F492967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1320 | 506 | 1278 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100029853|Ga0068859_1000298536 |
| Length | 107 |
| Sequence | MGQDCGDTCVKLLTGNDLATGDVTWWTGDGWSRHVEDAVDVGAQGEAIAHTEEGARRVNAPYVIDATAAPEGPRPAHIKDRIRALGPTVRPDLTLKPADPAVGSWVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 7 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 8 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 9 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 10 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 11 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 12 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 13 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 14 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 15 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 16 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 17 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 18 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 19 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 20 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 21 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 22 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 23 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 24 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 25 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 26 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 27 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 28 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 29 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 30 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 31 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 32 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 33 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 34 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 35 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 36 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 37 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 38 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 39 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 40 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 41 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 42 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 43 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 45 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 48 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 49 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 50 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 51 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 52 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 53 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 54 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 55 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 56 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 57 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 81 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 111 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 112 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 117 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 122 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 123 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 124 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 125 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 126 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 172 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 251 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 272 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 281 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 282 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 290 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 291 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 292 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 293 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 294 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 295 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 296 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 297 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 298 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 299 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 300 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 301 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 302 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 303 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 304 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 305 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 306 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 310 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 376 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 377 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 378 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 379 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 380 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 381 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 382 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 385 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 386 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 391 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 392 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 393 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 394 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 395 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 396 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 419 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 420 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 421 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 422 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 423 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 427 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 429 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 430 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 431 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 432 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 433 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 434 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 435 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 438 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 439 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 440 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 441 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 442 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 443 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 447 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 448 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 451 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 452 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 453 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 459 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 460 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 461 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 462 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 463 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 464 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 466 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 469 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 470 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 471 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 472 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 473 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 475 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 476 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 478 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 481 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 483 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 484 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 485 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 488 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 489 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 493 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 496 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 497 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.92 |
| Metatranscriptomes | 1.89 |
| Isolates | 3.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.38 |
| Bulb | 0 |
| Endosphere | 17.05 |
| Nodule | 0.15 |
| Rhizoplane | 3.48 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2770192 | 2162886007 | Bacteria | 20530 |
| 2 | SwRhRL2b_contig_433849 | 2162886007 | Bacteria | 2461 |
| 3 | ARcpr5yngRDRAFT_c005141 | 3300000043 | Bacteria | 1215 |
| 4 | JGI24736J21556_1006519 | 3300001904 | Bacteria | 1963 |
| 5 | JGI24741J21665_1001599 | 3300001915 | Bacteria | 6361 |
| 6 | JGI24741J21665_1002509 | 3300001915 | Bacteria | 4747 |
| 7 | JGI24740J21852_10001016 | 3300001979 | Bacteria | 12545 |
| 8 | JGI24739J22299_10000602 | 3300001989 | Bacteria | 12961 |
| 9 | JGI24739J22299_10007241 | 3300001989 | Bacteria | 4171 |
| 10 | JGI24739J22299_10016593 | 3300001989 | Bacteria | 2664 |
| 11 | JGI24737J22298_10001956 | 3300001990 | Bacteria | 7369 |
| 12 | JGI24737J22298_10008892 | 3300001990 | Bacteria | 3352 |
| 13 | JGI24737J22298_10014616 | 3300001990 | Bacteria | 2547 |
| 14 | JGI24737J22298_10044176 | 3300001990 | Bacteria | 1363 |
| 15 | JGI24735J21928_10004916 | 3300002067 | Bacteria | 4455 |
| 16 | JGI24738J21930_10002190 | 3300002075 | Bacteria | 5208 |
| 17 | JGI24738J21930_10016432 | 3300002075 | Bacteria | 1563 |
| 18 | JGI24035J26624_1005781 | 3300002126 | Bacteria | 1187 |
| 19 | JGI24751J29686_10000159 | 3300002459 | Bacteria | 32221 |
| 20 | JGI24751J29686_10026087 | 3300002459 | Bacteria | 1212 |
| 21 | JGI25150J39212_1000213 | 3300002774 | Bacteria | 31530 |
| 22 | JGI25151J46595_10052017 | 3300003187 | Bacteria | 1381 |
| 23 | JGI25165J46597_1000012 | 3300003214 | Bacteria | 421074 |
| 24 | JGI25153J46596_10000016 | 3300003215 | Bacteria | 285917 |
| 25 | JGI25153J46596_10000036 | 3300003215 | Bacteria | 182205 |
| 26 | JGI25153J46596_10028563 | 3300003215 | Bacteria | 1931 |
| 27 | JGI25160J50197_1065978 | 3300003354 | Bacteria | 705 |
| 28 | Ga0055539_1039470 | 3300003752 | Bacteria | 511 |
| 29 | Ga0055525_1000035 | 3300003759 | Bacteria | 300887 |
| 30 | Ga0055542_1000060 | 3300003762 | Bacteria | 162275 |
| 31 | Ga0055529_1000043 | 3300003763 | Bacteria | 221704 |
| 32 | Ga0055526_1000948 | 3300003771 | Bacteria | 21478 |
| 33 | Ga0055537_1001825 | 3300003773 | Bacteria | 7709 |
| 34 | Ga0055524_1000180 | 3300003775 | Bacteria | 71495 |
