ga0207691_10354339 | 3300025940 | Bacteria | 1255 |
| 417 | Ga0207711_10000496 | 3300025941 | Bacteria | 40666 |
| 418 | Ga0207711_10037389 | 3300025941 | Bacteria | 4123 |
| 419 | Ga0207711_10076367 | 3300025941 | Bacteria | 2917 |
| 420 | Ga0207711_10463542 | 3300025941 | Bacteria | 1180 |
| 421 | Ga0207661_10040299 | 3300025944 | Bacteria | 3671 |
| 422 | Ga0207661_10123832 | 3300025944 | Bacteria | 2205 |
| 423 | Ga0207679_10047857 | 3300025945 | Bacteria | 3110 |
| 424 | Ga0207679_10111886 | 3300025945 | Bacteria | 2157 |
| 425 | Ga0207679_10126589 | 3300025945 | Bacteria | 2042 |
| 426 | Ga0207667_10000830 | 3300025949 | Bacteria | 39956 |
| 427 | Ga0207667_10157268 | 3300025949 | Bacteria | 2338 |
| 428 | Ga0207667_10313294 | 3300025949 | Bacteria | 1603 |
| 429 | Ga0207667_10342927 | 3300025949 | Bacteria | 1524 |
| 430 | Ga0207651_10009173 | 3300025960 | Bacteria | 5393 |
| 431 | Ga0207651_10016951 | 3300025960 | Bacteria | 4288 |
| 432 | Ga0207651_10143589 | 3300025960 | Bacteria | 1847 |
| 433 | Ga0207651_10154311 | 3300025960 | Bacteria | 1792 |
| 434 | Ga0207651_10273299 | 3300025960 | Bacteria | 1393 |
| 435 | Ga0207712_10067376 | 3300025961 | Bacteria | 2562 |
| 436 | Ga0207712_10337608 | 3300025961 | Bacteria | 1248 |
| 437 | Ga0207668_10479853 | 3300025972 | Bacteria | 1066 |
| 438 | Ga0207640_10025713 | 3300025981 | Bacteria | 3566 |
| 439 | Ga0207640_10150608 | 3300025981 | Bacteria | 1709 |
| 440 | Ga0207640_10362520 | 3300025981 | Bacteria | 1168 |
| 441 | Ga0207658_10001593 | 3300025986 | Bacteria | 17501 |
| 442 | Ga0207658_10121760 | 3300025986 | Bacteria | 2081 |
| 443 | Ga0207658_10207128 | 3300025986 | Bacteria | 1641 |
| 444 | Ga0207658_10334820 | 3300025986 | Bacteria | 1314 |
| 445 | Ga0207677_10013370 | 3300026023 | Bacteria | 4754 |
| 446 | Ga0207677_10228577 | 3300026023 | Bacteria | 1497 |
| 447 | Ga0207677_11204544 | 3300026023 | Bacteria | 693 |
| 448 | Ga0207703_10007178 | 3300026035 | Bacteria | 8863 |
| 449 | Ga0207703_10063936 | 3300026035 | Bacteria | 3019 |
| 450 | Ga0207703_10317598 | 3300026035 | Bacteria | 1425 |
| 451 | Ga0207703_10613828 | 3300026035 | Bacteria | 1029 |
| 452 | Ga0207703_10629957 | 3300026035 | Bacteria | 1016 |
| 453 | Ga0207639_10002312 | 3300026041 | Bacteria | 12791 |
| 454 | Ga0207639_10003125 | 3300026041 | Bacteria | 11132 |
| 455 | Ga0207639_10078769 | 3300026041 | Bacteria | 2602 |
| 456 | Ga0207639_10164295 | 3300026041 | Bacteria | 1874 |
| 457 | Ga0207639_10284533 | 3300026041 | Bacteria | 1455 |
| 458 | Ga0207639_10373307 | 3300026041 | Bacteria | 1279 |
| 459 | Ga0207639_10390804 | 3300026041 | Bacteria | 1251 |
| 460 | Ga0207639_10438603 | 3300026041 | Bacteria | 1184 |
| 461 | Ga0207678_10002308 | 3300026067 | Bacteria | 17274 |
| 462 | Ga0207678_10002924 | 3300026067 | Bacteria | 15492 |
| 463 | Ga0207678_10056684 | 3300026067 | Bacteria | 3373 |
| 464 | Ga0207678_10089385 | 3300026067 | Bacteria | 2633 |
| 465 | Ga0207678_10197273 | 3300026067 | Bacteria | 1720 |
| 466 | Ga0207708_10115310 | 3300026075 | Bacteria | 2089 |
| 467 | Ga0207702_10013261 | 3300026078 | Bacteria | 6855 |
| 468 | Ga0207702_10041290 | 3300026078 | Bacteria | 3868 |
| 469 | Ga0207702_10484184 | 3300026078 | Bacteria | 1204 |
| 470 | Ga0207702_10678788 | 3300026078 | Bacteria | 1014 |
| 471 | Ga0207702_10964517 | 3300026078 | Bacteria | 845 |
| 472 | Ga0207641_10025781 | 3300026088 | Bacteria | 4848 |
| 473 | Ga0207641_10472548 | 3300026088 | Bacteria | 1214 |
| 474 | Ga0207648_10240821 | 3300026089 | Bacteria | 1611 |
| 475 | Ga0207648_10260403 | 3300026089 | Bacteria | 1548 |
| 476 | Ga0207676_10008206 | 3300026095 | Bacteria | 7431 |
| 477 | Ga0207676_10327860 | 3300026095 | Bacteria | 1408 |
| 478 | Ga0207676_10507784 | 3300026095 | Bacteria | 1146 |
| 479 | Ga0207674_10051394 | 3300026116 | Bacteria | 4206 |
| 480 | Ga0207674_10062738 | 3300026116 | Bacteria | 3753 |
| 481 | Ga0207674_10097083 | 3300026116 | Bacteria | 2931 |
| 482 | Ga0207674_10102592 | 3300026116 | Bacteria | 2840 |
| 483 | Ga0207674_10221047 | 3300026116 | Bacteria | 1842 |
| 484 | Ga0207674_10339414 | 3300026116 | Bacteria | 1453 |
| 485 | Ga0207674_10736496 | 3300026116 | Bacteria | 951 |
| 486 | Ga0207675_100001494 | 3300026118 | Bacteria | 23427 |
| 487 | Ga0207675_100226409 | 3300026118 | Bacteria | 1803 |
| 488 | Ga0207675_100589291 | 3300026118 | Bacteria | 1114 |
| 489 | Ga0207683_10010289 | 3300026121 | Bacteria | 7975 |
| 490 | Ga0207683_10176941 | 3300026121 | Bacteria | 1934 |
| 491 | Ga0207683_10195506 | 3300026121 | Bacteria | 1838 |
| 492 | Ga0207683_10364409 | 3300026121 | Bacteria | 1327 |
| 493 | Ga0207698_10008889 | 3300026142 | Bacteria | 6370 |
| 494 | Ga0207698_10065836 | 3300026142 | Bacteria | 2849 |
| 495 | Ga0207698_10066133 | 3300026142 | Bacteria | 2844 |
| 496 | Ga0207698_10198640 | 3300026142 | Bacteria | 1794 |
| 497 | Ga0207698_10237607 | 3300026142 | Bacteria | 1658 |
| 498 | Ga0207698_10318967 | 3300026142 | Bacteria | 1454 |
| 499 | Ga0207698_10490101 | 3300026142 | Bacteria | 1194 |
| 500 | Ga0207698_10493751 | 3300026142 | Bacteria | 1190 |
| 501 | Ga0209813_10000547 | 3300027866 | Bacteria | 8878 |
| 502 | Ga0209813_10157933 | 3300027866 | Bacteria | 816 |
| 503 | Ga0207428_10007154 | 3300027907 | Bacteria | 10211 |
| 504 | Ga0207428_10021909 | 3300027907 | Bacteria | 5402 |
| 505 | Ga0207428_10074450 | 3300027907 | Bacteria | 2663 |
| 506 | Ga0207428_10178470 | 3300027907 | Bacteria | 1605 |
| 507 | Ga0268266_10146424 | 3300028379 | Bacteria | 2124 |
| 508 | Ga0268266_10170393 | 3300028379 | Bacteria | 1976 |
| 509 | Ga0268266_10349811 | 3300028379 | Bacteria | 1389 |
| 510 | Ga0268266_10416577 | 3300028379 | Bacteria | 1272 |
| 511 | Ga0268266_10577781 | 3300028379 | Bacteria | 1078 |
| 512 | Ga0268266_10665643 | 3300028379 | Bacteria | 1002 |
| 513 | Ga0268265_10043211 | 3300028380 | Bacteria | 3348 |
| 514 | Ga0268265_10115732 | 3300028380 | Bacteria | 2198 |
| 515 | Ga0268265_10696602 | 3300028380 | Bacteria | 981 |
| 516 | Ga0268264_10061890 | 3300028381 | Bacteria | 3141 |
| 517 | Ga0268264_10108010 | 3300028381 | Bacteria | 2432 |
| 518 | Ga0268264_10133677 | 3300028381 | Bacteria | 2203 |
| 519 | Ga0268264_10295560 | 3300028381 | Bacteria | 1523 |
| 520 | Ga0268264_10295926 | 3300028381 | Bacteria | 1522 |
| 521 | Ga0265319_1073507 | 3300028563 | Bacteria | 1093 |
| 522 | Ga0265338_10033601 | 3300028800 | Bacteria | 4973 |
| 523 | Ga0265338_10042698 | 3300028800 | Bacteria | 4218 |
| 524 | Ga0265762_1017404 | 3300030760 | Bacteria | 1308 |
| 525 | Ga0265330_10030456 | 3300031235 | Bacteria | 2422 |
| 526 | Ga0265332_10005043 | 3300031238 | Bacteria | 6134 |
| 527 | Ga0265328_10000218 | 3300031239 | Bacteria | 26093 |
| 528 | Ga0265320_10032708 | 3300031240 | Bacteria | 2659 |
| 529 | Ga0265325_10019219 | 3300031241 | Bacteria | 3781 |
| 530 | Ga0265325_10042711 | 3300031241 | Bacteria | 2368 |
| 531 | Ga0265325_10171119 | 3300031241 | Bacteria | 1016 |
| 532 | Ga0265329_10035507 | 3300031242 | Bacteria | 1608 |
| 533 | Ga0265340_10000340 | 3300031247 | Bacteria | 24801 |
| 534 | Ga0265340_10009655 | 3300031247 | Bacteria | 5172 |
| 535 | Ga0265340_10095194 | 3300031247 | Bacteria | 1388 |
| 536 | Ga0265339_10000068 | 3300031249 | Bacteria | 91555 |
| 537 | Ga0265339_10010303 | 3300031249 | Bacteria | 5814 |
| 538 | Ga0265339_10075963 | 3300031249 | Bacteria | 1782 |
| 539 | Ga0265339_10179057 | 3300031249 | Bacteria | 1057 |
| 540 | Ga0265331_10051981 | 3300031250 | Bacteria | 1959 |
| 541 | Ga0265327_10034092 | 3300031251 | Bacteria | 2829 |
| 542 | Ga0265316_10058920 | 3300031344 | Bacteria | 2989 |
| 543 | Ga0265316_10170628 | 3300031344 | Bacteria | 1623 |
| 544 | Ga0265316_10175947 | 3300031344 | Bacteria | 1595 |
| 545 | Ga0307408_100029248 | 3300031548 | Bacteria | 3815 |
| 546 | Ga0307408_100472629 | 3300031548 | Bacteria | 1092 |
| 547 | Ga0265313_10000088 | 3300031595 | Bacteria | 90711 |
| 548 | Ga0265313_10149566 | 3300031595 | Bacteria | 999 |
| 549 | Ga0316575_10149388 | 3300031665 | Bacteria | 963 |
| 550 | Ga0316579_10011489 | 3300031691 | Bacteria | 3765 |
| 551 | Ga0316579_10054739 | 3300031691 | Bacteria | 1870 |
| 552 | Ga0265314_10131320 | 3300031711 | Bacteria | 1562 |
| 553 | Ga0265342_10000399 | 3300031712 | Bacteria | 48089 |
| 554 | Ga0265342_10037926 | 3300031712 | Bacteria | 2937 |
| 555 | Ga0265342_10175893 | 3300031712 | Bacteria | 1175 |
| 556 | Ga0265342_10210893 | 3300031712 | Bacteria | 1050 |
| 557 | Ga0316576_10176805 | 3300031727 | Bacteria | 1610 |
| 558 | Ga0316578_10010373 | 3300031728 | Bacteria | 4834 |
| 559 | Ga0307405_10018732 | 3300031731 | Bacteria | 3826 |
| 560 | Ga0307405_10142639 | 3300031731 | Bacteria | 1673 |
| 561 | Ga0307405_10171755 | 3300031731 | Bacteria | 1547 |
| 562 | Ga0307405_10321717 | 3300031731 | Bacteria | 1182 |
| 563 | Ga0316577_10133267 | 3300031733 | Bacteria | 1398 |
| 564 | Ga0307413_10107199 | 3300031824 | Bacteria | 1861 |
| 565 | Ga0307413_10226125 | 3300031824 | Bacteria | 1370 |
| 566 | Ga0307413_10400380 | 3300031824 | Bacteria | 1075 |
| 567 | Ga0307413_10793371 | 3300031824 | Bacteria | 795 |
| 568 | Ga0307413_10917521 | 3300031824 | Bacteria | 745 |
| 569 | Ga0307410_10055411 | 3300031852 | Bacteria | 2691 |
| 570 | Ga0307410_10090494 | 3300031852 | Bacteria | 2170 |
| 571 | Ga0307410_10274786 | 3300031852 | Bacteria | 1319 |
| 572 | Ga0307410_10311193 | 3300031852 | Bacteria | 1246 |
| 573 | Ga0307410_10481007 | 3300031852 | Bacteria | 1018 |
| 574 | Ga0307406_10061938 | 3300031901 | Bacteria | 2418 |
| 575 | Ga0307406_10147840 | 3300031901 | Bacteria | 1672 |
| 576 | Ga0307407_10054381 | 3300031903 | Bacteria | 2308 |
| 577 | Ga0307407_10074741 | 3300031903 | Bacteria | 2029 |
| 578 | Ga0307407_10097345 | 3300031903 | Bacteria | 1818 |
| 579 | Ga0307407_10823589 | 3300031903 | Bacteria | 707 |
| 580 | Ga0307412_10040409 | 3300031911 | Bacteria | 3017 |
| 581 | Ga0307412_10082451 | 3300031911 | Bacteria | 2227 |
| 582 | Ga0307412_10089144 | 3300031911 | Bacteria | 2153 |
| 583 | Ga0307412_10117114 | 3300031911 | Bacteria | 1912 |
| 584 | Ga0307412_10272515 | 3300031911 | Bacteria | 1325 |
| 585 | Ga0307412_10949367 | 3300031911 | Bacteria | 757 |
| 586 | Ga0307409_100010901 | 3300031995 | Bacteria | 5691 |
| 587 | Ga0307409_100022096 | 3300031995 | Bacteria | 4378 |
| 588 | Ga0307409_100032427 | 3300031995 | Bacteria | 3787 |
| 589 | Ga0307409_100067493 | 3300031995 | Bacteria | 2824 |
| 590 | Ga0307409_100098856 | 3300031995 | Bacteria | 2414 |
| 591 | Ga0307409_100861316 | 3300031995 | Bacteria | 917 |
| 592 | Ga0307409_101089900 | 3300031995 | Bacteria | 819 |
| 593 | Ga0307416_100002549 | 3300032002 | Bacteria | 10500 |
| 594 | Ga0307416_100005333 | 3300032002 | Bacteria | 7882 |
| 595 | Ga0307416_100073036 | 3300032002 | Bacteria | 2858 |
| 596 | Ga0307416_100251862 | 3300032002 | Bacteria | 1719 |
| 597 | Ga0307416_101587989 | 3300032002 | Bacteria | 759 |
| 598 | Ga0307414_10001040 | 3300032004 | Bacteria | 14198 |
| 599 | Ga0307414_10006477 | 3300032004 | Bacteria | 6528 |
| 600 | Ga0307414_10167357 | 3300032004 | Bacteria | 1753 |
| 601 | Ga0307414_10406893 | 3300032004 | Bacteria | 1183 |
| 602 | Ga0307411_10003258 | 3300032005 | Bacteria | 7488 |
| 603 | Ga0307411_10006084 | 3300032005 | Bacteria | 6000 |
| 604 | Ga0307411_10006109 | 3300032005 | Bacteria | 5991 |
| 605 | Ga0307411_10010035 | 3300032005 | Bacteria | 5021 |
| 606 | Ga0307411_10054586 | 3300032005 | Bacteria | 2624 |
| 607 | Ga0307411_10063642 | 3300032005 | Bacteria | 2466 |
| 608 | Ga0307411_10205136 | 3300032005 | Bacteria | 1517 |
| 609 | Ga0307411_10224671 | 3300032005 | Bacteria | 1459 |
| 610 | Ga0307411_10239453 | 3300032005 | Bacteria | 1419 |
| 611 | Ga0307411_10359858 | 3300032005 | Bacteria | 1189 |
| 612 | Ga0307411_10480067 | 3300032005 | Bacteria | 1046 |
| 613 | Ga0307415_100004677 | 3300032126 | Bacteria | 7158 |
| 614 | Ga0307415_100013659 | 3300032126 | Bacteria | 4747 |
| 615 | Ga0307415_100031432 | 3300032126 | Bacteria | 3420 |
| 616 | Ga0307415_100134743 | 3300032126 | Bacteria | 1876 |
| 617 | Ga0307415_100161715 | 3300032126 | Bacteria | 1736 |
| 618 | Ga0307415_100498059 | 3300032126 | Bacteria | 1064 |
| 619 | Ga0307415_100685954 | 3300032126 | Bacteria | 922 |
| 620 | Ga0307415_100737304 | 3300032126 | Bacteria | 893 |
| 621 | Ga0316583_10011289 | 3300032133 | Bacteria | 3217 |
| 622 | Ga0316585_10010049 | 3300032137 | Bacteria | 2772 |
| 623 | Ga0316580_10014622 | 3300032139 | Bacteria | 2396 |
| 624 | Ga0316593_10011756 | 3300032168 | Bacteria | 2554 |
