F492986

General Info

Members Datasets Scaffolds Average Seq Length
1321 472 2642 183

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0244649|Ga0501067_0244649_287_925
Length 212
Sequence MHQARPDCAGPDSAYIETATPPRERALMSQPTTDSWHGTTIISVRKGPKVVIAGDGQVSIGQTVMKHNARKVRPLSNGSVIAGFAGATADAFTLFERLEKKLEQYPGQLTRACVELAKDWRTDRYLRRLEALMIVADKSTSLVLTGNGDVLEPEGGVAAIGSGGNYALAAGRALYDSDLDAEAIARKAMKIAAEICVYTNDQVTLESLDTVK

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
125 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
205 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
209 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
231 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
260 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
270 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
271 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
275 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
278 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
279 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
280 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
281 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
284 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
335 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
372 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
373 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
374 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
398 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
399 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
400 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
401 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
402 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
403 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
404 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
405 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
409 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
410 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
411 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
412 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
413 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
414 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
420 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
421 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
433 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
434 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
435 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
436 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
437 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
438 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
439 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
442 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
443 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
444 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
445 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
446 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
447 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
448 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
449 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
450 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
451 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
452 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
467 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
468 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
469 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
470 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
471 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
472 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.76
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 2.5
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 0.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0244649 3300049583 Bacteria 998
2 JGI24746J21847_1003728 3300001977 Bacteria 2408
3 JGI25153J46596_10005049 3300003215 Bacteria 6981
4 Ga0065712_10158226 3300005290 Bacteria 1320
5 Ga0065715_10148475 3300005293 Bacteria 1758
6 Ga0070658_10026748 3300005327 Bacteria 4631
7 Ga0070658_10079821 3300005327 Bacteria 2687
8 Ga0070658_10277732 3300005327 Bacteria 1425
9 Ga0070658_10290689 3300005327 Bacteria 1392
10 Ga0070658_10433046 3300005327 Bacteria 1132
11 Ga0070658_10621901 3300005327 Bacteria 936
12 Ga0070658_10828065 3300005327 Bacteria 804
13 Ga0070676_10023356 3300005328 Bacteria 3475
14 Ga0070676_10078023 3300005328 Bacteria 2003
15 Ga0070690_100011597 3300005330 Bacteria 5159
16 Ga0070690_100051906 3300005330 Bacteria 2620
17 Ga0070670_100001209 3300005331 Bacteria 20518
18 Ga0070670_100524578 3300005331 Bacteria 1055
19 Ga0070677_10004816 3300005333 Bacteria 4427
20 Ga0070666_10002037 3300005335 Bacteria 12275
21 Ga0070666_10076575 3300005335 Bacteria 2282
22 Ga0070680_100008432 3300005336 Bacteria 7893
23 Ga0070680_100200812 3300005336 Bacteria 1681
24 Ga0070680_100401167 3300005336 Bacteria 1169
25 Ga0070682_100003228 3300005337 Bacteria 9039
26 Ga0070682_100039711 3300005337 Bacteria 2893
27 Ga0068868_100017842 3300005338 Bacteria 5294
28 Ga0070660_100001596 3300005339 Bacteria 15568
29 Ga0070660_100012544 3300005339 Bacteria 6054
30 Ga0070660_100154606 3300005339 Bacteria 1846
31 Ga0070660_100187241 3300005339 Bacteria 1676
32 Ga0070660_100203887 3300005339 Bacteria 1605
33 Ga0070689_100051517 3300005340 Bacteria 3182
34 Ga0070689_100054341 3300005340 Bacteria 3100
35 Ga0070689_100072706 3300005340 Bacteria 2688
36 Ga0070689_100072843 3300005340 Bacteria 2685
37 Ga0070689_100636335 3300005340 Bacteria 927
38 Ga0070689_100775201 3300005340 Bacteria 842
39 Ga0070687_100000651 3300005343 Bacteria 11519
40 Ga0070661_100012203 3300005344 Bacteria 6007
41 Ga0070661_100026608 3300005344 Bacteria 4161
42 Ga0070661_100133466 3300005344 Bacteria 1866
43 Ga0070661_100327957 3300005344 Bacteria 1197
44 Ga0070661_100447708 3300005344 Bacteria 1027
45 Ga0070668_100135892 3300005347 Bacteria 1977
46 Ga0070668_100362925 3300005347 Bacteria 1229
47 Ga0070669_100145047 3300005353 Bacteria 1833
48 Ga0070669_100455798 3300005353 Bacteria 1055
49 Ga0070669_100648620 3300005353 Bacteria 888
50 Ga0070675_100045786 3300005354 Bacteria 3580
51 Ga0070675_100357881 3300005354 Bacteria 1295
52 Ga0070675_100583733 3300005354 Bacteria 1013
53 Ga0070671_100006150 3300005355 Bacteria 9559
54 Ga0070671_100006644 3300005355 Bacteria 9247
55 Ga0070671_100019015 3300005355 Bacteria 5587
56 Ga0070671_100053667 3300005355 Bacteria 3351
57 Ga0070671_100151005 3300005355 Bacteria 1962
58 Ga0070674_100011744 3300005356 Bacteria 5344
59 Ga0070674_100048468 3300005356 Bacteria 2916
60 Ga0070674_100073361 3300005356 Bacteria 2426
61 Ga0070673_100005472 3300005364 Bacteria 8129
62 Ga0070673_100034218 3300005364 Bacteria 3842
63 Ga0070673_100147415 3300005364 Bacteria 1990
64 Ga0070673_101213387 3300005364 Bacteria 707
65 Ga0070688_100003838 3300005365 Bacteria 7792
66 Ga0070688_100040814 3300005365 Bacteria 2845
67 Ga0070688_100060496 3300005365 Bacteria 2392
68 Ga0070659_100004346 3300005366 Bacteria 10114
69 Ga0070659_100103715 3300005366 Bacteria 2291
70 Ga0070659_100253681 3300005366 Bacteria 1458
71 Ga0070659_100441516 3300005366 Bacteria 1103
72 Ga0070659_100604003 3300005366 Bacteria 943
73 Ga0070667_100006803 3300005367 Bacteria 9498
74 Ga0070667_100014101 3300005367 Bacteria 6604
75 Ga0070667_100220929 3300005367 Bacteria 1686
76 Ga0070667_100315983 3300005367 Bacteria 1409
77 Ga0070667_100379827 3300005367 Bacteria 1283
78 Ga0070667_100542108 3300005367 Bacteria 1069
79 Ga0070714_100112087 3300005435 Bacteria 2417
80 Ga0070714_100387490 3300005435 Bacteria 1319
81 Ga0070713_101010065 3300005436 Bacteria 802
82 Ga0070701_10052318 3300005438 Bacteria 2121
83 Ga0070711_100035525 3300005439 Bacteria 3333
84 Ga0070711_100038432 3300005439 Bacteria 3219
85 Ga0070705_100381098 3300005440 Bacteria 1038
86 Ga0070700_100060070 3300005441 Bacteria 2395
87 Ga0070708_100445673 3300005445 Bacteria 1221
88 Ga0070663_100015534 3300005455 Bacteria 4919
89 Ga0070663_100263224 3300005455 Bacteria 1368
90 Ga0070663_100563559 3300005455 Bacteria 954
91 Ga0070678_100097787 3300005456 Bacteria 2268
92 Ga0070678_100218922 3300005456 Bacteria 1582
93 Ga0070662_100002053 3300005457 Bacteria 12335
94 Ga0070662_100091919 3300005457 Bacteria 2280
95 Ga0070662_100110580 3300005457 Bacteria 2093
96 Ga0070662_100124062 3300005457 Bacteria 1982
97 Ga0070662_100274790 3300005457 Bacteria 1361
98 Ga0070662_100739849 3300005457 Bacteria 833
99 Ga0070662_100760893 3300005457 Bacteria 822
100 Ga0070681_10004156 3300005458 Bacteria 13699
101 Ga0070681_10012342 3300005458 Bacteria 8472
102 Ga0070681_10082436 3300005458 Bacteria 3171
103 Ga0070681_10091185 3300005458 Bacteria 2998
104 Ga0068867_100030511 3300005459 Bacteria 3889
105 Ga0070685_10003942 3300005466 Bacteria 7496
106 Ga0070698_100847963 3300005471 Bacteria 859
107 Ga0070699_100444522 3300005518 Bacteria 1175
108 Ga0070679_100010255 3300005530 Bacteria 8882
109 Ga0070679_100076980 3300005530 Bacteria 3324
110 Ga0070679_100137701 3300005530 Bacteria 2422
111 Ga0070679_100403330 3300005530 Bacteria 1313
112 Ga0070679_100515271 3300005530 Bacteria 1140
113 Ga0070684_100096416 3300005535 Bacteria 2636
114 Ga0070684_100475154 3300005535 Bacteria 1157
115 Ga0068853_100001120 3300005539 Bacteria 18964
116 Ga0068853_100010459 3300005539 Bacteria 7510
117 Ga0068853_100115026 3300005539 Bacteria 2393
118 Ga0068853_100115890 3300005539 Bacteria 2385
119 Ga0068853_100153069 3300005539 Bacteria 2077
120 Ga0068853_100158870 3300005539 Bacteria 2038
121 Ga0068853_100219835 3300005539 Bacteria 1735
122 Ga0068853_100302828 3300005539 Bacteria 1478
123 Ga0070672_100153303 3300005543 Bacteria 1907
124 Ga0070672_100256829 3300005543 Bacteria 1473
125 Ga0070686_100005413 3300005544 Bacteria 7070
126 Ga0070686_100116042 3300005544 Bacteria 1832
127 Ga0070686_100197760 3300005544 Bacteria 1439
128 Ga0070686_100445865 3300005544 Bacteria 994
129 Ga0070695_100005458 3300005545 Bacteria 7482
130 Ga0070695_100140405 3300005545 Bacteria 1675
131 Ga0070696_100043974 3300005546 Bacteria 3092
132 Ga0070696_100430025 3300005546 Bacteria 1038
133 Ga0070693_100082656 3300005547 Bacteria 1918
134 Ga0070665_100159096 3300005548 Bacteria 2260
135 Ga0070665_100349553 3300005548 Bacteria 1484
136 Ga0070704_100106130 3300005549 Bacteria 2128
137 Ga0070704_100120698 3300005549 Bacteria 2013
138 Ga0070704_100148959 3300005549 Bacteria 1837
139 Ga0070704_100485195 3300005549 Bacteria 1070
140 Ga0070704_101182971 3300005549 Bacteria 697
141 Ga0068855_100062365 3300005563 Bacteria 4352
142 Ga0068855_100135698 3300005563 Bacteria 2808
143 Ga0068855_100202226 3300005563 Bacteria 2236
144 Ga0068855_100271286 3300005563 Bacteria 1886
145 Ga0070664_100003030 3300005564 Bacteria 13583
146 Ga0070664_100003245 3300005564 Bacteria 13138
147 Ga0070664_100029345 3300005564 Bacteria 4586
148 Ga0070664_100112874 3300005564 Bacteria 2374
149 Ga0068857_100122892 3300005577 Bacteria 2339
150 Ga0068857_100226885 3300005577 Bacteria 1707
151 Ga0068857_100274643 3300005577 Bacteria 1549
152 Ga0068857_100333353 3300005577 Bacteria 1403
153 Ga0068857_100669314 3300005577 Bacteria 985
154 Ga0068854_100007527 3300005578 Bacteria 6960
155 Ga0068854_100474538 3300005578 Bacteria 1049
156 Ga0068854_100595590 3300005578 Bacteria 943
157 Ga0068854_100725891 3300005578 Bacteria 860
158 Ga0068856_100002582 3300005614 Bacteria 18651
159 Ga0068856_100091866 3300005614 Bacteria 3020
160 Ga0068856_100529572 3300005614 Bacteria 1199
161 Ga0068856_100590493 3300005614 Bacteria 1132
162 Ga0070702_100089235 3300005615 Bacteria 1866
163 Ga0068852_100012732 3300005616 Bacteria 6403
164 Ga0068852_100376593 3300005616 Bacteria 1392
165 Ga0068852_100377720 3300005616 Bacteria 1389
166 Ga0068852_100474068 3300005616 Bacteria 1243
167 Ga0068852_100505728 3300005616 Bacteria 1204
168 Ga0068852_100527839 3300005616 Bacteria 1178
169 Ga0068859_100041148 3300005617 Bacteria 4642
170 Ga0068859_100061003 3300005617 Bacteria 3800
171 Ga0068859_100456926 3300005617 Bacteria 1373
172 Ga0068864_100342635 3300005618 Bacteria 1409
173 Ga0068866_10131091 3300005718 Bacteria 1426
174 Ga0068861_100180074 3300005719 Bacteria 1759
175 Ga0068870_10017187 3300005840 Bacteria 3472
176 Ga0068863_100013225 3300005841 Bacteria 7960
177 Ga0068858_100001220 3300005842 Bacteria 26659
178 Ga0068858_100070910 3300005842 Bacteria 3230
179 Ga0068858_100072857 3300005842 Bacteria 3188