| 35 | Ga0055536_1000520 | 3300003781 | Bacteria | 26554 |
| 36 | Ga0055536_1006261 | 3300003781 | Bacteria | 5608 |
| 37 | Ga0055536_1029291 | 3300003781 | Bacteria | 1481 |
| 38 | Ga0055528_1037468 | 3300003790 | Bacteria | 1140 |
| 39 | Ga0055528_1046726 | 3300003790 | Bacteria | 910 |
| 40 | Ga0055530_10001171 | 3300003791 | Bacteria | 20279 |
| 41 | Ga0055530_10001368 | 3300003791 | Bacteria | 18071 |
| 42 | Ga0055530_10007997 | 3300003791 | Bacteria | 4322 |
| 43 | Ga0055530_10020941 | 3300003791 | Bacteria | 1939 |
| 44 | Ga0055530_10030601 | 3300003791 | Bacteria | 1423 |
| 45 | Ga0055540_1001281 | 3300003792 | Bacteria | 15301 |
| 46 | Ga0055540_1005532 | 3300003792 | Bacteria | 5280 |
| 47 | Ga0055531_10000161 | 3300003794 | Bacteria | 76455 |
| 48 | Ga0055531_10004136 | 3300003794 | Bacteria | 8964 |
| 49 | Ga0055531_10008952 | 3300003794 | Bacteria | 5182 |
| 50 | Ga0055531_10011225 | 3300003794 | Bacteria | 4350 |
| 51 | Ga0055543_1054170 | 3300004625 | Bacteria | 653 |
| 52 | Ga0065165_1001869 | 3300005262 | Bacteria | 20423 |
| 53 | Ga0065165_1004474 | 3300005262 | Bacteria | 8626 |
| 54 | Ga0065165_1017219 | 3300005262 | Bacteria | 2672 |
| 55 | Ga0065165_1066773 | 3300005262 | Bacteria | 967 |
| 56 | Ga0065165_1097225 | 3300005262 | Bacteria | 742 |
| 57 | Ga0065165_1138182 | 3300005262 | Bacteria | 578 |
| 58 | Ga0065704_10001418 | 3300005289 | Bacteria | 7876 |
| 59 | Ga0065704_10072077 | 3300005289 | Bacteria | 9198 |
| 60 | Ga0065704_10310336 | 3300005289 | Bacteria | 869 |
| 61 | Ga0065707_10023450 | 3300005295 | Bacteria | 1631 |
| 62 | Ga0065707_10082272 | 3300005295 | Bacteria | 17771 |
| 63 | Ga0065707_10100910 | 3300005295 | Bacteria | 2896 |
| 64 | Ga0065707_10107929 | 3300005295 | Bacteria | 2532 |
| 65 | Ga0065707_10193463 | 3300005295 | Bacteria | 1348 |
| 66 | Ga0065707_10312100 | 3300005295 | Bacteria | 983 |
| 67 | Ga0070658_10044373 | 3300005327 | Bacteria | 3593 |
| 68 | Ga0070658_10064042 | 3300005327 | Bacteria | 2998 |
| 69 | Ga0070658_10472506 | 3300005327 | Bacteria | 1082 |
| 70 | Ga0070658_10637336 | 3300005327 | Bacteria | 924 |
| 71 | Ga0070658_11043948 | 3300005327 | Bacteria | 711 |
| 72 | Ga0070658_11233995 | 3300005327 | Bacteria | 650 |
| 73 | Ga0070658_11417436 | 3300005327 | Bacteria | 603 |
| 74 | Ga0070676_11331128 | 3300005328 | Bacteria | 549 |
| 75 | Ga0070683_100147795 | 3300005329 | Bacteria | 2227 |
| 76 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 77 | Ga0070670_100155226 | 3300005331 | Bacteria | 1982 |
| 78 | Ga0070670_100245274 | 3300005331 | Bacteria | 1560 |
| 79 | Ga0070670_100864713 | 3300005331 | Bacteria | 818 |
| 80 | Ga0070670_100961164 | 3300005331 | Bacteria | 776 |
| 81 | Ga0070677_10024455 | 3300005333 | Bacteria | 2246 |
| 82 | Ga0070677_10559906 | 3300005333 | Bacteria | 628 |
| 83 | Ga0070666_10000063 | 3300005335 | Bacteria | 80378 |
| 84 | Ga0070666_10322469 | 3300005335 | Bacteria | 1102 |
| 85 | Ga0070666_11310846 | 3300005335 | Bacteria | 540 |
| 86 | Ga0068868_100962179 | 3300005338 | Bacteria | 779 |
| 87 | Ga0070660_100269472 | 3300005339 | Bacteria | 1391 |
| 88 | Ga0070660_101297513 | 3300005339 | Bacteria | 618 |
| 89 | Ga0070660_101775554 | 3300005339 | Bacteria | 525 |
| 90 | Ga0070660_101775555 | 3300005339 | Bacteria | 525 |
| 91 | Ga0070687_100234450 | 3300005343 | Bacteria | 1131 |
| 92 | Ga0070661_100112568 | 3300005344 | Bacteria | 2033 |
| 93 | Ga0070661_100316764 | 3300005344 | Bacteria | 1217 |
| 94 | Ga0070668_100013413 | 3300005347 | Bacteria | 6116 |
| 95 | Ga0070668_100027226 | 3300005347 | Bacteria | 4340 |
| 96 | Ga0070668_100056776 | 3300005347 | Bacteria | 3024 |
| 97 | Ga0070668_100928378 | 3300005347 | Bacteria | 779 |
| 98 | Ga0070668_100936694 | 3300005347 | Bacteria | 776 |
| 99 | Ga0070668_101482836 | 3300005347 | Bacteria | 620 |
| 100 | Ga0070669_100000042 | 3300005353 | Bacteria | 123396 |
| 101 | Ga0070669_100000044 | 3300005353 | Bacteria | 121087 |
| 102 | Ga0070669_100127069 | 3300005353 | Bacteria | 1952 |
| 103 | Ga0070669_100167169 | 3300005353 | Bacteria | 1713 |
| 104 | Ga0070669_100252260 | 3300005353 | Bacteria | 1405 |
| 105 | Ga0070669_100256143 | 3300005353 | Bacteria | 1395 |
| 106 | Ga0070669_100301438 | 3300005353 | Bacteria | 1289 |
| 107 | Ga0070669_100663394 | 3300005353 | Bacteria | 878 |
| 108 | Ga0070669_100689710 | 3300005353 | Bacteria | 862 |
| 109 | Ga0070669_100761649 | 3300005353 | Bacteria | 821 |
| 110 | Ga0070669_101996165 | 3300005353 | Bacteria | 507 |
| 111 | Ga0070675_100572366 | 3300005354 | Bacteria | 1023 |
| 112 | Ga0070675_100862714 | 3300005354 | Bacteria | 829 |
| 113 | Ga0070671_100000002 | 3300005355 | Bacteria | 292733 |
| 114 | Ga0070671_100043617 | 3300005355 | Bacteria | 3727 |
| 115 | Ga0070671_100060147 | 3300005355 | Bacteria | 3163 |
| 116 | Ga0070674_100000171 | 3300005356 | Bacteria | 30183 |
| 117 | Ga0070674_100159052 | 3300005356 | Bacteria | 1712 |
| 118 | Ga0070673_100203220 | 3300005364 | Bacteria | 1707 |
| 119 | Ga0070673_101271275 | 3300005364 | Bacteria | 691 |
| 120 | Ga0070659_100025300 | 3300005366 | Bacteria | 4557 |
| 121 | Ga0070659_100081800 | 3300005366 | Bacteria | 2579 |
| 122 | Ga0070659_100695800 | 3300005366 | Bacteria | 879 |
| 123 | Ga0070667_100004979 | 3300005367 | Bacteria | 11135 |
| 124 | Ga0070667_100035266 | 3300005367 | Bacteria | 4190 |
| 125 | Ga0070667_100243171 | 3300005367 | Bacteria | 1607 |
| 126 | Ga0070667_100547652 | 3300005367 | Bacteria | 1063 |
| 127 | Ga0070667_101629213 | 3300005367 | Bacteria | 607 |
| 128 | Ga0070700_101157030 | 3300005441 | Bacteria | 644 |
| 129 | Ga0070663_100001785 | 3300005455 | Bacteria | 11967 |
| 130 | Ga0070663_100347233 | 3300005455 | Bacteria | 1200 |
| 131 | Ga0070663_101253680 | 3300005455 | Bacteria | 653 |
| 132 | Ga0070678_100000584 | 3300005456 | Bacteria | 17915 |
| 133 | Ga0070678_100478977 | 3300005456 | Bacteria | 1095 |
| 134 | Ga0070662_100009003 | 3300005457 | Bacteria | 6513 |
| 135 | Ga0070662_100277877 | 3300005457 | Bacteria | 1354 |
| 136 | Ga0070662_101947430 | 3300005457 | Bacteria | 508 |
| 137 | Ga0070662_101971406 | 3300005457 | Bacteria | 504 |
| 138 | Ga0070685_10924414 | 3300005466 | Bacteria | 650 |
| 139 | Ga0070685_11049281 | 3300005466 | Bacteria | 614 |
| 140 | Ga0070707_100360654 | 3300005468 | Bacteria | 1412 |
| 141 | Ga0070707_100687156 | 3300005468 | Bacteria | 986 |
| 142 | Ga0070698_100548793 | 3300005471 | Bacteria | 1095 |
| 143 | Ga0070679_100311083 | 3300005530 | Bacteria | 1525 |
| 144 | Ga0070684_100060440 | 3300005535 | Bacteria | 3315 |
| 145 | Ga0070684_100361698 | 3300005535 | Bacteria | 1335 |
| 146 | Ga0068853_100252410 | 3300005539 | Bacteria | 1619 |
| 147 | Ga0068853_100285758 | 3300005539 | Bacteria | 1521 |
| 148 | Ga0068853_100891734 | 3300005539 | Bacteria | 854 |
| 149 | Ga0068853_102094991 | 3300005539 | Bacteria | 548 |
| 150 | Ga0070672_100290921 | 3300005543 | Bacteria | 1383 |
| 151 | Ga0070686_101391044 | 3300005544 | Bacteria | 588 |
| 152 | Ga0070665_100000186 | 3300005548 | Bacteria | 110750 |
| 153 | Ga0070665_100073523 | 3300005548 | Bacteria | 3424 |
| 154 | Ga0070665_100482368 | 3300005548 | Bacteria | 1251 |
| 155 | Ga0070665_101001609 | 3300005548 | Bacteria | 848 |
| 156 | Ga0070665_101634965 | 3300005548 | Bacteria | 652 |
| 157 | Ga0070665_101979966 | 3300005548 | Bacteria | 588 |
| 158 | Ga0068855_100003973 | 3300005563 | Bacteria | 18060 |
| 159 | Ga0068855_100014816 | 3300005563 | Bacteria | 9389 |
| 160 | Ga0068855_100182464 | 3300005563 | Bacteria | 2372 |
| 161 | Ga0068855_100294139 | 3300005563 | Bacteria | 1800 |
| 162 | Ga0068855_100326462 | 3300005563 | Bacteria | 1695 |
| 163 | Ga0068855_101226911 | 3300005563 | Bacteria | 779 |
| 164 | Ga0068855_101576146 | 3300005563 | Bacteria | 672 |
| 165 | Ga0068855_102132109 | 3300005563 | Bacteria | 564 |
| 166 | Ga0068855_102235263 | 3300005563 | Bacteria | 548 |
| 167 | Ga0070664_100375736 | 3300005564 | Bacteria | 1296 |
| 168 | Ga0070664_100701946 | 3300005564 | Bacteria | 943 |
| 169 | Ga0068857_100029821 | 3300005577 | Bacteria | 4814 |
| 170 | Ga0068857_100031231 | 3300005577 | Bacteria | 4707 |
| 171 | Ga0068857_100094013 | 3300005577 | Bacteria | 2684 |
| 172 | Ga0068857_100188529 | 3300005577 | Bacteria | 1878 |
| 173 | Ga0068857_100234145 | 3300005577 | Bacteria | 1680 |
| 174 | Ga0068857_100440521 | 3300005577 | Bacteria | 1217 |
| 175 | Ga0068857_100936628 | 3300005577 | Bacteria | 832 |
| 176 | Ga0068857_101694606 | 3300005577 | Bacteria | 618 |
| 177 | Ga0068857_101785867 | 3300005577 | Bacteria | 602 |
| 178 | Ga0068857_102247610 | 3300005577 | Bacteria | 535 |
| 179 | Ga0068854_100016369 | 3300005578 | Bacteria | 4943 |
| 180 | Ga0068854_100107513 | 3300005578 | Bacteria | 2100 |
| 181 | Ga0068854_101042552 | 3300005578 | Bacteria | 726 |
| 182 | Ga0068854_102286787 | 3300005578 | Bacteria | 501 |
| 183 | Ga0068856_100027825 | 3300005614 | Bacteria | 5515 |
| 184 | Ga0068856_100447260 | 3300005614 | Bacteria | 1313 |
| 185 | Ga0068856_101018113 | 3300005614 | Bacteria | 846 |
| 186 | Ga0068852_100109259 | 3300005616 | Bacteria | 2511 |
| 187 | Ga0068852_100910838 | 3300005616 | Bacteria | 896 |
| 188 | Ga0068852_101076526 | 3300005616 | Bacteria | 824 |
| 189 | Ga0068852_101451985 | 3300005616 | Bacteria | 708 |
| 190 | Ga0068859_100002597 | 3300005617 | Bacteria | 18383 |
| 191 | Ga0068859_100004323 | 3300005617 | Bacteria | 14490 |
| 192 | Ga0068859_100011775 | 3300005617 | Bacteria | 8788 |
| 193 | Ga0068859_100029853 | 3300005617 | Bacteria | 5470 |
| 194 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 195 | Ga0068864_100000731 | 3300005618 | Bacteria | 27480 |
| 196 | Ga0068864_100010775 | 3300005618 | Bacteria | 7554 |
| 197 | Ga0068864_100432511 | 3300005618 | Bacteria | 1256 |
| 198 | Ga0068864_100731752 | 3300005618 | Bacteria | 968 |
| 199 | Ga0068861_100000108 | 3300005719 | Bacteria | 41584 |
| 200 | Ga0068861_100000148 | 3300005719 | Bacteria | 36127 |
| 201 | Ga0068861_100001464 | 3300005719 | Bacteria | 14949 |
| 202 | Ga0068861_101917074 | 3300005719 | Bacteria | 590 |
| 203 | Ga0068851_10012072 | 3300005834 | Bacteria | 4067 |
| 204 | Ga0068851_10328221 | 3300005834 | Bacteria | 885 |
| 205 | Ga0068851_10328223 | 3300005834 | Bacteria | 885 |
| 206 | Ga0068863_100014281 | 3300005841 | Bacteria | 7649 |
| 207 | Ga0068863_100053964 | 3300005841 | Bacteria | 3809 |
| 208 | Ga0068858_100000583 | 3300005842 | Bacteria | 38259 |
| 209 | Ga0068858_100000588 | 3300005842 | Bacteria | 38216 |
| 210 | Ga0068858_100003492 | 3300005842 | Bacteria | 15587 |
| 211 | Ga0068858_100122627 | 3300005842 | Bacteria | 2432 |
| 212 | Ga0068858_100238411 | 3300005842 | Bacteria | 1725 |
| 213 | Ga0068860_100023270 | 3300005843 | Bacteria | 5987 |
| 214 | Ga0068860_100036289 | 3300005843 | Bacteria | 4724 |
| 215 | Ga0068860_100264595 | 3300005843 | Bacteria | 1677 |
| 216 | Ga0068860_100785965 | 3300005843 | Bacteria | 965 |