| 625 | Ga0316587_1046730 | 3300033529 | Bacteria | 788 |
| 626 | Ga0316596_1004566 | 3300033541 | Bacteria | 3116 |
| 627 | Ga0373958_0041941 | 3300034819 | Bacteria | 938 |
| 628 | Ga0373959_0121812 | 3300034820 | Bacteria | 638 |
| 629 | Ga0373938_0014004 | 3300034957 | Bacteria | 1532 |
| 630 | Ga0373929_0003939 | 3300035085 | Bacteria | 2660 |
| 631 | Ga0373929_0090681 | 3300035085 | Bacteria | 758 |
| 632 | Ga0373934_0006122 | 3300035086 | Bacteria | 4457 |
| 633 | Ga0373940_0016660 | 3300035088 | Bacteria | 1823 |
| 634 | Ga0373923_0084639 | 3300035111 | Bacteria | 1380 |
| 635 | Ga0373932_0021648 | 3300035112 | Bacteria | 1699 |
| 636 | Ga0373932_0063858 | 3300035112 | Bacteria | 1126 |
| 637 | Ga0373936_0005177 | 3300035113 | Bacteria | 4907 |
| 638 | Ga0373936_0135158 | 3300035113 | Bacteria | 1062 |
| 639 | Ga0373939_0047421 | 3300035114 | Bacteria | 1319 |
| 640 | Ga0373939_0152677 | 3300035114 | Bacteria | 842 |
| 641 | Ga0373941_0000346 | 3300035115 | Bacteria | 9108 |
| 642 | Ga0373945_0306079 | 3300035116 | Bacteria | 681 |
| 643 | Ga0373953_0025705 | 3300035117 | Bacteria | 2251 |
| 644 | Ga0373953_0047451 | 3300035117 | Bacteria | 1728 |
| 645 | Ga0373953_0213267 | 3300035117 | Bacteria | 836 |
| 646 | Ga0373954_0023234 | 3300035118 | Bacteria | 2818 |
| 647 | Ga0373954_0029189 | 3300035118 | Bacteria | 2539 |
| 648 | Ga0373956_0210857 | 3300035119 | Bacteria | 921 |
| 649 | Ga0373957_0087288 | 3300035120 | Bacteria | 1236 |
| 650 | Ga0373957_0135035 | 3300035120 | Bacteria | 1006 |
| 651 | Ga0373960_0004056 | 3300035121 | Bacteria | 3345 |
| 652 | Ga0373943_0036994 | 3300035170 | Bacteria | 2341 |
| 653 | Ga0373946_0246314 | 3300035171 | Bacteria | 870 |
| 654 | Ga0373955_0003048 | 3300035172 | Bacteria | 7338 |
| 655 | Ga0373955_0008692 | 3300035172 | Bacteria | 4726 |
| 656 | Ga0373942_0010535 | 3300035207 | Bacteria | 2177 |
| 657 | Ga0373961_0006736 | 3300035241 | Bacteria | 2763 |
| 658 | Ga0373962_0035672 | 3300035242 | Bacteria | 1382 |
| 659 | Ga0373962_0112893 | 3300035242 | Bacteria | 859 |
| 660 | Ga0316574_0000467 | 3300035398 | Bacteria | 16333 |
| 661 | Ga0373924_0061428 | 3300035410 | Bacteria | 1573 |
| 662 | Ga0373924_0199458 | 3300035410 | Bacteria | 882 |
| 663 | Ga0373931_0001292 | 3300035691 | Bacteria | 10708 |
| 664 | Ga0373931_0002313 | 3300035691 | Bacteria | 8416 |
| 665 | Ga0373931_0332445 | 3300035691 | Bacteria | 947 |
| 666 | Ga0373935_0007400 | 3300035692 | Bacteria | 6571 |
| 667 | Ga0373935_0146177 | 3300035692 | Bacteria | 1601 |
| 668 | Ga0373927_0035512 | 3300035695 | Bacteria | 3241 |
| 669 | Ga0373927_0049298 | 3300035695 | Bacteria | 2723 |
| 670 | Ga0373927_0062962 | 3300035695 | Bacteria | 2399 |
| 671 | Ga0373933_0005821 | 3300035724 | Bacteria | 6707 |
| 672 | Ga0373933_0009152 | 3300035724 | Bacteria | 5406 |
| 673 | Ga0373933_0622289 | 3300035724 | Bacteria | 709 |
| 674 | Ga0373947_0014629 | 3300035725 | Bacteria | 4499 |
| 675 | Ga0373947_0076796 | 3300035725 | Bacteria | 2059 |
| 676 | Ga0373947_0164580 | 3300035725 | Bacteria | 1436 |
| 677 | Ga0373947_0499461 | 3300035725 | Bacteria | 826 |
| 678 | Ga0373937_0000075 | 3300036401 | Bacteria | 89727 |
| 679 | Ga0373937_0000231 | 3300036401 | Bacteria | 54437 |
| 680 | Ga0373937_0429887 | 3300036401 | Bacteria | 1253 |
| 681 | Ga0373937_0939557 | 3300036401 | Bacteria | 813 |
| 682 | Ga0316582_0040365 | 3300036647 | Bacteria | 2912 |
| 683 | Ga0316582_0263607 | 3300036647 | Bacteria | 1181 |
| 684 | Ga0316582_0315671 | 3300036647 | Bacteria | 1074 |
| 685 | Ga0316584_0091032 | 3300036712 | Bacteria | 2283 |
| 686 | Ga0316584_0174508 | 3300036712 | Bacteria | 1593 |
| 687 | Ga0316584_0431552 | 3300036712 | Bacteria | 934 |
| 688 | Ga0373925_0000081 | 3300037068 | Bacteria | 102407 |
| 689 | Ga0373925_0134123 | 3300037068 | Bacteria | 1933 |
| 690 | Ga0395899_0010276 | 3300037312 | Bacteria | 7175 |
| 691 | Ga0395899_0021002 | 3300037312 | Bacteria | 4951 |
| 692 | Ga0395899_0129909 | 3300037312 | Bacteria | 1799 |
| 693 | Ga0395899_0458681 | 3300037312 | Bacteria | 833 |
| 694 | Ga0395900_0063629 | 3300037418 | Bacteria | 3792 |
| 695 | Ga0395900_0076737 | 3300037418 | Bacteria | 3433 |
| 696 | Ga0395900_0152979 | 3300037418 | Bacteria | 2356 |
| 697 | Ga0395898_0052511 | 3300037466 | Bacteria | 3982 |
| 698 | Ga0395898_0072191 | 3300037466 | Bacteria | 3334 |
| 699 | Ga0395905_0108517 | 3300037471 | Bacteria | 2606 |
| 700 | Ga0395905_0128888 | 3300037471 | Bacteria | 2379 |
| 701 | Ga0395905_0132823 | 3300037471 | Bacteria | 2341 |
| 702 | Ga0395905_0166922 | 3300037471 | Bacteria | 2068 |
| 703 | Ga0395905_0476632 | 3300037471 | Bacteria | 1147 |
| 704 | Ga0316581_0034438 | 3300037588 | Bacteria | 1532 |
| 705 | Ga0316581_0097300 | 3300037588 | Bacteria | 906 |
| 706 | Ga0436364_0721077 | 3300037853 | Bacteria | 701 |
| 707 | Ga0436364_1243640 | 3300037853 | Bacteria | 1499 |
| 708 | Ga0395901_0030541 | 3300038443 | Bacteria | 5551 |
| 709 | Ga0395901_0095901 | 3300038443 | Bacteria | 3108 |
| 710 | Ga0395901_0454161 | 3300038443 | Bacteria | 1310 |
| 711 | Ga0400490_34472 | 3300038726 | Bacteria | 6742 |
| 712 | Ga0400488_04486 | 3300038741 | Bacteria | 1967 |
| 713 | Ga0400488_59215 | 3300038741 | Bacteria | 10431 |
| 714 | Ga0400483_041422 | 3300039062 | Bacteria | 4570 |
| 715 | Ga0400483_184515 | 3300039062 | Bacteria | 1084 |
| 716 | Ga0400483_277636 | 3300039062 | Bacteria | 1402 |
| 717 | Ga0436365_0565920 | 3300039437 | Bacteria | 760 |
| 718 | Ga0436365_1068013 | 3300039437 | Bacteria | 638 |
| 719 | Ga0436365_1655375 | 3300039437 | Bacteria | 4942 |
| 720 | Ga0436365_1751841 | 3300039437 | Bacteria | 2819 |
| 721 | Ga0436361_0689606 | 3300039447 | Bacteria | 616 |
| 722 | Ga0436362_0544081 | 3300039453 | Bacteria | 818 |
| 723 | Ga0436362_1064891 | 3300039453 | Bacteria | 747 |
| 724 | Ga0439453_0006563 | 3300041408 | Bacteria | 1816 |
| 725 | Ga0439453_0012916 | 3300041408 | Bacteria | 1413 |
| 726 | Ga0451807_1298589 | 3300041486 | Bacteria | 663 |
| 727 | Ga0451843_0940280 | 3300041509 | Bacteria | 913 |
| 728 | Ga0439437_014891 | 3300042000 | Bacteria | 911 |
| 729 | Ga0439443_023327 | 3300042003 | Bacteria | 987 |
| 730 | Ga0439445_0004377 | 3300042004 | Bacteria | 3201 |
| 731 | Ga0450910_050728 | 3300042147 | Bacteria | 686 |
| 732 | Ga0439434_0049122 | 3300042435 | Bacteria | 1306 |
| 733 | Ga0439435_0086503 | 3300042436 | Bacteria | 947 |
| 734 | Ga0439459_0118537 | 3300042438 | Bacteria | 665 |
| 735 | Ga0439464_0083940 | 3300042439 | Bacteria | 954 |
| 736 | Ga0439460_0219031 | 3300042461 | Bacteria | 652 |
| 737 | Ga0451577_0213699 | 3300042876 | Bacteria | 1743 |
| 738 | Ga0451577_0298959 | 3300042876 | Bacteria | 1459 |
| 739 | Ga0466969_0091404 | 3300044656 | Bacteria | 1442 |
| 740 | Ga0466972_0146519 | 3300044658 | Bacteria | 1111 |
| 741 | Ga0466972_0273069 | 3300044658 | Bacteria | 790 |
| 742 | Ga0466966_0015054 | 3300044684 | Bacteria | 5117 |
| 743 | Ga0466966_0070826 | 3300044684 | Bacteria | 2185 |
| 744 | Ga0466961_0298972 | 3300044693 | Bacteria | 983 |
| 745 | Ga0466963_0103267 | 3300044694 | Bacteria | 1953 |
| 746 | Ga0466964_0208197 | 3300044706 | Bacteria | 943 |
| 747 | Ga0453684_0042475 | 3300044712 | Bacteria | 6128 |
| 748 | Ga0453684_0166907 | 3300044712 | Bacteria | 2598 |
| 749 | Ga0453684_0741911 | 3300044712 | Bacteria | 1064 |
| 750 | Ga0466968_0053193 | 3300044735 | Bacteria | 1734 |
| 751 | Ga0466970_0024076 | 3300044765 | Bacteria | 3183 |
| 752 | Ga0466970_0285414 | 3300044765 | Bacteria | 929 |
| 753 | Ga0466957_0019054 | 3300044842 | Bacteria | 4035 |
| 754 | Ga0466957_0414682 | 3300044842 | Bacteria | 923 |
| 755 | Ga0466957_0484359 | 3300044842 | Bacteria | 856 |
| 756 | Ga0466960_0054564 | 3300044901 | Bacteria | 1941 |
| 757 | Ga0466959_0048339 | 3300045049 | Bacteria | 3126 |
| 758 | Ga0451576_0005522 | 3300045051 | Bacteria | 15795 |
| 759 | Ga0451576_0103697 | 3300045051 | Bacteria | 2958 |
| 760 | Ga0451576_0168558 | 3300045051 | Bacteria | 2285 |
| 761 | Ga0466967_0039462 | 3300045976 | Bacteria | 4059 |
| 762 | Ga0466967_0087942 | 3300045976 | Bacteria | 2818 |
| 763 | Ga0466967_0088711 | 3300045976 | Bacteria | 2807 |
| 764 | Ga0466967_0165787 | 3300045976 | Bacteria | 2076 |
| 765 | Ga0466967_1098706 | 3300045976 | Bacteria | 792 |
| 766 | Ga0495592_0000102 | 3300046454 | Bacteria | 75767 |
| 767 | Ga0495592_0000694 | 3300046454 | Bacteria | 23469 |
| 768 | Ga0495629_0008845 | 3300046459 | Bacteria | 7404 |
| 769 | Ga0495629_0072659 | 3300046459 | Bacteria | 2401 |
| 770 | Ga0495638_0009457 | 3300046460 | Bacteria | 6839 |
| 771 | Ga0495651_0001342 | 3300046462 | Bacteria | 19049 |
| 772 | Ga0495653_0000681 | 3300046463 | Bacteria | 25993 |
| 773 | Ga0495653_0011013 | 3300046463 | Bacteria | 7396 |
| 774 | Ga0495582_0130616 | 3300046473 | Bacteria | 1419 |
| 775 | Ga0495639_0149172 | 3300046475 | Bacteria | 1127 |
| 776 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 777 | Ga0495664_0004663 | 3300046477 | Bacteria | 7497 |
| 778 | Ga0495584_0053441 | 3300046491 | Bacteria | 2033 |
| 779 | Ga0495585_0056622 | 3300046492 | Bacteria | 2165 |
| 780 | Ga0495585_0194871 | 3300046492 | Bacteria | 1035 |
| 781 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 782 | Ga0495608_0016534 | 3300046511 | Bacteria | 5105 |
| 783 | Ga0495618_0007196 | 3300046514 | Bacteria | 6737 |
| 784 | Ga0495618_0064002 | 3300046514 | Bacteria | 2336 |
| 785 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 786 | Ga0495628_0008859 | 3300046516 | Bacteria | 8612 |
| 787 | Ga0495628_0072643 | 3300046516 | Bacteria | 2681 |
| 788 | Ga0495630_0010531 | 3300046517 | Bacteria | 6681 |
| 789 | Ga0495630_0113607 | 3300046517 | Bacteria | 2052 |
| 790 | Ga0495632_0307532 | 3300046519 | Bacteria | 702 |
| 791 | Ga0495663_0009581 | 3300046525 | Bacteria | 2687 |
| 792 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 793 | Ga0495652_0072584 | 3300046529 | Bacteria | 2868 |
| 794 | Ga0495652_0147864 | 3300046529 | Bacteria | 1839 |
| 795 | Ga0495640_0002500 | 3300046533 | Bacteria | 14791 |
| 796 | Ga0495640_0012152 | 3300046533 | Bacteria | 6591 |
| 797 | Ga0495640_0198506 | 3300046533 | Bacteria | 1272 |
| 798 | Ga0495640_0547187 | 3300046533 | Bacteria | 702 |
| 799 | Ga0495587_0000043 | 3300046536 | Bacteria | 109717 |
| 800 | Ga0495587_0000753 | 3300046536 | Bacteria | 21591 |
| 801 | Ga0495598_0004644 | 3300046537 | Bacteria | 2988 |
| 802 | Ga0495609_0234018 | 3300046538 | Bacteria | 760 |
| 803 | Ga0495621_0006102 | 3300046539 | Bacteria | 3501 |
| 804 | Ga0495645_0000064 | 3300046543 | Bacteria | 74490 |
| 805 | Ga0495645_0116750 | 3300046543 | Bacteria | 1883 |
| 806 | Ga0495645_0168904 | 3300046543 | Bacteria | 1507 |
| 807 | Ga0495633_0005946 | 3300046558 | Bacteria | 7334 |
| 808 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 809 | Ga0495667_0000450 | 3300046559 | Bacteria | 26281 |
| 810 | Ga0495667_0117499 | 3300046559 | Bacteria | 1718 |
| 811 | Ga0495656_0157287 | 3300046615 | Bacteria | 1102 |
| 812 | Ga0495668_0463385 | 3300046616 | Bacteria | 698 |
| 813 | Ga0495634_0002682 | 3300046642 | Bacteria | 14626 |
| 814 | Ga0495634_0005621 | 3300046642 | Bacteria | 9611 |
| 815 | Ga0495634_0457636 | 3300046642 | Bacteria | 752 |
| 816 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 817 | Ga0495635_0001541 | 3300046663 | Bacteria | 15439 |
| 818 | Ga0495659_0071561 | 3300046664 | Bacteria | 1300 |
| 819 | Ga0495661_0108596 | 3300046665 | Bacteria | 1550 |
| 820 | Ga0495657_0011026 | 3300046675 | Bacteria | 6778 |
| 821 | Ga0495599_0002496 | 3300046678 | Bacteria | 10716 |
| 822 | Ga0495599_0007280 | 3300046678 | Bacteria | 6701 |
| 823 | Ga0495623_0003470 | 3300046679 | Bacteria | 10438 |
| 824 | Ga0495623_0008462 | 3300046679 | Bacteria | 6682 |
| 825 | Ga0495646_0000027 | 3300046680 | Bacteria | 97629 |
| 826 | Ga0495658_0129781 | 3300046683 | Bacteria | 1533 |
| 827 | Ga0495658_0364187 | 3300046683 | Bacteria | 919 |
| 828 | Ga0495669_0022836 | 3300046684 | Bacteria | 2719 |
| 829 | Ga0495669_0033137 | 3300046684 | Bacteria | 2273 |
| 830 | Ga0495613_0199191 | 3300046689 | Bacteria | 1412 |
| 831 | Ga0495613_0748630 | 3300046689 | Bacteria | 640 |
| 832 | Ga0495624_0415031 | 3300046690 | Bacteria | 807 |
| 833 | Ga0495624_0492094 | 3300046690 | Bacteria | 734 |
| 834 | Ga0495670_0035903 | 3300046691 | Bacteria | 2469 |
| 835 | Ga0495670_0114858 | 3300046691 | Bacteria | 1395 |
| 836 | Ga0495589_0075431 | 3300046794 | Bacteria | 1644 |
| 837 | Ga0495600_0000047 | 3300046809 | Bacteria | 71546 |
| 838 | Ga0495600_0001179 | 3300046809 | Bacteria | 14283 |