180 Ga0068858_100090683 3300005842 Bacteria 2845
181 Ga0068858_100100260 3300005842 Bacteria 2701
182 Ga0068858_100437848 3300005842 Bacteria 1259
183 Ga0068860_100077456 3300005843 Bacteria 3162
184 Ga0068860_100079166 3300005843 Bacteria 3125
185 Ga0068860_100091007 3300005843 Bacteria 2906
186 Ga0068860_100172293 3300005843 Bacteria 2091
187 Ga0068860_100204438 3300005843 Bacteria 1915
188 Ga0068862_100001900 3300005844 Bacteria 18964
189 Ga0068862_100002109 3300005844 Bacteria 17924
190 Ga0068862_100228872 3300005844 Bacteria 1686
191 Ga0081455_10032634 3300005937 Bacteria 4690
192 Ga0081455_10046241 3300005937 Bacteria 3778
193 Ga0081455_10351898 3300005937 Bacteria 1039
194 Ga0081538_10071824 3300005981 Bacteria 1901
195 Ga0070717_10036746 3300006028 Bacteria 3974
196 Ga0070717_10073587 3300006028 Bacteria 2856
197 Ga0070717_10460708 3300006028 Bacteria 1146
198 Ga0075365_10028316 3300006038 Bacteria 3573
199 Ga0075365_10261733 3300006038 Bacteria 1216
200 Ga0075368_10000154 3300006042 Bacteria 18483
201 Ga0075368_10141865 3300006042 Bacteria 1001
202 Ga0075363_100009861 3300006048 Bacteria 4506
203 Ga0075363_100031864 3300006048 Bacteria 2735
204 Ga0075363_100083791 3300006048 Bacteria 1747
205 Ga0075364_10010820 3300006051 Bacteria 5523
206 Ga0075364_10206662 3300006051 Bacteria 1331
207 Ga0075364_10513097 3300006051 Bacteria 819
208 Ga0070712_100073308 3300006175 Bacteria 2455
209 Ga0070712_100623008 3300006175 Bacteria 915
210 Ga0075362_10001229 3300006177 Bacteria 8066
211 Ga0075362_10283668 3300006177 Bacteria 819
212 Ga0075367_10018545 3300006178 Bacteria 3843
213 Ga0075367_10371473 3300006178 Bacteria 903
214 Ga0075369_10013093 3300006186 Bacteria 3285
215 Ga0075366_10004924 3300006195 Bacteria 7204
216 Ga0075366_10041243 3300006195 Bacteria 2733
217 Ga0075366_10046259 3300006195 Bacteria 2578
218 Ga0075366_10337864 3300006195 Bacteria 923
219 Ga0097621_100165643 3300006237 Bacteria 1903
220 Ga0075370_10047926 3300006353 Bacteria 2420
221 Ga0075370_10097232 3300006353 Bacteria 1702
222 Ga0075370_10283848 3300006353 Bacteria 983
223 Ga0068871_100216729 3300006358 Bacteria 1657
224 Ga0068871_100400195 3300006358 Bacteria 1223
225 Ga0068871_100528608 3300006358 Bacteria 1066
226 Ga0068871_100647239 3300006358 Bacteria 965
227 Ga0068871_101179939 3300006358 Bacteria 718
228 Ga0075428_100000606 3300006844 Bacteria 36554
229 Ga0075428_100001030 3300006844 Bacteria 29513
230 Ga0075428_100016563 3300006844 Bacteria 8138
231 Ga0075428_100053354 3300006844 Bacteria 4429
232 Ga0075428_100079887 3300006844 Bacteria 3569
233 Ga0075428_101017656 3300006844 Bacteria 877
234 Ga0075430_100002000 3300006846 Bacteria 16792
235 Ga0075430_100157001 3300006846 Bacteria 1894
236 Ga0075430_100343936 3300006846 Bacteria 1232
237 Ga0075430_100354083 3300006846 Bacteria 1212
238 Ga0075431_100000032 3300006847 Bacteria 72293
239 Ga0075431_100007296 3300006847 Bacteria 11010
240 Ga0075431_100010360 3300006847 Bacteria 9367
241 Ga0075431_100118643 3300006847 Bacteria 2730
242 Ga0075431_100630812 3300006847 Bacteria 1053
243 Ga0075433_10130756 3300006852 Bacteria 2230
244 Ga0075434_100069291 3300006871 Bacteria 3517
245 Ga0075429_100009118 3300006880 Bacteria 8612
246 Ga0075429_100059469 3300006880 Bacteria 3329
247 Ga0075429_100083653 3300006880 Bacteria 2782
248 Ga0068865_100065024 3300006881 Bacteria 2569
249 Ga0068865_100102026 3300006881 Bacteria 2102
250 Ga0075436_100039986 3300006914 Bacteria 3235
251 Ga0075436_100177303 3300006914 Bacteria 1506
252 Ga0097620_100041150 3300006931 Bacteria 4642
253 Ga0097620_100061002 3300006931 Bacteria 3800
254 Ga0097620_100456949 3300006931 Bacteria 1373
255 Ga0075435_100069623 3300007076 Bacteria 2870
256 Ga0075435_100696545 3300007076 Bacteria 883
257 Ga0099795_10033761 3300007788 Bacteria 1779
258 Ga0105240_10319701 3300009093 Bacteria 1770
259 Ga0111539_10001089 3300009094 Bacteria 35899
260 Ga0111539_10132368 3300009094 Bacteria 2920
261 Ga0111539_10532037 3300009094 Bacteria 1369
262 Ga0105245_10097484 3300009098 Bacteria 2715
263 Ga0114129_10000062 3300009147 Bacteria 96507
264 Ga0114129_10070132 3300009147 Bacteria 4886
265 Ga0114129_10481588 3300009147 Bacteria 1623
266 Ga0114129_10489248 3300009147 Bacteria 1608
267 Ga0105243_10685993 3300009148 Bacteria 997
268 Ga0105241_10358619 3300009174 Bacteria 1268
269 Ga0105242_10102160 3300009176 Bacteria 2431
270 Ga0105242_10127241 3300009176 Bacteria 2194
271 Ga0105242_10373575 3300009176 Bacteria 1323
272 Ga0105248_10000575 3300009177 Bacteria 41822
273 Ga0105248_10032460 3300009177 Bacteria 5836
274 Ga0105248_10052459 3300009177 Bacteria 4577
275 Ga0105248_11304190 3300009177 Bacteria 821
276 Ga0105238_10445675 3300009551 Bacteria 1291
277 Ga0105249_10004484 3300009553 Bacteria 12070
278 Ga0105249_10126386 3300009553 Bacteria 2435
279 Ga0105249_10443846 3300009553 Bacteria 1335
280 Ga0099796_10026974 3300010159 Bacteria 1830
281 Ga0105239_10160754 3300010375 Bacteria 2509
282 Ga0105246_10214319 3300011119 Bacteria 1505
283 Ga0157373_10034223 3300013100 Bacteria 3649
284 Ga0157371_10002512 3300013102 Bacteria 17426
285 Ga0157371_10040000 3300013102 Bacteria 3351
286 Ga0157371_10083091 3300013102 Bacteria 2268
287 Ga0157371_10182576 3300013102 Bacteria 1501
288 Ga0157370_10103179 3300013104 Bacteria 2670
289 Ga0157370_10228130 3300013104 Bacteria 1724
290 Ga0157370_10327032 3300013104 Bacteria 1414
291 Ga0157369_10038667 3300013105 Bacteria 5217
292 Ga0157369_10415943 3300013105 Bacteria 1394
293 Ga0157378_10712262 3300013297 Bacteria 1024
294 Ga0163162_10015418 3300013306 Bacteria 7466
295 Ga0157372_10005708 3300013307 Bacteria 13246
296 Ga0157372_10062690 3300013307 Bacteria 4166
297 Ga0157372_10203158 3300013307 Bacteria 2296
298 Ga0157372_10302849 3300013307 Bacteria 1859
299 Ga0157372_10743667 3300013307 Bacteria 1140
300 Ga0157375_10010448 3300013308 Bacteria 8168
301 Ga0157375_10153878 3300013308 Bacteria 2437
302 Ga0157375_10287312 3300013308 Bacteria 1808
303 Ga0157375_10620111 3300013308 Bacteria 1240
304 Ga0157375_11793722 3300013308 Bacteria 727
305 Ga0163163_10019652 3300014325 Bacteria 6346
306 Ga0163163_10104340 3300014325 Bacteria 2860
307 Ga0163163_10142267 3300014325 Bacteria 2441
308 Ga0163163_10608301 3300014325 Bacteria 1156
309 Ga0163163_10612577 3300014325 Bacteria 1152
310 Ga0163163_10974549 3300014325 Bacteria 911
311 Ga0157380_10093638 3300014326 Bacteria 2484
312 Ga0157380_10192704 3300014326 Bacteria 1801
313 Ga0157380_11475569 3300014326 Unclassified 732
314 Ga0157377_10003094 3300014745 Bacteria 7476
315 Ga0157379_10025431 3300014968 Bacteria 5259
316 Ga0157379_10370252 3300014968 Bacteria 1314
317 Ga0157379_10573192 3300014968 Bacteria 1052
318 Ga0157376_10231232 3300014969 Bacteria 1718
319 Ga0163161_10036976 3300017792 Bacteria 3499
320 Ga0163161_10165871 3300017792 Bacteria 1686
321 Ga0213876_10077378 3300021384 Bacteria 1757
322 Ga0213876_10237236 3300021384 Bacteria 969
323 Ga0213875_10082656 3300021388 Bacteria 1499
324 Ga0213875_10112131 3300021388 Bacteria 1274
325 Ga0224571_108629 3300022734 Bacteria 694
326 Ga0207673_1012565 3300025290 Bacteria 1105
327 Ga0209758_1000686 3300025297 Bacteria 50478
328 Ga0209758_1091124 3300025297 Bacteria 892
329 Ga0207697_10000027 3300025315 Bacteria 51720
330 Ga0207697_10084005 3300025315 Bacteria 1344
331 Ga0207682_10000609 3300025893 Bacteria 16628
332 Ga0207682_10161214 3300025893 Bacteria 1016
333 Ga0207642_10205557 3300025899 Bacteria 1091
334 Ga0207688_10000041 3300025901 Bacteria 44495
335 Ga0207680_10000656 3300025903 Bacteria 16342
336 Ga0207680_10224303 3300025903 Bacteria 1289
337 Ga0207680_10269620 3300025903 Bacteria 1180
338 Ga0207647_10001581 3300025904 Bacteria 17475
339 Ga0207645_10005539 3300025907 Bacteria 9140
340 Ga0207645_10019866 3300025907 Bacteria 4399
341 Ga0207645_10088321 3300025907 Bacteria 1993
342 Ga0207643_10001947 3300025908 Bacteria 11417
343 Ga0207705_10001911 3300025909 Bacteria 16282
344 Ga0207705_10418290 3300025909 Bacteria 1037
345 Ga0207705_10757681 3300025909 Bacteria 754
346 Ga0207654_10563484 3300025911 Bacteria 810
347 Ga0207707_10011717 3300025912 Bacteria 7630
348 Ga0207707_10050953 3300025912 Bacteria 3605
349 Ga0207707_10198634 3300025912 Bacteria 1749
350 Ga0207695_10200398 3300025913 Bacteria 1910
351 Ga0207671_10062172 3300025914 Bacteria 2772
352 Ga0207693_10339422 3300025915 Bacteria 1176
353 Ga0207693_10755157 3300025915 Bacteria 751
354 Ga0207663_10883540 3300025916 Bacteria 714
355 Ga0207660_11083128 3300025917 Bacteria 653
356 Ga0207662_10253307 3300025918 Bacteria 1156
357 Ga0207657_10000513 3300025919 Bacteria 41016
358 Ga0207657_10005300 3300025919 Bacteria 13511
359 Ga0207657_10073837 3300025919 Bacteria 2881
360 Ga0207657_10122173 3300025919 Bacteria 2142
361 Ga0207657_10186478 3300025919 Bacteria 1675
362 Ga0207649_10003140 3300025920 Bacteria 9063
363 Ga0207649_10013372 3300025920 Bacteria 4581
364 Ga0207649_10081466 3300025920 Bacteria 2096
365 Ga0207649_10095587 3300025920 Bacteria 1955
366 Ga0207649_10121030 3300025920 Bacteria 1764
367 Ga0207652_10014456 3300025921 Bacteria 6395
368 Ga0207652_10018941 3300025921 Bacteria 5651
369 Ga0207652_10031974 3300025921 Bacteria 4420
370 Ga0207652_10040820 3300025921 Bacteria 3942
371 Ga0207652_10056340 3300025921 Bacteria 3384
372 Ga0207652_10089135 3300025921 Bacteria 2708
373 Ga0207652_10146388 3300025921 Bacteria 2114
374 Ga0207652_10310698 3300025921 Bacteria 1423
375 Ga0207681_10079414 3300025923 Bacteria 2311
376 Ga0207681_10270397 3300025923 Bacteria 1334
377 Ga0207681_10516260 3300025923 Bacteria 980
378 Ga0207650_10007967 3300025925 Bacteria 7222
379 Ga0207650_10035373 3300025925 Bacteria 3626
380 Ga0207659_10011179 3300025926 Bacteria 5663
381 Ga0207659_10032556 3300025926 Bacteria 3580
382 Ga0207659_10300793 3300025926 Bacteria 1318
383 Ga0207687_10046755 3300025927 Bacteria 2997
384 Ga0207687_10408401 3300025927 Bacteria 1118
385 Ga0207700_10215050 3300025928 Bacteria 1627
386 Ga0207700_10302608 3300025928 Bacteria 1381
387 Ga0207700_10601631 3300025928 Bacteria 978
388 Ga0207664_10064285 3300025929 Bacteria 2934
389 Ga0207664_10085719 3300025929 Bacteria 2572
390 Ga0207644_10005027 3300025931 Bacteria 8634
391 Ga0207644_10019791 3300025931 Bacteria 4569
392 Ga0207644_10030690 3300025931 Bacteria 3740
393 Ga0207644_10087128 3300025931 Bacteria 2320
394 Ga0207644_10609447 3300025931 Bacteria 907
395 Ga0207690_10001108 3300025932 Bacteria 17166
396 Ga0207690_10260573 3300025932 Bacteria 1343
397 Ga0207706_10003288 3300025933 Bacteria 15471
398 Ga0207706_10005146 3300025933 Bacteria 12209
399 Ga0207706_10027521 3300025933 Bacteria 5083
400 Ga0207706_10027851 3300025933 Bacteria 5051
401 Ga0207706_10200301 3300025933 Bacteria 1751
402 Ga0207706_10353698 3300025933 Bacteria 1277
403 Ga0207706_10372932 3300025933 Bacteria 1239
404 Ga0207709_10936548 3300025935 Bacteria 705
405 Ga0207670_10010868 3300025936 Bacteria 5255
406 Ga0207670_10020783 3300025936 Bacteria 4039
407 Ga0207670_10052483 3300025936 Bacteria 2742
408 Ga0207670_10562344 3300025936 Bacteria 933
409 Ga0207669_10012258 3300025937 Bacteria 4210
410 Ga0207669_10048958 3300025937 Bacteria 2515
411 Ga0207704_10241588 3300025938 Bacteria 1350
412 Ga0207704_10351094 3300025938 Bacteria 1148
413 Ga0207704_10441272 3300025938 Bacteria 1037
414 Ga0207691_10000239 3300025940 Bacteria 53779
415 Ga0207691_10143694 3300025940 Bacteria 2101
416 Ga0207691_10354339 3300025940 Bacteria 1255
417 Ga0207711_10000496 3300025941 Bacteria 40666
418 Ga0207711_10037389 3300025941 Bacteria 4123
419 Ga0207711_10076367 3300025941 Bacteria 2917
420 Ga0207711_10463542 3300025941 Bacteria 1180
421 Ga0207661_10040299 3300025944 Bacteria 3671
422 Ga0207661_10123832 3300025944 Bacteria 2205
423 Ga0207679_10047857 3300025945 Bacteria 3110
424 Ga0207679_10111886 3300025945 Bacteria 2157
425 Ga0207679_10126589 3300025945 Bacteria 2042
426 Ga0207667_10000830 3300025949 Bacteria 39956
427 Ga0207667_10157268 3300025949 Bacteria 2338
428 Ga0207667_10313294 3300025949 Bacteria 1603
429 Ga0207667_10342927 3300025949 Bacteria 1524
430 Ga0207651_10009173 3300025960 Bacteria 5393
431 Ga0207651_10016951 3300025960 Bacteria 4288
432 Ga0207651_10143589 3300025960 Bacteria 1847
433 Ga0207651_10154311 3300025960 Bacteria 1792
434 Ga0207651_10273299 3300025960 Bacteria 1393
435 Ga0207712_10067376 3300025961 Bacteria 2562
436 Ga0207712_10337608 3300025961 Bacteria 1248
437 Ga0207668_10479853 3300025972 Bacteria 1066
438 Ga0207640_10025713 3300025981 Bacteria 3566
439 Ga0207640_10150608 3300025981 Bacteria 1709
440 Ga0207640_10362520 3300025981 Bacteria 1168