| 217 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 218 | Ga0068862_100000063 | 3300005844 | Bacteria | 124662 |
| 219 | Ga0068862_100007384 | 3300005844 | Bacteria | 9116 |
| 220 | Ga0068862_100010294 | 3300005844 | Bacteria | 7717 |
| 221 | Ga0068862_102156793 | 3300005844 | Bacteria | 568 |
| 222 | Ga0081539_10076735 | 3300005985 | Bacteria | 1770 |
| 223 | Ga0075365_10010903 | 3300006038 | Bacteria | 5322 |
| 224 | Ga0075368_10000252 | 3300006042 | Bacteria | 15267 |
| 225 | Ga0075368_10008082 | 3300006042 | Bacteria | 3735 |
| 226 | Ga0075363_100011199 | 3300006048 | Bacteria | 4288 |
| 227 | Ga0075363_100013169 | 3300006048 | Bacteria | 4001 |
| 228 | Ga0075364_10158281 | 3300006051 | Bacteria | 1528 |
| 229 | Ga0075364_10391812 | 3300006051 | Bacteria | 948 |
| 230 | Ga0075362_10031948 | 3300006177 | Bacteria | 2281 |
| 231 | Ga0075362_10045995 | 3300006177 | Bacteria | 1940 |
| 232 | Ga0075367_10000054 | 3300006178 | Bacteria | 27401 |
| 233 | Ga0075367_10081583 | 3300006178 | Bacteria | 1957 |
| 234 | Ga0075369_10041542 | 3300006186 | Bacteria | 1969 |
| 235 | Ga0075369_10099471 | 3300006186 | Bacteria | 1304 |
| 236 | Ga0075369_10137443 | 3300006186 | Bacteria | 1113 |
| 237 | Ga0075366_10022732 | 3300006195 | Bacteria | 3651 |
| 238 | Ga0075366_10061991 | 3300006195 | Bacteria | 2223 |
| 239 | Ga0075366_10090192 | 3300006195 | Bacteria | 1836 |
| 240 | Ga0075366_10132441 | 3300006195 | Bacteria | 1505 |
| 241 | Ga0075366_10167482 | 3300006195 | Bacteria | 1333 |
| 242 | Ga0075366_10353807 | 3300006195 | Bacteria | 902 |
| 243 | Ga0075366_10501124 | 3300006195 | Bacteria | 751 |
| 244 | Ga0075366_10537137 | 3300006195 | Bacteria | 724 |
| 245 | Ga0097621_100144109 | 3300006237 | Bacteria | 2038 |
| 246 | Ga0075370_10057920 | 3300006353 | Bacteria | 2203 |
| 247 | Ga0075370_10074920 | 3300006353 | Bacteria | 1940 |
| 248 | Ga0075370_10075998 | 3300006353 | Bacteria | 1926 |
| 249 | Ga0075370_10092517 | 3300006353 | Bacteria | 1745 |
| 250 | Ga0075370_10154405 | 3300006353 | Bacteria | 1346 |
| 251 | Ga0075370_10665590 | 3300006353 | Bacteria | 632 |
| 252 | Ga0068871_100016843 | 3300006358 | Bacteria | 5516 |
| 253 | Ga0068871_100121930 | 3300006358 | Bacteria | 2203 |
| 254 | Ga0068871_101057055 | 3300006358 | Bacteria | 758 |
| 255 | Ga0068865_101884820 | 3300006881 | Bacteria | 541 |
| 256 | Ga0097620_100002597 | 3300006931 | Bacteria | 18383 |
| 257 | Ga0097620_100004323 | 3300006931 | Bacteria | 14490 |
| 258 | Ga0097620_100011775 | 3300006931 | Bacteria | 8788 |
| 259 | Ga0097620_100029854 | 3300006931 | Bacteria | 5470 |
| 260 | Ga0079104_1031866 | 3300006946 | Bacteria | 1304 |
| 261 | Ga0079104_1087498 | 3300006946 | Bacteria | 635 |
| 262 | Ga0105251_10033437 | 3300009011 | Bacteria | 2553 |
| 263 | Ga0105251_10402660 | 3300009011 | Bacteria | 629 |
| 264 | Ga0105240_10000959 | 3300009093 | Bacteria | 51453 |
| 265 | Ga0105240_10043982 | 3300009093 | Bacteria | 5679 |
| 266 | Ga0105240_10229460 | 3300009093 | Bacteria | 2159 |
| 267 | Ga0105240_10296092 | 3300009093 | Bacteria | 1853 |
| 268 | Ga0111539_10440332 | 3300009094 | Bacteria | 1517 |
| 269 | Ga0111539_11333045 | 3300009094 | Bacteria | 833 |
| 270 | Ga0105245_10001709 | 3300009098 | Bacteria | 20004 |
| 271 | Ga0105247_10001115 | 3300009101 | Bacteria | 20007 |
| 272 | Ga0105247_10044573 | 3300009101 | Bacteria | 2721 |
| 273 | Ga0114129_10128044 | 3300009147 | Bacteria | 3490 |
| 274 | Ga0105243_10000122 | 3300009148 | Bacteria | 89527 |
| 275 | Ga0105243_10309260 | 3300009148 | Bacteria | 1435 |
| 276 | Ga0105243_11425044 | 3300009148 | Bacteria | 714 |
| 277 | Ga0105241_10002257 | 3300009174 | Bacteria | 14478 |
| 278 | Ga0105241_10002409 | 3300009174 | Bacteria | 14050 |
| 279 | Ga0105241_10466667 | 3300009174 | Bacteria | 1120 |
| 280 | Ga0105241_10948388 | 3300009174 | Bacteria | 802 |
| 281 | Ga0105248_10000287 | 3300009177 | Bacteria | 59537 |
| 282 | Ga0105248_10007934 | 3300009177 | Bacteria | 11668 |
| 283 | Ga0105248_10016133 | 3300009177 | Bacteria | 8219 |
| 284 | Ga0105248_10019155 | 3300009177 | Bacteria | 7571 |
| 285 | Ga0105248_10025995 | 3300009177 | Bacteria | 6512 |
| 286 | Ga0105248_10044942 | 3300009177 | Bacteria | 4953 |
| 287 | Ga0105248_10180454 | 3300009177 | Bacteria | 2379 |
| 288 | Ga0105248_11732468 | 3300009177 | Bacteria | 708 |
| 289 | Ga0105237_10001281 | 3300009545 | Bacteria | 33535 |
| 290 | Ga0105237_10007067 | 3300009545 | Bacteria | 12344 |
| 291 | Ga0105237_10016910 | 3300009545 | Bacteria | 7569 |
| 292 | Ga0105237_12136474 | 3300009545 | Bacteria | 569 |
| 293 | Ga0105238_10172228 | 3300009551 | Bacteria | 2141 |
| 294 | Ga0105238_10193883 | 3300009551 | Bacteria | 2007 |
| 295 | Ga0105238_10317298 | 3300009551 | Bacteria | 1544 |
| 296 | Ga0105238_11229716 | 3300009551 | Bacteria | 774 |
| 297 | Ga0105238_12735462 | 3300009551 | Bacteria | 530 |
| 298 | Ga0105249_10008807 | 3300009553 | Bacteria | 8809 |
| 299 | Ga0105249_10091346 | 3300009553 | Bacteria | 2848 |
| 300 | Ga0105249_10458298 | 3300009553 | Bacteria | 1315 |
| 301 | Ga0105249_10485665 | 3300009553 | Bacteria | 1279 |
| 302 | Ga0105249_11436545 | 3300009553 | Bacteria | 762 |
| 303 | Ga0105148_100027 | 3300009978 | Bacteria | 21393 |
| 304 | Ga0105239_10000156 | 3300010375 | Bacteria | 98400 |
| 305 | Ga0105239_10007208 | 3300010375 | Bacteria | 12776 |
| 306 | Ga0105239_10232710 | 3300010375 | Bacteria | 2067 |
| 307 | Ga0105239_11127209 | 3300010375 | Bacteria | 903 |
| 308 | Ga0105239_11149125 | 3300010375 | Bacteria | 894 |
| 309 | Ga0105239_11265648 | 3300010375 | Bacteria | 851 |
| 310 | Ga0105239_11314522 | 3300010375 | Bacteria | 834 |
| 311 | Ga0105246_10000632 | 3300011119 | Bacteria | 19638 |
| 312 | Ga0105246_10479629 | 3300011119 | Bacteria | 1052 |
| 313 | Ga0157373_10024990 | 3300013100 | Bacteria | 4324 |
| 314 | Ga0157373_10047725 | 3300013100 | Bacteria | 3054 |
| 315 | Ga0157373_10128467 | 3300013100 | Bacteria | 1782 |
| 316 | Ga0157373_10341584 | 3300013100 | Bacteria | 1067 |
| 317 | Ga0157373_10464031 | 3300013100 | Bacteria | 912 |
| 318 | Ga0157373_10732326 | 3300013100 | Bacteria | 726 |
| 319 | Ga0157371_10000030 | 3300013102 | Bacteria | 241585 |
| 320 | Ga0157371_10061175 | 3300013102 | Bacteria | 2670 |
| 321 | Ga0157371_10128777 | 3300013102 | Bacteria | 1800 |
| 322 | Ga0157371_10532220 | 3300013102 | Bacteria | 870 |
| 323 | Ga0157370_10008634 | 3300013104 | Bacteria | 10966 |
| 324 | Ga0157370_10302970 | 3300013104 | Bacteria | 1475 |
| 325 | Ga0157370_10440254 | 3300013104 | Bacteria | 1199 |
| 326 | Ga0157370_11141427 | 3300013104 | Bacteria | 704 |
| 327 | Ga0157370_11346144 | 3300013104 | Bacteria | 643 |
| 328 | Ga0157370_11783019 | 3300013104 | Bacteria | 552 |
| 329 | Ga0157369_10241631 | 3300013105 | Bacteria | 1886 |
| 330 | Ga0157369_10321648 | 3300013105 | Bacteria | 1608 |
| 331 | Ga0157369_10800289 | 3300013105 | Bacteria | 968 |
| 332 | Ga0157369_10990585 | 3300013105 | Bacteria | 861 |
| 333 | Ga0157374_10110705 | 3300013296 | Bacteria | 2641 |
| 334 | Ga0157374_11535133 | 3300013296 | Bacteria | 689 |
| 335 | Ga0157378_10018055 | 3300013297 | Bacteria | 6195 |
| 336 | Ga0157378_10021666 | 3300013297 | Bacteria | 5650 |
| 337 | Ga0157378_10590595 | 3300013297 | Bacteria | 1120 |
| 338 | Ga0157378_10755571 | 3300013297 | Bacteria | 995 |
| 339 | Ga0157378_12278574 | 3300013297 | Bacteria | 593 |
| 340 | Ga0163162_10003776 | 3300013306 | Bacteria | 14517 |
| 341 | Ga0163162_10018196 | 3300013306 | Bacteria | 6881 |
| 342 | Ga0163162_10037626 | 3300013306 | Bacteria | 4829 |
| 343 | Ga0163162_10283936 | 3300013306 | Bacteria | 1787 |
| 344 | Ga0163162_10437876 | 3300013306 | Bacteria | 1439 |
| 345 | Ga0163162_10700924 | 3300013306 | Bacteria | 1134 |
| 346 | Ga0163162_10829236 | 3300013306 | Bacteria | 1041 |
| 347 | Ga0163162_11273318 | 3300013306 | Bacteria | 835 |
| 348 | Ga0157372_10532860 | 3300013307 | Bacteria | 1369 |
| 349 | Ga0157372_10588635 | 3300013307 | Bacteria | 1297 |
| 350 | Ga0157372_11515622 | 3300013307 | Bacteria | 772 |
| 351 | Ga0157372_11851521 | 3300013307 | Bacteria | 694 |
| 352 | Ga0157375_10149491 | 3300013308 | Bacteria | 2470 |
| 353 | Ga0157375_10745285 | 3300013308 | Bacteria | 1131 |
| 354 | Ga0157375_10815281 | 3300013308 | Bacteria | 1081 |
| 355 | Ga0157375_11299390 | 3300013308 | Bacteria | 855 |
| 356 | Ga0157375_13309586 | 3300013308 | Bacteria | 537 |
| 357 | Ga0163163_10015793 | 3300014325 | Bacteria | 6993 |
| 358 | Ga0163163_10026383 | 3300014325 | Bacteria | 5552 |
| 359 | Ga0163163_10340374 | 3300014325 | Bacteria | 1555 |
| 360 | Ga0163163_11174288 | 3300014325 | Bacteria | 830 |
| 361 | Ga0157380_10000673 | 3300014326 | Bacteria | 21168 |
| 362 | Ga0157380_10000755 | 3300014326 | Bacteria | 20159 |
| 363 | Ga0157380_10077149 | 3300014326 | Bacteria | 2714 |
| 364 | Ga0157380_10079466 | 3300014326 | Bacteria | 2679 |
| 365 | Ga0157380_10335578 | 3300014326 | Bacteria | 1408 |
| 366 | Ga0157380_10351677 | 3300014326 | Bacteria | 1379 |
| 367 | Ga0157380_11368554 | 3300014326 | Bacteria | 757 |
| 368 | Ga0157377_11451075 | 3300014745 | Bacteria | 543 |
| 369 | Ga0157379_10093716 | 3300014968 | Bacteria | 2694 |
| 370 | Ga0157379_11099376 | 3300014968 | Bacteria | 761 |
| 371 | Ga0157376_10239100 | 3300014969 | Bacteria | 1691 |
| 372 | Ga0183363_1005 | 3300015690 | Bacteria | 403020 |
| 373 | Ga0163161_10001996 | 3300017792 | Bacteria | 14773 |
| 374 | Ga0163161_10033177 | 3300017792 | Bacteria | 3689 |
| 375 | Ga0163161_10034292 | 3300017792 | Bacteria | 3630 |
| 376 | Ga0163161_10222252 | 3300017792 | Bacteria | 1463 |
| 377 | Ga0163161_10421299 | 3300017792 | Bacteria | 1074 |
| 378 | Ga0163161_11343277 | 3300017792 | Bacteria | 623 |
| 379 | Ga0163161_11518759 | 3300017792 | Bacteria | 588 |
| 380 | Ga0163161_11979300 | 3300017792 | Bacteria | 518 |
| 381 | Ga0197907_11373989 | 3300020069 | Bacteria | 643 |
| 382 | Ga0206356_10423289 | 3300020070 | Bacteria | 1109 |
| 383 | Ga0206351_10390730 | 3300020077 | Bacteria | 639 |
| 384 | Ga0206353_10505260 | 3300020082 | Bacteria | 729 |
| 385 | Ga0206353_10958977 | 3300020082 | Bacteria | 672 |
| 386 | Ga0213874_10433940 | 3300021377 | Bacteria | 516 |
| 387 | Ga0213876_10314389 | 3300021384 | Bacteria | 833 |
| 388 | Ga0213875_10000229 | 3300021388 | Bacteria | 56654 |
| 389 | Ga0224712_10056485 | 3300022467 | Bacteria | 1548 |
| 390 | Ga0209674_104916 | 3300025226 | Bacteria | 2076 |
| 391 | Ga0209147_100491 | 3300025229 | Bacteria | 23505 |
| 392 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 393 | Ga0207425_1000037 | 3300025245 | Bacteria | 224645 |
| 394 | Ga0209646_1004404 | 3300025246 | Bacteria | 2570 |
| 395 | Ga0209026_1005891 | 3300025250 | Bacteria | 3151 |
| 396 | Ga0209026_1041594 | 3300025250 | Bacteria | 665 |
| 397 | Ga0209677_104802 | 3300025253 | Bacteria | 3747 |
| 398 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 399 | Ga0209129_1000363 | 3300025258 | Bacteria | 37614 |