| 839 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 840 | Ga0495604_0001199 | 3300047317 | Bacteria | 21407 |
| 841 | Ga0495604_0107838 | 3300047317 | Bacteria | 2035 |
| 842 | Ga0495636_0298178 | 3300047318 | Bacteria | 754 |
| 843 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 844 | Ga0495674_0000573 | 3300047319 | Bacteria | 34362 |
| 845 | Ga0495676_0045729 | 3300047321 | Bacteria | 3560 |
| 846 | Ga0495680_0000285 | 3300047322 | Bacteria | 56843 |
| 847 | Ga0495680_0002949 | 3300047322 | Bacteria | 17037 |
| 848 | Ga0495680_0351320 | 3300047322 | Bacteria | 1026 |
| 849 | Ga0495675_0032125 | 3300047444 | Bacteria | 3350 |
| 850 | Ga0495675_0066501 | 3300047444 | Bacteria | 2278 |
| 851 | Ga0495675_0450347 | 3300047444 | Bacteria | 745 |
| 852 | Ga0495677_0052449 | 3300047445 | Bacteria | 1503 |
| 853 | Ga0495677_0102171 | 3300047445 | Bacteria | 1086 |
| 854 | Ga0495684_0011810 | 3300047471 | Bacteria | 6738 |
| 855 | Ga0495684_0024992 | 3300047471 | Bacteria | 4594 |
| 856 | Ga0495686_0106680 | 3300047472 | Bacteria | 1684 |
| 857 | Ga0495593_0032963 | 3300047673 | Bacteria | 2822 |
| 858 | Ga0495593_0210655 | 3300047673 | Bacteria | 976 |
| 859 | Ga0495593_0257106 | 3300047673 | Bacteria | 874 |
| 860 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 861 | Ga0495602_0007083 | 3300048088 | Bacteria | 11769 |
| 862 | Ga0496100_0124207 | 3300048903 | Bacteria | 1810 |
| 863 | Ga0496101_0067877 | 3300048904 | Bacteria | 2605 |
| 864 | Ga0496101_0594585 | 3300048904 | Bacteria | 875 |
| 865 | Ga0496102_0088819 | 3300048905 | Bacteria | 2858 |
| 866 | Ga0496102_0748219 | 3300048905 | Bacteria | 900 |
| 867 | Ga0496103_0050675 | 3300048906 | Bacteria | 2568 |
| 868 | Ga0496104_0334729 | 3300048907 | Bacteria | 1427 |
| 869 | Ga0496104_0436585 | 3300048907 | Bacteria | 1221 |
| 870 | Ga0496105_0106651 | 3300048908 | Bacteria | 2313 |
| 871 | Ga0496105_0283645 | 3300048908 | Bacteria | 1335 |
| 872 | Ga0496108_0028372 | 3300048911 | Bacteria | 4630 |
| 873 | Ga0496108_0052890 | 3300048911 | Bacteria | 3405 |
| 874 | Ga0496108_0138631 | 3300048911 | Bacteria | 2095 |
| 875 | Ga0496108_0400326 | 3300048911 | Bacteria | 1199 |
| 876 | Ga0496109_0012227 | 3300048912 | Bacteria | 7406 |
| 877 | Ga0496109_0086385 | 3300048912 | Bacteria | 2897 |
| 878 | Ga0496109_0425520 | 3300048912 | Bacteria | 1254 |
| 879 | Ga0496110_0050539 | 3300048913 | Bacteria | 3650 |
| 880 | Ga0496110_0276164 | 3300048913 | Bacteria | 1530 |
| 881 | Ga0496110_0347132 | 3300048913 | Bacteria | 1352 |
| 882 | Ga0496110_0690529 | 3300048913 | Bacteria | 922 |
| 883 | Ga0496111_0015254 | 3300048914 | Bacteria | 5270 |
| 884 | Ga0496111_0670567 | 3300048914 | Bacteria | 756 |
| 885 | Ga0496112_0040251 | 3300048915 | Bacteria | 4569 |
| 886 | Ga0496112_0116807 | 3300048915 | Bacteria | 2638 |
| 887 | Ga0496113_0198353 | 3300048916 | Bacteria | 1595 |
| 888 | Ga0496113_1000798 | 3300048916 | Bacteria | 658 |
| 889 | Ga0496114_0156254 | 3300048917 | Bacteria | 1980 |
| 890 | Ga0496114_0188115 | 3300048917 | Bacteria | 1805 |
| 891 | Ga0496114_0338092 | 3300048917 | Bacteria | 1331 |
| 892 | Ga0496114_0670356 | 3300048917 | Bacteria | 911 |
| 893 | Ga0496115_0651006 | 3300048918 | Bacteria | 833 |
| 894 | Ga0496121_0171993 | 3300048924 | Bacteria | 1572 |
| 895 | Ga0496121_0582876 | 3300048924 | Bacteria | 693 |
| 896 | Ga0496126_0699576 | 3300048929 | Bacteria | 788 |
| 897 | Ga0501290_000464 | 3300049513 | Bacteria | 6297 |
| 898 | Ga0501292_000026 | 3300049515 | Bacteria | 42153 |
| 899 | Ga0501294_000620 | 3300049517 | Bacteria | 4032 |
| 900 | Ga0501317_062296 | 3300049533 | Bacteria | 614 |
| 901 | Ga0501031_0002683 | 3300049568 | Bacteria | 11328 |
| 902 | Ga0501031_0031678 | 3300049568 | Bacteria | 3449 |
| 903 | Ga0501031_0033840 | 3300049568 | Bacteria | 3335 |
| 904 | Ga0501031_0139148 | 3300049568 | Bacteria | 1586 |
| 905 | Ga0501031_0352347 | 3300049568 | Bacteria | 953 |
| 906 | Ga0501032_0006465 | 3300049569 | Bacteria | 8617 |
| 907 | Ga0501032_0007303 | 3300049569 | Bacteria | 8080 |
| 908 | Ga0501032_0008238 | 3300049569 | Bacteria | 7601 |
| 909 | Ga0501032_0029554 | 3300049569 | Bacteria | 3760 |
| 910 | Ga0501032_0034383 | 3300049569 | Bacteria | 3470 |
| 911 | Ga0501032_0055046 | 3300049569 | Bacteria | 2676 |
| 912 | Ga0501032_0134960 | 3300049569 | Bacteria | 1627 |
| 913 | Ga0501033_0004363 | 3300049570 | Bacteria | 11336 |
| 914 | Ga0501033_0015275 | 3300049570 | Bacteria | 5824 |
| 915 | Ga0501033_0034895 | 3300049570 | Bacteria | 3770 |
| 916 | Ga0501033_0062891 | 3300049570 | Bacteria | 2732 |
| 917 | Ga0501033_0081556 | 3300049570 | Bacteria | 2372 |
| 918 | Ga0501033_0092428 | 3300049570 | Bacteria | 2213 |
| 919 | Ga0501033_0111769 | 3300049570 | Bacteria | 1988 |
| 920 | Ga0501033_0123637 | 3300049570 | Bacteria | 1876 |
| 921 | Ga0501033_0284288 | 3300049570 | Bacteria | 1167 |
| 922 | Ga0501034_0000166 | 3300049571 | Bacteria | 122782 |
| 923 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 924 | Ga0501034_0004004 | 3300049571 | Bacteria | 16529 |
| 925 | Ga0501034_0011589 | 3300049571 | Bacteria | 9129 |
| 926 | Ga0501034_0015288 | 3300049571 | Bacteria | 7888 |
| 927 | Ga0501034_0022969 | 3300049571 | Bacteria | 6355 |
| 928 | Ga0501034_0053963 | 3300049571 | Bacteria | 4046 |
| 929 | Ga0501034_0055243 | 3300049571 | Bacteria | 3996 |
| 930 | Ga0501034_0074320 | 3300049571 | Bacteria | 3407 |
| 931 | Ga0501034_0093981 | 3300049571 | Bacteria | 2995 |
| 932 | Ga0501034_0109847 | 3300049571 | Bacteria | 2748 |
| 933 | Ga0501034_0172691 | 3300049571 | Bacteria | 2128 |
| 934 | Ga0501034_0321395 | 3300049571 | Bacteria | 1480 |
| 935 | Ga0501034_0528818 | 3300049571 | Bacteria | 1090 |
| 936 | Ga0501034_0810090 | 3300049571 | Bacteria | 829 |
| 937 | Ga0501034_0865926 | 3300049571 | Bacteria | 793 |
| 938 | Ga0501036_0000098 | 3300049572 | Bacteria | 54252 |
| 939 | Ga0501036_0000118 | 3300049572 | Bacteria | 49383 |
| 940 | Ga0501036_0011524 | 3300049572 | Bacteria | 7325 |
| 941 | Ga0501036_0059781 | 3300049572 | Bacteria | 3229 |
| 942 | Ga0501036_0096933 | 3300049572 | Bacteria | 2493 |
| 943 | Ga0501036_0172034 | 3300049572 | Bacteria | 1825 |
| 944 | Ga0501036_0212665 | 3300049572 | Bacteria | 1624 |
| 945 | Ga0501036_0236143 | 3300049572 | Bacteria | 1533 |
| 946 | Ga0501036_0272062 | 3300049572 | Bacteria | 1418 |
| 947 | Ga0501036_0322427 | 3300049572 | Bacteria | 1291 |
| 948 | Ga0501036_0391656 | 3300049572 | Bacteria | 1159 |
| 949 | Ga0501036_0445366 | 3300049572 | Bacteria | 1079 |
| 950 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 951 | Ga0501037_0002056 | 3300049573 | Bacteria | 14595 |
| 952 | Ga0501037_0021237 | 3300049573 | Bacteria | 4796 |
| 953 | Ga0501037_0082921 | 3300049573 | Bacteria | 2322 |
| 954 | Ga0501037_0165148 | 3300049573 | Bacteria | 1577 |
| 955 | Ga0501037_0188274 | 3300049573 | Bacteria | 1462 |
| 956 | Ga0501037_0240667 | 3300049573 | Bacteria | 1268 |
| 957 | Ga0501037_0554087 | 3300049573 | Bacteria | 775 |
| 958 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 959 | Ga0501038_0011141 | 3300049574 | Bacteria | 8211 |
| 960 | Ga0501038_0020000 | 3300049574 | Bacteria | 6026 |
| 961 | Ga0501038_0028839 | 3300049574 | Bacteria | 4927 |
| 962 | Ga0501038_0088715 | 3300049574 | Bacteria | 2595 |
| 963 | Ga0501038_0196113 | 3300049574 | Bacteria | 1623 |
| 964 | Ga0501038_0280926 | 3300049574 | Bacteria | 1310 |
| 965 | Ga0501038_0282712 | 3300049574 | Bacteria | 1306 |
| 966 | Ga0501038_0286085 | 3300049574 | Bacteria | 1296 |
| 967 | Ga0501038_0328335 | 3300049574 | Bacteria | 1195 |
| 968 | Ga0501038_0358729 | 3300049574 | Bacteria | 1134 |
| 969 | Ga0501039_0000547 | 3300049575 | Bacteria | 27186 |
| 970 | Ga0501039_0000554 | 3300049575 | Bacteria | 27105 |
| 971 | Ga0501039_0016705 | 3300049575 | Bacteria | 5623 |
| 972 | Ga0501039_0036429 | 3300049575 | Bacteria | 3796 |
| 973 | Ga0501039_0063880 | 3300049575 | Bacteria | 2852 |
| 974 | Ga0501039_0086154 | 3300049575 | Bacteria | 2446 |
| 975 | Ga0501039_0222742 | 3300049575 | Bacteria | 1483 |
| 976 | Ga0501039_0597706 | 3300049575 | Bacteria | 865 |
| 977 | Ga0501039_0600368 | 3300049575 | Bacteria | 863 |
| 978 | Ga0501040_0018492 | 3300049576 | Bacteria | 4627 |
| 979 | Ga0501040_0032602 | 3300049576 | Bacteria | 3526 |
| 980 | Ga0501040_0089782 | 3300049576 | Bacteria | 2135 |
| 981 | Ga0501040_0475150 | 3300049576 | Bacteria | 900 |
| 982 | Ga0501040_0482988 | 3300049576 | Bacteria | 893 |
| 983 | Ga0501040_0491450 | 3300049576 | Bacteria | 885 |
| 984 | Ga0501040_0673822 | 3300049576 | Bacteria | 748 |
| 985 | Ga0501041_0040615 | 3300049577 | Bacteria | 2824 |
| 986 | Ga0501041_0247238 | 3300049577 | Bacteria | 1121 |
| 987 | Ga0501041_0405466 | 3300049577 | Bacteria | 864 |
| 988 | Ga0501041_0479545 | 3300049577 | Bacteria | 790 |
| 989 | Ga0501042_0040851 | 3300049578 | Bacteria | 3297 |
| 990 | Ga0501042_0055463 | 3300049578 | Bacteria | 2828 |
| 991 | Ga0501042_0094903 | 3300049578 | Bacteria | 2142 |
| 992 | Ga0501042_0380823 | 3300049578 | Bacteria | 1021 |
| 993 | Ga0501042_0614942 | 3300049578 | Bacteria | 790 |
| 994 | Ga0501042_0634531 | 3300049578 | Bacteria | 777 |
| 995 | Ga0501043_0003262 | 3300049579 | Bacteria | 13373 |
| 996 | Ga0501043_0004952 | 3300049579 | Bacteria | 10775 |
| 997 | Ga0501043_0025398 | 3300049579 | Bacteria | 4648 |
| 998 | Ga0501043_0037821 | 3300049579 | Bacteria | 3796 |
| 999 | Ga0501043_0074646 | 3300049579 | Bacteria | 2663 |
| 1000 | Ga0501043_0091286 | 3300049579 | Bacteria | 2394 |
| 1001 | Ga0501043_0106599 | 3300049579 | Bacteria | 2201 |
| 1002 | Ga0501043_0131322 | 3300049579 | Bacteria | 1963 |
| 1003 | Ga0501043_0568607 | 3300049579 | Bacteria | 840 |
| 1004 | Ga0501043_1021618 | 3300049579 | Bacteria | 587 |
| 1005 | Ga0501046_0000483 | 3300049580 | Bacteria | 39806 |
| 1006 | Ga0501046_0007623 | 3300049580 | Bacteria | 9493 |
| 1007 | Ga0501046_0008888 | 3300049580 | Bacteria | 8723 |
| 1008 | Ga0501046_0019056 | 3300049580 | Bacteria | 5696 |
| 1009 | Ga0501046_0024112 | 3300049580 | Bacteria | 4996 |
| 1010 | Ga0501046_0041977 | 3300049580 | Bacteria | 3648 |
| 1011 | Ga0501046_0105086 | 3300049580 | Bacteria | 2163 |
| 1012 | Ga0501046_0209038 | 3300049580 | Bacteria | 1449 |
| 1013 | Ga0501046_0574290 | 3300049580 | Bacteria | 802 |
| 1014 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 1015 | Ga0501047_0000097 | 3300049581 | Bacteria | 107310 |
| 1016 | Ga0501047_0002349 | 3300049581 | Bacteria | 18098 |
| 1017 | Ga0501047_0011286 | 3300049581 | Bacteria | 8456 |
| 1018 | Ga0501047_0089266 | 3300049581 | Bacteria | 2959 |
| 1019 | Ga0501047_0150648 | 3300049581 | Bacteria | 2202 |
| 1020 | Ga0501047_0173726 | 3300049581 | Bacteria | 2023 |
| 1021 | Ga0501047_0175046 | 3300049581 | Bacteria | 2013 |
| 1022 | Ga0501047_0199679 | 3300049581 | Bacteria | 1861 |
| 1023 | Ga0501047_0249337 | 3300049581 | Bacteria | 1624 |
| 1024 | Ga0501047_0460618 | 3300049581 | Bacteria | 1100 |
| 1025 | Ga0501048_0000522 | 3300049582 | Bacteria | 26987 |
| 1026 | Ga0501048_0000821 | 3300049582 | Bacteria | 22904 |
| 1027 | Ga0501048_0021257 | 3300049582 | Bacteria | 4751 |
| 1028 | Ga0501048_0178190 | 3300049582 | Bacteria | 1506 |
| 1029 | Ga0501048_0192599 | 3300049582 | Bacteria | 1445 |
| 1030 | Ga0501048_0219615 | 3300049582 | Bacteria | 1348 |
| 1031 | Ga0501048_0279696 | 3300049582 | Bacteria | 1187 |
| 1032 | Ga0501067_0000576 | 3300049583 | Bacteria | 19849 |
| 1033 | Ga0501067_0000688 | 3300049583 | Bacteria | 18195 |
| 1034 | Ga0501067_0003424 | 3300049583 | Bacteria | 8731 |
| 1035 | Ga0501067_0007963 | 3300049583 | Bacteria | 5886 |
| 1036 | Ga0501067_0015150 | 3300049583 | Bacteria | 4267 |
| 1037 | Ga0501068_0000490 | 3300049584 | Bacteria | 20051 |
| 1038 | Ga0501068_0001239 | 3300049584 | Bacteria | 13551 |
| 1039 | Ga0501068_0035913 | 3300049584 | Bacteria | 2960 |
| 1040 | Ga0501068_0083205 | 3300049584 | Bacteria | 1966 |
| 1041 | Ga0501068_0104234 | 3300049584 | Bacteria | 1760 |
| 1042 | Ga0501068_0303221 | 3300049584 | Bacteria | 1023 |
| 1043 | Ga0501069_0000707 | 3300049585 | Bacteria | 15581 |
| 1044 | Ga0501069_0006762 | 3300049585 | Bacteria | 6004 |
| 1045 | Ga0501069_0026803 | 3300049585 | Bacteria | 3157 |
| 1046 | Ga0501069_0040815 | 3300049585 | Bacteria | 2564 |
| 1047 | Ga0501069_0162399 | 3300049585 | Bacteria | 1287 |
| 1048 | Ga0501070_0002047 | 3300049586 | Bacteria | 17725 |
| 1049 | Ga0501070_0028005 | 3300049586 | Bacteria | 4726 |
| 1050 | Ga0501070_0037453 | 3300049586 | Bacteria | 4049 |
| 1051 | Ga0501070_0037536 | 3300049586 | Bacteria | 4044 |