441 Ga0207658_10001593 3300025986 Bacteria 17501
442 Ga0207658_10121760 3300025986 Bacteria 2081
443 Ga0207658_10207128 3300025986 Bacteria 1641
444 Ga0207658_10334820 3300025986 Bacteria 1314
445 Ga0207677_10013370 3300026023 Bacteria 4754
446 Ga0207677_10228577 3300026023 Bacteria 1497
447 Ga0207677_11204544 3300026023 Bacteria 693
448 Ga0207703_10007178 3300026035 Bacteria 8863
449 Ga0207703_10063936 3300026035 Bacteria 3019
450 Ga0207703_10317598 3300026035 Bacteria 1425
451 Ga0207703_10613828 3300026035 Bacteria 1029
452 Ga0207703_10629957 3300026035 Bacteria 1016
453 Ga0207639_10002312 3300026041 Bacteria 12791
454 Ga0207639_10003125 3300026041 Bacteria 11132
455 Ga0207639_10078769 3300026041 Bacteria 2602
456 Ga0207639_10164295 3300026041 Bacteria 1874
457 Ga0207639_10284533 3300026041 Bacteria 1455
458 Ga0207639_10373307 3300026041 Bacteria 1279
459 Ga0207639_10390804 3300026041 Bacteria 1251
460 Ga0207639_10438603 3300026041 Bacteria 1184
461 Ga0207678_10002308 3300026067 Bacteria 17274
462 Ga0207678_10002924 3300026067 Bacteria 15492
463 Ga0207678_10056684 3300026067 Bacteria 3373
464 Ga0207678_10089385 3300026067 Bacteria 2633
465 Ga0207678_10197273 3300026067 Bacteria 1720
466 Ga0207708_10115310 3300026075 Bacteria 2089
467 Ga0207702_10013261 3300026078 Bacteria 6855
468 Ga0207702_10041290 3300026078 Bacteria 3868
469 Ga0207702_10484184 3300026078 Bacteria 1204
470 Ga0207702_10678788 3300026078 Bacteria 1014
471 Ga0207702_10964517 3300026078 Bacteria 845
472 Ga0207641_10025781 3300026088 Bacteria 4848
473 Ga0207641_10472548 3300026088 Bacteria 1214
474 Ga0207648_10240821 3300026089 Bacteria 1611
475 Ga0207648_10260403 3300026089 Bacteria 1548
476 Ga0207676_10008206 3300026095 Bacteria 7431
477 Ga0207676_10327860 3300026095 Bacteria 1408
478 Ga0207676_10507784 3300026095 Bacteria 1146
479 Ga0207674_10051394 3300026116 Bacteria 4206
480 Ga0207674_10062738 3300026116 Bacteria 3753
481 Ga0207674_10097083 3300026116 Bacteria 2931
482 Ga0207674_10102592 3300026116 Bacteria 2840
483 Ga0207674_10221047 3300026116 Bacteria 1842
484 Ga0207674_10339414 3300026116 Bacteria 1453
485 Ga0207674_10736496 3300026116 Bacteria 951
486 Ga0207675_100001494 3300026118 Bacteria 23427
487 Ga0207675_100226409 3300026118 Bacteria 1803
488 Ga0207675_100589291 3300026118 Bacteria 1114
489 Ga0207683_10010289 3300026121 Bacteria 7975
490 Ga0207683_10176941 3300026121 Bacteria 1934
491 Ga0207683_10195506 3300026121 Bacteria 1838
492 Ga0207683_10364409 3300026121 Bacteria 1327
493 Ga0207698_10008889 3300026142 Bacteria 6370
494 Ga0207698_10065836 3300026142 Bacteria 2849
495 Ga0207698_10066133 3300026142 Bacteria 2844
496 Ga0207698_10198640 3300026142 Bacteria 1794
497 Ga0207698_10237607 3300026142 Bacteria 1658
498 Ga0207698_10318967 3300026142 Bacteria 1454
499 Ga0207698_10490101 3300026142 Bacteria 1194
500 Ga0207698_10493751 3300026142 Bacteria 1190
501 Ga0209813_10000547 3300027866 Bacteria 8878
502 Ga0209813_10157933 3300027866 Bacteria 816
503 Ga0207428_10007154 3300027907 Bacteria 10211
504 Ga0207428_10021909 3300027907 Bacteria 5402
505 Ga0207428_10074450 3300027907 Bacteria 2663
506 Ga0207428_10178470 3300027907 Bacteria 1605
507 Ga0268266_10146424 3300028379 Bacteria 2124
508 Ga0268266_10170393 3300028379 Bacteria 1976
509 Ga0268266_10349811 3300028379 Bacteria 1389
510 Ga0268266_10416577 3300028379 Bacteria 1272
511 Ga0268266_10577781 3300028379 Bacteria 1078
512 Ga0268266_10665643 3300028379 Bacteria 1002
513 Ga0268265_10043211 3300028380 Bacteria 3348
514 Ga0268265_10115732 3300028380 Bacteria 2198
515 Ga0268265_10696602 3300028380 Bacteria 981
516 Ga0268264_10061890 3300028381 Bacteria 3141
517 Ga0268264_10108010 3300028381 Bacteria 2432
518 Ga0268264_10133677 3300028381 Bacteria 2203
519 Ga0268264_10295560 3300028381 Bacteria 1523
520 Ga0268264_10295926 3300028381 Bacteria 1522
521 Ga0265319_1073507 3300028563 Bacteria 1093
522 Ga0265338_10033601 3300028800 Bacteria 4973
523 Ga0265338_10042698 3300028800 Bacteria 4218
524 Ga0265762_1017404 3300030760 Bacteria 1308
525 Ga0265330_10030456 3300031235 Bacteria 2422
526 Ga0265332_10005043 3300031238 Bacteria 6134
527 Ga0265328_10000218 3300031239 Bacteria 26093
528 Ga0265320_10032708 3300031240 Bacteria 2659
529 Ga0265325_10019219 3300031241 Bacteria 3781
530 Ga0265325_10042711 3300031241 Bacteria 2368
531 Ga0265325_10171119 3300031241 Bacteria 1016
532 Ga0265329_10035507 3300031242 Bacteria 1608
533 Ga0265340_10000340 3300031247 Bacteria 24801
534 Ga0265340_10009655 3300031247 Bacteria 5172
535 Ga0265340_10095194 3300031247 Bacteria 1388
536 Ga0265339_10000068 3300031249 Bacteria 91555
537 Ga0265339_10010303 3300031249 Bacteria 5814
538 Ga0265339_10075963 3300031249 Bacteria 1782
539 Ga0265339_10179057 3300031249 Bacteria 1057
540 Ga0265331_10051981 3300031250 Bacteria 1959
541 Ga0265327_10034092 3300031251 Bacteria 2829
542 Ga0265316_10058920 3300031344 Bacteria 2989
543 Ga0265316_10170628 3300031344 Bacteria 1623
544 Ga0265316_10175947 3300031344 Bacteria 1595
545 Ga0307408_100029248 3300031548 Bacteria 3815
546 Ga0307408_100472629 3300031548 Bacteria 1092
547 Ga0265313_10000088 3300031595 Bacteria 90711
548 Ga0265313_10149566 3300031595 Bacteria 999
549 Ga0316575_10149388 3300031665 Bacteria 963
550 Ga0316579_10011489 3300031691 Bacteria 3765
551 Ga0316579_10054739 3300031691 Bacteria 1870
552 Ga0265314_10131320 3300031711 Bacteria 1562
553 Ga0265342_10000399 3300031712 Bacteria 48089
554 Ga0265342_10037926 3300031712 Bacteria 2937
555 Ga0265342_10175893 3300031712 Bacteria 1175
556 Ga0265342_10210893 3300031712 Bacteria 1050
557 Ga0316576_10176805 3300031727 Bacteria 1610
558 Ga0316578_10010373 3300031728 Bacteria 4834
559 Ga0307405_10018732 3300031731 Bacteria 3826
560 Ga0307405_10142639 3300031731 Bacteria 1673
561 Ga0307405_10171755 3300031731 Bacteria 1547
562 Ga0307405_10321717 3300031731 Bacteria 1182
563 Ga0316577_10133267 3300031733 Bacteria 1398
564 Ga0307413_10107199 3300031824 Bacteria 1861
565 Ga0307413_10226125 3300031824 Bacteria 1370
566 Ga0307413_10400380 3300031824 Bacteria 1075
567 Ga0307413_10793371 3300031824 Bacteria 795
568 Ga0307413_10917521 3300031824 Bacteria 745
569 Ga0307410_10055411 3300031852 Bacteria 2691
570 Ga0307410_10090494 3300031852 Bacteria 2170
571 Ga0307410_10274786 3300031852 Bacteria 1319
572 Ga0307410_10311193 3300031852 Bacteria 1246
573 Ga0307410_10481007 3300031852 Bacteria 1018
574 Ga0307406_10061938 3300031901 Bacteria 2418
575 Ga0307406_10147840 3300031901 Bacteria 1672
576 Ga0307407_10054381 3300031903 Bacteria 2308
577 Ga0307407_10074741 3300031903 Bacteria 2029
578 Ga0307407_10097345 3300031903 Bacteria 1818
579 Ga0307407_10823589 3300031903 Bacteria 707
580 Ga0307412_10040409 3300031911 Bacteria 3017
581 Ga0307412_10082451 3300031911 Bacteria 2227
582 Ga0307412_10089144 3300031911 Bacteria 2153
583 Ga0307412_10117114 3300031911 Bacteria 1912
584 Ga0307412_10272515 3300031911 Bacteria 1325
585 Ga0307412_10949367 3300031911 Bacteria 757
586 Ga0307409_100010901 3300031995 Bacteria 5691
587 Ga0307409_100022096 3300031995 Bacteria 4378
588 Ga0307409_100032427 3300031995 Bacteria 3787
589 Ga0307409_100067493 3300031995 Bacteria 2824
590 Ga0307409_100098856 3300031995 Bacteria 2414
591 Ga0307409_100861316 3300031995 Bacteria 917
592 Ga0307409_101089900 3300031995 Bacteria 819
593 Ga0307416_100002549 3300032002 Bacteria 10500
594 Ga0307416_100005333 3300032002 Bacteria 7882
595 Ga0307416_100073036 3300032002 Bacteria 2858
596 Ga0307416_100251862 3300032002 Bacteria 1719
597 Ga0307416_101587989 3300032002 Bacteria 759
598 Ga0307414_10001040 3300032004 Bacteria 14198
599 Ga0307414_10006477 3300032004 Bacteria 6528
600 Ga0307414_10167357 3300032004 Bacteria 1753
601 Ga0307414_10406893 3300032004 Bacteria 1183
602 Ga0307411_10003258 3300032005 Bacteria 7488
603 Ga0307411_10006084 3300032005 Bacteria 6000
604 Ga0307411_10006109 3300032005 Bacteria 5991
605 Ga0307411_10010035 3300032005 Bacteria 5021
606 Ga0307411_10054586 3300032005 Bacteria 2624
607 Ga0307411_10063642 3300032005 Bacteria 2466
608 Ga0307411_10205136 3300032005 Bacteria 1517
609 Ga0307411_10224671 3300032005 Bacteria 1459
610 Ga0307411_10239453 3300032005 Bacteria 1419
611 Ga0307411_10359858 3300032005 Bacteria 1189
612 Ga0307411_10480067 3300032005 Bacteria 1046
613 Ga0307415_100004677 3300032126 Bacteria 7158
614 Ga0307415_100013659 3300032126 Bacteria 4747
615 Ga0307415_100031432 3300032126 Bacteria 3420
616 Ga0307415_100134743 3300032126 Bacteria 1876
617 Ga0307415_100161715 3300032126 Bacteria 1736
618 Ga0307415_100498059 3300032126 Bacteria 1064
619 Ga0307415_100685954 3300032126 Bacteria 922
620 Ga0307415_100737304 3300032126 Bacteria 893
621 Ga0316583_10011289 3300032133 Bacteria 3217
622 Ga0316585_10010049 3300032137 Bacteria 2772
623 Ga0316580_10014622 3300032139 Bacteria 2396
624 Ga0316593_10011756 3300032168 Bacteria 2554
625 Ga0316587_1046730 3300033529 Bacteria 788
626 Ga0316596_1004566 3300033541 Bacteria 3116
627 Ga0373958_0041941 3300034819 Bacteria 938
628 Ga0373959_0121812 3300034820 Bacteria 638
629 Ga0373938_0014004 3300034957 Bacteria 1532
630 Ga0373929_0003939 3300035085 Bacteria 2660
631 Ga0373929_0090681 3300035085 Bacteria 758
632 Ga0373934_0006122 3300035086 Bacteria 4457
633 Ga0373940_0016660 3300035088 Bacteria 1823
634 Ga0373923_0084639 3300035111 Bacteria 1380
635 Ga0373932_0021648 3300035112 Bacteria 1699
636 Ga0373932_0063858 3300035112 Bacteria 1126
637 Ga0373936_0005177 3300035113 Bacteria 4907
638 Ga0373936_0135158 3300035113 Bacteria 1062
639 Ga0373939_0047421 3300035114 Bacteria 1319
640 Ga0373939_0152677 3300035114 Bacteria 842
641 Ga0373941_0000346 3300035115 Bacteria 9108
642 Ga0373945_0306079 3300035116 Bacteria 681
643 Ga0373953_0025705 3300035117 Bacteria 2251
644 Ga0373953_0047451 3300035117 Bacteria 1728
645 Ga0373953_0213267 3300035117 Bacteria 836
646 Ga0373954_0023234 3300035118 Bacteria 2818
647 Ga0373954_0029189 3300035118 Bacteria 2539
648 Ga0373956_0210857 3300035119 Bacteria 921
649 Ga0373957_0087288 3300035120 Bacteria 1236
650 Ga0373957_0135035 3300035120 Bacteria 1006
651 Ga0373960_0004056 3300035121 Bacteria 3345
652 Ga0373943_0036994 3300035170 Bacteria 2341
653 Ga0373946_0246314 3300035171 Bacteria 870
654 Ga0373955_0003048 3300035172 Bacteria 7338
655 Ga0373955_0008692 3300035172 Bacteria 4726
656 Ga0373942_0010535 3300035207 Bacteria 2177
657 Ga0373961_0006736 3300035241 Bacteria 2763
658 Ga0373962_0035672 3300035242 Bacteria 1382
659 Ga0373962_0112893 3300035242 Bacteria 859
660 Ga0316574_0000467 3300035398 Bacteria 16333
661 Ga0373924_0061428 3300035410 Bacteria 1573
662 Ga0373924_0199458 3300035410 Bacteria 882
663 Ga0373931_0001292 3300035691 Bacteria 10708
664 Ga0373931_0002313 3300035691 Bacteria 8416
665 Ga0373931_0332445 3300035691 Bacteria 947
666 Ga0373935_0007400 3300035692 Bacteria 6571
667 Ga0373935_0146177 3300035692 Bacteria 1601
668 Ga0373927_0035512 3300035695 Bacteria 3241
669 Ga0373927_0049298 3300035695 Bacteria 2723
670 Ga0373927_0062962 3300035695 Bacteria 2399
671 Ga0373933_0005821 3300035724 Bacteria 6707
672 Ga0373933_0009152 3300035724 Bacteria 5406
673 Ga0373933_0622289 3300035724 Bacteria 709
674 Ga0373947_0014629 3300035725 Bacteria 4499
675 Ga0373947_0076796 3300035725 Bacteria 2059
676 Ga0373947_0164580 3300035725 Bacteria 1436
677 Ga0373947_0499461 3300035725 Bacteria 826
678 Ga0373937_0000075 3300036401 Bacteria 89727
679 Ga0373937_0000231 3300036401 Bacteria 54437
680 Ga0373937_0429887 3300036401 Bacteria 1253
681 Ga0373937_0939557 3300036401 Bacteria 813
682 Ga0316582_0040365 3300036647 Bacteria 2912
683 Ga0316582_0263607 3300036647 Bacteria 1181
684 Ga0316582_0315671 3300036647 Bacteria 1074
685 Ga0316584_0091032 3300036712 Bacteria 2283
686 Ga0316584_0174508 3300036712 Bacteria 1593
687 Ga0316584_0431552 3300036712 Bacteria 934
688 Ga0373925_0000081 3300037068 Bacteria 102407
689 Ga0373925_0134123 3300037068 Bacteria 1933
690 Ga0395899_0010276 3300037312 Bacteria 7175
691 Ga0395899_0021002 3300037312 Bacteria 4951
692 Ga0395899_0129909 3300037312 Bacteria 1799
693 Ga0395899_0458681 3300037312 Bacteria 833
694 Ga0395900_0063629 3300037418 Bacteria 3792
695 Ga0395900_0076737 3300037418 Bacteria 3433
696 Ga0395900_0152979 3300037418 Bacteria 2356
697 Ga0395898_0052511 3300037466 Bacteria 3982
698 Ga0395898_0072191 3300037466 Bacteria 3334
699 Ga0395905_0108517 3300037471 Bacteria 2606
700 Ga0395905_0128888 3300037471 Bacteria 2379
701 Ga0395905_0132823 3300037471 Bacteria 2341
702 Ga0395905_0166922 3300037471 Bacteria 2068
703 Ga0395905_0476632 3300037471 Bacteria 1147