| 400 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 401 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 402 | Ga0209565_1000427 | 3300025263 | Bacteria | 34040 |
| 403 | Ga0209565_1067009 | 3300025263 | Bacteria | 612 |
| 404 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 405 | Ga0209673_1029026 | 3300025273 | Bacteria | 1768 |
| 406 | Ga0209673_1045116 | 3300025273 | Bacteria | 1214 |
| 407 | Ga0209675_1000097 | 3300025291 | Bacteria | 131546 |
| 408 | Ga0209675_1023972 | 3300025291 | Bacteria | 1568 |
| 409 | Ga0209676_1000060 | 3300025292 | Bacteria | 338238 |
| 410 | Ga0209676_1000175 | 3300025292 | Bacteria | 153258 |
| 411 | Ga0209676_1000298 | 3300025292 | Bacteria | 100554 |
| 412 | Ga0209676_1002287 | 3300025292 | Bacteria | 13986 |
| 413 | Ga0209676_1021394 | 3300025292 | Bacteria | 2174 |
| 414 | Ga0209025_1000117 | 3300025294 | Bacteria | 215073 |
| 415 | Ga0209025_1028779 | 3300025294 | Bacteria | 2710 |
| 416 | Ga0209564_1003622 | 3300025295 | Bacteria | 10279 |
| 417 | Ga0209564_1005290 | 3300025295 | Bacteria | 7438 |
| 418 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 419 | Ga0209758_1000103 | 3300025297 | Bacteria | 223968 |
| 420 | Ga0209758_1041032 | 3300025297 | Bacteria | 1736 |
| 421 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 422 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 423 | Ga0209050_1001389 | 3300025298 | Bacteria | 26337 |
| 424 | Ga0209050_1002628 | 3300025298 | Bacteria | 14768 |
| 425 | Ga0209050_1004951 | 3300025298 | Bacteria | 8681 |
| 426 | Ga0209050_1006341 | 3300025298 | Bacteria | 7038 |
| 427 | Ga0209050_1014852 | 3300025298 | Bacteria | 3320 |
| 428 | Ga0209050_1014985 | 3300025298 | Bacteria | 3292 |
| 429 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 430 | Ga0207426_1048373 | 3300025302 | Bacteria | 1278 |
| 431 | Ga0209051_1003509 | 3300025303 | Bacteria | 10253 |
| 432 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 433 | Ga0209257_1000174 | 3300025304 | Bacteria | 165255 |
| 434 | Ga0209257_1005036 | 3300025304 | Bacteria | 9613 |
| 435 | Ga0209257_1005111 | 3300025304 | Bacteria | 9510 |
| 436 | Ga0209257_1011340 | 3300025304 | Bacteria | 4307 |
| 437 | Ga0209257_1015537 | 3300025304 | Bacteria | 3159 |
| 438 | Ga0209257_1027653 | 3300025304 | Bacteria | 1885 |
| 439 | Ga0209257_1077966 | 3300025304 | Bacteria | 857 |
| 440 | Ga0207697_10000130 | 3300025315 | Bacteria | 36265 |
| 441 | Ga0207697_10116410 | 3300025315 | Bacteria | 1148 |
| 442 | Ga0207656_10018806 | 3300025321 | Bacteria | 2724 |
| 443 | Ga0207656_10228920 | 3300025321 | Bacteria | 905 |
| 444 | Ga0207713_1233720 | 3300025735 | Bacteria | 548 |
| 445 | Ga0207682_10154897 | 3300025893 | Bacteria | 1035 |
| 446 | Ga0207682_10184515 | 3300025893 | Bacteria | 954 |
| 447 | Ga0207710_10009801 | 3300025900 | Bacteria | 4027 |
| 448 | Ga0207710_10034124 | 3300025900 | Bacteria | 2234 |
| 449 | Ga0207710_10243809 | 3300025900 | Bacteria | 897 |
| 450 | Ga0207688_10018544 | 3300025901 | Bacteria | 3786 |
| 451 | Ga0207688_10297330 | 3300025901 | Bacteria | 986 |
| 452 | Ga0207680_10000033 | 3300025903 | Bacteria | 77177 |
| 453 | Ga0207680_10159744 | 3300025903 | Bacteria | 1510 |
| 454 | Ga0207680_10258292 | 3300025903 | Bacteria | 1205 |
| 455 | Ga0207647_10008063 | 3300025904 | Bacteria | 7573 |
| 456 | Ga0207647_10034522 | 3300025904 | Bacteria | 3228 |
| 457 | Ga0207705_10000163 | 3300025909 | Bacteria | 71674 |
| 458 | Ga0207705_10052748 | 3300025909 | Bacteria | 2929 |
| 459 | Ga0207705_10206861 | 3300025909 | Bacteria | 1488 |
| 460 | Ga0207705_10455676 | 3300025909 | Bacteria | 992 |
| 461 | Ga0207705_10929522 | 3300025909 | Bacteria | 673 |
| 462 | Ga0207654_10000852 | 3300025911 | Bacteria | 16833 |
| 463 | Ga0207654_10340074 | 3300025911 | Bacteria | 1031 |
| 464 | Ga0207695_10000521 | 3300025913 | Bacteria | 81496 |
| 465 | Ga0207695_10015077 | 3300025913 | Bacteria | 9118 |
| 466 | Ga0207695_10294189 | 3300025913 | Bacteria | 1516 |
| 467 | Ga0207695_10737600 | 3300025913 | Bacteria | 865 |
| 468 | Ga0207671_10000607 | 3300025914 | Bacteria | 47542 |
| 469 | Ga0207671_10003706 | 3300025914 | Bacteria | 15059 |
| 470 | Ga0207671_10046407 | 3300025914 | Bacteria | 3214 |
| 471 | Ga0207671_10116984 | 3300025914 | Bacteria | 2034 |
| 472 | Ga0207662_10296928 | 3300025918 | Bacteria | 1073 |
| 473 | Ga0207657_10023497 | 3300025919 | Bacteria | 5739 |
| 474 | Ga0207657_10124830 | 3300025919 | Bacteria | 2115 |
| 475 | Ga0207657_10280892 | 3300025919 | Bacteria | 1322 |
| 476 | Ga0207649_10000199 | 3300025920 | Bacteria | 49941 |
| 477 | Ga0207649_10676515 | 3300025920 | Bacteria | 799 |
| 478 | Ga0207652_10296559 | 3300025921 | Bacteria | 1459 |
| 479 | Ga0207646_10380072 | 3300025922 | Bacteria | 1276 |
| 480 | Ga0207646_10415378 | 3300025922 | Bacteria | 1215 |
| 481 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 482 | Ga0207681_10000041 | 3300025923 | Bacteria | 140201 |
| 483 | Ga0207681_10045969 | 3300025923 | Bacteria | 2935 |
| 484 | Ga0207681_10142103 | 3300025923 | Bacteria | 1789 |
| 485 | Ga0207681_10177893 | 3300025923 | Bacteria | 1618 |
| 486 | Ga0207681_10342918 | 3300025923 | Bacteria | 1194 |
| 487 | Ga0207681_10491650 | 3300025923 | Bacteria | 1003 |
| 488 | Ga0207681_10590246 | 3300025923 | Bacteria | 917 |
| 489 | Ga0207681_11172944 | 3300025923 | Bacteria | 645 |
| 490 | Ga0207681_11853343 | 3300025923 | Bacteria | 503 |
| 491 | Ga0207694_10049988 | 3300025924 | Bacteria | 3237 |
| 492 | Ga0207694_10078972 | 3300025924 | Bacteria | 2580 |
| 493 | Ga0207694_10115061 | 3300025924 | Bacteria | 2142 |
| 494 | Ga0207694_10161421 | 3300025924 | Bacteria | 1810 |
| 495 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 496 | Ga0207650_10018754 | 3300025925 | Bacteria | 4859 |
| 497 | Ga0207650_10199865 | 3300025925 | Bacteria | 1601 |
| 498 | Ga0207650_10230377 | 3300025925 | Bacteria | 1494 |
| 499 | Ga0207659_10121130 | 3300025926 | Bacteria | 2005 |
| 500 | Ga0207659_10678981 | 3300025926 | Bacteria | 881 |
| 501 | Ga0207659_11038005 | 3300025926 | Bacteria | 705 |
| 502 | Ga0207687_10009517 | 3300025927 | Bacteria | 6355 |
| 503 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 504 | Ga0207644_10026502 | 3300025931 | Bacteria | 3995 |
| 505 | Ga0207690_10003817 | 3300025932 | Bacteria | 8918 |
| 506 | Ga0207690_10045855 | 3300025932 | Bacteria | 2891 |
| 507 | Ga0207690_10838160 | 3300025932 | Bacteria | 761 |
| 508 | Ga0207706_10007087 | 3300025933 | Bacteria | 10368 |
| 509 | Ga0207706_10017165 | 3300025933 | Bacteria | 6527 |
| 510 | Ga0207706_10062160 | 3300025933 | Bacteria | 3289 |
| 511 | Ga0207706_10529829 | 3300025933 | Bacteria | 1015 |
| 512 | Ga0207706_10622765 | 3300025933 | Bacteria | 926 |
| 513 | Ga0207706_11109105 | 3300025933 | Bacteria | 661 |
| 514 | Ga0207686_11066050 | 3300025934 | Bacteria | 658 |
| 515 | Ga0207709_10000083 | 3300025935 | Bacteria | 163025 |
| 516 | Ga0207709_10144276 | 3300025935 | Bacteria | 1640 |
| 517 | Ga0207709_10187733 | 3300025935 | Bacteria | 1465 |
| 518 | Ga0207669_10000071 | 3300025937 | Bacteria | 51781 |
| 519 | Ga0207669_10004349 | 3300025937 | Bacteria | 6222 |
| 520 | Ga0207669_10647147 | 3300025937 | Bacteria | 864 |
| 521 | Ga0207704_11659004 | 3300025938 | Bacteria | 549 |
| 522 | Ga0207691_10217130 | 3300025940 | Bacteria | 1659 |
| 523 | Ga0207711_10000480 | 3300025941 | Bacteria | 41229 |
| 524 | Ga0207711_10017203 | 3300025941 | Bacteria | 6009 |
| 525 | Ga0207711_10074305 | 3300025941 | Bacteria | 2956 |
| 526 | Ga0207711_10087405 | 3300025941 | Bacteria | 2735 |
| 527 | Ga0207711_10850183 | 3300025941 | Bacteria | 849 |
| 528 | Ga0207689_10571751 | 3300025942 | Bacteria | 950 |
| 529 | Ga0207661_10346723 | 3300025944 | Bacteria | 1339 |
| 530 | Ga0207679_10114674 | 3300025945 | Bacteria | 2134 |
| 531 | Ga0207679_10741231 | 3300025945 | Bacteria | 893 |
| 532 | Ga0207679_11315222 | 3300025945 | Bacteria | 663 |
| 533 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 534 | Ga0207667_10001602 | 3300025949 | Bacteria | 28438 |
| 535 | Ga0207667_10204288 | 3300025949 | Bacteria | 2026 |
| 536 | Ga0207667_10451985 | 3300025949 | Bacteria | 1305 |
| 537 | Ga0207667_10480450 | 3300025949 | Bacteria | 1261 |
| 538 | Ga0207667_10665358 | 3300025949 | Bacteria | 1046 |
| 539 | Ga0207667_11415234 | 3300025949 | Bacteria | 668 |
| 540 | Ga0207651_10210381 | 3300025960 | Bacteria | 1565 |
| 541 | Ga0207651_10370198 | 3300025960 | Bacteria | 1212 |
| 542 | Ga0207651_10837605 | 3300025960 | Bacteria | 817 |
| 543 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 544 | Ga0207712_10001860 | 3300025961 | Bacteria | 13872 |
| 545 | Ga0207712_10290754 | 3300025961 | Bacteria | 1337 |
| 546 | Ga0207712_11093568 | 3300025961 | Bacteria | 709 |
| 547 | Ga0207668_10001038 | 3300025972 | Bacteria | 16583 |
| 548 | Ga0207668_10018151 | 3300025972 | Bacteria | 4420 |
| 549 | Ga0207668_10041472 | 3300025972 | Bacteria | 3111 |
| 550 | Ga0207668_10101044 | 3300025972 | Bacteria | 2143 |
| 551 | Ga0207668_10369505 | 3300025972 | Bacteria | 1204 |
| 552 | Ga0207668_10753815 | 3300025972 | Bacteria | 859 |
| 553 | Ga0207668_11094158 | 3300025972 | Bacteria | 714 |
| 554 | Ga0207668_11132687 | 3300025972 | Bacteria | 702 |
| 555 | Ga0207640_10007619 | 3300025981 | Bacteria | 5976 |
| 556 | Ga0207640_10011830 | 3300025981 | Bacteria | 4953 |
| 557 | Ga0207640_10021447 | 3300025981 | Bacteria | 3850 |
| 558 | Ga0207640_10028310 | 3300025981 | Bacteria | 3425 |
| 559 | Ga0207640_10057450 | 3300025981 | Bacteria | 2559 |
| 560 | Ga0207640_10688311 | 3300025981 | Bacteria | 875 |
| 561 | Ga0207658_10009452 | 3300025986 | Bacteria | 6613 |
| 562 | Ga0207658_10017969 | 3300025986 | Bacteria | 4874 |
| 563 | Ga0207658_10183878 | 3300025986 | Bacteria | 1732 |
| 564 | Ga0207658_10871864 | 3300025986 | Bacteria | 819 |
| 565 | Ga0207658_11092955 | 3300025986 | Bacteria | 728 |
| 566 | Ga0207658_11310604 | 3300025986 | Bacteria | 662 |
| 567 | Ga0207677_11937663 | 3300026023 | Bacteria | 548 |
| 568 | Ga0207703_10000715 | 3300026035 | Bacteria | 32705 |
| 569 | Ga0207703_10001509 | 3300026035 | Bacteria | 21208 |
| 570 | Ga0207703_10006058 | 3300026035 | Bacteria | 9671 |
| 571 | Ga0207703_10135086 | 3300026035 | Bacteria | 2134 |
| 572 | Ga0207703_10157722 | 3300026035 | Bacteria | 1985 |
| 573 | Ga0207639_10000138 | 3300026041 | Bacteria | 54326 |
| 574 | Ga0207639_10000414 | 3300026041 | Bacteria | 29581 |
| 575 | Ga0207639_10000510 | 3300026041 | Bacteria | 26910 |
| 576 | Ga0207639_10000631 | 3300026041 | Bacteria | 24265 |
| 577 | Ga0207639_10011189 | 3300026041 | Bacteria | 6225 |
| 578 | Ga0207639_10164033 | 3300026041 | Bacteria | 1875 |
| 579 | Ga0207639_10227672 | 3300026041 | Bacteria | 1614 |
| 580 | Ga0207678_10002459 | 3300026067 | Bacteria | 16827 |
| 581 | Ga0207678_10003700 | 3300026067 | Bacteria | 13745 |
| 582 | Ga0207702_10003043 | 3300026078 | Bacteria | 15581 |
| 583 | Ga0207702_10531268 | 3300026078 | Bacteria | 1149 |