| 1052 | Ga0501070_0040620 | 3300049586 | Bacteria | 3879 |
| 1053 | Ga0501070_0063974 | 3300049586 | Bacteria | 3047 |
| 1054 | Ga0501070_0191397 | 3300049586 | Bacteria | 1681 |
| 1055 | Ga0501070_0318792 | 3300049586 | Bacteria | 1265 |
| 1056 | Ga0501071_0008806 | 3300049587 | Bacteria | 6686 |
| 1057 | Ga0501071_0437350 | 3300049587 | Bacteria | 1001 |
| 1058 | Ga0501071_1012439 | 3300049587 | Bacteria | 642 |
| 1059 | Ga0501072_0000001 | 3300049588 | Bacteria | 362697 |
| 1060 | Ga0501072_0000327 | 3300049588 | Bacteria | 33913 |
| 1061 | Ga0501072_0001893 | 3300049588 | Bacteria | 15593 |
| 1062 | Ga0501072_0043315 | 3300049588 | Bacteria | 3537 |
| 1063 | Ga0501072_0100111 | 3300049588 | Bacteria | 2304 |
| 1064 | Ga0501072_0119346 | 3300049588 | Bacteria | 2101 |
| 1065 | Ga0501072_0121979 | 3300049588 | Bacteria | 2077 |
| 1066 | Ga0501072_0122605 | 3300049588 | Bacteria | 2071 |
| 1067 | Ga0501072_0175315 | 3300049588 | Bacteria | 1710 |
| 1068 | Ga0501072_0215532 | 3300049588 | Bacteria | 1530 |
| 1069 | Ga0501072_0447048 | 3300049588 | Bacteria | 1024 |
| 1070 | Ga0501073_0000955 | 3300049589 | Bacteria | 20800 |
| 1071 | Ga0501073_0008009 | 3300049589 | Bacteria | 7846 |
| 1072 | Ga0501073_0024073 | 3300049589 | Bacteria | 4372 |
| 1073 | Ga0501073_0085422 | 3300049589 | Bacteria | 2195 |
| 1074 | Ga0501073_0097498 | 3300049589 | Bacteria | 2042 |
| 1075 | Ga0501073_0113888 | 3300049589 | Bacteria | 1875 |
| 1076 | Ga0501073_0144272 | 3300049589 | Bacteria | 1650 |
| 1077 | Ga0501073_0153521 | 3300049589 | Bacteria | 1596 |
| 1078 | Ga0501073_0171543 | 3300049589 | Bacteria | 1501 |
| 1079 | Ga0501073_0196087 | 3300049589 | Bacteria | 1397 |
| 1080 | Ga0501073_0196188 | 3300049589 | Bacteria | 1396 |
| 1081 | Ga0501073_0199601 | 3300049589 | Bacteria | 1383 |
| 1082 | Ga0501073_0241066 | 3300049589 | Bacteria | 1248 |
| 1083 | Ga0501073_0350342 | 3300049589 | Bacteria | 1020 |
| 1084 | Ga0501073_0573255 | 3300049589 | Bacteria | 780 |
| 1085 | Ga0501074_0003990 | 3300049590 | Bacteria | 10519 |
| 1086 | Ga0501074_0004790 | 3300049590 | Bacteria | 9701 |
| 1087 | Ga0501074_0007646 | 3300049590 | Bacteria | 7821 |
| 1088 | Ga0501074_0024225 | 3300049590 | Bacteria | 4410 |
| 1089 | Ga0501074_0044060 | 3300049590 | Bacteria | 3231 |
| 1090 | Ga0501074_0064647 | 3300049590 | Bacteria | 2634 |
| 1091 | Ga0501074_0305811 | 3300049590 | Bacteria | 1129 |
| 1092 | Ga0501074_0406516 | 3300049590 | Bacteria | 965 |
| 1093 | Ga0501074_0846186 | 3300049590 | Bacteria | 644 |
| 1094 | Ga0501075_0072162 | 3300049591 | Bacteria | 2610 |
| 1095 | Ga0501075_0599849 | 3300049591 | Bacteria | 840 |
| 1096 | Ga0501076_0021371 | 3300049592 | Bacteria | 4964 |
| 1097 | Ga0501076_0122551 | 3300049592 | Bacteria | 2105 |
| 1098 | Ga0501076_0125455 | 3300049592 | Bacteria | 2080 |
| 1099 | Ga0501076_0185229 | 3300049592 | Bacteria | 1698 |
| 1100 | Ga0501076_0246670 | 3300049592 | Bacteria | 1461 |
| 1101 | Ga0501076_0313118 | 3300049592 | Bacteria | 1287 |
| 1102 | Ga0501076_1255141 | 3300049592 | Bacteria | 610 |
| 1103 | Ga0501077_0091077 | 3300049593 | Bacteria | 1932 |
| 1104 | Ga0501077_0187026 | 3300049593 | Bacteria | 1316 |
| 1105 | Ga0501077_0428101 | 3300049593 | Bacteria | 847 |
| 1106 | Ga0501222_000640 | 3300049662 | Bacteria | 5129 |
| 1107 | Ga0501223_005742 | 3300049663 | Bacteria | 2594 |
| 1108 | Ga0501227_010889 | 3300049665 | Bacteria | 1976 |
| 1109 | Ga0501249_007946 | 3300049679 | Bacteria | 2201 |
| 1110 | Ga0501259_000268 | 3300049688 | Bacteria | 8191 |
| 1111 | Ga0501225_0040742 | 3300049705 | Bacteria | 1280 |
| 1112 | Ga0501079_0006980 | 3300049741 | Bacteria | 8511 |
| 1113 | Ga0501079_0071163 | 3300049741 | Bacteria | 2686 |
| 1114 | Ga0501079_0076463 | 3300049741 | Bacteria | 2590 |
| 1115 | Ga0501079_0080214 | 3300049741 | Bacteria | 2523 |
| 1116 | Ga0501079_0111899 | 3300049741 | Bacteria | 2122 |
| 1117 | Ga0501079_0120015 | 3300049741 | Bacteria | 2044 |
| 1118 | Ga0501079_0140114 | 3300049741 | Bacteria | 1884 |
| 1119 | Ga0501079_0489445 | 3300049741 | Bacteria | 967 |
| 1120 | Ga0501080_0000047 | 3300049742 | Bacteria | 76956 |
| 1121 | Ga0501080_0000075 | 3300049742 | Bacteria | 66767 |
| 1122 | Ga0501080_0005687 | 3300049742 | Bacteria | 11148 |
| 1123 | Ga0501080_0011853 | 3300049742 | Bacteria | 7986 |
| 1124 | Ga0501080_0034243 | 3300049742 | Bacteria | 4740 |
| 1125 | Ga0501080_0159108 | 3300049742 | Bacteria | 2086 |
| 1126 | Ga0501080_0242492 | 3300049742 | Bacteria | 1645 |
| 1127 | Ga0501080_0520373 | 3300049742 | Bacteria | 1061 |
| 1128 | Ga0501080_0724103 | 3300049742 | Bacteria | 876 |
| 1129 | Ga0501080_0812448 | 3300049742 | Bacteria | 819 |
| 1130 | Ga0501080_0861557 | 3300049742 | Bacteria | 791 |
| 1131 | Ga0501080_1118815 | 3300049742 | Bacteria | 679 |
| 1132 | Ga0501081_0008289 | 3300049743 | Bacteria | 6744 |
| 1133 | Ga0501081_0166382 | 3300049743 | Bacteria | 1591 |
| 1134 | Ga0501081_0180111 | 3300049743 | Bacteria | 1528 |
| 1135 | Ga0501081_1113279 | 3300049743 | Bacteria | 598 |
| 1136 | Ga0501083_0000694 | 3300049744 | Bacteria | 21938 |
| 1137 | Ga0501083_0000808 | 3300049744 | Bacteria | 20535 |
| 1138 | Ga0501083_0000857 | 3300049744 | Bacteria | 20028 |
| 1139 | Ga0501083_0010083 | 3300049744 | Bacteria | 6660 |
| 1140 | Ga0501083_0032304 | 3300049744 | Bacteria | 3590 |
| 1141 | Ga0501083_0105896 | 3300049744 | Bacteria | 1851 |
| 1142 | Ga0501083_0126195 | 3300049744 | Bacteria | 1677 |
| 1143 | Ga0501083_0148049 | 3300049744 | Bacteria | 1537 |
| 1144 | Ga0501083_0180010 | 3300049744 | Bacteria | 1380 |
| 1145 | Ga0501267_003024 | 3300049764 | Bacteria | 1514 |
| 1146 | Ga0501279_000027 | 3300049775 | Bacteria | 40843 |
| 1147 | Ga0501280_000044 | 3300049776 | Bacteria | 37121 |
| 1148 | Ga0501281_04599 | 3300049777 | Bacteria | 968 |
| 1149 | Ga0501282_000334 | 3300049778 | Bacteria | 5704 |
| 1150 | Ga0501035_0000084 | 3300049822 | Bacteria | 116222 |
| 1151 | Ga0501035_0000222 | 3300049822 | Bacteria | 67780 |
| 1152 | Ga0501035_0000240 | 3300049822 | Bacteria | 65635 |
| 1153 | Ga0501035_0023093 | 3300049822 | Bacteria | 5708 |
| 1154 | Ga0501035_0093910 | 3300049822 | Bacteria | 2638 |
| 1155 | Ga0501035_0134538 | 3300049822 | Bacteria | 2153 |
| 1156 | Ga0501035_0186337 | 3300049822 | Bacteria | 1786 |
| 1157 | Ga0501035_0195686 | 3300049822 | Bacteria | 1736 |
| 1158 | Ga0501035_0404362 | 3300049822 | Bacteria | 1135 |
| 1159 | Ga0501035_0601317 | 3300049822 | Bacteria | 896 |
| 1160 | Ga0501035_0725229 | 3300049822 | Bacteria | 800 |
| 1161 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 1162 | Ga0501044_0000073 | 3300049823 | Bacteria | 122507 |
| 1163 | Ga0501044_0000122 | 3300049823 | Bacteria | 93246 |
| 1164 | Ga0501044_0009895 | 3300049823 | Bacteria | 10362 |
| 1165 | Ga0501044_0026426 | 3300049823 | Bacteria | 6143 |
| 1166 | Ga0501044_0037991 | 3300049823 | Bacteria | 5030 |
| 1167 | Ga0501044_0084636 | 3300049823 | Bacteria | 3205 |
| 1168 | Ga0501044_0195581 | 3300049823 | Bacteria | 1982 |
| 1169 | Ga0501044_0244736 | 3300049823 | Bacteria | 1736 |
| 1170 | Ga0501044_0289043 | 3300049823 | Bacteria | 1571 |
| 1171 | Ga0501044_0318044 | 3300049823 | Bacteria | 1481 |
| 1172 | Ga0501044_0351893 | 3300049823 | Bacteria | 1392 |
| 1173 | Ga0501044_0745093 | 3300049823 | Bacteria | 862 |
| 1174 | Ga0501045_0020260 | 3300049824 | Bacteria | 4749 |
| 1175 | Ga0501045_0056835 | 3300049824 | Bacteria | 2862 |
| 1176 | Ga0501045_0107574 | 3300049824 | Bacteria | 2066 |
| 1177 | Ga0501045_0140486 | 3300049824 | Bacteria | 1796 |
| 1178 | Ga0501045_0159840 | 3300049824 | Bacteria | 1677 |
| 1179 | Ga0501045_0400872 | 3300049824 | Bacteria | 1021 |
| 1180 | Ga0501045_0766462 | 3300049824 | Bacteria | 711 |
| 1181 | nmdc:mga03683_105249_c1 | 3300050489 | Bacteria | 1243 |
| 1182 | nmdc:mga03683_10611_c1 | 3300050489 | Bacteria | 3309 |
| 1183 | nmdc:mga03683_14732_c1 | 3300050489 | Bacteria | 2900 |
| 1184 | nmdc:mga03n38_111658_c1 | 3300050490 | Bacteria | 1332 |
| 1185 | nmdc:mga03n38_112709_c1 | 3300050490 | Bacteria | 1327 |
| 1186 | nmdc:mga03n38_11414_c1 | 3300050490 | Bacteria | 3310 |
| 1187 | nmdc:mga00v17_10354_c1 | 3300050491 | Bacteria | 4549 |
| 1188 | nmdc:mga00v17_459614_c1 | 3300050491 | Bacteria | 826 |
| 1189 | nmdc:mga00v17_498095_c1 | 3300050491 | Bacteria | 790 |
| 1190 | nmdc:mga00v17_590400_c1 | 3300050491 | Bacteria | 717 |
| 1191 | nmdc:mga00v17_608140_c1 | 3300050491 | Bacteria | 705 |
| 1192 | nmdc:mga0yw44_572322_c1 | 3300050492 | Bacteria | 767 |
| 1193 | nmdc:mga0yw44_661200_c1 | 3300050492 | Bacteria | 710 |
| 1194 | nmdc:mga0k408_14308_c1 | 3300050493 | Bacteria | 4368 |
| 1195 | nmdc:mga0k408_19574_c1 | 3300050493 | Bacteria | 3785 |
| 1196 | nmdc:mga0k408_19827_c1 | 3300050493 | Bacteria | 3763 |
| 1197 | nmdc:mga0k408_226323_c1 | 3300050493 | Bacteria | 1117 |
| 1198 | nmdc:mga06z11_33274_c1 | 3300050494 | Bacteria | 2521 |
| 1199 | nmdc:mga06z11_717_c1 | 3300050494 | Bacteria | 12069 |
| 1200 | nmdc:mga04h51_183045_c1 | 3300050495 | Bacteria | 816 |
| 1201 | nmdc:mga04h51_261_c1 | 3300050495 | Bacteria | 13697 |
| 1202 | nmdc:mga04h51_333897_c1 | 3300050495 | Bacteria | 624 |
| 1203 | nmdc:mga07m45_172315_c1 | 3300050496 | Bacteria | 1258 |
| 1204 | nmdc:mga07m45_7_c1 | 3300050496 | Bacteria | 223540 |
| 1205 | nmdc:mga05p37_223527_c1 | 3300050507 | Bacteria | 2271 |
| 1206 | nmdc:mga05p37_387146_c1 | 3300050507 | Bacteria | 1636 |
| 1207 | nmdc:mga05p37_462759_c1 | 3300050507 | Bacteria | 1465 |
| 1208 | nmdc:mga05p37_564_c1 | 3300050507 | Bacteria | 40786 |
| 1209 | nmdc:mga05p37_816617_c1 | 3300050507 | Bacteria | 1018 |
| 1210 | nmdc:mga09592_19928_c1 | 3300050508 | Bacteria | 5510 |
| 1211 | nmdc:mga09592_20905_c1 | 3300050508 | Bacteria | 5390 |
| 1212 | nmdc:mga09592_225653_c1 | 3300050508 | Bacteria | 1623 |
| 1213 | nmdc:mga09592_26841_c1 | 3300050508 | Bacteria | 4774 |
| 1214 | nmdc:mga09592_58331_c1 | 3300050508 | Bacteria | 3264 |
| 1215 | nmdc:mga0qj67_1194_c1 | 3300050509 | Bacteria | 18027 |
| 1216 | nmdc:mga0qj67_139012_c1 | 3300050509 | Bacteria | 1969 |
| 1217 | nmdc:mga0qj67_176641_c1 | 3300050509 | Bacteria | 1734 |
| 1218 | nmdc:mga0qj67_611093_c1 | 3300050509 | Bacteria | 872 |
| 1219 | nmdc:mga06r32_1217376_c1 | 3300050510 | Bacteria | 699 |
| 1220 | nmdc:mga06r32_13924_c1 | 3300050510 | Bacteria | 7297 |
| 1221 | nmdc:mga06r32_191_c1 | 3300050510 | Bacteria | 49056 |
| 1222 | nmdc:mga06r32_360112_c1 | 3300050510 | Bacteria | 1439 |
| 1223 | nmdc:mga06r32_437492_c1 | 3300050510 | Bacteria | 1288 |
| 1224 | nmdc:mga06r32_8176_c1 | 3300050510 | Bacteria | 9413 |
| 1225 | nmdc:mga08y16_14382_c1 | 3300050511 | Bacteria | 8330 |
| 1226 | nmdc:mga08y16_330510_c1 | 3300050511 | Bacteria | 1568 |
| 1227 | nmdc:mga08y16_4792_c1 | 3300050511 | Bacteria | 14111 |
| 1228 | nmdc:mga08y16_79789_c1 | 3300050511 | Bacteria | 3411 |
| 1229 | nmdc:mga08y16_89_c1 | 3300050511 | Bacteria | 76793 |
| 1230 | nmdc:mga08y16_963796_c1 | 3300050511 | Bacteria | 835 |
| 1231 | nmdc:mga0n895_11749_c1 | 3300050512 | Bacteria | 7827 |
| 1232 | nmdc:mga0rr50_576898_c1 | 3300050513 | Bacteria | 958 |
| 1233 | nmdc:mga0rr50_684664_c1 | 3300050513 | Bacteria | 875 |
| 1234 | nmdc:mga08x19_45856_c1 | 3300050514 | Bacteria | 2794 |
| 1235 | nmdc:mga08x19_523752_c1 | 3300050514 | Bacteria | 838 |
| 1236 | nmdc:mga0a205_272836_c1 | 3300050515 | Bacteria | 1568 |
| 1237 | nmdc:mga0a205_34901_c1 | 3300050515 | Bacteria | 4828 |
| 1238 | nmdc:mga0a205_411557_c1 | 3300050515 | Bacteria | 1215 |
| 1239 | nmdc:mga0a205_880256_c1 | 3300050515 | Bacteria | 742 |
| 1240 | nmdc:mga0sz30_304608_c1 | 3300050516 | Bacteria | 711 |
| 1241 | nmdc:mga0sz30_3060_c1 | 3300050516 | Bacteria | 5991 |
| 1242 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 1243 | Ga0495601_0019662 | 3300053077 | Bacteria | 4120 |
| 1244 | Ga0495601_0063264 | 3300053077 | Bacteria | 2352 |
| 1245 | Ga0495601_0083752 | 3300053077 | Bacteria | 2048 |
| 1246 | Ga0495612_0000041 | 3300053078 | Bacteria | 62752 |
| 1247 | Ga0495612_0000733 | 3300053078 | Bacteria | 13321 |
| 1248 | Ga0495595_0000578 | 3300053084 | Bacteria | 14020 |
| 1249 | Ga0495595_0002928 | 3300053084 | Bacteria | 6736 |
| 1250 | Ga0495595_0017378 | 3300053084 | Bacteria | 3094 |
| 1251 | Ga0495595_0156438 | 3300053084 | Bacteria | 1123 |
| 1252 | Ga0495619_0002914 | 3300053085 | Bacteria | 11117 |
| 1253 | Ga0495619_0007913 | 3300053085 | Bacteria | 6725 |
| 1254 | Ga0500643_000065 | 3300053087 | Bacteria | 119995 |
| 1255 | Ga0500646_0070812 | 3300053090 | Bacteria | 1045 |