704 Ga0316581_0034438 3300037588 Bacteria 1532
705 Ga0316581_0097300 3300037588 Bacteria 906
706 Ga0436364_0721077 3300037853 Bacteria 701
707 Ga0436364_1243640 3300037853 Bacteria 1499
708 Ga0395901_0030541 3300038443 Bacteria 5551
709 Ga0395901_0095901 3300038443 Bacteria 3108
710 Ga0395901_0454161 3300038443 Bacteria 1310
711 Ga0400490_34472 3300038726 Bacteria 6742
712 Ga0400488_04486 3300038741 Bacteria 1967
713 Ga0400488_59215 3300038741 Bacteria 10431
714 Ga0400483_041422 3300039062 Bacteria 4570
715 Ga0400483_184515 3300039062 Bacteria 1084
716 Ga0400483_277636 3300039062 Bacteria 1402
717 Ga0436365_0565920 3300039437 Bacteria 760
718 Ga0436365_1068013 3300039437 Bacteria 638
719 Ga0436365_1655375 3300039437 Bacteria 4942
720 Ga0436365_1751841 3300039437 Bacteria 2819
721 Ga0436361_0689606 3300039447 Bacteria 616
722 Ga0436362_0544081 3300039453 Bacteria 818
723 Ga0436362_1064891 3300039453 Bacteria 747
724 Ga0439453_0006563 3300041408 Bacteria 1816
725 Ga0439453_0012916 3300041408 Bacteria 1413
726 Ga0451807_1298589 3300041486 Bacteria 663
727 Ga0451843_0940280 3300041509 Bacteria 913
728 Ga0439437_014891 3300042000 Bacteria 911
729 Ga0439443_023327 3300042003 Bacteria 987
730 Ga0439445_0004377 3300042004 Bacteria 3201
731 Ga0450910_050728 3300042147 Bacteria 686
732 Ga0439434_0049122 3300042435 Bacteria 1306
733 Ga0439435_0086503 3300042436 Bacteria 947
734 Ga0439459_0118537 3300042438 Bacteria 665
735 Ga0439464_0083940 3300042439 Bacteria 954
736 Ga0439460_0219031 3300042461 Bacteria 652
737 Ga0451577_0213699 3300042876 Bacteria 1743
738 Ga0451577_0298959 3300042876 Bacteria 1459
739 Ga0466969_0091404 3300044656 Bacteria 1442
740 Ga0466972_0146519 3300044658 Bacteria 1111
741 Ga0466972_0273069 3300044658 Bacteria 790
742 Ga0466966_0015054 3300044684 Bacteria 5117
743 Ga0466966_0070826 3300044684 Bacteria 2185
744 Ga0466961_0298972 3300044693 Bacteria 983
745 Ga0466963_0103267 3300044694 Bacteria 1953
746 Ga0466964_0208197 3300044706 Bacteria 943
747 Ga0453684_0042475 3300044712 Bacteria 6128
748 Ga0453684_0166907 3300044712 Bacteria 2598
749 Ga0453684_0741911 3300044712 Bacteria 1064
750 Ga0466968_0053193 3300044735 Bacteria 1734
751 Ga0466970_0024076 3300044765 Bacteria 3183
752 Ga0466970_0285414 3300044765 Bacteria 929
753 Ga0466957_0019054 3300044842 Bacteria 4035
754 Ga0466957_0414682 3300044842 Bacteria 923
755 Ga0466957_0484359 3300044842 Bacteria 856
756 Ga0466960_0054564 3300044901 Bacteria 1941
757 Ga0466959_0048339 3300045049 Bacteria 3126
758 Ga0451576_0005522 3300045051 Bacteria 15795
759 Ga0451576_0103697 3300045051 Bacteria 2958
760 Ga0451576_0168558 3300045051 Bacteria 2285
761 Ga0466967_0039462 3300045976 Bacteria 4059
762 Ga0466967_0087942 3300045976 Bacteria 2818
763 Ga0466967_0088711 3300045976 Bacteria 2807
764 Ga0466967_0165787 3300045976 Bacteria 2076
765 Ga0466967_1098706 3300045976 Bacteria 792
766 Ga0495592_0000102 3300046454 Bacteria 75767
767 Ga0495592_0000694 3300046454 Bacteria 23469
768 Ga0495629_0008845 3300046459 Bacteria 7404
769 Ga0495629_0072659 3300046459 Bacteria 2401
770 Ga0495638_0009457 3300046460 Bacteria 6839
771 Ga0495651_0001342 3300046462 Bacteria 19049
772 Ga0495653_0000681 3300046463 Bacteria 25993
773 Ga0495653_0011013 3300046463 Bacteria 7396
774 Ga0495582_0130616 3300046473 Bacteria 1419
775 Ga0495639_0149172 3300046475 Bacteria 1127
776 Ga0495664_0000016 3300046477 Bacteria 175933
777 Ga0495664_0004663 3300046477 Bacteria 7497
778 Ga0495584_0053441 3300046491 Bacteria 2033
779 Ga0495585_0056622 3300046492 Bacteria 2165
780 Ga0495585_0194871 3300046492 Bacteria 1035
781 Ga0495608_0000006 3300046511 Bacteria 324334
782 Ga0495608_0016534 3300046511 Bacteria 5105
783 Ga0495618_0007196 3300046514 Bacteria 6737
784 Ga0495618_0064002 3300046514 Bacteria 2336
785 Ga0495628_0000018 3300046516 Bacteria 169916
786 Ga0495628_0008859 3300046516 Bacteria 8612
787 Ga0495628_0072643 3300046516 Bacteria 2681
788 Ga0495630_0010531 3300046517 Bacteria 6681
789 Ga0495630_0113607 3300046517 Bacteria 2052
790 Ga0495632_0307532 3300046519 Bacteria 702
791 Ga0495663_0009581 3300046525 Bacteria 2687
792 Ga0495652_0000005 3300046529 Bacteria 524368
793 Ga0495652_0072584 3300046529 Bacteria 2868
794 Ga0495652_0147864 3300046529 Bacteria 1839
795 Ga0495640_0002500 3300046533 Bacteria 14791
796 Ga0495640_0012152 3300046533 Bacteria 6591
797 Ga0495640_0198506 3300046533 Bacteria 1272
798 Ga0495640_0547187 3300046533 Bacteria 702
799 Ga0495587_0000043 3300046536 Bacteria 109717
800 Ga0495587_0000753 3300046536 Bacteria 21591
801 Ga0495598_0004644 3300046537 Bacteria 2988
802 Ga0495609_0234018 3300046538 Bacteria 760
803 Ga0495621_0006102 3300046539 Bacteria 3501
804 Ga0495645_0000064 3300046543 Bacteria 74490
805 Ga0495645_0116750 3300046543 Bacteria 1883
806 Ga0495645_0168904 3300046543 Bacteria 1507
807 Ga0495633_0005946 3300046558 Bacteria 7334
808 Ga0495667_0000023 3300046559 Bacteria 169343
809 Ga0495667_0000450 3300046559 Bacteria 26281
810 Ga0495667_0117499 3300046559 Bacteria 1718
811 Ga0495656_0157287 3300046615 Bacteria 1102
812 Ga0495668_0463385 3300046616 Bacteria 698
813 Ga0495634_0002682 3300046642 Bacteria 14626
814 Ga0495634_0005621 3300046642 Bacteria 9611
815 Ga0495634_0457636 3300046642 Bacteria 752
816 Ga0495635_0000021 3300046663 Bacteria 164643
817 Ga0495635_0001541 3300046663 Bacteria 15439
818 Ga0495659_0071561 3300046664 Bacteria 1300
819 Ga0495661_0108596 3300046665 Bacteria 1550
820 Ga0495657_0011026 3300046675 Bacteria 6778
821 Ga0495599_0002496 3300046678 Bacteria 10716
822 Ga0495599_0007280 3300046678 Bacteria 6701
823 Ga0495623_0003470 3300046679 Bacteria 10438
824 Ga0495623_0008462 3300046679 Bacteria 6682
825 Ga0495646_0000027 3300046680 Bacteria 97629
826 Ga0495658_0129781 3300046683 Bacteria 1533
827 Ga0495658_0364187 3300046683 Bacteria 919
828 Ga0495669_0022836 3300046684 Bacteria 2719
829 Ga0495669_0033137 3300046684 Bacteria 2273
830 Ga0495613_0199191 3300046689 Bacteria 1412
831 Ga0495613_0748630 3300046689 Bacteria 640
832 Ga0495624_0415031 3300046690 Bacteria 807
833 Ga0495624_0492094 3300046690 Bacteria 734
834 Ga0495670_0035903 3300046691 Bacteria 2469
835 Ga0495670_0114858 3300046691 Bacteria 1395
836 Ga0495589_0075431 3300046794 Bacteria 1644
837 Ga0495600_0000047 3300046809 Bacteria 71546
838 Ga0495600_0001179 3300046809 Bacteria 14283
839 Ga0495604_0000014 3300047317 Bacteria 205481
840 Ga0495604_0001199 3300047317 Bacteria 21407
841 Ga0495604_0107838 3300047317 Bacteria 2035
842 Ga0495636_0298178 3300047318 Bacteria 754
843 Ga0495674_0000014 3300047319 Bacteria 241211
844 Ga0495674_0000573 3300047319 Bacteria 34362
845 Ga0495676_0045729 3300047321 Bacteria 3560
846 Ga0495680_0000285 3300047322 Bacteria 56843
847 Ga0495680_0002949 3300047322 Bacteria 17037
848 Ga0495680_0351320 3300047322 Bacteria 1026
849 Ga0495675_0032125 3300047444 Bacteria 3350
850 Ga0495675_0066501 3300047444 Bacteria 2278
851 Ga0495675_0450347 3300047444 Bacteria 745
852 Ga0495677_0052449 3300047445 Bacteria 1503
853 Ga0495677_0102171 3300047445 Bacteria 1086
854 Ga0495684_0011810 3300047471 Bacteria 6738
855 Ga0495684_0024992 3300047471 Bacteria 4594
856 Ga0495686_0106680 3300047472 Bacteria 1684
857 Ga0495593_0032963 3300047673 Bacteria 2822
858 Ga0495593_0210655 3300047673 Bacteria 976
859 Ga0495593_0257106 3300047673 Bacteria 874
860 Ga0495602_0000017 3300048088 Bacteria 184180
861 Ga0495602_0007083 3300048088 Bacteria 11769
862 Ga0496100_0124207 3300048903 Bacteria 1810
863 Ga0496101_0067877 3300048904 Bacteria 2605
864 Ga0496101_0594585 3300048904 Bacteria 875
865 Ga0496102_0088819 3300048905 Bacteria 2858
866 Ga0496102_0748219 3300048905 Bacteria 900
867 Ga0496103_0050675 3300048906 Bacteria 2568
868 Ga0496104_0334729 3300048907 Bacteria 1427
869 Ga0496104_0436585 3300048907 Bacteria 1221
870 Ga0496105_0106651 3300048908 Bacteria 2313
871 Ga0496105_0283645 3300048908 Bacteria 1335
872 Ga0496108_0028372 3300048911 Bacteria 4630
873 Ga0496108_0052890 3300048911 Bacteria 3405
874 Ga0496108_0138631 3300048911 Bacteria 2095
875 Ga0496108_0400326 3300048911 Bacteria 1199
876 Ga0496109_0012227 3300048912 Bacteria 7406
877 Ga0496109_0086385 3300048912 Bacteria 2897
878 Ga0496109_0425520 3300048912 Bacteria 1254
879 Ga0496110_0050539 3300048913 Bacteria 3650
880 Ga0496110_0276164 3300048913 Bacteria 1530
881 Ga0496110_0347132 3300048913 Bacteria 1352
882 Ga0496110_0690529 3300048913 Bacteria 922
883 Ga0496111_0015254 3300048914 Bacteria 5270
884 Ga0496111_0670567 3300048914 Bacteria 756
885 Ga0496112_0040251 3300048915 Bacteria 4569
886 Ga0496112_0116807 3300048915 Bacteria 2638
887 Ga0496113_0198353 3300048916 Bacteria 1595
888 Ga0496113_1000798 3300048916 Bacteria 658
889 Ga0496114_0156254 3300048917 Bacteria 1980
890 Ga0496114_0188115 3300048917 Bacteria 1805
891 Ga0496114_0338092 3300048917 Bacteria 1331
892 Ga0496114_0670356 3300048917 Bacteria 911
893 Ga0496115_0651006 3300048918 Bacteria 833
894 Ga0496121_0171993 3300048924 Bacteria 1572
895 Ga0496121_0582876 3300048924 Bacteria 693
896 Ga0496126_0699576 3300048929 Bacteria 788
897 Ga0501290_000464 3300049513 Bacteria 6297
898 Ga0501292_000026 3300049515 Bacteria 42153
899 Ga0501294_000620 3300049517 Bacteria 4032
900 Ga0501317_062296 3300049533 Bacteria 614
901 Ga0501031_0002683 3300049568 Bacteria 11328
902 Ga0501031_0031678 3300049568 Bacteria 3449
903 Ga0501031_0033840 3300049568 Bacteria 3335
904 Ga0501031_0139148 3300049568 Bacteria 1586
905 Ga0501031_0352347 3300049568 Bacteria 953
906 Ga0501032_0006465 3300049569 Bacteria 8617
907 Ga0501032_0007303 3300049569 Bacteria 8080
908 Ga0501032_0008238 3300049569 Bacteria 7601
909 Ga0501032_0029554 3300049569 Bacteria 3760
910 Ga0501032_0034383 3300049569 Bacteria 3470
911 Ga0501032_0055046 3300049569 Bacteria 2676
912 Ga0501032_0134960 3300049569 Bacteria 1627
913 Ga0501033_0004363 3300049570 Bacteria 11336
914 Ga0501033_0015275 3300049570 Bacteria 5824
915 Ga0501033_0034895 3300049570 Bacteria 3770
916 Ga0501033_0062891 3300049570 Bacteria 2732
917 Ga0501033_0081556 3300049570 Bacteria 2372
918 Ga0501033_0092428 3300049570 Bacteria 2213
919 Ga0501033_0111769 3300049570 Bacteria 1988
920 Ga0501033_0123637 3300049570 Bacteria 1876
921 Ga0501033_0284288 3300049570 Bacteria 1167
922 Ga0501034_0000166 3300049571 Bacteria 122782
923 Ga0501034_0000250 3300049571 Bacteria 99407
924 Ga0501034_0004004 3300049571 Bacteria 16529
925 Ga0501034_0011589 3300049571 Bacteria 9129
926 Ga0501034_0015288 3300049571 Bacteria 7888
927 Ga0501034_0022969 3300049571 Bacteria 6355
928 Ga0501034_0053963 3300049571 Bacteria 4046
929 Ga0501034_0055243 3300049571 Bacteria 3996
930 Ga0501034_0074320 3300049571 Bacteria 3407
931 Ga0501034_0093981 3300049571 Bacteria 2995
932 Ga0501034_0109847 3300049571 Bacteria 2748
933 Ga0501034_0172691 3300049571 Bacteria 2128
934 Ga0501034_0321395 3300049571 Bacteria 1480
935 Ga0501034_0528818 3300049571 Bacteria 1090
936 Ga0501034_0810090 3300049571 Bacteria 829
937 Ga0501034_0865926 3300049571 Bacteria 793
938 Ga0501036_0000098 3300049572 Bacteria 54252
939 Ga0501036_0000118 3300049572 Bacteria 49383
940 Ga0501036_0011524 3300049572 Bacteria 7325
941 Ga0501036_0059781 3300049572 Bacteria 3229
942 Ga0501036_0096933 3300049572 Bacteria 2493
943 Ga0501036_0172034 3300049572 Bacteria 1825
944 Ga0501036_0212665 3300049572 Bacteria 1624
945 Ga0501036_0236143 3300049572 Bacteria 1533
946 Ga0501036_0272062 3300049572 Bacteria 1418
947 Ga0501036_0322427 3300049572 Bacteria 1291
948 Ga0501036_0391656 3300049572 Bacteria 1159
949 Ga0501036_0445366 3300049572 Bacteria 1079
950 Ga0501037_0000092 3300049573 Bacteria 83924
951 Ga0501037_0002056 3300049573 Bacteria 14595
952 Ga0501037_0021237 3300049573 Bacteria 4796
953 Ga0501037_0082921 3300049573 Bacteria 2322
954 Ga0501037_0165148 3300049573 Bacteria 1577
955 Ga0501037_0188274 3300049573 Bacteria 1462
956 Ga0501037_0240667 3300049573 Bacteria 1268
957 Ga0501037_0554087 3300049573 Bacteria 775
958 Ga0501038_0000059 3300049574 Bacteria 92319
959 Ga0501038_0011141 3300049574 Bacteria 8211
960 Ga0501038_0020000 3300049574 Bacteria 6026
961 Ga0501038_0028839 3300049574 Bacteria 4927
962 Ga0501038_0088715 3300049574 Bacteria 2595
963 Ga0501038_0196113 3300049574 Bacteria 1623
964 Ga0501038_0280926 3300049574 Bacteria 1310
965 Ga0501038_0282712 3300049574 Bacteria 1306
966 Ga0501038_0286085 3300049574 Bacteria 1296
967 Ga0501038_0328335 3300049574 Bacteria 1195
968 Ga0501038_0358729 3300049574 Bacteria 1134
969 Ga0501039_0000547 3300049575 Bacteria 27186
970 Ga0501039_0000554 3300049575 Bacteria 27105