| 584 | Ga0207641_10019831 | 3300026088 | Bacteria | 5518 |
| 585 | Ga0207641_10041729 | 3300026088 | Bacteria | 3846 |
| 586 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 587 | Ga0207676_10000691 | 3300026095 | Bacteria | 26590 |
| 588 | Ga0207676_10000705 | 3300026095 | Bacteria | 26301 |
| 589 | Ga0207676_12156681 | 3300026095 | Bacteria | 555 |
| 590 | Ga0207674_10006416 | 3300026116 | Bacteria | 13835 |
| 591 | Ga0207674_10010631 | 3300026116 | Bacteria | 10407 |
| 592 | Ga0207674_10036911 | 3300026116 | Bacteria | 5086 |
| 593 | Ga0207674_10041762 | 3300026116 | Bacteria | 4741 |
| 594 | Ga0207674_10297659 | 3300026116 | Bacteria | 1562 |
| 595 | Ga0207674_10393357 | 3300026116 | Bacteria | 1340 |
| 596 | Ga0207674_10514476 | 3300026116 | Bacteria | 1156 |
| 597 | Ga0207674_12237726 | 3300026116 | Bacteria | 509 |
| 598 | Ga0207675_100000309 | 3300026118 | Bacteria | 46765 |
| 599 | Ga0207675_100000355 | 3300026118 | Bacteria | 43840 |
| 600 | Ga0207675_100000400 | 3300026118 | Bacteria | 41588 |
| 601 | Ga0207675_102505765 | 3300026118 | Bacteria | 527 |
| 602 | Ga0207683_10001740 | 3300026121 | Bacteria | 19350 |
| 603 | Ga0207683_10411708 | 3300026121 | Bacteria | 1244 |
| 604 | Ga0207698_10001107 | 3300026142 | Bacteria | 15705 |
| 605 | Ga0207698_10089829 | 3300026142 | Bacteria | 2511 |
| 606 | Ga0207698_10491433 | 3300026142 | Bacteria | 1192 |
| 607 | Ga0207698_10540719 | 3300026142 | Bacteria | 1140 |
| 608 | Ga0207698_11077887 | 3300026142 | Bacteria | 816 |
| 609 | Ga0207698_11787572 | 3300026142 | Bacteria | 630 |
| 610 | Ga0209983_1024418 | 3300027665 | Bacteria | 1272 |
| 611 | Ga0209813_10000063 | 3300027866 | Bacteria | 43741 |
| 612 | Ga0209813_10002858 | 3300027866 | Bacteria | 3997 |
| 613 | Ga0209974_10001093 | 3300027876 | Bacteria | 9608 |
| 614 | Ga0209974_10012498 | 3300027876 | Bacteria | 2838 |
| 615 | Ga0209974_10276072 | 3300027876 | Bacteria | 638 |
| 616 | Ga0207428_11112655 | 3300027907 | Bacteria | 552 |
| 617 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 618 | Ga0268266_10054091 | 3300028379 | Bacteria | 3450 |
| 619 | Ga0268266_10456578 | 3300028379 | Bacteria | 1215 |
| 620 | Ga0268266_10895661 | 3300028379 | Bacteria | 858 |
| 621 | Ga0268266_11037509 | 3300028379 | Bacteria | 793 |
| 622 | Ga0268266_11142570 | 3300028379 | Bacteria | 753 |
| 623 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 624 | Ga0268265_10000055 | 3300028380 | Bacteria | 158947 |
| 625 | Ga0268265_10000361 | 3300028380 | Bacteria | 49182 |
| 626 | Ga0268265_10213788 | 3300028380 | Bacteria | 1682 |
| 627 | Ga0268264_10000116 | 3300028381 | Bacteria | 198591 |
| 628 | Ga0268264_10000381 | 3300028381 | Bacteria | 64651 |
| 629 | Ga0307517_10065328 | 3300028786 | Bacteria | 3368 |
| 630 | Ga0307517_10361308 | 3300028786 | Bacteria | 784 |
| 631 | Ga0307515_10264001 | 3300028794 | Bacteria | 1453 |
| 632 | Ga0307513_10010089 | 3300031456 | Bacteria | 11892 |
| 633 | Ga0307513_10015055 | 3300031456 | Bacteria | 9388 |
| 634 | Ga0307408_100044971 | 3300031548 | Bacteria | 3150 |
| 635 | Ga0307408_100070707 | 3300031548 | Bacteria | 2577 |
| 636 | Ga0307408_100084371 | 3300031548 | Bacteria | 2383 |
| 637 | Ga0307408_100204844 | 3300031548 | Bacteria | 1599 |
| 638 | Ga0307408_100250903 | 3300031548 | Bacteria | 1459 |
| 639 | Ga0307408_100404388 | 3300031548 | Bacteria | 1173 |
| 640 | Ga0307408_100431046 | 3300031548 | Bacteria | 1139 |
| 641 | Ga0307408_100980300 | 3300031548 | Bacteria | 778 |
| 642 | Ga0307408_101049808 | 3300031548 | Bacteria | 753 |
| 643 | Ga0307408_102039583 | 3300031548 | Bacteria | 552 |
| 644 | Ga0307508_10005365 | 3300031616 | Bacteria | 12204 |
| 645 | Ga0307405_10004910 | 3300031731 | Bacteria | 6384 |
| 646 | Ga0307405_10009565 | 3300031731 | Bacteria | 4975 |
| 647 | Ga0307405_10082731 | 3300031731 | Bacteria | 2102 |
| 648 | Ga0307405_10370699 | 3300031731 | Bacteria | 1111 |
| 649 | Ga0307405_10762230 | 3300031731 | Bacteria | 807 |
| 650 | Ga0307405_11050431 | 3300031731 | Bacteria | 697 |
| 651 | Ga0307405_11133832 | 3300031731 | Bacteria | 673 |
| 652 | Ga0316577_10092435 | 3300031733 | Bacteria | 1694 |
| 653 | Ga0307413_10044933 | 3300031824 | Bacteria | 2614 |
| 654 | Ga0307413_10073468 | 3300031824 | Bacteria | 2162 |
| 655 | Ga0307413_10084823 | 3300031824 | Bacteria | 2043 |
| 656 | Ga0307413_10103732 | 3300031824 | Bacteria | 1886 |
| 657 | Ga0307413_10146455 | 3300031824 | Bacteria | 1640 |
| 658 | Ga0307413_10169563 | 3300031824 | Bacteria | 1543 |
| 659 | Ga0307413_10393412 | 3300031824 | Bacteria | 1084 |
| 660 | Ga0307413_10605513 | 3300031824 | Bacteria | 897 |
| 661 | Ga0307413_10697101 | 3300031824 | Bacteria | 843 |
| 662 | Ga0307413_10844256 | 3300031824 | Bacteria | 773 |
| 663 | Ga0307413_10963448 | 3300031824 | Bacteria | 729 |
| 664 | Ga0307413_11554865 | 3300031824 | Bacteria | 586 |
| 665 | Ga0307413_12103167 | 3300031824 | Bacteria | 510 |
| 666 | Ga0307410_10190435 | 3300031852 | Bacteria | 1559 |
| 667 | Ga0307410_10204849 | 3300031852 | Bacteria | 1508 |
| 668 | Ga0307410_11037292 | 3300031852 | Bacteria | 708 |
| 669 | Ga0307410_11175373 | 3300031852 | Bacteria | 667 |
| 670 | Ga0307410_12043752 | 3300031852 | Bacteria | 512 |
| 671 | Ga0307406_10002286 | 3300031901 | Bacteria | 10426 |
| 672 | Ga0307406_10051820 | 3300031901 | Bacteria | 2607 |
| 673 | Ga0307406_10328878 | 3300031901 | Bacteria | 1185 |
| 674 | Ga0307406_10395285 | 3300031901 | Bacteria | 1094 |
| 675 | Ga0307406_10496583 | 3300031901 | Bacteria | 988 |
| 676 | Ga0307406_10686566 | 3300031901 | Bacteria | 853 |
| 677 | Ga0307406_10862838 | 3300031901 | Bacteria | 768 |
| 678 | Ga0307407_10044269 | 3300031903 | Bacteria | 2507 |
| 679 | Ga0307407_10625440 | 3300031903 | Bacteria | 804 |
| 680 | Ga0307412_10000950 | 3300031911 | Bacteria | 16577 |
| 681 | Ga0307412_10002858 | 3300031911 | Bacteria | 9580 |
| 682 | Ga0307412_10013155 | 3300031911 | Bacteria | 4843 |
| 683 | Ga0307412_10035518 | 3300031911 | Bacteria | 3185 |
| 684 | Ga0307412_10035799 | 3300031911 | Bacteria | 3174 |
| 685 | Ga0307412_10062673 | 3300031911 | Bacteria | 2505 |
| 686 | Ga0307412_10065616 | 3300031911 | Bacteria | 2457 |
| 687 | Ga0307412_10071061 | 3300031911 | Bacteria | 2375 |
| 688 | Ga0307412_10135036 | 3300031911 | Bacteria | 1798 |
| 689 | Ga0307412_10181563 | 3300031911 | Bacteria | 1583 |
| 690 | Ga0307412_10276572 | 3300031911 | Bacteria | 1316 |
| 691 | Ga0307412_10279333 | 3300031911 | Bacteria | 1310 |
| 692 | Ga0307412_10983596 | 3300031911 | Bacteria | 744 |
| 693 | Ga0307412_11030838 | 3300031911 | Bacteria | 728 |
| 694 | Ga0307412_11448082 | 3300031911 | Bacteria | 623 |
| 695 | Ga0307412_11595562 | 3300031911 | Bacteria | 596 |
| 696 | Ga0307409_100099251 | 3300031995 | Bacteria | 2411 |
| 697 | Ga0307409_100124850 | 3300031995 | Bacteria | 2187 |
| 698 | Ga0307409_100359727 | 3300031995 | Bacteria | 1376 |
| 699 | Ga0307409_101075659 | 3300031995 | Bacteria | 825 |
| 700 | Ga0307409_101395479 | 3300031995 | Bacteria | 727 |
| 701 | Ga0307409_102251672 | 3300031995 | Bacteria | 574 |
| 702 | Ga0307416_100014228 | 3300032002 | Bacteria | 5442 |
| 703 | Ga0307416_100078949 | 3300032002 | Bacteria | 2772 |
| 704 | Ga0307416_100195156 | 3300032002 | Bacteria | 1914 |
| 705 | Ga0307416_100297322 | 3300032002 | Bacteria | 1602 |
| 706 | Ga0307416_100595634 | 3300032002 | Bacteria | 1184 |
| 707 | Ga0307416_101202531 | 3300032002 | Bacteria | 863 |
| 708 | Ga0307416_101251196 | 3300032002 | Bacteria | 848 |
| 709 | Ga0307414_10000402 | 3300032004 | Bacteria | 23465 |
| 710 | Ga0307414_10001891 | 3300032004 | Bacteria | 10819 |
| 711 | Ga0307414_10018465 | 3300032004 | Bacteria | 4295 |
| 712 | Ga0307414_10038219 | 3300032004 | Bacteria | 3221 |
| 713 | Ga0307414_10078400 | 3300032004 | Bacteria | 2408 |
| 714 | Ga0307414_10121142 | 3300032004 | Bacteria | 2011 |
| 715 | Ga0307414_10244896 | 3300032004 | Bacteria | 1486 |
| 716 | Ga0307414_10273465 | 3300032004 | Bacteria | 1416 |
| 717 | Ga0307414_10445182 | 3300032004 | Bacteria | 1135 |
| 718 | Ga0307414_10472269 | 3300032004 | Bacteria | 1104 |
| 719 | Ga0307414_10517500 | 3300032004 | Bacteria | 1058 |
| 720 | Ga0307414_10654838 | 3300032004 | Bacteria | 947 |
| 721 | Ga0307414_10673272 | 3300032004 | Bacteria | 934 |
| 722 | Ga0307414_10903635 | 3300032004 | Bacteria | 810 |
| 723 | Ga0307414_10966679 | 3300032004 | Bacteria | 783 |
| 724 | Ga0307414_11186195 | 3300032004 | Bacteria | 707 |
| 725 | Ga0307414_11259150 | 3300032004 | Bacteria | 686 |
| 726 | Ga0307414_11323529 | 3300032004 | Bacteria | 669 |
| 727 | Ga0307414_11449077 | 3300032004 | Bacteria | 638 |
| 728 | Ga0307414_11569562 | 3300032004 | Bacteria | 613 |
| 729 | Ga0307414_11697238 | 3300032004 | Bacteria | 589 |
| 730 | Ga0307411_10301428 | 3300032005 | Bacteria | 1285 |
| 731 | Ga0307411_10321106 | 3300032005 | Bacteria | 1250 |
| 732 | Ga0307411_11142703 | 3300032005 | Bacteria | 704 |
| 733 | Ga0307411_11252254 | 3300032005 | Bacteria | 674 |
| 734 | Ga0307411_11273438 | 3300032005 | Bacteria | 669 |
| 735 | Ga0307415_100098837 | 3300032126 | Bacteria | 2134 |
| 736 | Ga0307415_101747886 | 3300032126 | Bacteria | 601 |
| 737 | Ga0307415_102171547 | 3300032126 | Bacteria | 543 |
| 738 | Ga0307510_10009662 | 3300033180 | Bacteria | 11493 |
| 739 | Ga0316574_0706846 | 3300035398 | Bacteria | 618 |
| 740 | Ga0316584_0510960 | 3300036712 | Bacteria | 843 |
| 741 | Ga0395899_0178310 | 3300037312 | Bacteria | 1493 |
| 742 | Ga0436364_0530420 | 3300037853 | Bacteria | 132998 |
| 743 | Ga0436364_0928985 | 3300037853 | Bacteria | 2245 |
| 744 | Ga0395901_0108157 | 3300038443 | Bacteria | 2919 |
| 745 | Ga0395901_0205414 | 3300038443 | Bacteria | 2064 |
| 746 | Ga0237819_00832 | 3300038705 | Bacteria | 9739 |
| 747 | Ga0436365_0255801 | 3300039437 | Bacteria | 716 |
| 748 | Ga0436365_0375564 | 3300039437 | Bacteria | 3278 |
| 749 | Ga0436365_0571419 | 3300039437 | Bacteria | 1010 |
| 750 | Ga0436365_1490641 | 3300039437 | Bacteria | 1165 |
| 751 | Ga0436363_0495682 | 3300039450 | Bacteria | 843 |
| 752 | Ga0436363_1680954 | 3300039450 | Bacteria | 714 |
| 753 | Ga0439436_0018761 | 3300041404 | Bacteria | 2068 |
| 754 | Ga0439436_0137832 | 3300041404 | Bacteria | 685 |
| 755 | Ga0439461_0000282 | 3300041410 | Bacteria | 7317 |
| 756 | Ga0439461_0140690 | 3300041410 | Bacteria | 617 |
| 757 | Ga0439466_0065719 | 3300041411 | Bacteria | 1162 |
| 758 | Ga0439465_0004149 | 3300041413 | Bacteria | 4715 |
| 759 | Ga0451789_1323950 | 3300041443 | Bacteria | 620 |
| 760 | Ga0451791_0004095 | 3300041451 | Bacteria | 569 |
| 761 | Ga0451791_1323816 | 3300041451 | Bacteria | 839 |
| 762 | Ga0451791_1781184 | 3300041451 | Bacteria | 611 |
| 763 | Ga0451802_1880086 | 3300041460 | Bacteria | 675 |
| 764 | Ga0451804_1088671 | 3300041463 | Bacteria | 692 |
| 765 | Ga0451807_0190259 | 3300041486 | Bacteria | 571 |
| 766 | Ga0451807_0329435 | 3300041486 | Bacteria | 532 |