| 1256 | Ga0500566_0265020 | 3300053094 | Bacteria | 827 |
| 1257 | Ga0500566_0298727 | 3300053094 | Bacteria | 759 |
| 1258 | Ga0500641_0002717 | 3300053096 | Bacteria | 6250 |
| 1259 | Ga0500641_0007230 | 3300053096 | Bacteria | 3957 |
| 1260 | Ga0500592_000384 | 3300053116 | Bacteria | 7453 |
| 1261 | Ga0500594_0195330 | 3300053118 | Bacteria | 664 |
| 1262 | Ga0500595_007591 | 3300053119 | Bacteria | 4492 |
| 1263 | Ga0500607_000854 | 3300053121 | Bacteria | 29366 |
| 1264 | Ga0500607_004296 | 3300053121 | Bacteria | 9890 |
| 1265 | Ga0500642_0314401 | 3300053130 | Bacteria | 704 |
| 1266 | Ga0500652_000090 | 3300053131 | Bacteria | 38615 |
| 1267 | Ga0500652_003278 | 3300053131 | Bacteria | 4900 |
| 1268 | Ga0500658_0080953 | 3300053134 | Bacteria | 1389 |
| 1269 | Ga0500559_0002140 | 3300053136 | Bacteria | 10511 |
| 1270 | Ga0500604_0000065 | 3300053151 | Bacteria | 37746 |
| 1271 | Ga0500616_0036739 | 3300053153 | Bacteria | 2657 |
| 1272 | Ga0500616_0047136 | 3300053153 | Bacteria | 2289 |
| 1273 | Ga0500627_0000551 | 3300053158 | Bacteria | 10092 |
| 1274 | Ga0500627_0251533 | 3300053158 | Bacteria | 782 |
| 1275 | Ga0500636_0044766 | 3300053177 | Bacteria | 2610 |
| 1276 | Ga0500645_000261 | 3300053730 | Bacteria | 37957 |
| 1277 | Ga0500645_001908 | 3300053730 | Bacteria | 9918 |
| 1278 | Ga0500645_094918 | 3300053730 | Bacteria | 844 |
| 1279 | Ga0501084_0000079 | 3300054114 | Bacteria | 71210 |
| 1280 | Ga0501084_0003295 | 3300054114 | Bacteria | 13068 |
| 1281 | Ga0501084_0032719 | 3300054114 | Bacteria | 4351 |
| 1282 | Ga0501084_0068755 | 3300054114 | Bacteria | 2965 |
| 1283 | Ga0501084_0090467 | 3300054114 | Bacteria | 2569 |
| 1284 | Ga0501084_0110255 | 3300054114 | Bacteria | 2312 |
| 1285 | Ga0501084_0140691 | 3300054114 | Bacteria | 2032 |
| 1286 | Ga0501084_0446536 | 3300054114 | Bacteria | 1093 |
| 1287 | Ga0501084_0476620 | 3300054114 | Bacteria | 1055 |
| 1288 | Ga0501084_0547947 | 3300054114 | Bacteria | 977 |
| 1289 | Ga0590075_064910 | 3300059424 | Bacteria | 942 |
| 1290 | Ga0590075_075302 | 3300059424 | Bacteria | 873 |
| 1291 | Ga0587077_106110 | 3300059493 | Bacteria | 682 |
| 1292 | Ga0587106_028992 | 3300059605 | Bacteria | 876 |
| 1293 | Ga0587062_029273 | 3300059639 | Bacteria | 834 |
| 1294 | Ga0587076_045819 | 3300059645 | Bacteria | 834 |
| 1295 | Ga0587079_084023 | 3300059647 | Bacteria | 733 |
| 1296 | Ga0501082_0001185 | 3300060353 | Bacteria | 22911 |
| 1297 | Ga0501082_0001707 | 3300060353 | Bacteria | 19386 |
| 1298 | Ga0501082_0004072 | 3300060353 | Bacteria | 12754 |
| 1299 | Ga0501082_0015079 | 3300060353 | Bacteria | 6658 |
| 1300 | Ga0501082_0032192 | 3300060353 | Bacteria | 4522 |
| 1301 | Ga0501082_0074277 | 3300060353 | Bacteria | 2928 |
| 1302 | Ga0501082_0153261 | 3300060353 | Bacteria | 2002 |
| 1303 | Ga0501082_0154605 | 3300060353 | Bacteria | 1993 |
| 1304 | Ga0501082_0244555 | 3300060353 | Bacteria | 1561 |
| 1305 | Ga0501082_0282206 | 3300060353 | Bacteria | 1445 |
| 1306 | Ga0501082_0339784 | 3300060353 | Bacteria | 1308 |
| 1307 | Ga0501082_0395956 | 3300060353 | Bacteria | 1205 |
| 1308 | Ga0501082_0433953 | 3300060353 | Bacteria | 1147 |
| 1309 | Ga0501082_0451088 | 3300060353 | Bacteria | 1124 |
| 1310 | Ga0501082_0517308 | 3300060353 | Bacteria | 1043 |
| 1311 | Ga0530510_0035312 | 3300061734 | Bacteria | 3603 |
| 1312 | Ga0530510_0079605 | 3300061734 | Bacteria | 2383 |
| 1313 | Ga0530510_0604927 | 3300061734 | Bacteria | 834 |
| 1314 | Ga0530510_1112104 | 3300061734 | Bacteria | 605 |
| 1315 | 2523469174 | 2523231067 | Bacteria | 5230452 |
| 1316 | 2671693545 | 2671180139 | Bacteria | 4196045 |
| 1317 | 2894822242 | 2894817345 | Bacteria | 4892941 |
| 1318 | 2896185693 | 2896184354 | Bacteria | 3258548 |
| 1319 | 2917558208 | 2917554339 | Bacteria | 4987857 |
| 1320 | 2929298512 | 2929297113 | Bacteria | 3141306 |
| 1321 | 3000867000 | 3000865235 | Bacteria | 3106258 |
| 1322 | Ga0501067_0244649 | |||
| 1323 | JGI24746J21847_1003728 | |||
| 1324 | JGI25153J46596_10005049 | |||
| 1325 | Ga0065712_10158226 | |||
| 1326 | Ga0065715_10148475 | |||
| 1327 | Ga0070658_10026748 | |||
| 1328 | Ga0070658_10079821 | |||
| 1329 | Ga0070658_10277732 | |||
| 1330 | Ga0070658_10290689 | |||
| 1331 | Ga0070658_10433046 | |||
| 1332 | Ga0070658_10621901 | |||
| 1333 | Ga0070658_10828065 | |||
| 1334 | Ga0070676_10023356 | |||
| 1335 | Ga0070676_10078023 | |||
| 1336 | Ga0070690_100011597 | |||
| 1337 | Ga0070690_100051906 | |||
| 1338 | Ga0070670_100001209 | |||
| 1339 | Ga0070670_100524578 | |||
| 1340 | Ga0070677_10004816 | |||
| 1341 | Ga0070666_10002037 | |||
| 1342 | Ga0070666_10076575 | |||
| 1343 | Ga0070680_100008432 | |||
| 1344 | Ga0070680_100200812 | |||
| 1345 | Ga0070680_100401167 | |||
| 1346 | Ga0070682_100003228 | |||
| 1347 | Ga0070682_100039711 | |||
| 1348 | Ga0068868_100017842 | |||
| 1349 | Ga0070660_100001596 | |||
| 1350 | Ga0070660_100012544 | |||
| 1351 | Ga0070660_100154606 | |||
| 1352 | Ga0070660_100187241 | |||
| 1353 | Ga0070660_100203887 | |||
| 1354 | Ga0070689_100051517 | |||
| 1355 | Ga0070689_100054341 | |||
| 1356 | Ga0070689_100072706 | |||
| 1357 | Ga0070689_100072843 | |||
| 1358 | Ga0070689_100636335 | |||
| 1359 | Ga0070689_100775201 | |||
| 1360 | Ga0070687_100000651 | |||
| 1361 | Ga0070661_100012203 | |||
| 1362 | Ga0070661_100026608 | |||
| 1363 | Ga0070661_100133466 | |||
| 1364 | Ga0070661_100327957 | |||
| 1365 | Ga0070661_100447708 | |||
| 1366 | Ga0070668_100135892 | |||
| 1367 | Ga0070668_100362925 | |||
| 1368 | Ga0070669_100145047 | |||
| 1369 | Ga0070669_100455798 | |||
| 1370 | Ga0070669_100648620 | |||
| 1371 | Ga0070675_100045786 | |||
| 1372 | Ga0070675_100357881 | |||
| 1373 | Ga0070675_100583733 | |||
| 1374 | Ga0070671_100006150 | |||
| 1375 | Ga0070671_100006644 | |||
| 1376 | Ga0070671_100019015 | |||
| 1377 | Ga0070671_100053667 | |||
| 1378 | Ga0070671_100151005 | |||
| 1379 | Ga0070674_100011744 | |||
| 1380 | Ga0070674_100048468 | |||
| 1381 | Ga0070674_100073361 | |||
| 1382 | Ga0070673_100005472 | |||
| 1383 | Ga0070673_100034218 | |||
| 1384 | Ga0070673_100147415 | |||
| 1385 | Ga0070673_101213387 | |||
| 1386 | Ga0070688_100003838 | |||
| 1387 | Ga0070688_100040814 | |||
| 1388 | Ga0070688_100060496 | |||
| 1389 | Ga0070659_100004346 | |||
| 1390 | Ga0070659_100103715 | |||
| 1391 | Ga0070659_100253681 | |||
| 1392 | Ga0070659_100441516 | |||
| 1393 | Ga0070659_100604003 | |||
| 1394 | Ga0070667_100006803 | |||
| 1395 | Ga0070667_100014101 | |||
| 1396 | Ga0070667_100220929 | |||
| 1397 | Ga0070667_100315983 | |||
| 1398 | Ga0070667_100379827 | |||
| 1399 | Ga0070667_100542108 | |||
| 1400 | Ga0070714_100112087 | |||
| 1401 | Ga0070714_100387490 | |||
| 1402 | Ga0070713_101010065 | |||
| 1403 | Ga0070701_10052318 | |||
| 1404 | Ga0070711_100035525 | |||
| 1405 | Ga0070711_100038432 | |||
| 1406 | Ga0070705_100381098 | |||
| 1407 | Ga0070700_100060070 | |||
| 1408 | Ga0070708_100445673 | |||
| 1409 | Ga0070663_100015534 | |||
| 1410 | Ga0070663_100263224 | |||
| 1411 | Ga0070663_100563559 | |||
| 1412 | Ga0070678_100097787 | |||
| 1413 | Ga0070678_100218922 | |||
| 1414 | Ga0070662_100002053 | |||
| 1415 | Ga0070662_100091919 | |||
| 1416 | Ga0070662_100110580 | |||
| 1417 | Ga0070662_100124062 | |||
| 1418 | Ga0070662_100274790 | |||
| 1419 | Ga0070662_100739849 | |||
| 1420 | Ga0070662_100760893 | |||
| 1421 | Ga0070681_10004156 | |||
| 1422 | Ga0070681_10012342 | |||
| 1423 | Ga0070681_10082436 | |||
| 1424 | Ga0070681_10091185 | |||
| 1425 | Ga0068867_100030511 | |||
| 1426 | Ga0070685_10003942 | |||
| 1427 | Ga0070698_100847963 | |||
| 1428 | Ga0070699_100444522 | |||
| 1429 | Ga0070679_100010255 | |||
| 1430 | Ga0070679_100076980 | |||
| 1431 | Ga0070679_100137701 | |||
| 1432 | Ga0070679_100403330 | |||
| 1433 | Ga0070679_100515271 | |||
| 1434 | Ga0070684_100096416 | |||
| 1435 | Ga0070684_100475154 | |||
| 1436 | Ga0068853_100001120 | |||
| 1437 | Ga0068853_100010459 | |||
| 1438 | Ga0068853_100115026 | |||
| 1439 | Ga0068853_100115890 | |||
| 1440 | Ga0068853_100153069 | |||
| 1441 | Ga0068853_100158870 | |||
| 1442 | Ga0068853_100219835 | |||
| 1443 | Ga0068853_100302828 | |||
| 1444 | Ga0070672_100153303 | |||
| 1445 | Ga0070672_100256829 | |||
| 1446 | Ga0070686_100005413 | |||
| 1447 | Ga0070686_100116042 | |||
| 1448 | Ga0070686_100197760 | |||
| 1449 | Ga0070686_100445865 | |||
| 1450 | Ga0070695_100005458 | |||
| 1451 | Ga0070695_100140405 | |||
| 1452 | Ga0070696_100043974 | |||
| 1453 | Ga0070696_100430025 | |||
| 1454 | Ga0070693_100082656 | |||
| 1455 | Ga0070665_100159096 | |||
| 1456 | Ga0070665_100349553 | |||
| 1457 | Ga0070704_100106130 | |||
| 1458 | Ga0070704_100120698 | |||
| 1459 | Ga0070704_100148959 | |||
| 1460 | Ga0070704_100485195 | |||
| 1461 | Ga0070704_101182971 | |||
| 1462 | Ga0068855_100062365 | |||
| 1463 | Ga0068855_100135698 | |||
| 1464 | Ga0068855_100202226 | |||
| 1465 | Ga0068855_100271286 | |||
| 1466 | Ga0070664_100003030 | |||
| 1467 | Ga0070664_100003245 | |||
| 1468 | Ga0070664_100029345 | |||
| 1469 | Ga0070664_100112874 | |||
| 1470 | Ga0068857_100122892 | |||
| 1471 | Ga0068857_100226885 | |||
| 1472 | Ga0068857_100274643 | |||
| 1473 | Ga0068857_100333353 | |||
| 1474 | Ga0068857_100669314 | |||
| 1475 | Ga0068854_100007527 | |||
| 1476 | Ga0068854_100474538 | |||
| 1477 | Ga0068854_100595590 | |||
| 1478 | Ga0068854_100725891 | |||
| 1479 | Ga0068856_100002582 | |||
| 1480 | Ga0068856_100091866 | |||
| 1481 | Ga0068856_100529572 | |||
| 1482 | Ga0068856_100590493 | |||
| 1483 | Ga0070702_100089235 | |||
| 1484 | Ga0068852_100012732 | |||
| 1485 | Ga0068852_100376593 | |||
| 1486 | Ga0068852_100377720 | |||
| 1487 | Ga0068852_100474068 | |||
| 1488 | Ga0068852_100505728 | |||
| 1489 | Ga0068852_100527839 | |||
| 1490 | Ga0068859_100041148 | |||
| 1491 | Ga0068859_100061003 | |||
| 1492 | Ga0068859_100456926 | |||
| 1493 | Ga0068864_100342635 | |||
| 1494 | Ga0068866_10131091 | |||
| 1495 | Ga0068861_100180074 | |||
| 1496 | Ga0068870_10017187 | |||
| 1497 | Ga0068863_100013225 | |||
| 1498 | Ga0068858_100001220 | |||
| 1499 | Ga0068858_100070910 | |||
| 1500 | Ga0068858_100072857 | |||
| 1501 | Ga0068858_100090683 | |||
| 1502 | Ga0068858_100100260 | |||
| 1503 | Ga0068858_100437848 | |||
| 1504 | Ga0068860_100077456 | |||
| 1505 | Ga0068860_100079166 | |||
| 1506 | Ga0068860_100091007 | |||
| 1507 | Ga0068860_100172293 | |||
| 1508 | Ga0068860_100204438 | |||
| 1509 | Ga0068862_100001900 | |||
| 1510 | Ga0068862_100002109 | |||
| 1511 | Ga0068862_100228872 | |||
| 1512 | Ga0081455_10032634 | |||
| 1513 | Ga0081455_10046241 | |||
| 1514 | Ga0081455_10351898 | |||
| 1515 | Ga0081538_10071824 | |||
| 1516 | Ga0070717_10036746 | |||
| 1517 | Ga0070717_10073587 | |||
| 1518 | Ga0070717_10460708 | |||
| 1519 | Ga0075365_10028316 | |||
| 1520 | Ga0075365_10261733 | |||
| 1521 | Ga0075368_10000154 | |||
| 1522 | Ga0075368_10141865 | |||
| 1523 | Ga0075363_100009861 | |||
| 1524 | Ga0075363_100031864 | |||
| 1525 | Ga0075363_100083791 | |||
| 1526 | Ga0075364_10010820 | |||
| 1527 | Ga0075364_10206662 | |||
| 1528 | Ga0075364_10513097 | |||
| 1529 | Ga0070712_100073308 | |||
| 1530 | Ga0070712_100623008 | |||
| 1531 | Ga0075362_10001229 | |||
| 1532 | Ga0075362_10283668 | |||
| 1533 | Ga0075367_10018545 | |||
| 1534 | Ga0075367_10371473 | |||
| 1535 | Ga0075369_10013093 | |||
| 1536 | Ga0075366_10004924 | |||
| 1537 | Ga0075366_10041243 | |||
| 1538 | Ga0075366_10046259 | |||
| 1539 | Ga0075366_10337864 | |||
| 1540 | Ga0097621_100165643 | |||
| 1541 | Ga0075370_10047926 | |||
| 1542 | Ga0075370_10097232 | |||
| 1543 | Ga0075370_10283848 | |||
| 1544 | Ga0068871_100216729 | |||
| 1545 | Ga0068871_100400195 | |||
| 1546 | Ga0068871_100528608 | |||
| 1547 | Ga0068871_100647239 | |||
| 1548 | Ga0068871_101179939 | |||
| 1549 | Ga0075428_100000606 | |||
| 1550 | Ga0075428_100001030 | |||
| 1551 | Ga0075428_100016563 | |||
| 1552 | Ga0075428_100053354 | |||
| 1553 | Ga0075428_100079887 | |||
| 1554 | Ga0075428_101017656 | |||
| 1555 | Ga0075430_100002000 | |||
| 1556 | Ga0075430_100157001 | |||
| 1557 | Ga0075430_100343936 | |||
| 1558 | Ga0075430_100354083 | |||
| 1559 | Ga0075431_100000032 | |||
| 1560 | Ga0075431_100007296 | |||
| 1561 | Ga0075431_100010360 | |||
| 1562 | Ga0075431_100118643 | |||
| 1563 | Ga0075431_100630812 | |||
| 1564 | Ga0075433_10130756 | |||
| 1565 | Ga0075434_100069291 | |||
| 1566 | Ga0075429_100009118 | |||
| 1567 | Ga0075429_100059469 | |||
| 1568 | Ga0075429_100083653 | |||
| 1569 | Ga0068865_100065024 | |||
| 1570 | Ga0068865_100102026 | |||