971 Ga0501039_0016705 3300049575 Bacteria 5623
972 Ga0501039_0036429 3300049575 Bacteria 3796
973 Ga0501039_0063880 3300049575 Bacteria 2852
974 Ga0501039_0086154 3300049575 Bacteria 2446
975 Ga0501039_0222742 3300049575 Bacteria 1483
976 Ga0501039_0597706 3300049575 Bacteria 865
977 Ga0501039_0600368 3300049575 Bacteria 863
978 Ga0501040_0018492 3300049576 Bacteria 4627
979 Ga0501040_0032602 3300049576 Bacteria 3526
980 Ga0501040_0089782 3300049576 Bacteria 2135
981 Ga0501040_0475150 3300049576 Bacteria 900
982 Ga0501040_0482988 3300049576 Bacteria 893
983 Ga0501040_0491450 3300049576 Bacteria 885
984 Ga0501040_0673822 3300049576 Bacteria 748
985 Ga0501041_0040615 3300049577 Bacteria 2824
986 Ga0501041_0247238 3300049577 Bacteria 1121
987 Ga0501041_0405466 3300049577 Bacteria 864
988 Ga0501041_0479545 3300049577 Bacteria 790
989 Ga0501042_0040851 3300049578 Bacteria 3297
990 Ga0501042_0055463 3300049578 Bacteria 2828
991 Ga0501042_0094903 3300049578 Bacteria 2142
992 Ga0501042_0380823 3300049578 Bacteria 1021
993 Ga0501042_0614942 3300049578 Bacteria 790
994 Ga0501042_0634531 3300049578 Bacteria 777
995 Ga0501043_0003262 3300049579 Bacteria 13373
996 Ga0501043_0004952 3300049579 Bacteria 10775
997 Ga0501043_0025398 3300049579 Bacteria 4648
998 Ga0501043_0037821 3300049579 Bacteria 3796
999 Ga0501043_0074646 3300049579 Bacteria 2663
1000 Ga0501043_0091286 3300049579 Bacteria 2394
1001 Ga0501043_0106599 3300049579 Bacteria 2201
1002 Ga0501043_0131322 3300049579 Bacteria 1963
1003 Ga0501043_0568607 3300049579 Bacteria 840
1004 Ga0501043_1021618 3300049579 Bacteria 587
1005 Ga0501046_0000483 3300049580 Bacteria 39806
1006 Ga0501046_0007623 3300049580 Bacteria 9493
1007 Ga0501046_0008888 3300049580 Bacteria 8723
1008 Ga0501046_0019056 3300049580 Bacteria 5696
1009 Ga0501046_0024112 3300049580 Bacteria 4996
1010 Ga0501046_0041977 3300049580 Bacteria 3648
1011 Ga0501046_0105086 3300049580 Bacteria 2163
1012 Ga0501046_0209038 3300049580 Bacteria 1449
1013 Ga0501046_0574290 3300049580 Bacteria 802
1014 Ga0501047_0000022 3300049581 Bacteria 249062
1015 Ga0501047_0000097 3300049581 Bacteria 107310
1016 Ga0501047_0002349 3300049581 Bacteria 18098
1017 Ga0501047_0011286 3300049581 Bacteria 8456
1018 Ga0501047_0089266 3300049581 Bacteria 2959
1019 Ga0501047_0150648 3300049581 Bacteria 2202
1020 Ga0501047_0173726 3300049581 Bacteria 2023
1021 Ga0501047_0175046 3300049581 Bacteria 2013
1022 Ga0501047_0199679 3300049581 Bacteria 1861
1023 Ga0501047_0249337 3300049581 Bacteria 1624
1024 Ga0501047_0460618 3300049581 Bacteria 1100
1025 Ga0501048_0000522 3300049582 Bacteria 26987
1026 Ga0501048_0000821 3300049582 Bacteria 22904
1027 Ga0501048_0021257 3300049582 Bacteria 4751
1028 Ga0501048_0178190 3300049582 Bacteria 1506
1029 Ga0501048_0192599 3300049582 Bacteria 1445
1030 Ga0501048_0219615 3300049582 Bacteria 1348
1031 Ga0501048_0279696 3300049582 Bacteria 1187
1032 Ga0501067_0000576 3300049583 Bacteria 19849
1033 Ga0501067_0000688 3300049583 Bacteria 18195
1034 Ga0501067_0003424 3300049583 Bacteria 8731
1035 Ga0501067_0007963 3300049583 Bacteria 5886
1036 Ga0501067_0015150 3300049583 Bacteria 4267
1037 Ga0501068_0000490 3300049584 Bacteria 20051
1038 Ga0501068_0001239 3300049584 Bacteria 13551
1039 Ga0501068_0035913 3300049584 Bacteria 2960
1040 Ga0501068_0083205 3300049584 Bacteria 1966
1041 Ga0501068_0104234 3300049584 Bacteria 1760
1042 Ga0501068_0303221 3300049584 Bacteria 1023
1043 Ga0501069_0000707 3300049585 Bacteria 15581
1044 Ga0501069_0006762 3300049585 Bacteria 6004
1045 Ga0501069_0026803 3300049585 Bacteria 3157
1046 Ga0501069_0040815 3300049585 Bacteria 2564
1047 Ga0501069_0162399 3300049585 Bacteria 1287
1048 Ga0501070_0002047 3300049586 Bacteria 17725
1049 Ga0501070_0028005 3300049586 Bacteria 4726
1050 Ga0501070_0037453 3300049586 Bacteria 4049
1051 Ga0501070_0037536 3300049586 Bacteria 4044
1052 Ga0501070_0040620 3300049586 Bacteria 3879
1053 Ga0501070_0063974 3300049586 Bacteria 3047
1054 Ga0501070_0191397 3300049586 Bacteria 1681
1055 Ga0501070_0318792 3300049586 Bacteria 1265
1056 Ga0501071_0008806 3300049587 Bacteria 6686
1057 Ga0501071_0437350 3300049587 Bacteria 1001
1058 Ga0501071_1012439 3300049587 Bacteria 642
1059 Ga0501072_0000001 3300049588 Bacteria 362697
1060 Ga0501072_0000327 3300049588 Bacteria 33913
1061 Ga0501072_0001893 3300049588 Bacteria 15593
1062 Ga0501072_0043315 3300049588 Bacteria 3537
1063 Ga0501072_0100111 3300049588 Bacteria 2304
1064 Ga0501072_0119346 3300049588 Bacteria 2101
1065 Ga0501072_0121979 3300049588 Bacteria 2077
1066 Ga0501072_0122605 3300049588 Bacteria 2071
1067 Ga0501072_0175315 3300049588 Bacteria 1710
1068 Ga0501072_0215532 3300049588 Bacteria 1530
1069 Ga0501072_0447048 3300049588 Bacteria 1024
1070 Ga0501073_0000955 3300049589 Bacteria 20800
1071 Ga0501073_0008009 3300049589 Bacteria 7846
1072 Ga0501073_0024073 3300049589 Bacteria 4372
1073 Ga0501073_0085422 3300049589 Bacteria 2195
1074 Ga0501073_0097498 3300049589 Bacteria 2042
1075 Ga0501073_0113888 3300049589 Bacteria 1875
1076 Ga0501073_0144272 3300049589 Bacteria 1650
1077 Ga0501073_0153521 3300049589 Bacteria 1596
1078 Ga0501073_0171543 3300049589 Bacteria 1501
1079 Ga0501073_0196087 3300049589 Bacteria 1397
1080 Ga0501073_0196188 3300049589 Bacteria 1396
1081 Ga0501073_0199601 3300049589 Bacteria 1383
1082 Ga0501073_0241066 3300049589 Bacteria 1248
1083 Ga0501073_0350342 3300049589 Bacteria 1020
1084 Ga0501073_0573255 3300049589 Bacteria 780
1085 Ga0501074_0003990 3300049590 Bacteria 10519
1086 Ga0501074_0004790 3300049590 Bacteria 9701
1087 Ga0501074_0007646 3300049590 Bacteria 7821
1088 Ga0501074_0024225 3300049590 Bacteria 4410
1089 Ga0501074_0044060 3300049590 Bacteria 3231
1090 Ga0501074_0064647 3300049590 Bacteria 2634
1091 Ga0501074_0305811 3300049590 Bacteria 1129
1092 Ga0501074_0406516 3300049590 Bacteria 965
1093 Ga0501074_0846186 3300049590 Bacteria 644
1094 Ga0501075_0072162 3300049591 Bacteria 2610
1095 Ga0501075_0599849 3300049591 Bacteria 840
1096 Ga0501076_0021371 3300049592 Bacteria 4964
1097 Ga0501076_0122551 3300049592 Bacteria 2105
1098 Ga0501076_0125455 3300049592 Bacteria 2080
1099 Ga0501076_0185229 3300049592 Bacteria 1698
1100 Ga0501076_0246670 3300049592 Bacteria 1461
1101 Ga0501076_0313118 3300049592 Bacteria 1287
1102 Ga0501076_1255141 3300049592 Bacteria 610
1103 Ga0501077_0091077 3300049593 Bacteria 1932
1104 Ga0501077_0187026 3300049593 Bacteria 1316
1105 Ga0501077_0428101 3300049593 Bacteria 847
1106 Ga0501222_000640 3300049662 Bacteria 5129
1107 Ga0501223_005742 3300049663 Bacteria 2594
1108 Ga0501227_010889 3300049665 Bacteria 1976
1109 Ga0501249_007946 3300049679 Bacteria 2201
1110 Ga0501259_000268 3300049688 Bacteria 8191
1111 Ga0501225_0040742 3300049705 Bacteria 1280
1112 Ga0501079_0006980 3300049741 Bacteria 8511
1113 Ga0501079_0071163 3300049741 Bacteria 2686
1114 Ga0501079_0076463 3300049741 Bacteria 2590
1115 Ga0501079_0080214 3300049741 Bacteria 2523
1116 Ga0501079_0111899 3300049741 Bacteria 2122
1117 Ga0501079_0120015 3300049741 Bacteria 2044
1118 Ga0501079_0140114 3300049741 Bacteria 1884
1119 Ga0501079_0489445 3300049741 Bacteria 967
1120 Ga0501080_0000047 3300049742 Bacteria 76956
1121 Ga0501080_0000075 3300049742 Bacteria 66767
1122 Ga0501080_0005687 3300049742 Bacteria 11148
1123 Ga0501080_0011853 3300049742 Bacteria 7986
1124 Ga0501080_0034243 3300049742 Bacteria 4740
1125 Ga0501080_0159108 3300049742 Bacteria 2086
1126 Ga0501080_0242492 3300049742 Bacteria 1645
1127 Ga0501080_0520373 3300049742 Bacteria 1061
1128 Ga0501080_0724103 3300049742 Bacteria 876
1129 Ga0501080_0812448 3300049742 Bacteria 819
1130 Ga0501080_0861557 3300049742 Bacteria 791
1131 Ga0501080_1118815 3300049742 Bacteria 679
1132 Ga0501081_0008289 3300049743 Bacteria 6744
1133 Ga0501081_0166382 3300049743 Bacteria 1591
1134 Ga0501081_0180111 3300049743 Bacteria 1528
1135 Ga0501081_1113279 3300049743 Bacteria 598
1136 Ga0501083_0000694 3300049744 Bacteria 21938
1137 Ga0501083_0000808 3300049744 Bacteria 20535
1138 Ga0501083_0000857 3300049744 Bacteria 20028
1139 Ga0501083_0010083 3300049744 Bacteria 6660
1140 Ga0501083_0032304 3300049744 Bacteria 3590
1141 Ga0501083_0105896 3300049744 Bacteria 1851
1142 Ga0501083_0126195 3300049744 Bacteria 1677
1143 Ga0501083_0148049 3300049744 Bacteria 1537
1144 Ga0501083_0180010 3300049744 Bacteria 1380
1145 Ga0501267_003024 3300049764 Bacteria 1514
1146 Ga0501279_000027 3300049775 Bacteria 40843
1147 Ga0501280_000044 3300049776 Bacteria 37121
1148 Ga0501281_04599 3300049777 Bacteria 968
1149 Ga0501282_000334 3300049778 Bacteria 5704
1150 Ga0501035_0000084 3300049822 Bacteria 116222
1151 Ga0501035_0000222 3300049822 Bacteria 67780
1152 Ga0501035_0000240 3300049822 Bacteria 65635
1153 Ga0501035_0023093 3300049822 Bacteria 5708
1154 Ga0501035_0093910 3300049822 Bacteria 2638
1155 Ga0501035_0134538 3300049822 Bacteria 2153
1156 Ga0501035_0186337 3300049822 Bacteria 1786
1157 Ga0501035_0195686 3300049822 Bacteria 1736
1158 Ga0501035_0404362 3300049822 Bacteria 1135
1159 Ga0501035_0601317 3300049822 Bacteria 896
1160 Ga0501035_0725229 3300049822 Bacteria 800
1161 Ga0501044_0000072 3300049823 Bacteria 124143
1162 Ga0501044_0000073 3300049823 Bacteria 122507
1163 Ga0501044_0000122 3300049823 Bacteria 93246
1164 Ga0501044_0009895 3300049823 Bacteria 10362
1165 Ga0501044_0026426 3300049823 Bacteria 6143
1166 Ga0501044_0037991 3300049823 Bacteria 5030
1167 Ga0501044_0084636 3300049823 Bacteria 3205
1168 Ga0501044_0195581 3300049823 Bacteria 1982
1169 Ga0501044_0244736 3300049823 Bacteria 1736
1170 Ga0501044_0289043 3300049823 Bacteria 1571
1171 Ga0501044_0318044 3300049823 Bacteria 1481
1172 Ga0501044_0351893 3300049823 Bacteria 1392
1173 Ga0501044_0745093 3300049823 Bacteria 862
1174 Ga0501045_0020260 3300049824 Bacteria 4749
1175 Ga0501045_0056835 3300049824 Bacteria 2862
1176 Ga0501045_0107574 3300049824 Bacteria 2066
1177 Ga0501045_0140486 3300049824 Bacteria 1796
1178 Ga0501045_0159840 3300049824 Bacteria 1677
1179 Ga0501045_0400872 3300049824 Bacteria 1021
1180 Ga0501045_0766462 3300049824 Bacteria 711
1181 nmdc:mga03683_105249_c1 3300050489 Bacteria 1243
1182 nmdc:mga03683_10611_c1 3300050489 Bacteria 3309
1183 nmdc:mga03683_14732_c1 3300050489 Bacteria 2900
1184 nmdc:mga03n38_111658_c1 3300050490 Bacteria 1332
1185 nmdc:mga03n38_112709_c1 3300050490 Bacteria 1327
1186 nmdc:mga03n38_11414_c1 3300050490 Bacteria 3310
1187 nmdc:mga00v17_10354_c1 3300050491 Bacteria 4549
1188 nmdc:mga00v17_459614_c1 3300050491 Bacteria 826
1189 nmdc:mga00v17_498095_c1 3300050491 Bacteria 790
1190 nmdc:mga00v17_590400_c1 3300050491 Bacteria 717
1191 nmdc:mga00v17_608140_c1 3300050491 Bacteria 705
1192 nmdc:mga0yw44_572322_c1 3300050492 Bacteria 767
1193 nmdc:mga0yw44_661200_c1 3300050492 Bacteria 710
1194 nmdc:mga0k408_14308_c1 3300050493 Bacteria 4368
1195 nmdc:mga0k408_19574_c1 3300050493 Bacteria 3785
1196 nmdc:mga0k408_19827_c1 3300050493 Bacteria 3763
1197 nmdc:mga0k408_226323_c1 3300050493 Bacteria 1117
1198 nmdc:mga06z11_33274_c1 3300050494 Bacteria 2521
1199 nmdc:mga06z11_717_c1 3300050494 Bacteria 12069
1200 nmdc:mga04h51_183045_c1 3300050495 Bacteria 816
1201 nmdc:mga04h51_261_c1 3300050495 Bacteria 13697
1202 nmdc:mga04h51_333897_c1 3300050495 Bacteria 624
1203 nmdc:mga07m45_172315_c1 3300050496 Bacteria 1258
1204 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
1205 nmdc:mga05p37_223527_c1 3300050507 Bacteria 2271
1206 nmdc:mga05p37_387146_c1 3300050507 Bacteria 1636
1207 nmdc:mga05p37_462759_c1 3300050507 Bacteria 1465
1208 nmdc:mga05p37_564_c1 3300050507 Bacteria 40786
1209 nmdc:mga05p37_816617_c1 3300050507 Bacteria 1018
1210 nmdc:mga09592_19928_c1 3300050508 Bacteria 5510
1211 nmdc:mga09592_20905_c1 3300050508 Bacteria 5390
1212 nmdc:mga09592_225653_c1 3300050508 Bacteria 1623
1213 nmdc:mga09592_26841_c1 3300050508 Bacteria 4774
1214 nmdc:mga09592_58331_c1 3300050508 Bacteria 3264
1215 nmdc:mga0qj67_1194_c1 3300050509 Bacteria 18027
1216 nmdc:mga0qj67_139012_c1 3300050509 Bacteria 1969
1217 nmdc:mga0qj67_176641_c1 3300050509 Bacteria 1734
1218 nmdc:mga0qj67_611093_c1 3300050509 Bacteria 872
1219 nmdc:mga06r32_1217376_c1 3300050510 Bacteria 699
1220 nmdc:mga06r32_13924_c1 3300050510 Bacteria 7297
1221 nmdc:mga06r32_191_c1 3300050510 Bacteria 49056
1222 nmdc:mga06r32_360112_c1 3300050510 Bacteria 1439
1223 nmdc:mga06r32_437492_c1 3300050510 Bacteria 1288
1224 nmdc:mga06r32_8176_c1 3300050510 Bacteria 9413
1225 nmdc:mga08y16_14382_c1 3300050511 Bacteria 8330
1226 nmdc:mga08y16_330510_c1 3300050511 Bacteria 1568
1227 nmdc:mga08y16_4792_c1 3300050511 Bacteria 14111