| 767 | Ga0451833_0606967 | 3300041491 | Bacteria | 636 |
| 768 | Ga0451837_1233901 | 3300041494 | Bacteria | 1070 |
| 769 | Ga0451841_0204279 | 3300041498 | Bacteria | 554 |
| 770 | Ga0451841_0601808 | 3300041498 | Bacteria | 501 |
| 771 | Ga0451843_0273453 | 3300041509 | Bacteria | 856 |
| 772 | Ga0451843_0328850 | 3300041509 | Bacteria | 553 |
| 773 | Ga0451855_1280009 | 3300041511 | Bacteria | 665 |
| 774 | Ga0451853_1666297 | 3300041512 | Bacteria | 1002 |
| 775 | Ga0439431_0065349 | 3300041997 | Bacteria | 962 |
| 776 | Ga0439431_0136679 | 3300041997 | Bacteria | 690 |
| 777 | Ga0439442_032520 | 3300042002 | Bacteria | 1090 |
| 778 | Ga0439445_0003320 | 3300042004 | Bacteria | 3614 |
| 779 | Ga0439445_0173222 | 3300042004 | Bacteria | 632 |
| 780 | Ga0439432_003330 | 3300042006 | Bacteria | 5968 |
| 781 | Ga0439457_052627 | 3300042014 | Bacteria | 915 |
| 782 | Ga0439462_0008838 | 3300042015 | Bacteria | 2545 |
| 783 | Ga0439462_0011511 | 3300042015 | Bacteria | 2253 |
| 784 | Ga0450912_000546 | 3300042116 | Bacteria | 1910 |
| 785 | Ga0450912_008590 | 3300042116 | Bacteria | 850 |
| 786 | Ga0450920_044532 | 3300042122 | Bacteria | 887 |
| 787 | Ga0439446_0100651 | 3300042156 | Bacteria | 914 |
| 788 | Ga0439434_0001642 | 3300042435 | Bacteria | 6468 |
| 789 | Ga0439435_0006215 | 3300042436 | Bacteria | 2674 |
| 790 | Ga0450893_0030345 | 3300042532 | Bacteria | 962 |
| 791 | Ga0451577_0183229 | 3300042876 | Bacteria | 1888 |
| 792 | Ga0453684_0193386 | 3300044712 | Bacteria | 2378 |
| 793 | Ga0466957_0218865 | 3300044842 | Bacteria | 1257 |
| 794 | Ga0466959_0522808 | 3300045049 | Bacteria | 801 |
| 795 | Ga0451576_0000588 | 3300045051 | Bacteria | 77026 |
| 796 | Ga0451576_0181078 | 3300045051 | Bacteria | 2200 |
| 797 | Ga0495617_262793 | 3300046452 | Bacteria | 530 |
| 798 | Ga0495627_000193 | 3300046453 | Bacteria | 67253 |
| 799 | Ga0495627_000478 | 3300046453 | Bacteria | 33914 |
| 800 | Ga0495590_0267909 | 3300046457 | Bacteria | 638 |
| 801 | Ga0495629_0044090 | 3300046459 | Bacteria | 3131 |
| 802 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 803 | Ga0495638_0000350 | 3300046460 | Bacteria | 57915 |
| 804 | Ga0495638_0240756 | 3300046460 | Bacteria | 1002 |
| 805 | Ga0495650_0000373 | 3300046471 | Bacteria | 78223 |
| 806 | Ga0495650_0111234 | 3300046471 | Bacteria | 1017 |
| 807 | Ga0495605_0443035 | 3300046474 | Bacteria | 536 |
| 808 | Ga0495662_0082809 | 3300046476 | Bacteria | 1561 |
| 809 | Ga0495584_0129371 | 3300046491 | Bacteria | 1280 |
| 810 | Ga0495584_0156510 | 3300046491 | Bacteria | 1158 |
| 811 | Ga0495585_0001259 | 3300046492 | Bacteria | 20359 |
| 812 | Ga0495607_0057229 | 3300046501 | Bacteria | 2235 |
| 813 | Ga0495607_0289913 | 3300046501 | Bacteria | 774 |
| 814 | Ga0495583_0000305 | 3300046506 | Bacteria | 78306 |
| 815 | Ga0495583_0001602 | 3300046506 | Bacteria | 22224 |
| 816 | Ga0495583_0042926 | 3300046506 | Bacteria | 2108 |
| 817 | Ga0495583_0068889 | 3300046506 | Bacteria | 1559 |
| 818 | Ga0495583_0112543 | 3300046506 | Bacteria | 1152 |
| 819 | Ga0495583_0173081 | 3300046506 | Bacteria | 886 |
| 820 | Ga0495606_0000591 | 3300046507 | Bacteria | 57426 |
| 821 | Ga0495606_0033962 | 3300046507 | Bacteria | 3509 |
| 822 | Ga0495610_0001092 | 3300046512 | Bacteria | 24761 |
| 823 | Ga0495610_0005829 | 3300046512 | Bacteria | 8656 |
| 824 | Ga0495610_0031673 | 3300046512 | Bacteria | 2756 |
| 825 | Ga0495631_0339081 | 3300046518 | Bacteria | 640 |
| 826 | Ga0495631_0350275 | 3300046518 | Bacteria | 628 |
| 827 | Ga0495632_0000042 | 3300046519 | Bacteria | 145186 |
| 828 | Ga0495632_0000538 | 3300046519 | Bacteria | 35631 |
| 829 | Ga0495637_0000626 | 3300046520 | Bacteria | 24967 |
| 830 | Ga0495637_0251194 | 3300046520 | Bacteria | 636 |
| 831 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 832 | Ga0495643_0000027 | 3300046522 | Bacteria | 266446 |
| 833 | Ga0495643_0005403 | 3300046522 | Bacteria | 8651 |
| 834 | Ga0495643_0009293 | 3300046522 | Bacteria | 6121 |
| 835 | Ga0495643_0036125 | 3300046522 | Bacteria | 2716 |
| 836 | Ga0495643_0126700 | 3300046522 | Bacteria | 1285 |
| 837 | Ga0495643_0152750 | 3300046522 | Bacteria | 1142 |
| 838 | Ga0495648_0000023 | 3300046524 | Bacteria | 240174 |
| 839 | Ga0495648_0000115 | 3300046524 | Bacteria | 98656 |
| 840 | Ga0495648_0009282 | 3300046524 | Bacteria | 7645 |
| 841 | Ga0495648_0011981 | 3300046524 | Bacteria | 6498 |
| 842 | Ga0495648_0058400 | 3300046524 | Bacteria | 2307 |
| 843 | Ga0495648_0065078 | 3300046524 | Bacteria | 2145 |
| 844 | Ga0495648_0286746 | 3300046524 | Bacteria | 778 |
| 845 | Ga0495663_0000015 | 3300046525 | Bacteria | 145185 |
| 846 | Ga0495663_0003401 | 3300046525 | Bacteria | 4595 |
| 847 | Ga0495663_0056048 | 3300046525 | Bacteria | 1230 |
| 848 | Ga0495663_0229267 | 3300046525 | Bacteria | 655 |
| 849 | Ga0495663_0266177 | 3300046525 | Bacteria | 611 |
| 850 | Ga0495642_0107275 | 3300046528 | Bacteria | 1192 |
| 851 | Ga0495654_0000595 | 3300046530 | Bacteria | 28928 |
| 852 | Ga0495654_0018453 | 3300046530 | Bacteria | 3656 |
| 853 | Ga0495654_0256201 | 3300046530 | Bacteria | 727 |
| 854 | Ga0495587_0414242 | 3300046536 | Bacteria | 748 |
| 855 | Ga0495598_0027069 | 3300046537 | Bacteria | 1578 |
| 856 | Ga0495609_0407114 | 3300046538 | Bacteria | 544 |
| 857 | Ga0495621_0026775 | 3300046539 | Bacteria | 1948 |
| 858 | Ga0495621_0045810 | 3300046539 | Bacteria | 1550 |
| 859 | Ga0495597_0088605 | 3300046542 | Bacteria | 1316 |
| 860 | Ga0495597_0110442 | 3300046542 | Bacteria | 1153 |
| 861 | Ga0495622_0012047 | 3300046557 | Bacteria | 3998 |
| 862 | Ga0495633_0000197 | 3300046558 | Bacteria | 76903 |
| 863 | Ga0495633_0000262 | 3300046558 | Bacteria | 62524 |
| 864 | Ga0495633_0002089 | 3300046558 | Bacteria | 14358 |
| 865 | Ga0495633_0002581 | 3300046558 | Bacteria | 12683 |
| 866 | Ga0495633_0011568 | 3300046558 | Bacteria | 4749 |
| 867 | Ga0495633_0033930 | 3300046558 | Bacteria | 2457 |
| 868 | Ga0495656_0154145 | 3300046615 | Bacteria | 1112 |
| 869 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 870 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 871 | Ga0495668_0001393 | 3300046616 | Bacteria | 23542 |
| 872 | Ga0495668_0019492 | 3300046616 | Bacteria | 3909 |
| 873 | Ga0495668_0115889 | 3300046616 | Bacteria | 1465 |
| 874 | Ga0495668_0193293 | 3300046616 | Bacteria | 1114 |
| 875 | Ga0495668_0247004 | 3300046616 | Bacteria | 977 |
| 876 | Ga0495668_0302435 | 3300046616 | Bacteria | 877 |
| 877 | Ga0495668_0482226 | 3300046616 | Bacteria | 683 |
| 878 | Ga0495611_0103287 | 3300046648 | Bacteria | 1325 |
| 879 | Ga0495611_0472799 | 3300046648 | Bacteria | 570 |
| 880 | Ga0495625_0000390 | 3300046660 | Bacteria | 66951 |
| 881 | Ga0495625_0000503 | 3300046660 | Bacteria | 58118 |
| 882 | Ga0495625_0001297 | 3300046660 | Bacteria | 31374 |
| 883 | Ga0495625_0003168 | 3300046660 | Bacteria | 16742 |
| 884 | Ga0495625_0003788 | 3300046660 | Bacteria | 14662 |
| 885 | Ga0495625_0033137 | 3300046660 | Bacteria | 3823 |
| 886 | Ga0495625_0097778 | 3300046660 | Bacteria | 2020 |
| 887 | Ga0495625_0109644 | 3300046660 | Bacteria | 1888 |
| 888 | Ga0495625_0128081 | 3300046660 | Bacteria | 1721 |
| 889 | Ga0495625_0310558 | 3300046660 | Bacteria | 1006 |
| 890 | Ga0495625_0384363 | 3300046660 | Bacteria | 880 |
| 891 | Ga0495625_0665919 | 3300046660 | Bacteria | 618 |
| 892 | Ga0495625_0670243 | 3300046660 | Bacteria | 616 |
| 893 | Ga0495625_0809704 | 3300046660 | Bacteria | 544 |
| 894 | Ga0495661_0524839 | 3300046665 | Bacteria | 562 |
| 895 | Ga0495669_0000268 | 3300046684 | Bacteria | 29882 |
| 896 | Ga0495670_0000066 | 3300046691 | Bacteria | 46500 |
| 897 | Ga0495670_0177630 | 3300046691 | Bacteria | 1123 |
| 898 | Ga0495670_0275580 | 3300046691 | Bacteria | 899 |
| 899 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 900 | Ga0495671_0000012 | 3300046692 | Bacteria | 358632 |
| 901 | Ga0495671_0096391 | 3300046692 | Bacteria | 1447 |
| 902 | Ga0495671_0100039 | 3300046692 | Bacteria | 1418 |
| 903 | Ga0495671_0118696 | 3300046692 | Bacteria | 1291 |
| 904 | Ga0495649_0121204 | 3300046694 | Bacteria | 1383 |
| 905 | Ga0495600_0004421 | 3300046809 | Bacteria | 8408 |
| 906 | Ga0495660_0215999 | 3300046810 | Bacteria | 907 |
| 907 | Ga0495636_0216797 | 3300047318 | Bacteria | 878 |
| 908 | Ga0495683_0004909 | 3300047323 | Bacteria | 7484 |
| 909 | Ga0495683_0035493 | 3300047323 | Bacteria | 2534 |
| 910 | Ga0495683_0283249 | 3300047323 | Bacteria | 717 |
| 911 | Ga0495683_0397774 | 3300047323 | Bacteria | 573 |
| 912 | Ga0495687_000055 | 3300047443 | Bacteria | 194477 |
| 913 | Ga0495687_005115 | 3300047443 | Bacteria | 8496 |
| 914 | Ga0495677_0003912 | 3300047445 | Bacteria | 5762 |
| 915 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 916 | Ga0495673_0260267 | 3300047469 | Bacteria | 631 |
| 917 | Ga0495681_0000032 | 3300047470 | Bacteria | 127415 |
| 918 | Ga0495681_0002596 | 3300047470 | Bacteria | 12823 |
| 919 | Ga0495681_0037808 | 3300047470 | Bacteria | 2373 |
| 920 | Ga0495681_0144421 | 3300047470 | Bacteria | 1002 |
| 921 | Ga0495681_0154438 | 3300047470 | Bacteria | 960 |
| 922 | Ga0495686_0001453 | 3300047472 | Bacteria | 25811 |
| 923 | Ga0495686_0004143 | 3300047472 | Bacteria | 12066 |
| 924 | Ga0495686_0008478 | 3300047472 | Bacteria | 7539 |
| 925 | Ga0495686_0042206 | 3300047472 | Bacteria | 2902 |
| 926 | Ga0495686_0078552 | 3300047472 | Bacteria | 2020 |
| 927 | Ga0495686_0165401 | 3300047472 | Bacteria | 1290 |
| 928 | Ga0495686_0438090 | 3300047472 | Bacteria | 696 |
| 929 | Ga0495615_0018356 | 3300048090 | Bacteria | 1538 |
| 930 | Ga0495615_0026748 | 3300048090 | Bacteria | 1349 |
| 931 | Ga0496100_0927777 | 3300048903 | Bacteria | 684 |
| 932 | Ga0496101_0106166 | 3300048904 | Bacteria | 2109 |
| 933 | Ga0496101_1080129 | 3300048904 | Bacteria | 630 |
| 934 | Ga0496101_1081136 | 3300048904 | Bacteria | 630 |
| 935 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 936 | Ga0496102_0011200 | 3300048905 | Bacteria | 7724 |
| 937 | Ga0496102_0027205 | 3300048905 | Bacteria | 5108 |
| 938 | Ga0496102_0834760 | 3300048905 | Bacteria | 844 |
| 939 | Ga0496102_1270847 | 3300048905 | Bacteria | 655 |
| 940 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 941 | Ga0496103_0000151 | 3300048906 | Bacteria | 72539 |
| 942 | Ga0496103_0796185 | 3300048906 | Bacteria | 596 |
| 943 | Ga0496104_0046225 | 3300048907 | Bacteria | 4099 |
| 944 | Ga0496104_0520997 | 3300048907 | Bacteria | 1100 |
| 945 | Ga0496104_1696910 | 3300048907 | Bacteria | 534 |
| 946 | Ga0496105_0002067 | 3300048908 | Bacteria | 14517 |
| 947 | Ga0496107_0753502 | 3300048910 | Bacteria | 714 |
| 948 | Ga0496108_0002067 | 3300048911 | Bacteria | 16059 |
| 949 | Ga0496108_1232693 | 3300048911 | Bacteria | 631 |
| 950 | Ga0496109_0134818 | 3300048912 | Bacteria | 2306 |
| 951 | Ga0496109_0564467 | 3300048912 | Bacteria | 1073 |
| 952 | Ga0496109_0724700 | 3300048912 | Bacteria | 932 |