| 1571 | Ga0075436_100039986 | |||
| 1572 | Ga0075436_100177303 | |||
| 1573 | Ga0097620_100041150 | |||
| 1574 | Ga0097620_100061002 | |||
| 1575 | Ga0097620_100456949 | |||
| 1576 | Ga0075435_100069623 | |||
| 1577 | Ga0075435_100696545 | |||
| 1578 | Ga0099795_10033761 | |||
| 1579 | Ga0105240_10319701 | |||
| 1580 | Ga0111539_10001089 | |||
| 1581 | Ga0111539_10132368 | |||
| 1582 | Ga0111539_10532037 | |||
| 1583 | Ga0105245_10097484 | |||
| 1584 | Ga0114129_10000062 | |||
| 1585 | Ga0114129_10070132 | |||
| 1586 | Ga0114129_10481588 | |||
| 1587 | Ga0114129_10489248 | |||
| 1588 | Ga0105243_10685993 | |||
| 1589 | Ga0105241_10358619 | |||
| 1590 | Ga0105242_10102160 | |||
| 1591 | Ga0105242_10127241 | |||
| 1592 | Ga0105242_10373575 | |||
| 1593 | Ga0105248_10000575 | |||
| 1594 | Ga0105248_10032460 | |||
| 1595 | Ga0105248_10052459 | |||
| 1596 | Ga0105248_11304190 | |||
| 1597 | Ga0105238_10445675 | |||
| 1598 | Ga0105249_10004484 | |||
| 1599 | Ga0105249_10126386 | |||
| 1600 | Ga0105249_10443846 | |||
| 1601 | Ga0099796_10026974 | |||
| 1602 | Ga0105239_10160754 | |||
| 1603 | Ga0105246_10214319 | |||
| 1604 | Ga0157373_10034223 | |||
| 1605 | Ga0157371_10002512 | |||
| 1606 | Ga0157371_10040000 | |||
| 1607 | Ga0157371_10083091 | |||
| 1608 | Ga0157371_10182576 | |||
| 1609 | Ga0157370_10103179 | |||
| 1610 | Ga0157370_10228130 | |||
| 1611 | Ga0157370_10327032 | |||
| 1612 | Ga0157369_10038667 | |||
| 1613 | Ga0157369_10415943 | |||
| 1614 | Ga0157378_10712262 | |||
| 1615 | Ga0163162_10015418 | |||
| 1616 | Ga0157372_10005708 | |||
| 1617 | Ga0157372_10062690 | |||
| 1618 | Ga0157372_10203158 | |||
| 1619 | Ga0157372_10302849 | |||
| 1620 | Ga0157372_10743667 | |||
| 1621 | Ga0157375_10010448 | |||
| 1622 | Ga0157375_10153878 | |||
| 1623 | Ga0157375_10287312 | |||
| 1624 | Ga0157375_10620111 | |||
| 1625 | Ga0157375_11793722 | |||
| 1626 | Ga0163163_10019652 | |||
| 1627 | Ga0163163_10104340 | |||
| 1628 | Ga0163163_10142267 | |||
| 1629 | Ga0163163_10608301 | |||
| 1630 | Ga0163163_10612577 | |||
| 1631 | Ga0163163_10974549 | |||
| 1632 | Ga0157380_10093638 | |||
| 1633 | Ga0157380_10192704 | |||
| 1634 | Ga0157380_11475569 | |||
| 1635 | Ga0157377_10003094 | |||
| 1636 | Ga0157379_10025431 | |||
| 1637 | Ga0157379_10370252 | |||
| 1638 | Ga0157379_10573192 | |||
| 1639 | Ga0157376_10231232 | |||
| 1640 | Ga0163161_10036976 | |||
| 1641 | Ga0163161_10165871 | |||
| 1642 | Ga0213876_10077378 | |||
| 1643 | Ga0213876_10237236 | |||
| 1644 | Ga0213875_10082656 | |||
| 1645 | Ga0213875_10112131 | |||
| 1646 | Ga0224571_108629 | |||
| 1647 | Ga0207673_1012565 | |||
| 1648 | Ga0209758_1000686 | |||
| 1649 | Ga0209758_1091124 | |||
| 1650 | Ga0207697_10000027 | |||
| 1651 | Ga0207697_10084005 | |||
| 1652 | Ga0207682_10000609 | |||
| 1653 | Ga0207682_10161214 | |||
| 1654 | Ga0207642_10205557 | |||
| 1655 | Ga0207688_10000041 | |||
| 1656 | Ga0207680_10000656 | |||
| 1657 | Ga0207680_10224303 | |||
| 1658 | Ga0207680_10269620 | |||
| 1659 | Ga0207647_10001581 | |||
| 1660 | Ga0207645_10005539 | |||
| 1661 | Ga0207645_10019866 | |||
| 1662 | Ga0207645_10088321 | |||
| 1663 | Ga0207643_10001947 | |||
| 1664 | Ga0207705_10001911 | |||
| 1665 | Ga0207705_10418290 | |||
| 1666 | Ga0207705_10757681 | |||
| 1667 | Ga0207654_10563484 | |||
| 1668 | Ga0207707_10011717 | |||
| 1669 | Ga0207707_10050953 | |||
| 1670 | Ga0207707_10198634 | |||
| 1671 | Ga0207695_10200398 | |||
| 1672 | Ga0207671_10062172 | |||
| 1673 | Ga0207693_10339422 | |||
| 1674 | Ga0207693_10755157 | |||
| 1675 | Ga0207663_10883540 | |||
| 1676 | Ga0207660_11083128 | |||
| 1677 | Ga0207662_10253307 | |||
| 1678 | Ga0207657_10000513 | |||
| 1679 | Ga0207657_10005300 | |||
| 1680 | Ga0207657_10073837 | |||
| 1681 | Ga0207657_10122173 | |||
| 1682 | Ga0207657_10186478 | |||
| 1683 | Ga0207649_10003140 | |||
| 1684 | Ga0207649_10013372 | |||
| 1685 | Ga0207649_10081466 | |||
| 1686 | Ga0207649_10095587 | |||
| 1687 | Ga0207649_10121030 | |||
| 1688 | Ga0207652_10014456 | |||
| 1689 | Ga0207652_10018941 | |||
| 1690 | Ga0207652_10031974 | |||
| 1691 | Ga0207652_10040820 | |||
| 1692 | Ga0207652_10056340 | |||
| 1693 | Ga0207652_10089135 | |||
| 1694 | Ga0207652_10146388 | |||
| 1695 | Ga0207652_10310698 | |||
| 1696 | Ga0207681_10079414 | |||
| 1697 | Ga0207681_10270397 | |||
| 1698 | Ga0207681_10516260 | |||
| 1699 | Ga0207650_10007967 | |||
| 1700 | Ga0207650_10035373 | |||
| 1701 | Ga0207659_10011179 | |||
| 1702 | Ga0207659_10032556 | |||
| 1703 | Ga0207659_10300793 | |||
| 1704 | Ga0207687_10046755 | |||
| 1705 | Ga0207687_10408401 | |||
| 1706 | Ga0207700_10215050 | |||
| 1707 | Ga0207700_10302608 | |||
| 1708 | Ga0207700_10601631 | |||
| 1709 | Ga0207664_10064285 | |||
| 1710 | Ga0207664_10085719 | |||
| 1711 | Ga0207644_10005027 | |||
| 1712 | Ga0207644_10019791 | |||
| 1713 | Ga0207644_10030690 | |||
| 1714 | Ga0207644_10087128 | |||
| 1715 | Ga0207644_10609447 | |||
| 1716 | Ga0207690_10001108 | |||
| 1717 | Ga0207690_10260573 | |||
| 1718 | Ga0207706_10003288 | |||
| 1719 | Ga0207706_10005146 | |||
| 1720 | Ga0207706_10027521 | |||
| 1721 | Ga0207706_10027851 | |||
| 1722 | Ga0207706_10200301 | |||
| 1723 | Ga0207706_10353698 | |||
| 1724 | Ga0207706_10372932 | |||
| 1725 | Ga0207709_10936548 | |||
| 1726 | Ga0207670_10010868 | |||
| 1727 | Ga0207670_10020783 | |||
| 1728 | Ga0207670_10052483 | |||
| 1729 | Ga0207670_10562344 | |||
| 1730 | Ga0207669_10012258 | |||
| 1731 | Ga0207669_10048958 | |||
| 1732 | Ga0207704_10241588 | |||
| 1733 | Ga0207704_10351094 | |||
| 1734 | Ga0207704_10441272 | |||
| 1735 | Ga0207691_10000239 | |||
| 1736 | Ga0207691_10143694 | |||
| 1737 | Ga0207691_10354339 | |||
| 1738 | Ga0207711_10000496 | |||
| 1739 | Ga0207711_10037389 | |||
| 1740 | Ga0207711_10076367 | |||
| 1741 | Ga0207711_10463542 | |||
| 1742 | Ga0207661_10040299 | |||
| 1743 | Ga0207661_10123832 | |||
| 1744 | Ga0207679_10047857 | |||
| 1745 | Ga0207679_10111886 | |||
| 1746 | Ga0207679_10126589 | |||
| 1747 | Ga0207667_10000830 | |||
| 1748 | Ga0207667_10157268 | |||
| 1749 | Ga0207667_10313294 | |||
| 1750 | Ga0207667_10342927 | |||
| 1751 | Ga0207651_10009173 | |||
| 1752 | Ga0207651_10016951 | |||
| 1753 | Ga0207651_10143589 | |||
| 1754 | Ga0207651_10154311 | |||
| 1755 | Ga0207651_10273299 | |||
| 1756 | Ga0207712_10067376 | |||
| 1757 | Ga0207712_10337608 | |||
| 1758 | Ga0207668_10479853 | |||
| 1759 | Ga0207640_10025713 | |||
| 1760 | Ga0207640_10150608 | |||
| 1761 | Ga0207640_10362520 | |||
| 1762 | Ga0207658_10001593 | |||
| 1763 | Ga0207658_10121760 | |||
| 1764 | Ga0207658_10207128 | |||
| 1765 | Ga0207658_10334820 | |||
| 1766 | Ga0207677_10013370 | |||
| 1767 | Ga0207677_10228577 | |||
| 1768 | Ga0207677_11204544 | |||
| 1769 | Ga0207703_10007178 | |||
| 1770 | Ga0207703_10063936 | |||
| 1771 | Ga0207703_10317598 | |||
| 1772 | Ga0207703_10613828 | |||
| 1773 | Ga0207703_10629957 | |||
| 1774 | Ga0207639_10002312 | |||
| 1775 | Ga0207639_10003125 | |||
| 1776 | Ga0207639_10078769 | |||
| 1777 | Ga0207639_10164295 | |||
| 1778 | Ga0207639_10284533 | |||
| 1779 | Ga0207639_10373307 | |||
| 1780 | Ga0207639_10390804 | |||
| 1781 | Ga0207639_10438603 | |||
| 1782 | Ga0207678_10002308 | |||
| 1783 | Ga0207678_10002924 | |||
| 1784 | Ga0207678_10056684 | |||
| 1785 | Ga0207678_10089385 | |||
| 1786 | Ga0207678_10197273 | |||
| 1787 | Ga0207708_10115310 | |||
| 1788 | Ga0207702_10013261 | |||
| 1789 | Ga0207702_10041290 | |||
| 1790 | Ga0207702_10484184 | |||
| 1791 | Ga0207702_10678788 | |||
| 1792 | Ga0207702_10964517 | |||
| 1793 | Ga0207641_10025781 | |||
| 1794 | Ga0207641_10472548 | |||
| 1795 | Ga0207648_10240821 | |||
| 1796 | Ga0207648_10260403 | |||
| 1797 | Ga0207676_10008206 | |||
| 1798 | Ga0207676_10327860 | |||
| 1799 | Ga0207676_10507784 | |||
| 1800 | Ga0207674_10051394 | |||
| 1801 | Ga0207674_10062738 | |||
| 1802 | Ga0207674_10097083 | |||
| 1803 | Ga0207674_10102592 | |||
| 1804 | Ga0207674_10221047 | |||
| 1805 | Ga0207674_10339414 | |||
| 1806 | Ga0207674_10736496 | |||
| 1807 | Ga0207675_100001494 | |||
| 1808 | Ga0207675_100226409 | |||
| 1809 | Ga0207675_100589291 | |||
| 1810 | Ga0207683_10010289 | |||
| 1811 | Ga0207683_10176941 | |||
| 1812 | Ga0207683_10195506 | |||
| 1813 | Ga0207683_10364409 | |||
| 1814 | Ga0207698_10008889 | |||
| 1815 | Ga0207698_10065836 | |||
| 1816 | Ga0207698_10066133 | |||
| 1817 | Ga0207698_10198640 | |||
| 1818 | Ga0207698_10237607 | |||
| 1819 | Ga0207698_10318967 | |||
| 1820 | Ga0207698_10490101 | |||
| 1821 | Ga0207698_10493751 | |||
| 1822 | Ga0209813_10000547 | |||
| 1823 | Ga0209813_10157933 | |||
| 1824 | Ga0207428_10007154 | |||
| 1825 | Ga0207428_10021909 | |||
| 1826 | Ga0207428_10074450 | |||
| 1827 | Ga0207428_10178470 | |||
| 1828 | Ga0268266_10146424 | |||
| 1829 | Ga0268266_10170393 | |||
| 1830 | Ga0268266_10349811 | |||
| 1831 | Ga0268266_10416577 | |||
| 1832 | Ga0268266_10577781 | |||
| 1833 | Ga0268266_10665643 | |||
| 1834 | Ga0268265_10043211 | |||
| 1835 | Ga0268265_10115732 | |||
| 1836 | Ga0268265_10696602 | |||
| 1837 | Ga0268264_10061890 | |||
| 1838 | Ga0268264_10108010 | |||
| 1839 | Ga0268264_10133677 | |||
| 1840 | Ga0268264_10295560 | |||
| 1841 | Ga0268264_10295926 | |||
| 1842 | Ga0265319_1073507 | |||
| 1843 | Ga0265338_10033601 | |||
| 1844 | Ga0265338_10042698 | |||
| 1845 | Ga0265762_1017404 | |||
| 1846 | Ga0265330_10030456 | |||
| 1847 | Ga0265332_10005043 | |||
| 1848 | Ga0265328_10000218 | |||
| 1849 | Ga0265320_10032708 | |||
| 1850 | Ga0265325_10019219 | |||
| 1851 | Ga0265325_10042711 | |||
| 1852 | Ga0265325_10171119 | |||
| 1853 | Ga0265329_10035507 | |||
| 1854 | Ga0265340_10000340 | |||
| 1855 | Ga0265340_10009655 | |||
| 1856 | Ga0265340_10095194 | |||
| 1857 | Ga0265339_10000068 | |||
| 1858 | Ga0265339_10010303 | |||
| 1859 | Ga0265339_10075963 | |||
| 1860 | Ga0265339_10179057 | |||
| 1861 | Ga0265331_10051981 | |||
| 1862 | Ga0265327_10034092 | |||
| 1863 | Ga0265316_10058920 | |||
| 1864 | Ga0265316_10170628 | |||
| 1865 | Ga0265316_10175947 | |||
| 1866 | Ga0307408_100029248 | |||
| 1867 | Ga0307408_100472629 | |||
| 1868 | Ga0265313_10000088 | |||
| 1869 | Ga0265313_10149566 | |||
| 1870 | Ga0316575_10149388 | |||
| 1871 | Ga0316579_10011489 | |||
| 1872 | Ga0316579_10054739 | |||
| 1873 | Ga0265314_10131320 | |||
| 1874 | Ga0265342_10000399 | |||
| 1875 | Ga0265342_10037926 | |||
| 1876 | Ga0265342_10175893 | |||
| 1877 | Ga0265342_10210893 | |||
| 1878 | Ga0316576_10176805 | |||
| 1879 | Ga0316578_10010373 | |||
| 1880 | Ga0307405_10018732 | |||
| 1881 | Ga0307405_10142639 | |||
| 1882 | Ga0307405_10171755 | |||
| 1883 | Ga0307405_10321717 | |||
| 1884 | Ga0316577_10133267 | |||
| 1885 | Ga0307413_10107199 | |||
| 1886 | Ga0307413_10226125 | |||
| 1887 | Ga0307413_10400380 | |||
| 1888 | Ga0307413_10793371 | |||
| 1889 | Ga0307413_10917521 | |||
| 1890 | Ga0307410_10055411 | |||
| 1891 | Ga0307410_10090494 | |||
| 1892 | Ga0307410_10274786 | |||
| 1893 | Ga0307410_10311193 | |||
| 1894 | Ga0307410_10481007 | |||
| 1895 | Ga0307406_10061938 | |||
| 1896 | Ga0307406_10147840 | |||
| 1897 | Ga0307407_10054381 | |||
| 1898 | Ga0307407_10074741 | |||
| 1899 | Ga0307407_10097345 | |||
| 1900 | Ga0307407_10823589 | |||
| 1901 | Ga0307412_10040409 | |||
| 1902 | Ga0307412_10082451 | |||
| 1903 | Ga0307412_10089144 | |||
| 1904 | Ga0307412_10117114 | |||
| 1905 | Ga0307412_10272515 | |||
| 1906 | Ga0307412_10949367 | |||
| 1907 | Ga0307409_100010901 | |||
| 1908 | Ga0307409_100022096 | |||
| 1909 | Ga0307409_100032427 | |||
| 1910 | Ga0307409_100067493 | |||
| 1911 | Ga0307409_100098856 | |||
| 1912 | Ga0307409_100861316 | |||
| 1913 | Ga0307409_101089900 | |||
| 1914 | Ga0307416_100002549 | |||
| 1915 | Ga0307416_100005333 | |||
| 1916 | Ga0307416_100073036 | |||
| 1917 | Ga0307416_100251862 | |||
| 1918 | Ga0307416_101587989 | |||
| 1919 | Ga0307414_10001040 | |||
| 1920 | Ga0307414_10006477 | |||
| 1921 | Ga0307414_10167357 | |||
| 1922 | Ga0307414_10406893 | |||
| 1923 | Ga0307411_10003258 | |||
| 1924 | Ga0307411_10006084 | |||
| 1925 | Ga0307411_10006109 | |||
| 1926 | Ga0307411_10010035 | |||
| 1927 | Ga0307411_10054586 | |||
| 1928 | Ga0307411_10063642 | |||
| 1929 | Ga0307411_10205136 | |||
| 1930 | Ga0307411_10224671 | |||
| 1931 | Ga0307411_10239453 | |||
| 1932 | Ga0307411_10359858 | |||
| 1933 | Ga0307411_10480067 | |||
| 1934 | Ga0307415_100004677 | |||
| 1935 | Ga0307415_100013659 | |||
| 1936 | Ga0307415_100031432 | |||
| 1937 | Ga0307415_100134743 | |||
| 1938 | Ga0307415_100161715 | |||
| 1939 | Ga0307415_100498059 | |||
| 1940 | Ga0307415_100685954 | |||