1228 nmdc:mga08y16_79789_c1 3300050511 Bacteria 3411
1229 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
1230 nmdc:mga08y16_963796_c1 3300050511 Bacteria 835
1231 nmdc:mga0n895_11749_c1 3300050512 Bacteria 7827
1232 nmdc:mga0rr50_576898_c1 3300050513 Bacteria 958
1233 nmdc:mga0rr50_684664_c1 3300050513 Bacteria 875
1234 nmdc:mga08x19_45856_c1 3300050514 Bacteria 2794
1235 nmdc:mga08x19_523752_c1 3300050514 Bacteria 838
1236 nmdc:mga0a205_272836_c1 3300050515 Bacteria 1568
1237 nmdc:mga0a205_34901_c1 3300050515 Bacteria 4828
1238 nmdc:mga0a205_411557_c1 3300050515 Bacteria 1215
1239 nmdc:mga0a205_880256_c1 3300050515 Bacteria 742
1240 nmdc:mga0sz30_304608_c1 3300050516 Bacteria 711
1241 nmdc:mga0sz30_3060_c1 3300050516 Bacteria 5991
1242 Ga0495601_0000016 3300053077 Bacteria 207486
1243 Ga0495601_0019662 3300053077 Bacteria 4120
1244 Ga0495601_0063264 3300053077 Bacteria 2352
1245 Ga0495601_0083752 3300053077 Bacteria 2048
1246 Ga0495612_0000041 3300053078 Bacteria 62752
1247 Ga0495612_0000733 3300053078 Bacteria 13321
1248 Ga0495595_0000578 3300053084 Bacteria 14020
1249 Ga0495595_0002928 3300053084 Bacteria 6736
1250 Ga0495595_0017378 3300053084 Bacteria 3094
1251 Ga0495595_0156438 3300053084 Bacteria 1123
1252 Ga0495619_0002914 3300053085 Bacteria 11117
1253 Ga0495619_0007913 3300053085 Bacteria 6725
1254 Ga0500643_000065 3300053087 Bacteria 119995
1255 Ga0500646_0070812 3300053090 Bacteria 1045
1256 Ga0500566_0265020 3300053094 Bacteria 827
1257 Ga0500566_0298727 3300053094 Bacteria 759
1258 Ga0500641_0002717 3300053096 Bacteria 6250
1259 Ga0500641_0007230 3300053096 Bacteria 3957
1260 Ga0500592_000384 3300053116 Bacteria 7453
1261 Ga0500594_0195330 3300053118 Bacteria 664
1262 Ga0500595_007591 3300053119 Bacteria 4492
1263 Ga0500607_000854 3300053121 Bacteria 29366
1264 Ga0500607_004296 3300053121 Bacteria 9890
1265 Ga0500642_0314401 3300053130 Bacteria 704
1266 Ga0500652_000090 3300053131 Bacteria 38615
1267 Ga0500652_003278 3300053131 Bacteria 4900
1268 Ga0500658_0080953 3300053134 Bacteria 1389
1269 Ga0500559_0002140 3300053136 Bacteria 10511
1270 Ga0500604_0000065 3300053151 Bacteria 37746
1271 Ga0500616_0036739 3300053153 Bacteria 2657
1272 Ga0500616_0047136 3300053153 Bacteria 2289
1273 Ga0500627_0000551 3300053158 Bacteria 10092
1274 Ga0500627_0251533 3300053158 Bacteria 782
1275 Ga0500636_0044766 3300053177 Bacteria 2610
1276 Ga0500645_000261 3300053730 Bacteria 37957
1277 Ga0500645_001908 3300053730 Bacteria 9918
1278 Ga0500645_094918 3300053730 Bacteria 844
1279 Ga0501084_0000079 3300054114 Bacteria 71210
1280 Ga0501084_0003295 3300054114 Bacteria 13068
1281 Ga0501084_0032719 3300054114 Bacteria 4351
1282 Ga0501084_0068755 3300054114 Bacteria 2965
1283 Ga0501084_0090467 3300054114 Bacteria 2569
1284 Ga0501084_0110255 3300054114 Bacteria 2312
1285 Ga0501084_0140691 3300054114 Bacteria 2032
1286 Ga0501084_0446536 3300054114 Bacteria 1093
1287 Ga0501084_0476620 3300054114 Bacteria 1055
1288 Ga0501084_0547947 3300054114 Bacteria 977
1289 Ga0590075_064910 3300059424 Bacteria 942
1290 Ga0590075_075302 3300059424 Bacteria 873
1291 Ga0587077_106110 3300059493 Bacteria 682
1292 Ga0587106_028992 3300059605 Bacteria 876
1293 Ga0587062_029273 3300059639 Bacteria 834
1294 Ga0587076_045819 3300059645 Bacteria 834
1295 Ga0587079_084023 3300059647 Bacteria 733
1296 Ga0501082_0001185 3300060353 Bacteria 22911
1297 Ga0501082_0001707 3300060353 Bacteria 19386
1298 Ga0501082_0004072 3300060353 Bacteria 12754
1299 Ga0501082_0015079 3300060353 Bacteria 6658
1300 Ga0501082_0032192 3300060353 Bacteria 4522
1301 Ga0501082_0074277 3300060353 Bacteria 2928
1302 Ga0501082_0153261 3300060353 Bacteria 2002
1303 Ga0501082_0154605 3300060353 Bacteria 1993
1304 Ga0501082_0244555 3300060353 Bacteria 1561
1305 Ga0501082_0282206 3300060353 Bacteria 1445
1306 Ga0501082_0339784 3300060353 Bacteria 1308
1307 Ga0501082_0395956 3300060353 Bacteria 1205
1308 Ga0501082_0433953 3300060353 Bacteria 1147
1309 Ga0501082_0451088 3300060353 Bacteria 1124
1310 Ga0501082_0517308 3300060353 Bacteria 1043
1311 Ga0530510_0035312 3300061734 Bacteria 3603
1312 Ga0530510_0079605 3300061734 Bacteria 2383
1313 Ga0530510_0604927 3300061734 Bacteria 834
1314 Ga0530510_1112104 3300061734 Bacteria 605
1315 2523469174 2523231067 Bacteria 5230452
1316 2671693545 2671180139 Bacteria 4196045
1317 2894822242 2894817345 Bacteria 4892941
1318 2896185693 2896184354 Bacteria 3258548
1319 2917558208 2917554339 Bacteria 4987857
1320 2929298512 2929297113 Bacteria 3141306
1321 3000867000 3000865235 Bacteria 3106258
1322 Ga0501067_0244649
1323 JGI24746J21847_1003728
1324 JGI25153J46596_10005049
1325 Ga0065712_10158226
1326 Ga0065715_10148475
1327 Ga0070658_10026748
1328 Ga0070658_10079821
1329 Ga0070658_10277732
1330 Ga0070658_10290689
1331 Ga0070658_10433046
1332 Ga0070658_10621901
1333 Ga0070658_10828065
1334 Ga0070676_10023356
1335 Ga0070676_10078023
1336 Ga0070690_100011597
1337 Ga0070690_100051906
1338 Ga0070670_100001209
1339 Ga0070670_100524578
1340 Ga0070677_10004816
1341 Ga0070666_10002037
1342 Ga0070666_10076575
1343 Ga0070680_100008432
1344 Ga0070680_100200812
1345 Ga0070680_100401167
1346 Ga0070682_100003228
1347 Ga0070682_100039711
1348 Ga0068868_100017842
1349 Ga0070660_100001596
1350 Ga0070660_100012544
1351 Ga0070660_100154606
1352 Ga0070660_100187241
1353 Ga0070660_100203887
1354 Ga0070689_100051517
1355 Ga0070689_100054341
1356 Ga0070689_100072706
1357 Ga0070689_100072843
1358 Ga0070689_100636335
1359 Ga0070689_100775201
1360 Ga0070687_100000651
1361 Ga0070661_100012203
1362 Ga0070661_100026608
1363 Ga0070661_100133466
1364 Ga0070661_100327957
1365 Ga0070661_100447708
1366 Ga0070668_100135892
1367 Ga0070668_100362925
1368 Ga0070669_100145047
1369 Ga0070669_100455798
1370 Ga0070669_100648620
1371 Ga0070675_100045786
1372 Ga0070675_100357881
1373 Ga0070675_100583733
1374 Ga0070671_100006150
1375 Ga0070671_100006644
1376 Ga0070671_100019015
1377 Ga0070671_100053667
1378 Ga0070671_100151005
1379 Ga0070674_100011744
1380 Ga0070674_100048468
1381 Ga0070674_100073361
1382 Ga0070673_100005472
1383 Ga0070673_100034218
1384 Ga0070673_100147415
1385 Ga0070673_101213387
1386 Ga0070688_100003838
1387 Ga0070688_100040814
1388 Ga0070688_100060496
1389 Ga0070659_100004346
1390 Ga0070659_100103715
1391 Ga0070659_100253681
1392 Ga0070659_100441516
1393 Ga0070659_100604003
1394 Ga0070667_100006803
1395 Ga0070667_100014101
1396 Ga0070667_100220929
1397 Ga0070667_100315983
1398 Ga0070667_100379827
1399 Ga0070667_100542108
1400 Ga0070714_100112087
1401 Ga0070714_100387490
1402 Ga0070713_101010065
1403 Ga0070701_10052318
1404 Ga0070711_100035525
1405 Ga0070711_100038432
1406 Ga0070705_100381098
1407 Ga0070700_100060070
1408 Ga0070708_100445673
1409 Ga0070663_100015534
1410 Ga0070663_100263224
1411 Ga0070663_100563559
1412 Ga0070678_100097787
1413 Ga0070678_100218922
1414 Ga0070662_100002053
1415 Ga0070662_100091919
1416 Ga0070662_100110580
1417 Ga0070662_100124062
1418 Ga0070662_100274790
1419 Ga0070662_100739849
1420 Ga0070662_100760893
1421 Ga0070681_10004156
1422 Ga0070681_10012342
1423 Ga0070681_10082436
1424 Ga0070681_10091185
1425 Ga0068867_100030511
1426 Ga0070685_10003942
1427 Ga0070698_100847963
1428 Ga0070699_100444522
1429 Ga0070679_100010255
1430 Ga0070679_100076980
1431 Ga0070679_100137701
1432 Ga0070679_100403330
1433 Ga0070679_100515271
1434 Ga0070684_100096416
1435 Ga0070684_100475154
1436 Ga0068853_100001120
1437 Ga0068853_100010459
1438 Ga0068853_100115026
1439 Ga0068853_100115890
1440 Ga0068853_100153069
1441 Ga0068853_100158870
1442 Ga0068853_100219835
1443 Ga0068853_100302828
1444 Ga0070672_100153303
1445 Ga0070672_100256829
1446 Ga0070686_100005413
1447 Ga0070686_100116042
1448 Ga0070686_100197760
1449 Ga0070686_100445865
1450 Ga0070695_100005458
1451 Ga0070695_100140405
1452 Ga0070696_100043974
1453 Ga0070696_100430025
1454 Ga0070693_100082656
1455 Ga0070665_100159096
1456 Ga0070665_100349553
1457 Ga0070704_100106130
1458 Ga0070704_100120698
1459 Ga0070704_100148959
1460 Ga0070704_100485195
1461 Ga0070704_101182971
1462 Ga0068855_100062365
1463 Ga0068855_100135698
1464 Ga0068855_100202226
1465 Ga0068855_100271286
1466 Ga0070664_100003030
1467 Ga0070664_100003245
1468 Ga0070664_100029345
1469 Ga0070664_100112874
1470 Ga0068857_100122892
1471 Ga0068857_100226885
1472 Ga0068857_100274643
1473 Ga0068857_100333353
1474 Ga0068857_100669314
1475 Ga0068854_100007527
1476 Ga0068854_100474538
1477 Ga0068854_100595590
1478 Ga0068854_100725891
1479 Ga0068856_100002582
1480 Ga0068856_100091866
1481 Ga0068856_100529572
1482 Ga0068856_100590493
1483 Ga0070702_100089235
1484 Ga0068852_100012732
1485 Ga0068852_100376593
1486 Ga0068852_100377720
1487 Ga0068852_100474068
1488 Ga0068852_100505728
1489 Ga0068852_100527839
1490 Ga0068859_100041148
1491 Ga0068859_100061003
1492 Ga0068859_100456926
1493 Ga0068864_100342635
1494 Ga0068866_10131091
1495 Ga0068861_100180074
1496 Ga0068870_10017187
1497 Ga0068863_100013225
1498 Ga0068858_100001220
1499 Ga0068858_100070910
1500 Ga0068858_100072857
1501 Ga0068858_100090683
1502 Ga0068858_100100260
1503 Ga0068858_100437848
1504 Ga0068860_100077456
1505 Ga0068860_100079166
1506 Ga0068860_100091007
1507 Ga0068860_100172293
1508 Ga0068860_100204438
1509 Ga0068862_100001900
1510 Ga0068862_100002109
1511 Ga0068862_100228872
1512 Ga0081455_10032634
1513 Ga0081455_10046241
1514 Ga0081455_10351898
1515 Ga0081538_10071824
1516 Ga0070717_10036746
1517 Ga0070717_10073587
1518 Ga0070717_10460708
1519 Ga0075365_10028316
1520 Ga0075365_10261733
1521 Ga0075368_10000154
1522 Ga0075368_10141865
1523 Ga0075363_100009861
1524 Ga0075363_100031864
1525 Ga0075363_100083791
1526 Ga0075364_10010820
1527 Ga0075364_10206662
1528 Ga0075364_10513097
1529 Ga0070712_100073308
1530 Ga0070712_100623008
1531 Ga0075362_10001229
1532 Ga0075362_10283668
1533 Ga0075367_10018545
1534 Ga0075367_10371473
1535 Ga0075369_10013093
1536 Ga0075366_10004924
1537 Ga0075366_10041243
1538 Ga0075366_10046259
1539 Ga0075366_10337864
1540 Ga0097621_100165643
1541 Ga0075370_10047926
1542 Ga0075370_10097232
1543 Ga0075370_10283848
1544 Ga0068871_100216729
1545 Ga0068871_100400195
1546 Ga0068871_100528608
1547 Ga0068871_100647239
1548 Ga0068871_101179939
1549 Ga0075428_100000606
1550 Ga0075428_100001030
1551 Ga0075428_100016563
1552 Ga0075428_100053354
1553 Ga0075428_100079887
1554 Ga0075428_101017656
1555 Ga0075430_100002000
1556 Ga0075430_100157001
1557 Ga0075430_100343936
1558 Ga0075430_100354083
1559 Ga0075431_100000032
1560 Ga0075431_100007296
1561 Ga0075431_100010360
1562 Ga0075431_100118643
1563 Ga0075431_100630812
1564 Ga0075433_10130756
1565 Ga0075434_100069291
1566 Ga0075429_100009118
1567 Ga0075429_100059469
1568 Ga0075429_100083653
1569 Ga0068865_100065024
1570 Ga0068865_100102026
1571 Ga0075436_100039986
1572 Ga0075436_100177303
1573 Ga0097620_100041150
1574 Ga0097620_100061002
1575 Ga0097620_100456949
1576 Ga0075435_100069623
1577 Ga0075435_100696545
1578 Ga0099795_10033761
1579 Ga0105240_10319701
1580 Ga0111539_10001089
1581 Ga0111539_10132368
1582 Ga0111539_10532037
1583 Ga0105245_10097484
1584 Ga0114129_10000062
1585 Ga0114129_10070132
1586 Ga0114129_10481588
1587 Ga0114129_10489248
1588 Ga0105243_10685993
1589 Ga0105241_10358619
1590 Ga0105242_10102160
1591 Ga0105242_10127241
1592 Ga0105242_10373575
1593 Ga0105248_10000575
1594 Ga0105248_10032460
1595 Ga0105248_10052459
1596 Ga0105248_11304190
1597 Ga0105238_10445675
1598 Ga0105249_10004484
1599 Ga0105249_10126386
1600 Ga0105249_10443846
1601 Ga0099796_10026974
1602 Ga0105239_10160754
1603 Ga0105246_10214319
1604 Ga0157373_10034223
1605 Ga0157371_10002512
1606 Ga0157371_10040000
1607 Ga0157371_10083091
1608 Ga0157371_10182576
1609 Ga0157370_10103179
1610 Ga0157370_10228130
1611 Ga0157370_10327032
1612 Ga0157369_10038667
1613 Ga0157369_10415943
1614 Ga0157378_10712262
1615 Ga0163162_10015418
1616 Ga0157372_10005708
1617 Ga0157372_10062690
1618 Ga0157372_10203158
1619 Ga0157372_10302849
1620 Ga0157372_10743667
1621 Ga0157375_10010448
1622 Ga0157375_10153878
1623 Ga0157375_10287312
1624 Ga0157375_10620111
1625 Ga0157375_11793722
1626 Ga0163163_10019652
1627 Ga0163163_10104340
1628 Ga0163163_10142267
1629 Ga0163163_10608301
1630 Ga0163163_10612577
1631 Ga0163163_10974549
1632 Ga0157380_10093638
1633 Ga0157380_10192704
1634 Ga0157380_11475569
1635 Ga0157377_10003094
1636 Ga0157379_10025431
1637 Ga0157379_10370252
1638 Ga0157379_10573192
1639 Ga0157376_10231232
1640 Ga0163161_10036976
1641 Ga0163161_10165871
1642 Ga0213876_10077378
1643 Ga0213876_10237236
1644 Ga0213875_10082656
1645 Ga0213875_10112131
1646 Ga0224571_108629
1647 Ga0207673_1012565