| 953 | Ga0496110_0058567 | 3300048913 | Bacteria | 3393 |
| 954 | Ga0496110_0140354 | 3300048913 | Bacteria | 2184 |
| 955 | Ga0496110_0156130 | 3300048913 | Bacteria | 2067 |
| 956 | Ga0496110_1263689 | 3300048913 | Bacteria | 647 |
| 957 | Ga0496111_0030916 | 3300048914 | Bacteria | 3810 |
| 958 | Ga0496111_0112774 | 3300048914 | Bacteria | 2003 |
| 959 | Ga0496112_0123702 | 3300048915 | Bacteria | 2558 |
| 960 | Ga0496113_0004996 | 3300048916 | Bacteria | 8221 |
| 961 | Ga0496113_0125999 | 3300048916 | Bacteria | 2006 |
| 962 | Ga0496113_1263065 | 3300048916 | Bacteria | 575 |
| 963 | Ga0496114_0014916 | 3300048917 | Bacteria | 6245 |
| 964 | Ga0496114_0061205 | 3300048917 | Bacteria | 3148 |
| 965 | Ga0496115_0000018 | 3300048918 | Bacteria | 182523 |
| 966 | Ga0496115_0304870 | 3300048918 | Bacteria | 1304 |
| 967 | Ga0496116_0000664 | 3300048919 | Bacteria | 44805 |
| 968 | Ga0496116_0013868 | 3300048919 | Bacteria | 6469 |
| 969 | Ga0496116_0330323 | 3300048919 | Bacteria | 709 |
| 970 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 971 | Ga0496117_0000408 | 3300048920 | Bacteria | 72369 |
| 972 | Ga0496117_0018914 | 3300048920 | Bacteria | 5682 |
| 973 | Ga0496117_0118200 | 3300048920 | Bacteria | 1635 |
| 974 | Ga0496117_0366028 | 3300048920 | Bacteria | 739 |
| 975 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 976 | Ga0496118_0000600 | 3300048921 | Bacteria | 59661 |
| 977 | Ga0496118_0001927 | 3300048921 | Bacteria | 29427 |
| 978 | Ga0496118_0024471 | 3300048921 | Bacteria | 5208 |
| 979 | Ga0496118_0111601 | 3300048921 | Bacteria | 1812 |
| 980 | Ga0496118_0135646 | 3300048921 | Bacteria | 1571 |
| 981 | Ga0496118_0547135 | 3300048921 | Bacteria | 565 |
| 982 | Ga0496118_0609535 | 3300048921 | Bacteria | 521 |
| 983 | Ga0496119_0011638 | 3300048922 | Bacteria | 7251 |
| 984 | Ga0496119_0026037 | 3300048922 | Bacteria | 4067 |
| 985 | Ga0496120_0116338 | 3300048923 | Bacteria | 1389 |
| 986 | Ga0496121_0000208 | 3300048924 | Bacteria | 129753 |
| 987 | Ga0496121_0000237 | 3300048924 | Bacteria | 118615 |
| 988 | Ga0496121_0001774 | 3300048924 | Bacteria | 35047 |
| 989 | Ga0496121_0010863 | 3300048924 | Bacteria | 10179 |
| 990 | Ga0496121_0083746 | 3300048924 | Bacteria | 2517 |
| 991 | Ga0496121_0107141 | 3300048924 | Bacteria | 2141 |
| 992 | Ga0496121_0285376 | 3300048924 | Bacteria | 1127 |
| 993 | Ga0496121_0303153 | 3300048924 | Bacteria | 1083 |
| 994 | Ga0496122_0000970 | 3300048925 | Bacteria | 51487 |
| 995 | Ga0496122_0010455 | 3300048925 | Bacteria | 9557 |
| 996 | Ga0496122_0036922 | 3300048925 | Bacteria | 3942 |
| 997 | Ga0496122_0170992 | 3300048925 | Bacteria | 1310 |
| 998 | Ga0496122_0294950 | 3300048925 | Bacteria | 878 |
| 999 | Ga0496122_0315114 | 3300048925 | Bacteria | 835 |
| 1000 | Ga0496123_0000286 | 3300048926 | Bacteria | 98752 |
| 1001 | Ga0496123_0015139 | 3300048926 | Bacteria | 6347 |
| 1002 | Ga0496123_0029909 | 3300048926 | Bacteria | 3998 |
| 1003 | Ga0496123_0060522 | 3300048926 | Bacteria | 2441 |
| 1004 | Ga0496123_0162083 | 3300048926 | Bacteria | 1191 |
| 1005 | Ga0496123_0264775 | 3300048926 | Bacteria | 840 |
| 1006 | Ga0496124_0000099 | 3300048927 | Bacteria | 182007 |
| 1007 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 1008 | Ga0496124_0002045 | 3300048927 | Bacteria | 27415 |
| 1009 | Ga0496124_0002943 | 3300048927 | Bacteria | 21414 |
| 1010 | Ga0496124_0013584 | 3300048927 | Bacteria | 7940 |
| 1011 | Ga0496124_0052650 | 3300048927 | Bacteria | 3457 |
| 1012 | Ga0496124_0053462 | 3300048927 | Bacteria | 3423 |
| 1013 | Ga0496124_0059087 | 3300048927 | Bacteria | 3222 |
| 1014 | Ga0496124_0205382 | 3300048927 | Bacteria | 1494 |
| 1015 | Ga0496124_0216169 | 3300048927 | Bacteria | 1446 |
| 1016 | Ga0496124_0536880 | 3300048927 | Bacteria | 775 |
| 1017 | Ga0496124_0614764 | 3300048927 | Bacteria | 704 |
| 1018 | Ga0496124_0883505 | 3300048927 | Bacteria | 544 |
| 1019 | Ga0496125_0012876 | 3300048928 | Bacteria | 8263 |
| 1020 | Ga0496125_0022088 | 3300048928 | Bacteria | 5916 |
| 1021 | Ga0496125_0050166 | 3300048928 | Bacteria | 3458 |
| 1022 | Ga0496125_0073878 | 3300048928 | Bacteria | 2647 |
| 1023 | Ga0496125_0106291 | 3300048928 | Bacteria | 2049 |
| 1024 | Ga0496125_0169773 | 3300048928 | Bacteria | 1468 |
| 1025 | Ga0496125_0299026 | 3300048928 | Bacteria | 987 |
| 1026 | Ga0496125_0304291 | 3300048928 | Bacteria | 975 |
| 1027 | Ga0496125_0598961 | 3300048928 | Bacteria | 602 |
| 1028 | Ga0496126_0000507 | 3300048929 | Bacteria | 76510 |
| 1029 | Ga0496126_0048499 | 3300048929 | Bacteria | 3880 |
| 1030 | Ga0496126_0116494 | 3300048929 | Bacteria | 2322 |
| 1031 | Ga0496126_0141298 | 3300048929 | Bacteria | 2072 |
| 1032 | Ga0496126_0455171 | 3300048929 | Bacteria | 1029 |
| 1033 | Ga0496126_0789729 | 3300048929 | Bacteria | 729 |
| 1034 | Ga0501306_101616 | 3300049127 | Bacteria | 515 |
| 1035 | Ga0501305_009896 | 3300049161 | Bacteria | 1263 |
| 1036 | Ga0501307_003277 | 3300049162 | Bacteria | 1578 |
| 1037 | Ga0495678_013203 | 3300049459 | Bacteria | 3888 |
| 1038 | Ga0495678_148894 | 3300049459 | Bacteria | 758 |
| 1039 | Ga0501290_000239 | 3300049513 | Bacteria | 9080 |
| 1040 | Ga0501291_140520 | 3300049514 | Bacteria | 539 |
| 1041 | Ga0501292_000008 | 3300049515 | Bacteria | 83748 |
| 1042 | Ga0501293_001729 | 3300049516 | Bacteria | 1645 |
| 1043 | Ga0501293_023847 | 3300049516 | Bacteria | 617 |
| 1044 | Ga0501294_009404 | 3300049517 | Bacteria | 959 |
| 1045 | Ga0501300_000363 | 3300049523 | Bacteria | 6905 |
| 1046 | Ga0501313_012426 | 3300049529 | Bacteria | 992 |
| 1047 | Ga0501313_031360 | 3300049529 | Bacteria | 690 |
| 1048 | Ga0501315_007923 | 3300049531 | Bacteria | 1223 |
| 1049 | Ga0501317_011776 | 3300049533 | Bacteria | 1069 |
| 1050 | Ga0501324_046489 | 3300049540 | Bacteria | 506 |
| 1051 | Ga0501335_004555 | 3300049551 | Bacteria | 1214 |
| 1052 | Ga0501031_0223725 | 3300049568 | Bacteria | 1225 |
| 1053 | Ga0501031_0378666 | 3300049568 | Bacteria | 916 |
| 1054 | Ga0501032_0056525 | 3300049569 | Bacteria | 2637 |
| 1055 | Ga0501032_0228127 | 3300049569 | Bacteria | 1211 |
| 1056 | Ga0501032_0415144 | 3300049569 | Bacteria | 864 |
| 1057 | Ga0501033_0007915 | 3300049570 | Bacteria | 8232 |
| 1058 | Ga0501033_0103136 | 3300049570 | Bacteria | 2080 |
| 1059 | Ga0501033_0256012 | 3300049570 | Bacteria | 1240 |
| 1060 | Ga0501033_0488746 | 3300049570 | Bacteria | 852 |
| 1061 | Ga0501034_0024797 | 3300049571 | Bacteria | 6102 |
| 1062 | Ga0501034_0143619 | 3300049571 | Bacteria | 2365 |
| 1063 | Ga0501034_0175045 | 3300049571 | Bacteria | 2112 |
| 1064 | Ga0501034_0383379 | 3300049571 | Bacteria | 1330 |
| 1065 | Ga0501034_0570302 | 3300049571 | Bacteria | 1040 |
| 1066 | Ga0501034_0648180 | 3300049571 | Bacteria | 958 |
| 1067 | Ga0501034_0768735 | 3300049571 | Bacteria | 858 |
| 1068 | Ga0501034_1636362 | 3300049571 | Bacteria | 517 |
| 1069 | Ga0501036_0042413 | 3300049572 | Bacteria | 3852 |
| 1070 | Ga0501036_0335592 | 3300049572 | Bacteria | 1263 |
| 1071 | Ga0501036_0594917 | 3300049572 | Bacteria | 918 |
| 1072 | Ga0501036_0682019 | 3300049572 | Bacteria | 850 |
| 1073 | Ga0501037_0007067 | 3300049573 | Bacteria | 8202 |
| 1074 | Ga0501037_0157079 | 3300049573 | Bacteria | 1623 |
| 1075 | Ga0501037_0675456 | 3300049573 | Bacteria | 689 |
| 1076 | Ga0501037_0721677 | 3300049573 | Bacteria | 662 |
| 1077 | Ga0501038_0162575 | 3300049574 | Bacteria | 1813 |
| 1078 | Ga0501038_0179345 | 3300049574 | Bacteria | 1710 |
| 1079 | Ga0501038_0249511 | 3300049574 | Bacteria | 1406 |
| 1080 | Ga0501038_1210606 | 3300049574 | Bacteria | 548 |
| 1081 | Ga0501039_0069075 | 3300049575 | Bacteria | 2743 |
| 1082 | Ga0501039_0667237 | 3300049575 | Bacteria | 814 |
| 1083 | Ga0501039_1348332 | 3300049575 | Bacteria | 550 |
| 1084 | Ga0501042_0766286 | 3300049578 | Bacteria | 702 |
| 1085 | Ga0501042_0808800 | 3300049578 | Bacteria | 682 |
| 1086 | Ga0501042_1453349 | 3300049578 | Bacteria | 500 |
| 1087 | Ga0501043_0127668 | 3300049579 | Bacteria | 1994 |
| 1088 | Ga0501043_0235691 | 3300049579 | Bacteria | 1412 |
| 1089 | Ga0501043_0286073 | 3300049579 | Bacteria | 1263 |
| 1090 | Ga0501043_0376967 | 3300049579 | Bacteria | 1074 |
| 1091 | Ga0501046_0087795 | 3300049580 | Bacteria | 2396 |
| 1092 | Ga0501046_0248471 | 3300049580 | Bacteria | 1310 |
| 1093 | Ga0501047_0000876 | 3300049581 | Bacteria | 30712 |
| 1094 | Ga0501047_0293727 | 3300049581 | Bacteria | 1468 |
| 1095 | Ga0501047_0380991 | 3300049581 | Bacteria | 1245 |
| 1096 | Ga0501047_0384774 | 3300049581 | Bacteria | 1237 |
| 1097 | Ga0501047_0529825 | 3300049581 | Bacteria | 1003 |
| 1098 | Ga0501047_1256300 | 3300049581 | Bacteria | 554 |
| 1099 | Ga0501048_0063746 | 3300049582 | Bacteria | 2606 |
| 1100 | Ga0501048_0439882 | 3300049582 | Bacteria | 933 |
| 1101 | Ga0501067_0415310 | 3300049583 | Bacteria | 751 |
| 1102 | Ga0501070_0209515 | 3300049586 | Bacteria | 1600 |
| 1103 | Ga0501071_0505286 | 3300049587 | Bacteria | 927 |
| 1104 | Ga0501071_0814569 | 3300049587 | Bacteria | 720 |
| 1105 | Ga0501073_0753796 | 3300049589 | Bacteria | 671 |
| 1106 | Ga0501202_010095 | 3300049652 | Bacteria | 1745 |
| 1107 | Ga0501206_003593 | 3300049653 | Bacteria | 1970 |
| 1108 | Ga0501206_006431 | 3300049653 | Bacteria | 1529 |
| 1109 | Ga0501207_012775 | 3300049654 | Bacteria | 1265 |
| 1110 | Ga0501208_077551 | 3300049655 | Bacteria | 678 |
| 1111 | Ga0501222_000772 | 3300049662 | Bacteria | 4610 |
| 1112 | Ga0501223_000004 | 3300049663 | Bacteria | 141027 |
| 1113 | Ga0501223_000368 | 3300049663 | Bacteria | 11106 |
| 1114 | Ga0501223_112769 | 3300049663 | Bacteria | 569 |
| 1115 | Ga0501224_006184 | 3300049664 | Bacteria | 1732 |
| 1116 | Ga0501224_019511 | 3300049664 | Bacteria | 1010 |
| 1117 | Ga0501227_018690 | 3300049665 | Bacteria | 1575 |
| 1118 | Ga0501233_039761 | 3300049668 | Bacteria | 1100 |
| 1119 | Ga0501235_008987 | 3300049669 | Bacteria | 2181 |
| 1120 | Ga0501235_011993 | 3300049669 | Bacteria | 1905 |
| 1121 | Ga0501235_035994 | 3300049669 | Bacteria | 1125 |
| 1122 | Ga0501236_002716 | 3300049670 | Bacteria | 2039 |
| 1123 | Ga0501236_007445 | 3300049670 | Bacteria | 1368 |
| 1124 | Ga0501249_000686 | 3300049679 | Bacteria | 7716 |
| 1125 | Ga0501257_001004 | 3300049686 | Bacteria | 5686 |
| 1126 | Ga0501257_037227 | 3300049686 | Bacteria | 1186 |
| 1127 | Ga0501259_000589 | 3300049688 | Bacteria | 5813 |
| 1128 | Ga0501261_000030 | 3300049690 | Bacteria | 32000 |
| 1129 | Ga0501221_010535 | 3300049704 | Bacteria | 1644 |
| 1130 | Ga0501225_0000003 | 3300049705 | Bacteria | 141070 |
| 1131 | Ga0501225_0001931 | 3300049705 | Bacteria | 6489 |
| 1132 | Ga0501225_0002873 | 3300049705 | Bacteria | 5287 |
| 1133 | Ga0501245_002127 | 3300049708 | Bacteria | 2631 |
| 1134 | Ga0501245_008085 | 3300049708 | Bacteria | 1494 |
| 1135 | Ga0501080_0166082 | 3300049742 | Bacteria | 2037 |
| 1136 | Ga0501241_010421 | 3300049758 | Bacteria | 1691 |
| 1137 | Ga0501264_005550 | 3300049761 | Bacteria | 1150 |