| 1941 | Ga0307415_100737304 | |||
| 1942 | Ga0316583_10011289 | |||
| 1943 | Ga0316585_10010049 | |||
| 1944 | Ga0316580_10014622 | |||
| 1945 | Ga0316593_10011756 | |||
| 1946 | Ga0316587_1046730 | |||
| 1947 | Ga0316596_1004566 | |||
| 1948 | Ga0373958_0041941 | |||
| 1949 | Ga0373959_0121812 | |||
| 1950 | Ga0373938_0014004 | |||
| 1951 | Ga0373929_0003939 | |||
| 1952 | Ga0373929_0090681 | |||
| 1953 | Ga0373934_0006122 | |||
| 1954 | Ga0373940_0016660 | |||
| 1955 | Ga0373923_0084639 | |||
| 1956 | Ga0373932_0021648 | |||
| 1957 | Ga0373932_0063858 | |||
| 1958 | Ga0373936_0005177 | |||
| 1959 | Ga0373936_0135158 | |||
| 1960 | Ga0373939_0047421 | |||
| 1961 | Ga0373939_0152677 | |||
| 1962 | Ga0373941_0000346 | |||
| 1963 | Ga0373945_0306079 | |||
| 1964 | Ga0373953_0025705 | |||
| 1965 | Ga0373953_0047451 | |||
| 1966 | Ga0373953_0213267 | |||
| 1967 | Ga0373954_0023234 | |||
| 1968 | Ga0373954_0029189 | |||
| 1969 | Ga0373956_0210857 | |||
| 1970 | Ga0373957_0087288 | |||
| 1971 | Ga0373957_0135035 | |||
| 1972 | Ga0373960_0004056 | |||
| 1973 | Ga0373943_0036994 | |||
| 1974 | Ga0373946_0246314 | |||
| 1975 | Ga0373955_0003048 | |||
| 1976 | Ga0373955_0008692 | |||
| 1977 | Ga0373942_0010535 | |||
| 1978 | Ga0373961_0006736 | |||
| 1979 | Ga0373962_0035672 | |||
| 1980 | Ga0373962_0112893 | |||
| 1981 | Ga0316574_0000467 | |||
| 1982 | Ga0373924_0061428 | |||
| 1983 | Ga0373924_0199458 | |||
| 1984 | Ga0373931_0001292 | |||
| 1985 | Ga0373931_0002313 | |||
| 1986 | Ga0373931_0332445 | |||
| 1987 | Ga0373935_0007400 | |||
| 1988 | Ga0373935_0146177 | |||
| 1989 | Ga0373927_0035512 | |||
| 1990 | Ga0373927_0049298 | |||
| 1991 | Ga0373927_0062962 | |||
| 1992 | Ga0373933_0005821 | |||
| 1993 | Ga0373933_0009152 | |||
| 1994 | Ga0373933_0622289 | |||
| 1995 | Ga0373947_0014629 | |||
| 1996 | Ga0373947_0076796 | |||
| 1997 | Ga0373947_0164580 | |||
| 1998 | Ga0373947_0499461 | |||
| 1999 | Ga0373937_0000075 | |||
| 2000 | Ga0373937_0000231 | |||
| 2001 | Ga0373937_0429887 | |||
| 2002 | Ga0373937_0939557 | |||
| 2003 | Ga0316582_0040365 | |||
| 2004 | Ga0316582_0263607 | |||
| 2005 | Ga0316582_0315671 | |||
| 2006 | Ga0316584_0091032 | |||
| 2007 | Ga0316584_0174508 | |||
| 2008 | Ga0316584_0431552 | |||
| 2009 | Ga0373925_0000081 | |||
| 2010 | Ga0373925_0134123 | |||
| 2011 | Ga0395899_0010276 | |||
| 2012 | Ga0395899_0021002 | |||
| 2013 | Ga0395899_0129909 | |||
| 2014 | Ga0395899_0458681 | |||
| 2015 | Ga0395900_0063629 | |||
| 2016 | Ga0395900_0076737 | |||
| 2017 | Ga0395900_0152979 | |||
| 2018 | Ga0395898_0052511 | |||
| 2019 | Ga0395898_0072191 | |||
| 2020 | Ga0395905_0108517 | |||
| 2021 | Ga0395905_0128888 | |||
| 2022 | Ga0395905_0132823 | |||
| 2023 | Ga0395905_0166922 | |||
| 2024 | Ga0395905_0476632 | |||
| 2025 | Ga0316581_0034438 | |||
| 2026 | Ga0316581_0097300 | |||
| 2027 | Ga0436364_0721077 | |||
| 2028 | Ga0436364_1243640 | |||
| 2029 | Ga0395901_0030541 | |||
| 2030 | Ga0395901_0095901 | |||
| 2031 | Ga0395901_0454161 | |||
| 2032 | Ga0400490_34472 | |||
| 2033 | Ga0400488_04486 | |||
| 2034 | Ga0400488_59215 | |||
| 2035 | Ga0400483_041422 | |||
| 2036 | Ga0400483_184515 | |||
| 2037 | Ga0400483_277636 | |||
| 2038 | Ga0436365_0565920 | |||
| 2039 | Ga0436365_1068013 | |||
| 2040 | Ga0436365_1655375 | |||
| 2041 | Ga0436365_1751841 | |||
| 2042 | Ga0436361_0689606 | |||
| 2043 | Ga0436362_0544081 | |||
| 2044 | Ga0436362_1064891 | |||
| 2045 | Ga0439453_0006563 | |||
| 2046 | Ga0439453_0012916 | |||
| 2047 | Ga0451807_1298589 | |||
| 2048 | Ga0451843_0940280 | |||
| 2049 | Ga0439437_014891 | |||
| 2050 | Ga0439443_023327 | |||
| 2051 | Ga0439445_0004377 | |||
| 2052 | Ga0450910_050728 | |||
| 2053 | Ga0439434_0049122 | |||
| 2054 | Ga0439435_0086503 | |||
| 2055 | Ga0439459_0118537 | |||
| 2056 | Ga0439464_0083940 | |||
| 2057 | Ga0439460_0219031 | |||
| 2058 | Ga0451577_0213699 | |||
| 2059 | Ga0451577_0298959 | |||
| 2060 | Ga0466969_0091404 | |||
| 2061 | Ga0466972_0146519 | |||
| 2062 | Ga0466972_0273069 | |||
| 2063 | Ga0466966_0015054 | |||
| 2064 | Ga0466966_0070826 | |||
| 2065 | Ga0466961_0298972 | |||
| 2066 | Ga0466963_0103267 | |||
| 2067 | Ga0466964_0208197 | |||
| 2068 | Ga0453684_0042475 | |||
| 2069 | Ga0453684_0166907 | |||
| 2070 | Ga0453684_0741911 | |||
| 2071 | Ga0466968_0053193 | |||
| 2072 | Ga0466970_0024076 | |||
| 2073 | Ga0466970_0285414 | |||
| 2074 | Ga0466957_0019054 | |||
| 2075 | Ga0466957_0414682 | |||
| 2076 | Ga0466957_0484359 | |||
| 2077 | Ga0466960_0054564 | |||
| 2078 | Ga0466959_0048339 | |||
| 2079 | Ga0451576_0005522 | |||
| 2080 | Ga0451576_0103697 | |||
| 2081 | Ga0451576_0168558 | |||
| 2082 | Ga0466967_0039462 | |||
| 2083 | Ga0466967_0087942 | |||
| 2084 | Ga0466967_0088711 | |||
| 2085 | Ga0466967_0165787 | |||
| 2086 | Ga0466967_1098706 | |||
| 2087 | Ga0495592_0000102 | |||
| 2088 | Ga0495592_0000694 | |||
| 2089 | Ga0495629_0008845 | |||
| 2090 | Ga0495629_0072659 | |||
| 2091 | Ga0495638_0009457 | |||
| 2092 | Ga0495651_0001342 | |||
| 2093 | Ga0495653_0000681 | |||
| 2094 | Ga0495653_0011013 | |||
| 2095 | Ga0495582_0130616 | |||
| 2096 | Ga0495639_0149172 | |||
| 2097 | Ga0495664_0000016 | |||
| 2098 | Ga0495664_0004663 | |||
| 2099 | Ga0495584_0053441 | |||
| 2100 | Ga0495585_0056622 | |||
| 2101 | Ga0495585_0194871 | |||
| 2102 | Ga0495608_0000006 | |||
| 2103 | Ga0495608_0016534 | |||
| 2104 | Ga0495618_0007196 | |||
| 2105 | Ga0495618_0064002 | |||
| 2106 | Ga0495628_0000018 | |||
| 2107 | Ga0495628_0008859 | |||
| 2108 | Ga0495628_0072643 | |||
| 2109 | Ga0495630_0010531 | |||
| 2110 | Ga0495630_0113607 | |||
| 2111 | Ga0495632_0307532 | |||
| 2112 | Ga0495663_0009581 | |||
| 2113 | Ga0495652_0000005 | |||
| 2114 | Ga0495652_0072584 | |||
| 2115 | Ga0495652_0147864 | |||
| 2116 | Ga0495640_0002500 | |||
| 2117 | Ga0495640_0012152 | |||
| 2118 | Ga0495640_0198506 | |||
| 2119 | Ga0495640_0547187 | |||
| 2120 | Ga0495587_0000043 | |||
| 2121 | Ga0495587_0000753 | |||
| 2122 | Ga0495598_0004644 | |||
| 2123 | Ga0495609_0234018 | |||
| 2124 | Ga0495621_0006102 | |||
| 2125 | Ga0495645_0000064 | |||
| 2126 | Ga0495645_0116750 | |||
| 2127 | Ga0495645_0168904 | |||
| 2128 | Ga0495633_0005946 | |||
| 2129 | Ga0495667_0000023 | |||
| 2130 | Ga0495667_0000450 | |||
| 2131 | Ga0495667_0117499 | |||
| 2132 | Ga0495656_0157287 | |||
| 2133 | Ga0495668_0463385 | |||
| 2134 | Ga0495634_0002682 | |||
| 2135 | Ga0495634_0005621 | |||
| 2136 | Ga0495634_0457636 | |||
| 2137 | Ga0495635_0000021 | |||
| 2138 | Ga0495635_0001541 | |||
| 2139 | Ga0495659_0071561 | |||
| 2140 | Ga0495661_0108596 | |||
| 2141 | Ga0495657_0011026 | |||
| 2142 | Ga0495599_0002496 | |||
| 2143 | Ga0495599_0007280 | |||
| 2144 | Ga0495623_0003470 | |||
| 2145 | Ga0495623_0008462 | |||
| 2146 | Ga0495646_0000027 | |||
| 2147 | Ga0495658_0129781 | |||
| 2148 | Ga0495658_0364187 | |||
| 2149 | Ga0495669_0022836 | |||
| 2150 | Ga0495669_0033137 | |||
| 2151 | Ga0495613_0199191 | |||
| 2152 | Ga0495613_0748630 | |||
| 2153 | Ga0495624_0415031 | |||
| 2154 | Ga0495624_0492094 | |||
| 2155 | Ga0495670_0035903 | |||
| 2156 | Ga0495670_0114858 | |||
| 2157 | Ga0495589_0075431 | |||
| 2158 | Ga0495600_0000047 | |||
| 2159 | Ga0495600_0001179 | |||
| 2160 | Ga0495604_0000014 | |||
| 2161 | Ga0495604_0001199 | |||
| 2162 | Ga0495604_0107838 | |||
| 2163 | Ga0495636_0298178 | |||
| 2164 | Ga0495674_0000014 | |||
| 2165 | Ga0495674_0000573 | |||
| 2166 | Ga0495676_0045729 | |||
| 2167 | Ga0495680_0000285 | |||
| 2168 | Ga0495680_0002949 | |||
| 2169 | Ga0495680_0351320 | |||
| 2170 | Ga0495675_0032125 | |||
| 2171 | Ga0495675_0066501 | |||
| 2172 | Ga0495675_0450347 | |||
| 2173 | Ga0495677_0052449 | |||
| 2174 | Ga0495677_0102171 | |||
| 2175 | Ga0495684_0011810 | |||
| 2176 | Ga0495684_0024992 | |||
| 2177 | Ga0495686_0106680 | |||
| 2178 | Ga0495593_0032963 | |||
| 2179 | Ga0495593_0210655 | |||
| 2180 | Ga0495593_0257106 | |||
| 2181 | Ga0495602_0000017 | |||
| 2182 | Ga0495602_0007083 | |||
| 2183 | Ga0496100_0124207 | |||
| 2184 | Ga0496101_0067877 | |||
| 2185 | Ga0496101_0594585 | |||
| 2186 | Ga0496102_0088819 | |||
| 2187 | Ga0496102_0748219 | |||
| 2188 | Ga0496103_0050675 | |||
| 2189 | Ga0496104_0334729 | |||
| 2190 | Ga0496104_0436585 | |||
| 2191 | Ga0496105_0106651 | |||
| 2192 | Ga0496105_0283645 | |||
| 2193 | Ga0496108_0028372 | |||
| 2194 | Ga0496108_0052890 | |||
| 2195 | Ga0496108_0138631 | |||
| 2196 | Ga0496108_0400326 | |||
| 2197 | Ga0496109_0012227 | |||
| 2198 | Ga0496109_0086385 | |||
| 2199 | Ga0496109_0425520 | |||
| 2200 | Ga0496110_0050539 | |||
| 2201 | Ga0496110_0276164 | |||
| 2202 | Ga0496110_0347132 | |||
| 2203 | Ga0496110_0690529 | |||
| 2204 | Ga0496111_0015254 | |||
| 2205 | Ga0496111_0670567 | |||
| 2206 | Ga0496112_0040251 | |||
| 2207 | Ga0496112_0116807 | |||
| 2208 | Ga0496113_0198353 | |||
| 2209 | Ga0496113_1000798 | |||
| 2210 | Ga0496114_0156254 | |||
| 2211 | Ga0496114_0188115 | |||
| 2212 | Ga0496114_0338092 | |||
| 2213 | Ga0496114_0670356 | |||
| 2214 | Ga0496115_0651006 | |||
| 2215 | Ga0496121_0171993 | |||
| 2216 | Ga0496121_0582876 | |||
| 2217 | Ga0496126_0699576 | |||
| 2218 | Ga0501290_000464 | |||
| 2219 | Ga0501292_000026 | |||
| 2220 | Ga0501294_000620 | |||
| 2221 | Ga0501317_062296 | |||
| 2222 | Ga0501031_0002683 | |||
| 2223 | Ga0501031_0031678 | |||
| 2224 | Ga0501031_0033840 | |||
| 2225 | Ga0501031_0139148 | |||
| 2226 | Ga0501031_0352347 | |||
| 2227 | Ga0501032_0006465 | |||
| 2228 | Ga0501032_0007303 | |||
| 2229 | Ga0501032_0008238 | |||
| 2230 | Ga0501032_0029554 | |||
| 2231 | Ga0501032_0034383 | |||
| 2232 | Ga0501032_0055046 | |||
| 2233 | Ga0501032_0134960 | |||
| 2234 | Ga0501033_0004363 | |||
| 2235 | Ga0501033_0015275 | |||
| 2236 | Ga0501033_0034895 | |||
| 2237 | Ga0501033_0062891 | |||
| 2238 | Ga0501033_0081556 | |||
| 2239 | Ga0501033_0092428 | |||
| 2240 | Ga0501033_0111769 | |||
| 2241 | Ga0501033_0123637 | |||
| 2242 | Ga0501033_0284288 | |||
| 2243 | Ga0501034_0000166 | |||
| 2244 | Ga0501034_0000250 | |||
| 2245 | Ga0501034_0004004 | |||
| 2246 | Ga0501034_0011589 | |||
| 2247 | Ga0501034_0015288 | |||
| 2248 | Ga0501034_0022969 | |||
| 2249 | Ga0501034_0053963 | |||
| 2250 | Ga0501034_0055243 | |||
| 2251 | Ga0501034_0074320 | |||
| 2252 | Ga0501034_0093981 | |||
| 2253 | Ga0501034_0109847 | |||
| 2254 | Ga0501034_0172691 | |||
| 2255 | Ga0501034_0321395 | |||
| 2256 | Ga0501034_0528818 | |||
| 2257 | Ga0501034_0810090 | |||
| 2258 | Ga0501034_0865926 | |||
| 2259 | Ga0501036_0000098 | |||
| 2260 | Ga0501036_0000118 | |||
| 2261 | Ga0501036_0011524 | |||
| 2262 | Ga0501036_0059781 | |||
| 2263 | Ga0501036_0096933 | |||
| 2264 | Ga0501036_0172034 | |||
| 2265 | Ga0501036_0212665 | |||
| 2266 | Ga0501036_0236143 | |||
| 2267 | Ga0501036_0272062 | |||
| 2268 | Ga0501036_0322427 | |||
| 2269 | Ga0501036_0391656 | |||
| 2270 | Ga0501036_0445366 | |||
| 2271 | Ga0501037_0000092 | |||
| 2272 | Ga0501037_0002056 | |||
| 2273 | Ga0501037_0021237 | |||
| 2274 | Ga0501037_0082921 | |||
| 2275 | Ga0501037_0165148 | |||
| 2276 | Ga0501037_0188274 | |||
| 2277 | Ga0501037_0240667 | |||
| 2278 | Ga0501037_0554087 | |||
| 2279 | Ga0501038_0000059 | |||
| 2280 | Ga0501038_0011141 | |||
| 2281 | Ga0501038_0020000 | |||
| 2282 | Ga0501038_0028839 | |||
| 2283 | Ga0501038_0088715 | |||
| 2284 | Ga0501038_0196113 | |||
| 2285 | Ga0501038_0280926 | |||
| 2286 | Ga0501038_0282712 | |||
| 2287 | Ga0501038_0286085 | |||
| 2288 | Ga0501038_0328335 | |||
| 2289 | Ga0501038_0358729 | |||
| 2290 | Ga0501039_0000547 | |||
| 2291 | Ga0501039_0000554 | |||
| 2292 | Ga0501039_0016705 | |||
| 2293 | Ga0501039_0036429 | |||
| 2294 | Ga0501039_0063880 | |||
| 2295 | Ga0501039_0086154 | |||
| 2296 | Ga0501039_0222742 | |||
| 2297 | Ga0501039_0597706 | |||
| 2298 | Ga0501039_0600368 | |||
| 2299 | Ga0501040_0018492 | |||
| 2300 | Ga0501040_0032602 | |||
| 2301 | Ga0501040_0089782 | |||
| 2302 | Ga0501040_0475150 | |||
| 2303 | Ga0501040_0482988 | |||
| 2304 | Ga0501040_0491450 | |||
| 2305 | Ga0501040_0673822 | |||
| 2306 | Ga0501041_0040615 | |||
| 2307 | Ga0501041_0247238 | |||
| 2308 | Ga0501041_0405466 | |||
| 2309 | Ga0501041_0479545 | |||
| 2310 | Ga0501042_0040851 | |||
| 2311 | Ga0501042_0055463 | |||
| 2312 | Ga0501042_0094903 | |||
| 2313 | Ga0501042_0380823 | |||
| 2314 | Ga0501042_0614942 | |||
| 2315 | Ga0501042_0634531 | |||
| 2316 | Ga0501043_0003262 | |||
| 2317 | Ga0501043_0004952 | |||
| 2318 | Ga0501043_0025398 | |||
| 2319 | Ga0501043_0037821 | |||
| 2320 | Ga0501043_0074646 | |||
| 2321 | Ga0501043_0091286 | |||