1648 Ga0209758_1000686
1649 Ga0209758_1091124
1650 Ga0207697_10000027
1651 Ga0207697_10084005
1652 Ga0207682_10000609
1653 Ga0207682_10161214
1654 Ga0207642_10205557
1655 Ga0207688_10000041
1656 Ga0207680_10000656
1657 Ga0207680_10224303
1658 Ga0207680_10269620
1659 Ga0207647_10001581
1660 Ga0207645_10005539
1661 Ga0207645_10019866
1662 Ga0207645_10088321
1663 Ga0207643_10001947
1664 Ga0207705_10001911
1665 Ga0207705_10418290
1666 Ga0207705_10757681
1667 Ga0207654_10563484
1668 Ga0207707_10011717
1669 Ga0207707_10050953
1670 Ga0207707_10198634
1671 Ga0207695_10200398
1672 Ga0207671_10062172
1673 Ga0207693_10339422
1674 Ga0207693_10755157
1675 Ga0207663_10883540
1676 Ga0207660_11083128
1677 Ga0207662_10253307
1678 Ga0207657_10000513
1679 Ga0207657_10005300
1680 Ga0207657_10073837
1681 Ga0207657_10122173
1682 Ga0207657_10186478
1683 Ga0207649_10003140
1684 Ga0207649_10013372
1685 Ga0207649_10081466
1686 Ga0207649_10095587
1687 Ga0207649_10121030
1688 Ga0207652_10014456
1689 Ga0207652_10018941
1690 Ga0207652_10031974
1691 Ga0207652_10040820
1692 Ga0207652_10056340
1693 Ga0207652_10089135
1694 Ga0207652_10146388
1695 Ga0207652_10310698
1696 Ga0207681_10079414
1697 Ga0207681_10270397
1698 Ga0207681_10516260
1699 Ga0207650_10007967
1700 Ga0207650_10035373
1701 Ga0207659_10011179
1702 Ga0207659_10032556
1703 Ga0207659_10300793
1704 Ga0207687_10046755
1705 Ga0207687_10408401
1706 Ga0207700_10215050
1707 Ga0207700_10302608
1708 Ga0207700_10601631
1709 Ga0207664_10064285
1710 Ga0207664_10085719
1711 Ga0207644_10005027
1712 Ga0207644_10019791
1713 Ga0207644_10030690
1714 Ga0207644_10087128
1715 Ga0207644_10609447
1716 Ga0207690_10001108
1717 Ga0207690_10260573
1718 Ga0207706_10003288
1719 Ga0207706_10005146
1720 Ga0207706_10027521
1721 Ga0207706_10027851
1722 Ga0207706_10200301
1723 Ga0207706_10353698
1724 Ga0207706_10372932
1725 Ga0207709_10936548
1726 Ga0207670_10010868
1727 Ga0207670_10020783
1728 Ga0207670_10052483
1729 Ga0207670_10562344
1730 Ga0207669_10012258
1731 Ga0207669_10048958
1732 Ga0207704_10241588
1733 Ga0207704_10351094
1734 Ga0207704_10441272
1735 Ga0207691_10000239
1736 Ga0207691_10143694
1737 Ga0207691_10354339
1738 Ga0207711_10000496
1739 Ga0207711_10037389
1740 Ga0207711_10076367
1741 Ga0207711_10463542
1742 Ga0207661_10040299
1743 Ga0207661_10123832
1744 Ga0207679_10047857
1745 Ga0207679_10111886
1746 Ga0207679_10126589
1747 Ga0207667_10000830
1748 Ga0207667_10157268
1749 Ga0207667_10313294
1750 Ga0207667_10342927
1751 Ga0207651_10009173
1752 Ga0207651_10016951
1753 Ga0207651_10143589
1754 Ga0207651_10154311
1755 Ga0207651_10273299
1756 Ga0207712_10067376
1757 Ga0207712_10337608
1758 Ga0207668_10479853
1759 Ga0207640_10025713
1760 Ga0207640_10150608
1761 Ga0207640_10362520
1762 Ga0207658_10001593
1763 Ga0207658_10121760
1764 Ga0207658_10207128
1765 Ga0207658_10334820
1766 Ga0207677_10013370
1767 Ga0207677_10228577
1768 Ga0207677_11204544
1769 Ga0207703_10007178
1770 Ga0207703_10063936
1771 Ga0207703_10317598
1772 Ga0207703_10613828
1773 Ga0207703_10629957
1774 Ga0207639_10002312
1775 Ga0207639_10003125
1776 Ga0207639_10078769
1777 Ga0207639_10164295
1778 Ga0207639_10284533
1779 Ga0207639_10373307
1780 Ga0207639_10390804
1781 Ga0207639_10438603
1782 Ga0207678_10002308
1783 Ga0207678_10002924
1784 Ga0207678_10056684
1785 Ga0207678_10089385
1786 Ga0207678_10197273
1787 Ga0207708_10115310
1788 Ga0207702_10013261
1789 Ga0207702_10041290
1790 Ga0207702_10484184
1791 Ga0207702_10678788
1792 Ga0207702_10964517
1793 Ga0207641_10025781
1794 Ga0207641_10472548
1795 Ga0207648_10240821
1796 Ga0207648_10260403
1797 Ga0207676_10008206
1798 Ga0207676_10327860
1799 Ga0207676_10507784
1800 Ga0207674_10051394
1801 Ga0207674_10062738
1802 Ga0207674_10097083
1803 Ga0207674_10102592
1804 Ga0207674_10221047
1805 Ga0207674_10339414
1806 Ga0207674_10736496
1807 Ga0207675_100001494
1808 Ga0207675_100226409
1809 Ga0207675_100589291
1810 Ga0207683_10010289
1811 Ga0207683_10176941
1812 Ga0207683_10195506
1813 Ga0207683_10364409
1814 Ga0207698_10008889
1815 Ga0207698_10065836
1816 Ga0207698_10066133
1817 Ga0207698_10198640
1818 Ga0207698_10237607
1819 Ga0207698_10318967
1820 Ga0207698_10490101
1821 Ga0207698_10493751
1822 Ga0209813_10000547
1823 Ga0209813_10157933
1824 Ga0207428_10007154
1825 Ga0207428_10021909
1826 Ga0207428_10074450
1827 Ga0207428_10178470
1828 Ga0268266_10146424
1829 Ga0268266_10170393
1830 Ga0268266_10349811
1831 Ga0268266_10416577
1832 Ga0268266_10577781
1833 Ga0268266_10665643
1834 Ga0268265_10043211
1835 Ga0268265_10115732
1836 Ga0268265_10696602
1837 Ga0268264_10061890
1838 Ga0268264_10108010
1839 Ga0268264_10133677
1840 Ga0268264_10295560
1841 Ga0268264_10295926
1842 Ga0265319_1073507
1843 Ga0265338_10033601
1844 Ga0265338_10042698
1845 Ga0265762_1017404
1846 Ga0265330_10030456
1847 Ga0265332_10005043
1848 Ga0265328_10000218
1849 Ga0265320_10032708
1850 Ga0265325_10019219
1851 Ga0265325_10042711
1852 Ga0265325_10171119
1853 Ga0265329_10035507
1854 Ga0265340_10000340
1855 Ga0265340_10009655
1856 Ga0265340_10095194
1857 Ga0265339_10000068
1858 Ga0265339_10010303
1859 Ga0265339_10075963
1860 Ga0265339_10179057
1861 Ga0265331_10051981
1862 Ga0265327_10034092
1863 Ga0265316_10058920
1864 Ga0265316_10170628
1865 Ga0265316_10175947
1866 Ga0307408_100029248
1867 Ga0307408_100472629
1868 Ga0265313_10000088
1869 Ga0265313_10149566
1870 Ga0316575_10149388
1871 Ga0316579_10011489
1872 Ga0316579_10054739
1873 Ga0265314_10131320
1874 Ga0265342_10000399
1875 Ga0265342_10037926
1876 Ga0265342_10175893
1877 Ga0265342_10210893
1878 Ga0316576_10176805
1879 Ga0316578_10010373
1880 Ga0307405_10018732
1881 Ga0307405_10142639
1882 Ga0307405_10171755
1883 Ga0307405_10321717
1884 Ga0316577_10133267
1885 Ga0307413_10107199
1886 Ga0307413_10226125
1887 Ga0307413_10400380
1888 Ga0307413_10793371
1889 Ga0307413_10917521
1890 Ga0307410_10055411
1891 Ga0307410_10090494
1892 Ga0307410_10274786
1893 Ga0307410_10311193
1894 Ga0307410_10481007
1895 Ga0307406_10061938
1896 Ga0307406_10147840
1897 Ga0307407_10054381
1898 Ga0307407_10074741
1899 Ga0307407_10097345
1900 Ga0307407_10823589
1901 Ga0307412_10040409
1902 Ga0307412_10082451
1903 Ga0307412_10089144
1904 Ga0307412_10117114
1905 Ga0307412_10272515
1906 Ga0307412_10949367
1907 Ga0307409_100010901
1908 Ga0307409_100022096
1909 Ga0307409_100032427
1910 Ga0307409_100067493
1911 Ga0307409_100098856
1912 Ga0307409_100861316
1913 Ga0307409_101089900
1914 Ga0307416_100002549
1915 Ga0307416_100005333
1916 Ga0307416_100073036
1917 Ga0307416_100251862
1918 Ga0307416_101587989
1919 Ga0307414_10001040
1920 Ga0307414_10006477
1921 Ga0307414_10167357
1922 Ga0307414_10406893
1923 Ga0307411_10003258
1924 Ga0307411_10006084
1925 Ga0307411_10006109
1926 Ga0307411_10010035
1927 Ga0307411_10054586
1928 Ga0307411_10063642
1929 Ga0307411_10205136
1930 Ga0307411_10224671
1931 Ga0307411_10239453
1932 Ga0307411_10359858
1933 Ga0307411_10480067
1934 Ga0307415_100004677
1935 Ga0307415_100013659
1936 Ga0307415_100031432
1937 Ga0307415_100134743
1938 Ga0307415_100161715
1939 Ga0307415_100498059
1940 Ga0307415_100685954
1941 Ga0307415_100737304
1942 Ga0316583_10011289
1943 Ga0316585_10010049
1944 Ga0316580_10014622
1945 Ga0316593_10011756
1946 Ga0316587_1046730
1947 Ga0316596_1004566
1948 Ga0373958_0041941
1949 Ga0373959_0121812
1950 Ga0373938_0014004
1951 Ga0373929_0003939
1952 Ga0373929_0090681
1953 Ga0373934_0006122
1954 Ga0373940_0016660
1955 Ga0373923_0084639
1956 Ga0373932_0021648
1957 Ga0373932_0063858
1958 Ga0373936_0005177
1959 Ga0373936_0135158
1960 Ga0373939_0047421
1961 Ga0373939_0152677
1962 Ga0373941_0000346
1963 Ga0373945_0306079
1964 Ga0373953_0025705
1965 Ga0373953_0047451
1966 Ga0373953_0213267
1967 Ga0373954_0023234
1968 Ga0373954_0029189
1969 Ga0373956_0210857
1970 Ga0373957_0087288
1971 Ga0373957_0135035
1972 Ga0373960_0004056
1973 Ga0373943_0036994
1974 Ga0373946_0246314
1975 Ga0373955_0003048
1976 Ga0373955_0008692
1977 Ga0373942_0010535
1978 Ga0373961_0006736
1979 Ga0373962_0035672
1980 Ga0373962_0112893
1981 Ga0316574_0000467
1982 Ga0373924_0061428
1983 Ga0373924_0199458
1984 Ga0373931_0001292
1985 Ga0373931_0002313
1986 Ga0373931_0332445
1987 Ga0373935_0007400
1988 Ga0373935_0146177
1989 Ga0373927_0035512
1990 Ga0373927_0049298
1991 Ga0373927_0062962
1992 Ga0373933_0005821
1993 Ga0373933_0009152
1994 Ga0373933_0622289
1995 Ga0373947_0014629
1996 Ga0373947_0076796
1997 Ga0373947_0164580
1998 Ga0373947_0499461
1999 Ga0373937_0000075
2000 Ga0373937_0000231
2001 Ga0373937_0429887
2002 Ga0373937_0939557
2003 Ga0316582_0040365
2004 Ga0316582_0263607
2005 Ga0316582_0315671
2006 Ga0316584_0091032
2007 Ga0316584_0174508
2008 Ga0316584_0431552
2009 Ga0373925_0000081
2010 Ga0373925_0134123
2011 Ga0395899_0010276
2012 Ga0395899_0021002
2013 Ga0395899_0129909
2014 Ga0395899_0458681
2015 Ga0395900_0063629
2016 Ga0395900_0076737
2017 Ga0395900_0152979
2018 Ga0395898_0052511
2019 Ga0395898_0072191
2020 Ga0395905_0108517
2021 Ga0395905_0128888
2022 Ga0395905_0132823
2023 Ga0395905_0166922
2024 Ga0395905_0476632
2025 Ga0316581_0034438
2026 Ga0316581_0097300
2027 Ga0436364_0721077
2028 Ga0436364_1243640
2029 Ga0395901_0030541
2030 Ga0395901_0095901
2031 Ga0395901_0454161
2032 Ga0400490_34472
2033 Ga0400488_04486
2034 Ga0400488_59215
2035 Ga0400483_041422
2036 Ga0400483_184515
2037 Ga0400483_277636
2038 Ga0436365_0565920
2039 Ga0436365_1068013
2040 Ga0436365_1655375
2041 Ga0436365_1751841
2042 Ga0436361_0689606
2043 Ga0436362_0544081
2044 Ga0436362_1064891
2045 Ga0439453_0006563
2046 Ga0439453_0012916
2047 Ga0451807_1298589
2048 Ga0451843_0940280
2049 Ga0439437_014891
2050 Ga0439443_023327
2051 Ga0439445_0004377
2052 Ga0450910_050728
2053 Ga0439434_0049122
2054 Ga0439435_0086503
2055 Ga0439459_0118537
2056 Ga0439464_0083940
2057 Ga0439460_0219031
2058 Ga0451577_0213699
2059 Ga0451577_0298959
2060 Ga0466969_0091404
2061 Ga0466972_0146519
2062 Ga0466972_0273069
2063 Ga0466966_0015054
2064 Ga0466966_0070826
2065 Ga0466961_0298972
2066 Ga0466963_0103267
2067 Ga0466964_0208197
2068 Ga0453684_0042475
2069 Ga0453684_0166907
2070 Ga0453684_0741911
2071 Ga0466968_0053193
2072 Ga0466970_0024076
2073 Ga0466970_0285414
2074 Ga0466957_0019054
2075 Ga0466957_0414682
2076 Ga0466957_0484359
2077 Ga0466960_0054564
2078 Ga0466959_0048339
2079 Ga0451576_0005522
2080 Ga0451576_0103697
2081 Ga0451576_0168558
2082 Ga0466967_0039462
2083 Ga0466967_0087942
2084 Ga0466967_0088711
2085 Ga0466967_0165787
2086 Ga0466967_1098706
2087 Ga0495592_0000102
2088 Ga0495592_0000694
2089 Ga0495629_0008845
2090 Ga0495629_0072659
2091 Ga0495638_0009457
2092 Ga0495651_0001342
2093 Ga0495653_0000681
2094 Ga0495653_0011013
2095 Ga0495582_0130616
2096 Ga0495639_0149172
2097 Ga0495664_0000016
2098 Ga0495664_0004663
2099 Ga0495584_0053441
2100 Ga0495585_0056622
2101 Ga0495585_0194871
2102 Ga0495608_0000006
2103 Ga0495608_0016534
2104 Ga0495618_0007196
2105 Ga0495618_0064002
2106 Ga0495628_0000018
2107 Ga0495628_0008859
2108 Ga0495628_0072643
2109 Ga0495630_0010531
2110 Ga0495630_0113607
2111 Ga0495632_0307532
2112 Ga0495663_0009581
2113 Ga0495652_0000005
2114 Ga0495652_0072584
2115 Ga0495652_0147864
2116 Ga0495640_0002500
2117 Ga0495640_0012152
2118 Ga0495640_0198506
2119 Ga0495640_0547187
2120 Ga0495587_0000043
2121 Ga0495587_0000753
2122 Ga0495598_0004644
2123 Ga0495609_0234018
2124 Ga0495621_0006102
2125 Ga0495645_0000064
2126 Ga0495645_0116750
2127 Ga0495645_0168904
2128 Ga0495633_0005946
2129 Ga0495667_0000023
2130 Ga0495667_0000450
2131 Ga0495667_0117499
2132 Ga0495656_0157287
2133 Ga0495668_0463385
2134 Ga0495634_0002682
2135 Ga0495634_0005621
2136 Ga0495634_0457636
2137 Ga0495635_0000021
2138 Ga0495635_0001541
2139 Ga0495659_0071561
2140 Ga0495661_0108596
2141 Ga0495657_0011026
2142 Ga0495599_0002496
2143 Ga0495599_0007280
2144 Ga0495623_0003470
2145 Ga0495623_0008462
2146 Ga0495646_0000027
2147 Ga0495658_0129781
2148 Ga0495658_0364187
2149 Ga0495669_0022836
2150 Ga0495669_0033137
2151 Ga0495613_0199191
2152 Ga0495613_0748630
2153 Ga0495624_0415031
2154 Ga0495624_0492094
2155 Ga0495670_0035903
2156 Ga0495670_0114858
2157 Ga0495589_0075431
2158 Ga0495600_0000047
2159 Ga0495600_0001179
2160 Ga0495604_0000014
2161 Ga0495604_0001199
2162 Ga0495604_0107838
2163 Ga0495636_0298178
2164 Ga0495674_0000014
2165 Ga0495674_0000573
2166 Ga0495676_0045729
2167 Ga0495680_0000285
2168 Ga0495680_0002949
2169 Ga0495680_0351320
2170 Ga0495675_0032125
2171 Ga0495675_0066501
2172 Ga0495675_0450347
2173 Ga0495677_0052449
2174 Ga0495677_0102171
2175 Ga0495684_0011810
2176 Ga0495684_0024992
2177 Ga0495686_0106680
2178 Ga0495593_0032963
2179 Ga0495593_0210655
2180 Ga0495593_0257106
2181 Ga0495602_0000017
2182 Ga0495602_0007083
2183 Ga0496100_0124207
2184 Ga0496101_0067877
2185 Ga0496101_0594585
2186 Ga0496102_0088819
2187 Ga0496102_0748219
2188 Ga0496103_0050675
2189 Ga0496104_0334729
2190 Ga0496104_0436585
2191 Ga0496105_0106651
2192 Ga0496105_0283645
2193 Ga0496108_0028372
2194 Ga0496108_0052890
2195 Ga0496108_0138631
2196 Ga0496108_0400326
2197 Ga0496109_0012227
2198 Ga0496109_0086385
2199 Ga0496109_0425520
2200 Ga0496110_0050539
2201 Ga0496110_0276164
2202 Ga0496110_0347132
2203 Ga0496110_0690529
2204 Ga0496111_0015254
2205 Ga0496111_0670567
2206 Ga0496112_0040251
2207 Ga0496112_0116807
2208 Ga0496113_0198353
2209 Ga0496113_1000798
2210 Ga0496114_0156254
2211 Ga0496114_0188115
2212 Ga0496114_0338092
2213 Ga0496114_0670356
2214 Ga0496115_0651006
2215 Ga0496121_0171993
2216 Ga0496121_0582876
2217 Ga0496126_0699576
2218 Ga0501290_000464
2219 Ga0501292_000026
2220 Ga0501294_000620
2221 Ga0501317_062296
2222 Ga0501031_0002683
2223 Ga0501031_0031678
2224 Ga0501031_0033840
2225 Ga0501031_0139148
2226 Ga0501031_0352347
2227 Ga0501032_0006465
2228 Ga0501032_0007303
2229 Ga0501032_0008238
2230 Ga0501032_0029554
2231 Ga0501032_0034383
2232 Ga0501032_0055046
2233 Ga0501032_0134960
2234 Ga0501033_0004363
2235 Ga0501033_0015275
2236 Ga0501033_0034895
2237 Ga0501033_0062891
2238 Ga0501033_0081556
2239 Ga0501033_0092428
2240 Ga0501033_0111769
2241 Ga0501033_0123637
2242 Ga0501033_0284288
2243 Ga0501034_0000166
2244 Ga0501034_0000250
2245 Ga0501034_0004004
2246 Ga0501034_0011589
2247 Ga0501034_0015288
2248 Ga0501034_0022969
2249 Ga0501034_0053963
2250 Ga0501034_0055243
2251 Ga0501034_0074320
2252 Ga0501034_0093981
2253 Ga0501034_0109847
2254 Ga0501034_0172691
2255 Ga0501034_0321395
2256 Ga0501034_0528818
2257 Ga0501034_0810090
2258 Ga0501034_0865926
2259 Ga0501036_0000098
2260 Ga0501036_0000118
2261 Ga0501036_0011524
2262 Ga0501036_0059781
2263 Ga0501036_0096933
2264 Ga0501036_0172034
2265 Ga0501036_0212665
2266 Ga0501036_0236143
2267 Ga0501036_0272062
2268 Ga0501036_0322427
2269 Ga0501036_0391656
2270 Ga0501036_0445366
2271 Ga0501037_0000092
2272 Ga0501037_0002056
2273 Ga0501037_0021237
2274 Ga0501037_0082921
2275 Ga0501037_0165148
2276 Ga0501037_0188274
2277 Ga0501037_0240667
2278 Ga0501037_0554087
2279 Ga0501038_0000059
2280 Ga0501038_0011141
2281 Ga0501038_0020000
2282 Ga0501038_0028839
2283 Ga0501038_0088715
2284 Ga0501038_0196113
2285 Ga0501038_0280926
2286 Ga0501038_0282712
2287 Ga0501038_0286085
2288 Ga0501038_0328335
2289 Ga0501038_0358729
2290 Ga0501039_0000547
2291 Ga0501039_0000554
2292 Ga0501039_0016705
2293 Ga0501039_0036429
2294 Ga0501039_0063880
2295 Ga0501039_0086154
2296 Ga0501039_0222742
2297 Ga0501039_0597706
2298 Ga0501039_0600368
2299 Ga0501040_0018492
2300 Ga0501040_0032602
2301 Ga0501040_0089782
2302 Ga0501040_0475150
2303 Ga0501040_0482988
2304 Ga0501040_0491450
2305 Ga0501040_0673822
2306 Ga0501041_0040615
2307 Ga0501041_0247238
2308 Ga0501041_0405466
2309 Ga0501041_0479545
2310 Ga0501042_0040851
2311 Ga0501042_0055463
2312 Ga0501042_0094903
2313 Ga0501042_0380823
2314 Ga0501042_0614942
2315 Ga0501042_0634531
2316 Ga0501043_0003262
2317 Ga0501043_0004952
2318 Ga0501043_0025398
2319 Ga0501043_0037821
2320 Ga0501043_0074646
2321 Ga0501043_0091286
2322 Ga0501043_0106599
2323 Ga0501043_0131322
2324 Ga0501043_0568607
2325 Ga0501043_1021618
2326 Ga0501046_0000483
2327 Ga0501046_0007623
2328 Ga0501046_0008888
2329 Ga0501046_0019056
2330 Ga0501046_0024112
2331 Ga0501046_0041977
2332 Ga0501046_0105086
2333 Ga0501046_0209038
2334 Ga0501046_0574290
2335 Ga0501047_0000022
2336 Ga0501047_0000097
2337 Ga0501047_0002349
2338 Ga0501047_0011286
2339 Ga0501047_0089266
2340 Ga0501047_0150648
2341 Ga0501047_0173726
2342 Ga0501047_0175046
2343 Ga0501047_0199679
2344 Ga0501047_0249337
2345 Ga0501047_0460618
2346 Ga0501048_0000522
2347 Ga0501048_0000821
2348 Ga0501048_0021257
2349 Ga0501048_0178190
2350 Ga0501048_0192599
2351 Ga0501048_0219615
2352 Ga0501048_0279696
2353 Ga0501067_0000576
2354 Ga0501067_0000688
2355 Ga0501067_0003424
2356 Ga0501067_0007963
2357 Ga0501067_0015150
2358 Ga0501068_0000490
2359 Ga0501068_0001239
2360 Ga0501068_0035913
2361 Ga0501068_0083205
2362 Ga0501068_0104234
2363 Ga0501068_0303221
2364 Ga0501069_0000707
2365 Ga0501069_0006762
2366 Ga0501069_0026803
2367 Ga0501069_0040815
2368 Ga0501069_0162399
2369 Ga0501070_0002047
2370 Ga0501070_0028005
2371 Ga0501070_0037453
2372 Ga0501070_0037536
2373 Ga0501070_0040620
2374 Ga0501070_0063974
2375 Ga0501070_0191397
2376 Ga0501070_0318792
2377 Ga0501071_0008806
2378 Ga0501071_0437350
2379 Ga0501071_1012439
2380 Ga0501072_0000001
2381 Ga0501072_0000327
2382 Ga0501072_0001893
2383 Ga0501072_0043315
2384 Ga0501072_0100111
2385 Ga0501072_0119346
2386 Ga0501072_0121979
2387 Ga0501072_0122605
2388 Ga0501072_0175315
2389 Ga0501072_0215532
2390 Ga0501072_0447048
2391 Ga0501073_0000955
2392 Ga0501073_0008009
2393 Ga0501073_0024073
2394 Ga0501073_0085422
2395 Ga0501073_0097498
2396 Ga0501073_0113888
2397 Ga0501073_0144272
2398 Ga0501073_0153521
2399 Ga0501073_0171543
2400 Ga0501073_0196087
2401 Ga0501073_0196188
2402 Ga0501073_0199601
2403 Ga0501073_0241066
2404 Ga0501073_0350342
2405 Ga0501073_0573255
2406 Ga0501074_0003990
2407 Ga0501074_0004790
2408 Ga0501074_0007646
2409 Ga0501074_0024225
2410 Ga0501074_0044060
2411 Ga0501074_0064647
2412 Ga0501074_0305811
2413 Ga0501074_0406516
2414 Ga0501074_0846186
2415 Ga0501075_0072162
2416 Ga0501075_0599849
2417 Ga0501076_0021371
2418 Ga0501076_0122551
2419 Ga0501076_0125455
2420 Ga0501076_0185229
2421 Ga0501076_0246670
2422 Ga0501076_0313118
2423 Ga0501076_1255141
2424 Ga0501077_0091077
2425 Ga0501077_0187026
2426 Ga0501077_0428101
2427 Ga0501222_000640
2428 Ga0501223_005742
2429 Ga0501227_010889
2430 Ga0501249_007946
2431 Ga0501259_000268
2432 Ga0501225_0040742
2433 Ga0501079_0006980
2434 Ga0501079_0071163
2435 Ga0501079_0076463
2436 Ga0501079_0080214
2437 Ga0501079_0111899
2438 Ga0501079_0120015
2439 Ga0501079_0140114
2440 Ga0501079_0489445
2441 Ga0501080_0000047
2442 Ga0501080_0000075
2443 Ga0501080_0005687
2444 Ga0501080_0011853
2445 Ga0501080_0034243
2446 Ga0501080_0159108
2447 Ga0501080_0242492
2448 Ga0501080_0520373
2449 Ga0501080_0724103
2450 Ga0501080_0812448
2451 Ga0501080_0861557
2452 Ga0501080_1118815
2453 Ga0501081_0008289
2454 Ga0501081_0166382
2455 Ga0501081_0180111
2456 Ga0501081_1113279
2457 Ga0501083_0000694
2458 Ga0501083_0000808
2459 Ga0501083_0000857
2460 Ga0501083_0010083
2461 Ga0501083_0032304
2462 Ga0501083_0105896
2463 Ga0501083_0126195
2464 Ga0501083_0148049
2465 Ga0501083_0180010
2466 Ga0501267_003024
2467 Ga0501279_000027
2468 Ga0501280_000044
2469 Ga0501281_04599
2470 Ga0501282_000334
2471 Ga0501035_0000084
2472 Ga0501035_0000222
2473 Ga0501035_0000240
2474 Ga0501035_0023093
2475 Ga0501035_0093910
2476 Ga0501035_0134538
2477 Ga0501035_0186337
2478 Ga0501035_0195686
2479 Ga0501035_0404362
2480 Ga0501035_0601317
2481 Ga0501035_0725229
2482 Ga0501044_0000072
2483 Ga0501044_0000073
2484 Ga0501044_0000122
2485 Ga0501044_0009895
2486 Ga0501044_0026426
2487 Ga0501044_0037991
2488 Ga0501044_0084636
2489 Ga0501044_0195581
2490 Ga0501044_0244736
2491 Ga0501044_0289043
2492 Ga0501044_0318044
2493 Ga0501044_0351893
2494 Ga0501044_0745093
2495 Ga0501045_0020260
2496 Ga0501045_0056835
2497 Ga0501045_0107574
2498 Ga0501045_0140486
2499 Ga0501045_0159840
2500 Ga0501045_0400872
2501 Ga0501045_0766462
2502 nmdc:mga03683_105249_c1
2503 nmdc:mga03683_10611_c1
2504 nmdc:mga03683_14732_c1
2505 nmdc:mga03n38_111658_c1
2506 nmdc:mga03n38_112709_c1
2507 nmdc:mga03n38_11414_c1
2508 nmdc:mga00v17_10354_c1
2509 nmdc:mga00v17_459614_c1
2510 nmdc:mga00v17_498095_c1
2511 nmdc:mga00v17_590400_c1
2512 nmdc:mga00v17_608140_c1
2513 nmdc:mga0yw44_572322_c1
2514 nmdc:mga0yw44_661200_c1
2515 nmdc:mga0k408_14308_c1
2516 nmdc:mga0k408_19574_c1
2517 nmdc:mga0k408_19827_c1
2518 nmdc:mga0k408_226323_c1
2519 nmdc:mga06z11_33274_c1
2520 nmdc:mga06z11_717_c1
2521 nmdc:mga04h51_183045_c1
2522 nmdc:mga04h51_261_c1
2523 nmdc:mga04h51_333897_c1
2524 nmdc:mga07m45_172315_c1
2525 nmdc:mga07m45_7_c1
2526 nmdc:mga05p37_223527_c1
2527 nmdc:mga05p37_387146_c1
2528 nmdc:mga05p37_462759_c1
2529 nmdc:mga05p37_564_c1
2530 nmdc:mga05p37_816617_c1
2531 nmdc:mga09592_19928_c1
2532 nmdc:mga09592_20905_c1
2533 nmdc:mga09592_225653_c1
2534 nmdc:mga09592_26841_c1
2535 nmdc:mga09592_58331_c1
2536 nmdc:mga0qj67_1194_c1
2537 nmdc:mga0qj67_139012_c1
2538 nmdc:mga0qj67_176641_c1
2539 nmdc:mga0qj67_611093_c1
2540 nmdc:mga06r32_1217376_c1
2541 nmdc:mga06r32_13924_c1
2542 nmdc:mga06r32_191_c1
2543 nmdc:mga06r32_360112_c1
2544 nmdc:mga06r32_437492_c1
2545 nmdc:mga06r32_8176_c1
2546 nmdc:mga08y16_14382_c1
2547 nmdc:mga08y16_330510_c1
2548 nmdc:mga08y16_4792_c1
2549 nmdc:mga08y16_79789_c1
2550 nmdc:mga08y16_89_c1
2551 nmdc:mga08y16_963796_c1
2552 nmdc:mga0n895_11749_c1
2553 nmdc:mga0rr50_576898_c1
2554 nmdc:mga0rr50_684664_c1
2555 nmdc:mga08x19_45856_c1
2556 nmdc:mga08x19_523752_c1
2557 nmdc:mga0a205_272836_c1
2558 nmdc:mga0a205_34901_c1
2559 nmdc:mga0a205_411557_c1
2560 nmdc:mga0a205_880256_c1
2561 nmdc:mga0sz30_304608_c1
2562 nmdc:mga0sz30_3060_c1
2563 Ga0495601_0000016
2564 Ga0495601_0019662
2565 Ga0495601_0063264
2566 Ga0495601_0083752
2567 Ga0495612_0000041
2568 Ga0495612_0000733
2569 Ga0495595_0000578
2570 Ga0495595_0002928
2571 Ga0495595_0017378
2572 Ga0495595_0156438
2573 Ga0495619_0002914
2574 Ga0495619_0007913
2575 Ga0500643_000065
2576 Ga0500646_0070812
2577 Ga0500566_0265020
2578 Ga0500566_0298727
2579 Ga0500641_0002717
2580 Ga0500641_0007230
2581 Ga0500592_000384
2582 Ga0500594_0195330
2583 Ga0500595_007591
2584 Ga0500607_000854
2585 Ga0500607_004296
2586 Ga0500642_0314401
2587 Ga0500652_000090
2588 Ga0500652_003278
2589 Ga0500658_0080953
2590 Ga0500559_0002140
2591 Ga0500604_0000065
2592 Ga0500616_0036739
2593 Ga0500616_0047136
2594 Ga0500627_0000551
2595 Ga0500627_0251533
2596 Ga0500636_0044766
2597 Ga0500645_000261
2598 Ga0500645_001908
2599 Ga0500645_094918
2600 Ga0501084_0000079
2601 Ga0501084_0003295
2602 Ga0501084_0032719
2603 Ga0501084_0068755
2604 Ga0501084_0090467
2605 Ga0501084_0110255
2606 Ga0501084_0140691
2607 Ga0501084_0446536
2608 Ga0501084_0476620
2609 Ga0501084_0547947
2610 Ga0590075_064910
2611 Ga0590075_075302
2612 Ga0587077_106110
2613 Ga0587106_028992
2614 Ga0587062_029273
2615 Ga0587076_045819
2616 Ga0587079_084023
2617 Ga0501082_0001185
2618 Ga0501082_0001707
2619 Ga0501082_0004072
2620 Ga0501082_0015079
2621 Ga0501082_0032192
2622 Ga0501082_0074277
2623 Ga0501082_0153261
2624 Ga0501082_0154605
2625 Ga0501082_0244555
2626 Ga0501082_0282206
2627 Ga0501082_0339784
2628 Ga0501082_0395956
2629 Ga0501082_0433953
2630 Ga0501082_0451088
2631 Ga0501082_0517308
2632 Ga0530510_0035312
2633 Ga0530510_0079605
2634 Ga0530510_0604927
2635 Ga0530510_1112104
2636 2523469174
2637 2671693545
2638 2894822242
2639 2896185693
2640 2917558208
2641 2929298512
2642 3000867000

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00227

Proteasome

Proteasome subunit

36

208

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g4e-assembly1.cif.gz_B crystal structure of the l88a mutant of hslv from escherichia coli 0.9812 5 174
2z3a-assembly1.cif.gz_J crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus 0.9741 2 174
3ty6-assembly1.cif.gz_D atp-dependent protease hslv from bacillus anthracis str. ames 0.9727 2 174
1m4y-assembly1.cif.gz_A crystal structure of hslv from thermotoga maritima 0.9726 5 174
1ofi-assembly2.cif.gz_N asymmetric complex between hslv and i-domain deleted hslu (h. influenzae) 0.9708 5 174
ID Description Score Start End Superfamily
1nedC00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.977 5 174 3.60.20.10
af_Q12375_14_292_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9693 130 158 1.50.40.10
1nedC00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9496 5 174 3.60.20.10
5fmga00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8647 2 173 3.60.20.10
1pma100 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8629 5 174 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A356VCR6-F1-model_v4 deleted 0.9938 45 174
AF-A0A1G3ZRR4-F1-model_v4 deleted 0.9937 2 174
AF-A0A2N6DFI9-F1-model_v4 ATP-dependent protease subunit HslV (EC 3.4.25.2) 0.9926 2 174 GO:0004298
GO:0005839
GO:0009376
GO:0046872
GO:0051603
AF-A0A2G2IKE4-F1-model_v4 ATP-dependent protease subunit HslV (EC 3.4.25.2) 0.9922 4 174 GO:0004298
GO:0005839
GO:0009376
GO:0046872
GO:0051603
AF-A0A1Q7RN31-F1-model_v4 ATP-dependent protease subunit HslV (EC 3.4.25.2) 0.9919 2 174 GO:0004298
GO:0005839
GO:0009376
GO:0046872
GO:0051603

Map