| 2322 | Ga0501043_0106599 | |||
| 2323 | Ga0501043_0131322 | |||
| 2324 | Ga0501043_0568607 | |||
| 2325 | Ga0501043_1021618 | |||
| 2326 | Ga0501046_0000483 | |||
| 2327 | Ga0501046_0007623 | |||
| 2328 | Ga0501046_0008888 | |||
| 2329 | Ga0501046_0019056 | |||
| 2330 | Ga0501046_0024112 | |||
| 2331 | Ga0501046_0041977 | |||
| 2332 | Ga0501046_0105086 | |||
| 2333 | Ga0501046_0209038 | |||
| 2334 | Ga0501046_0574290 | |||
| 2335 | Ga0501047_0000022 | |||
| 2336 | Ga0501047_0000097 | |||
| 2337 | Ga0501047_0002349 | |||
| 2338 | Ga0501047_0011286 | |||
| 2339 | Ga0501047_0089266 | |||
| 2340 | Ga0501047_0150648 | |||
| 2341 | Ga0501047_0173726 | |||
| 2342 | Ga0501047_0175046 | |||
| 2343 | Ga0501047_0199679 | |||
| 2344 | Ga0501047_0249337 | |||
| 2345 | Ga0501047_0460618 | |||
| 2346 | Ga0501048_0000522 | |||
| 2347 | Ga0501048_0000821 | |||
| 2348 | Ga0501048_0021257 | |||
| 2349 | Ga0501048_0178190 | |||
| 2350 | Ga0501048_0192599 | |||
| 2351 | Ga0501048_0219615 | |||
| 2352 | Ga0501048_0279696 | |||
| 2353 | Ga0501067_0000576 | |||
| 2354 | Ga0501067_0000688 | |||
| 2355 | Ga0501067_0003424 | |||
| 2356 | Ga0501067_0007963 | |||
| 2357 | Ga0501067_0015150 | |||
| 2358 | Ga0501068_0000490 | |||
| 2359 | Ga0501068_0001239 | |||
| 2360 | Ga0501068_0035913 | |||
| 2361 | Ga0501068_0083205 | |||
| 2362 | Ga0501068_0104234 | |||
| 2363 | Ga0501068_0303221 | |||
| 2364 | Ga0501069_0000707 | |||
| 2365 | Ga0501069_0006762 | |||
| 2366 | Ga0501069_0026803 | |||
| 2367 | Ga0501069_0040815 | |||
| 2368 | Ga0501069_0162399 | |||
| 2369 | Ga0501070_0002047 | |||
| 2370 | Ga0501070_0028005 | |||
| 2371 | Ga0501070_0037453 | |||
| 2372 | Ga0501070_0037536 | |||
| 2373 | Ga0501070_0040620 | |||
| 2374 | Ga0501070_0063974 | |||
| 2375 | Ga0501070_0191397 | |||
| 2376 | Ga0501070_0318792 | |||
| 2377 | Ga0501071_0008806 | |||
| 2378 | Ga0501071_0437350 | |||
| 2379 | Ga0501071_1012439 | |||
| 2380 | Ga0501072_0000001 | |||
| 2381 | Ga0501072_0000327 | |||
| 2382 | Ga0501072_0001893 | |||
| 2383 | Ga0501072_0043315 | |||
| 2384 | Ga0501072_0100111 | |||
| 2385 | Ga0501072_0119346 | |||
| 2386 | Ga0501072_0121979 | |||
| 2387 | Ga0501072_0122605 | |||
| 2388 | Ga0501072_0175315 | |||
| 2389 | Ga0501072_0215532 | |||
| 2390 | Ga0501072_0447048 | |||
| 2391 | Ga0501073_0000955 | |||
| 2392 | Ga0501073_0008009 | |||
| 2393 | Ga0501073_0024073 | |||
| 2394 | Ga0501073_0085422 | |||
| 2395 | Ga0501073_0097498 | |||
| 2396 | Ga0501073_0113888 | |||
| 2397 | Ga0501073_0144272 | |||
| 2398 | Ga0501073_0153521 | |||
| 2399 | Ga0501073_0171543 | |||
| 2400 | Ga0501073_0196087 | |||
| 2401 | Ga0501073_0196188 | |||
| 2402 | Ga0501073_0199601 | |||
| 2403 | Ga0501073_0241066 | |||
| 2404 | Ga0501073_0350342 | |||
| 2405 | Ga0501073_0573255 | |||
| 2406 | Ga0501074_0003990 | |||
| 2407 | Ga0501074_0004790 | |||
| 2408 | Ga0501074_0007646 | |||
| 2409 | Ga0501074_0024225 | |||
| 2410 | Ga0501074_0044060 | |||
| 2411 | Ga0501074_0064647 | |||
| 2412 | Ga0501074_0305811 | |||
| 2413 | Ga0501074_0406516 | |||
| 2414 | Ga0501074_0846186 | |||
| 2415 | Ga0501075_0072162 | |||
| 2416 | Ga0501075_0599849 | |||
| 2417 | Ga0501076_0021371 | |||
| 2418 | Ga0501076_0122551 | |||
| 2419 | Ga0501076_0125455 | |||
| 2420 | Ga0501076_0185229 | |||
| 2421 | Ga0501076_0246670 | |||
| 2422 | Ga0501076_0313118 | |||
| 2423 | Ga0501076_1255141 | |||
| 2424 | Ga0501077_0091077 | |||
| 2425 | Ga0501077_0187026 | |||
| 2426 | Ga0501077_0428101 | |||
| 2427 | Ga0501222_000640 | |||
| 2428 | Ga0501223_005742 | |||
| 2429 | Ga0501227_010889 | |||
| 2430 | Ga0501249_007946 | |||
| 2431 | Ga0501259_000268 | |||
| 2432 | Ga0501225_0040742 | |||
| 2433 | Ga0501079_0006980 | |||
| 2434 | Ga0501079_0071163 | |||
| 2435 | Ga0501079_0076463 | |||
| 2436 | Ga0501079_0080214 | |||
| 2437 | Ga0501079_0111899 | |||
| 2438 | Ga0501079_0120015 | |||
| 2439 | Ga0501079_0140114 | |||
| 2440 | Ga0501079_0489445 | |||
| 2441 | Ga0501080_0000047 | |||
| 2442 | Ga0501080_0000075 | |||
| 2443 | Ga0501080_0005687 | |||
| 2444 | Ga0501080_0011853 | |||
| 2445 | Ga0501080_0034243 | |||
| 2446 | Ga0501080_0159108 | |||
| 2447 | Ga0501080_0242492 | |||
| 2448 | Ga0501080_0520373 | |||
| 2449 | Ga0501080_0724103 | |||
| 2450 | Ga0501080_0812448 | |||
| 2451 | Ga0501080_0861557 | |||
| 2452 | Ga0501080_1118815 | |||
| 2453 | Ga0501081_0008289 | |||
| 2454 | Ga0501081_0166382 | |||
| 2455 | Ga0501081_0180111 | |||
| 2456 | Ga0501081_1113279 | |||
| 2457 | Ga0501083_0000694 | |||
| 2458 | Ga0501083_0000808 | |||
| 2459 | Ga0501083_0000857 | |||
| 2460 | Ga0501083_0010083 | |||
| 2461 | Ga0501083_0032304 | |||
| 2462 | Ga0501083_0105896 | |||
| 2463 | Ga0501083_0126195 | |||
| 2464 | Ga0501083_0148049 | |||
| 2465 | Ga0501083_0180010 | |||
| 2466 | Ga0501267_003024 | |||
| 2467 | Ga0501279_000027 | |||
| 2468 | Ga0501280_000044 | |||
| 2469 | Ga0501281_04599 | |||
| 2470 | Ga0501282_000334 | |||
| 2471 | Ga0501035_0000084 | |||
| 2472 | Ga0501035_0000222 | |||
| 2473 | Ga0501035_0000240 | |||
| 2474 | Ga0501035_0023093 | |||
| 2475 | Ga0501035_0093910 | |||
| 2476 | Ga0501035_0134538 | |||
| 2477 | Ga0501035_0186337 | |||
| 2478 | Ga0501035_0195686 | |||
| 2479 | Ga0501035_0404362 | |||
| 2480 | Ga0501035_0601317 | |||
| 2481 | Ga0501035_0725229 | |||
| 2482 | Ga0501044_0000072 | |||
| 2483 | Ga0501044_0000073 | |||
| 2484 | Ga0501044_0000122 | |||
| 2485 | Ga0501044_0009895 | |||
| 2486 | Ga0501044_0026426 | |||
| 2487 | Ga0501044_0037991 | |||
| 2488 | Ga0501044_0084636 | |||
| 2489 | Ga0501044_0195581 | |||
| 2490 | Ga0501044_0244736 | |||
| 2491 | Ga0501044_0289043 | |||
| 2492 | Ga0501044_0318044 | |||
| 2493 | Ga0501044_0351893 | |||
| 2494 | Ga0501044_0745093 | |||
| 2495 | Ga0501045_0020260 | |||
| 2496 | Ga0501045_0056835 | |||
| 2497 | Ga0501045_0107574 | |||
| 2498 | Ga0501045_0140486 | |||
| 2499 | Ga0501045_0159840 | |||
| 2500 | Ga0501045_0400872 | |||
| 2501 | Ga0501045_0766462 | |||
| 2502 | nmdc:mga03683_105249_c1 | |||
| 2503 | nmdc:mga03683_10611_c1 | |||
| 2504 | nmdc:mga03683_14732_c1 | |||
| 2505 | nmdc:mga03n38_111658_c1 | |||
| 2506 | nmdc:mga03n38_112709_c1 | |||
| 2507 | nmdc:mga03n38_11414_c1 | |||
| 2508 | nmdc:mga00v17_10354_c1 | |||
| 2509 | nmdc:mga00v17_459614_c1 | |||
| 2510 | nmdc:mga00v17_498095_c1 | |||
| 2511 | nmdc:mga00v17_590400_c1 | |||
| 2512 | nmdc:mga00v17_608140_c1 | |||
| 2513 | nmdc:mga0yw44_572322_c1 | |||
| 2514 | nmdc:mga0yw44_661200_c1 | |||
| 2515 | nmdc:mga0k408_14308_c1 | |||
| 2516 | nmdc:mga0k408_19574_c1 | |||
| 2517 | nmdc:mga0k408_19827_c1 | |||
| 2518 | nmdc:mga0k408_226323_c1 | |||
| 2519 | nmdc:mga06z11_33274_c1 | |||
| 2520 | nmdc:mga06z11_717_c1 | |||
| 2521 | nmdc:mga04h51_183045_c1 | |||
| 2522 | nmdc:mga04h51_261_c1 | |||
| 2523 | nmdc:mga04h51_333897_c1 | |||
| 2524 | nmdc:mga07m45_172315_c1 | |||
| 2525 | nmdc:mga07m45_7_c1 | |||
| 2526 | nmdc:mga05p37_223527_c1 | |||
| 2527 | nmdc:mga05p37_387146_c1 | |||
| 2528 | nmdc:mga05p37_462759_c1 | |||
| 2529 | nmdc:mga05p37_564_c1 | |||
| 2530 | nmdc:mga05p37_816617_c1 | |||
| 2531 | nmdc:mga09592_19928_c1 | |||
| 2532 | nmdc:mga09592_20905_c1 | |||
| 2533 | nmdc:mga09592_225653_c1 | |||
| 2534 | nmdc:mga09592_26841_c1 | |||
| 2535 | nmdc:mga09592_58331_c1 | |||
| 2536 | nmdc:mga0qj67_1194_c1 | |||
| 2537 | nmdc:mga0qj67_139012_c1 | |||
| 2538 | nmdc:mga0qj67_176641_c1 | |||
| 2539 | nmdc:mga0qj67_611093_c1 | |||
| 2540 | nmdc:mga06r32_1217376_c1 | |||
| 2541 | nmdc:mga06r32_13924_c1 | |||
| 2542 | nmdc:mga06r32_191_c1 | |||
| 2543 | nmdc:mga06r32_360112_c1 | |||
| 2544 | nmdc:mga06r32_437492_c1 | |||
| 2545 | nmdc:mga06r32_8176_c1 | |||
| 2546 | nmdc:mga08y16_14382_c1 | |||
| 2547 | nmdc:mga08y16_330510_c1 | |||
| 2548 | nmdc:mga08y16_4792_c1 | |||
| 2549 | nmdc:mga08y16_79789_c1 | |||
| 2550 | nmdc:mga08y16_89_c1 | |||
| 2551 | nmdc:mga08y16_963796_c1 | |||
| 2552 | nmdc:mga0n895_11749_c1 | |||
| 2553 | nmdc:mga0rr50_576898_c1 | |||
| 2554 | nmdc:mga0rr50_684664_c1 | |||
| 2555 | nmdc:mga08x19_45856_c1 | |||
| 2556 | nmdc:mga08x19_523752_c1 | |||
| 2557 | nmdc:mga0a205_272836_c1 | |||
| 2558 | nmdc:mga0a205_34901_c1 | |||
| 2559 | nmdc:mga0a205_411557_c1 | |||
| 2560 | nmdc:mga0a205_880256_c1 | |||
| 2561 | nmdc:mga0sz30_304608_c1 | |||
| 2562 | nmdc:mga0sz30_3060_c1 | |||
| 2563 | Ga0495601_0000016 | |||
| 2564 | Ga0495601_0019662 | |||
| 2565 | Ga0495601_0063264 | |||
| 2566 | Ga0495601_0083752 | |||
| 2567 | Ga0495612_0000041 | |||
| 2568 | Ga0495612_0000733 | |||
| 2569 | Ga0495595_0000578 | |||
| 2570 | Ga0495595_0002928 | |||
| 2571 | Ga0495595_0017378 | |||
| 2572 | Ga0495595_0156438 | |||
| 2573 | Ga0495619_0002914 | |||
| 2574 | Ga0495619_0007913 | |||
| 2575 | Ga0500643_000065 | |||
| 2576 | Ga0500646_0070812 | |||
| 2577 | Ga0500566_0265020 | |||
| 2578 | Ga0500566_0298727 | |||
| 2579 | Ga0500641_0002717 | |||
| 2580 | Ga0500641_0007230 | |||
| 2581 | Ga0500592_000384 | |||
| 2582 | Ga0500594_0195330 | |||
| 2583 | Ga0500595_007591 | |||
| 2584 | Ga0500607_000854 | |||
| 2585 | Ga0500607_004296 | |||
| 2586 | Ga0500642_0314401 | |||
| 2587 | Ga0500652_000090 | |||
| 2588 | Ga0500652_003278 | |||
| 2589 | Ga0500658_0080953 | |||
| 2590 | Ga0500559_0002140 | |||
| 2591 | Ga0500604_0000065 | |||
| 2592 | Ga0500616_0036739 | |||
| 2593 | Ga0500616_0047136 | |||
| 2594 | Ga0500627_0000551 | |||
| 2595 | Ga0500627_0251533 | |||
| 2596 | Ga0500636_0044766 | |||
| 2597 | Ga0500645_000261 | |||
| 2598 | Ga0500645_001908 | |||
| 2599 | Ga0500645_094918 | |||
| 2600 | Ga0501084_0000079 | |||
| 2601 | Ga0501084_0003295 | |||
| 2602 | Ga0501084_0032719 | |||
| 2603 | Ga0501084_0068755 | |||
| 2604 | Ga0501084_0090467 | |||
| 2605 | Ga0501084_0110255 | |||
| 2606 | Ga0501084_0140691 | |||
| 2607 | Ga0501084_0446536 | |||
| 2608 | Ga0501084_0476620 | |||
| 2609 | Ga0501084_0547947 | |||
| 2610 | Ga0590075_064910 | |||
| 2611 | Ga0590075_075302 | |||
| 2612 | Ga0587077_106110 | |||
| 2613 | Ga0587106_028992 | |||
| 2614 | Ga0587062_029273 | |||
| 2615 | Ga0587076_045819 | |||
| 2616 | Ga0587079_084023 | |||
| 2617 | Ga0501082_0001185 | |||
| 2618 | Ga0501082_0001707 | |||
| 2619 | Ga0501082_0004072 | |||
| 2620 | Ga0501082_0015079 | |||
| 2621 | Ga0501082_0032192 | |||
| 2622 | Ga0501082_0074277 | |||
| 2623 | Ga0501082_0153261 | |||
| 2624 | Ga0501082_0154605 | |||
| 2625 | Ga0501082_0244555 | |||
| 2626 | Ga0501082_0282206 | |||
| 2627 | Ga0501082_0339784 | |||
| 2628 | Ga0501082_0395956 | |||
| 2629 | Ga0501082_0433953 | |||
| 2630 | Ga0501082_0451088 | |||
| 2631 | Ga0501082_0517308 | |||
| 2632 | Ga0530510_0035312 | |||
| 2633 | Ga0530510_0079605 | |||
| 2634 | Ga0530510_0604927 | |||
| 2635 | Ga0530510_1112104 | |||
| 2636 | 2523469174 | |||
| 2637 | 2671693545 | |||
| 2638 | 2894822242 | |||
| 2639 | 2896185693 | |||
| 2640 | 2917558208 | |||
| 2641 | 2929298512 | |||
| 2642 | 3000867000 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g4e-assembly1.cif.gz_B | crystal structure of the l88a mutant of hslv from escherichia coli | 0.9812 | 5 | 174 |
| 2z3a-assembly1.cif.gz_J | crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus | 0.9741 | 2 | 174 |
| 3ty6-assembly1.cif.gz_D | atp-dependent protease hslv from bacillus anthracis str. ames | 0.9727 | 2 | 174 |
| 1m4y-assembly1.cif.gz_A | crystal structure of hslv from thermotoga maritima | 0.9726 | 5 | 174 |
| 1ofi-assembly2.cif.gz_N | asymmetric complex between hslv and i-domain deleted hslu (h. influenzae) | 0.9708 | 5 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nedC00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.977 | 5 | 174 | 3.60.20.10 |
| af_Q12375_14_292_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.9693 | 130 | 158 | 1.50.40.10 |
| 1nedC00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9496 | 5 | 174 | 3.60.20.10 |
| 5fmga00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8647 | 2 | 173 | 3.60.20.10 |
| 1pma100 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8629 | 5 | 174 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356VCR6-F1-model_v4 | deleted | 0.9938 | 45 | 174 |
|
| AF-A0A1G3ZRR4-F1-model_v4 | deleted | 0.9937 | 2 | 174 |
|
| AF-A0A2N6DFI9-F1-model_v4 | ATP-dependent protease subunit HslV (EC 3.4.25.2) | 0.9926 | 2 | 174 |
GO:0004298
GO:0005839 GO:0009376 GO:0046872 GO:0051603 |
| AF-A0A2G2IKE4-F1-model_v4 | ATP-dependent protease subunit HslV (EC 3.4.25.2) | 0.9922 | 4 | 174 |
GO:0004298
GO:0005839 GO:0009376 GO:0046872 GO:0051603 |
| AF-A0A1Q7RN31-F1-model_v4 | ATP-dependent protease subunit HslV (EC 3.4.25.2) | 0.9919 | 2 | 174 |
GO:0004298
GO:0005839 GO:0009376 GO:0046872 GO:0051603 |