| 1138 | Ga0501279_000002 | 3300049775 | Bacteria | 205937 |
| 1139 | Ga0501280_000010 | 3300049776 | Bacteria | 63153 |
| 1140 | Ga0501280_008201 | 3300049776 | Bacteria | 1456 |
| 1141 | Ga0501281_00100 | 3300049777 | Bacteria | 10298 |
| 1142 | Ga0501281_11331 | 3300049777 | Bacteria | 634 |
| 1143 | Ga0501282_000779 | 3300049778 | Bacteria | 3663 |
| 1144 | Ga0501035_0007244 | 3300049822 | Bacteria | 10381 |
| 1145 | Ga0501035_0299712 | 3300049822 | Bacteria | 1355 |
| 1146 | Ga0501035_0659817 | 3300049822 | Bacteria | 847 |
| 1147 | Ga0501044_0031887 | 3300049823 | Bacteria | 5542 |
| 1148 | Ga0501044_0186702 | 3300049823 | Bacteria | 2037 |
| 1149 | Ga0501044_0348005 | 3300049823 | Bacteria | 1402 |
| 1150 | Ga0501044_0373081 | 3300049823 | Bacteria | 1343 |
| 1151 | Ga0501044_0591466 | 3300049823 | Bacteria | 1003 |
| 1152 | Ga0501044_0681022 | 3300049823 | Bacteria | 915 |
| 1153 | Ga0501044_0880516 | 3300049823 | Bacteria | 771 |
| 1154 | Ga0501045_0988261 | 3300049824 | Bacteria | 617 |
| 1155 | nmdc:mga03683_191052_c1 | 3300050489 | Bacteria | 937 |
| 1156 | nmdc:mga03683_229_c1 | 3300050489 | Bacteria | 17517 |
| 1157 | nmdc:mga03n38_19603_c1 | 3300050490 | Bacteria | 2691 |
| 1158 | nmdc:mga00v17_144311_c1 | 3300050491 | Bacteria | 1528 |
| 1159 | nmdc:mga00v17_150524_c1 | 3300050491 | Bacteria | 1495 |
| 1160 | nmdc:mga00v17_166252_c1 | 3300050491 | Bacteria | 1421 |
| 1161 | nmdc:mga0yw44_141365_c1 | 3300050492 | Bacteria | 1565 |
| 1162 | nmdc:mga0k408_223480_c1 | 3300050493 | Bacteria | 1124 |
| 1163 | nmdc:mga0k408_29927_c1 | 3300050493 | Bacteria | 3103 |
| 1164 | nmdc:mga0k408_42790_c1 | 3300050493 | Bacteria | 2608 |
| 1165 | nmdc:mga0k408_61537_c1 | 3300050493 | Bacteria | 2182 |
| 1166 | nmdc:mga0k408_779808_c1 | 3300050493 | Bacteria | 558 |
| 1167 | nmdc:mga0k408_88899_c1 | 3300050493 | Bacteria | 1814 |
| 1168 | nmdc:mga06z11_27_c1 | 3300050494 | Bacteria | 64010 |
| 1169 | nmdc:mga06z11_646394_c1 | 3300050494 | Bacteria | 644 |
| 1170 | nmdc:mga06z11_6554_c1 | 3300050494 | Bacteria | 4748 |
| 1171 | nmdc:mga04h51_147_c1 | 3300050495 | Bacteria | 20575 |
| 1172 | nmdc:mga04h51_4151_c1 | 3300050495 | Bacteria | 3577 |
| 1173 | nmdc:mga07m45_253890_c1 | 3300050496 | Bacteria | 1023 |
| 1174 | nmdc:mga07m45_33_c1 | 3300050496 | Bacteria | 75596 |
| 1175 | nmdc:mga07m45_427415_c1 | 3300050496 | Bacteria | 768 |
| 1176 | nmdc:mga07m45_471260_c1 | 3300050496 | Bacteria | 728 |
| 1177 | nmdc:mga07m45_84542_c1 | 3300050496 | Bacteria | 1460 |
| 1178 | nmdc:mga07m45_90862_c1 | 3300050496 | Bacteria | 1749 |
| 1179 | nmdc:mga05p37_1296370_c1 | 3300050507 | Bacteria | 743 |
| 1180 | nmdc:mga08y16_1661375_c1 | 3300050511 | Bacteria | 595 |
| 1181 | nmdc:mga0sz30_59743_c1 | 3300050516 | Bacteria | 1627 |
| 1182 | nmdc:mga0sz30_9117_c1 | 3300050516 | Bacteria | 3764 |
| 1183 | Ga0495612_0327786 | 3300053078 | Bacteria | 689 |
| 1184 | Ga0500610_0000496 | 3300053079 | Bacteria | 12112 |
| 1185 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 1186 | Ga0500643_000065 | 3300053087 | Bacteria | 119995 |
| 1187 | Ga0500643_001584 | 3300053087 | Bacteria | 12872 |
| 1188 | Ga0500643_002759 | 3300053087 | Bacteria | 8794 |
| 1189 | Ga0500643_003367 | 3300053087 | Bacteria | 7736 |
| 1190 | Ga0500643_007933 | 3300053087 | Bacteria | 4224 |
| 1191 | Ga0500643_010821 | 3300053087 | Bacteria | 3371 |
| 1192 | Ga0500643_016304 | 3300053087 | Bacteria | 2519 |
| 1193 | Ga0500643_016401 | 3300053087 | Bacteria | 2509 |
| 1194 | Ga0500643_034447 | 3300053087 | Bacteria | 1525 |
| 1195 | Ga0500583_0559113 | 3300053092 | Bacteria | 531 |
| 1196 | Ga0500651_0289877 | 3300053093 | Bacteria | 942 |
| 1197 | Ga0500651_0497111 | 3300053093 | Bacteria | 673 |
| 1198 | Ga0500566_0002509 | 3300053094 | Bacteria | 10901 |
| 1199 | Ga0500641_0093245 | 3300053096 | Bacteria | 1287 |
| 1200 | Ga0500556_0000074 | 3300053104 | Bacteria | 98799 |
| 1201 | Ga0500556_0265161 | 3300053104 | Bacteria | 675 |
| 1202 | Ga0500562_076918 | 3300053108 | Bacteria | 902 |
| 1203 | Ga0500562_224004 | 3300053108 | Bacteria | 508 |
| 1204 | Ga0500572_016593 | 3300053111 | Bacteria | 1879 |
| 1205 | Ga0500592_000118 | 3300053116 | Bacteria | 17080 |
| 1206 | Ga0500592_000393 | 3300053116 | Bacteria | 7341 |
| 1207 | Ga0500592_015653 | 3300053116 | Bacteria | 1217 |
| 1208 | Ga0500594_0000572 | 3300053118 | Bacteria | 7889 |
| 1209 | Ga0500594_0105044 | 3300053118 | Bacteria | 873 |
| 1210 | Ga0500595_031857 | 3300053119 | Bacteria | 1765 |
| 1211 | Ga0500595_106833 | 3300053119 | Bacteria | 798 |
| 1212 | Ga0500597_003969 | 3300053120 | Bacteria | 4495 |
| 1213 | Ga0500607_000098 | 3300053121 | Bacteria | 65919 |
| 1214 | Ga0500608_007974 | 3300053122 | Bacteria | 4419 |
| 1215 | Ga0500608_159037 | 3300053122 | Bacteria | 981 |
| 1216 | Ga0500608_298128 | 3300053122 | Bacteria | 600 |
| 1217 | Ga0500626_315636 | 3300053128 | Bacteria | 543 |
| 1218 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 1219 | Ga0500642_0000116 | 3300053130 | Bacteria | 37194 |
| 1220 | Ga0500652_179255 | 3300053131 | Bacteria | 869 |
| 1221 | Ga0500658_0043853 | 3300053134 | Bacteria | 1802 |
| 1222 | Ga0500658_0091278 | 3300053134 | Bacteria | 1317 |
| 1223 | Ga0500559_0060943 | 3300053136 | Bacteria | 1682 |
| 1224 | Ga0500559_0065891 | 3300053136 | Bacteria | 1623 |
| 1225 | Ga0500559_0130334 | 3300053136 | Bacteria | 1174 |
| 1226 | Ga0500559_0309131 | 3300053136 | Bacteria | 742 |
| 1227 | Ga0500559_0341614 | 3300053136 | Bacteria | 701 |
| 1228 | Ga0500559_0345425 | 3300053136 | Bacteria | 696 |
| 1229 | Ga0500559_0574737 | 3300053136 | Bacteria | 512 |
| 1230 | Ga0500564_192633 | 3300053138 | Bacteria | 843 |
| 1231 | Ga0500564_220754 | 3300053138 | Bacteria | 767 |
| 1232 | Ga0500568_0007493 | 3300053139 | Bacteria | 5350 |
| 1233 | Ga0500568_0115245 | 3300053139 | Bacteria | 1003 |
| 1234 | Ga0500568_0162151 | 3300053139 | Bacteria | 825 |
| 1235 | Ga0500573_0000046 | 3300053140 | Bacteria | 98723 |
| 1236 | Ga0500573_0440291 | 3300053140 | Bacteria | 605 |
| 1237 | Ga0500577_0516699 | 3300053142 | Bacteria | 521 |
| 1238 | Ga0500588_0055704 | 3300053146 | Bacteria | 1249 |
| 1239 | Ga0500590_097791 | 3300053148 | Bacteria | 1414 |
| 1240 | Ga0500604_0017059 | 3300053151 | Bacteria | 2005 |
| 1241 | Ga0500604_0105546 | 3300053151 | Bacteria | 932 |
| 1242 | Ga0500604_0200470 | 3300053151 | Bacteria | 686 |
| 1243 | Ga0500604_0225753 | 3300053151 | Bacteria | 646 |
| 1244 | Ga0500604_0289952 | 3300053151 | Bacteria | 567 |
| 1245 | Ga0500616_0116858 | 3300053153 | Bacteria | 1280 |
| 1246 | Ga0500619_245683 | 3300053154 | Bacteria | 590 |
| 1247 | Ga0500619_255005 | 3300053154 | Bacteria | 577 |
| 1248 | Ga0500619_260087 | 3300053154 | Bacteria | 569 |
| 1249 | Ga0500622_0229706 | 3300053156 | Bacteria | 827 |
| 1250 | Ga0500624_000044 | 3300053157 | Bacteria | 90094 |
| 1251 | Ga0500624_000053 | 3300053157 | Bacteria | 74086 |
| 1252 | Ga0500627_0000054 | 3300053158 | Bacteria | 55229 |
| 1253 | Ga0500627_0000508 | 3300053158 | Bacteria | 10461 |
| 1254 | Ga0500627_0000799 | 3300053158 | Bacteria | 8399 |
| 1255 | Ga0500627_0319549 | 3300053158 | Bacteria | 674 |
| 1256 | Ga0500627_0463127 | 3300053158 | Bacteria | 532 |
| 1257 | Ga0500633_0072786 | 3300053160 | Bacteria | 1230 |
| 1258 | Ga0500636_0005811 | 3300053177 | Bacteria | 7063 |
| 1259 | Ga0500637_0000008 | 3300053178 | Bacteria | 89244 |
| 1260 | Ga0500611_000244 | 3300053727 | Bacteria | 6165 |
| 1261 | Ga0500611_128595 | 3300053727 | Bacteria | 681 |
| 1262 | Ga0500645_000009 | 3300053730 | Bacteria | 206177 |
| 1263 | Ga0500645_000439 | 3300053730 | Bacteria | 28425 |
| 1264 | Ga0500645_002373 | 3300053730 | Bacteria | 8483 |
| 1265 | Ga0500645_007761 | 3300053730 | Bacteria | 3712 |
| 1266 | Ga0500645_184279 | 3300053730 | Bacteria | 567 |
| 1267 | Ga0500596_013713 | 3300053735 | Bacteria | 1222 |
| 1268 | Ga0500661_071886 | 3300055283 | Bacteria | 633 |
| 1269 | Ga0587077_030086 | 3300059493 | Bacteria | 1028 |
| 1270 | Ga0587085_045596 | 3300059506 | Bacteria | 781 |
| 1271 | Ga0587090_000313 | 3300059510 | Bacteria | 3797 |
| 1272 | Ga0587090_114637 | 3300059510 | Bacteria | 578 |
| 1273 | Ga0587101_152085 | 3300059623 | Bacteria | 502 |
| 1274 | Ga0587115_024628 | 3300059626 | Bacteria | 860 |
| 1275 | Ga0587128_083613 | 3300059630 | Bacteria | 643 |
| 1276 | Ga0587072_135641 | 3300059643 | Bacteria | 583 |
| 1277 | Ga0587107_141702 | 3300059652 | Bacteria | 514 |
| 1278 | Ga0587111_0043277 | 3300060346 | Bacteria | 968 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_11141427 | Ga0157370_111414271 | 87 |
| 2 | 3300005262 | Ga0065165_1004474 | Ga0065165_10044745 | 90 |
| 3 | 3300046491 | Ga0495584_0129371 | Ga0495584_0129371_67_363 | 90 |
| 4 | 3300046519 | Ga0495632_0000042 | Ga0495632_0000042_50440_50736 | 90 |
| 5 | 3300046522 | Ga0495643_0000005 | Ga0495643_0000005_392396_392692 | 90 |
| 6 | 3300046525 | Ga0495663_0000015 | Ga0495663_0000015_94450_94746 | 90 |
| 7 | 3300046558 | Ga0495633_0000197 | Ga0495633_0000197_21957_22253 | 90 |
| 8 | 3300046558 | Ga0495633_0000262 | Ga0495633_0000262_50440_50736 | 90 |
| 9 | 3300046660 | Ga0495625_0809704 | Ga0495625_0809704_14_310 | 90 |
| 10 | 3300046692 | Ga0495671_0000007 | Ga0495671_0000007_392330_392626 | 90 |
| 11 | 3300047323 | Ga0495683_0283249 | Ga0495683_0283249_387_683 | 90 |
| 12 | 3300047470 | Ga0495681_0002596 | Ga0495681_0002596_7249_7545 | 90 |
| 13 | 3300047472 | Ga0495686_0078552 | Ga0495686_0078552_761_1057 | 90 |
| 14 | 3300009177 | Ga0105248_11732468 | Ga0105248_117324682 | 91 |
| 15 | 3300017792 | Ga0163161_10001996 | Ga0163161_100019967 | 91 |
| 16 | 3300025900 | Ga0207710_10243809 | Ga0207710_102438092 | 91 |
| 17 | 3300048921 | Ga0496118_0135646 | Ga0496118_0135646_517_813 | 91 |
| 18 | iso_pu_bacteria | 2599185354 | 2600200736 | 91 |
| 19 | iso_pu_bacteria | 2751185897 | 2753765136 | 91 |
| 20 | 3300046520 | Ga0495637_0000626 | Ga0495637_0000626_17212_17508 | 92 |
| 21 | 3300005563 | Ga0068855_100014816 | Ga0068855_10001481611 | 93 |
| 22 | 3300013100 | Ga0157373_10128467 | Ga0157373_101284672 | 93 |
| 23 | 3300025949 | Ga0207667_10480450 | Ga0207667_104804502 | 93 |
| 24 | iso_pu_bacteria | 2512564014 | 2512644704 | 94 |
| 25 | iso_pu_bacteria | 2599185359 | 2600226335 | 94 |
| 26 | iso_pu_bacteria | 2643221541 | 2643730035 | 94 |
| 27 | iso_pu_bacteria | 2643221560 | 2643822900 | 94 |
| 28 | iso_pu_bacteria | 2643221563 | 2643832494 | 94 |
| 29 | iso_pu_bacteria | 2643221588 | 2643950306 | 94 |
| 30 | iso_pu_bacteria | 2643221605 | 2644039783 | 94 |
| 31 | iso_pu_bacteria | 2643221606 | 2644045521 | 94 |
| 32 | iso_pu_bacteria | 2643221608 | 2644053711 | 94 |
| 33 | iso_pu_bacteria | 2643221622 | 2644126963 | 94 |
| 34 | iso_pu_bacteria | 2643221671 | 2644392853 | 94 |
| 35 | iso_pu_bacteria | 2775507255 | 2778123875 | 94 |
| 36 | iso_pu_bacteria | 2818991466 | 2819712421 | 94 |
| 37 | iso_pu_bacteria | 2830075706 | 2830077899 | 94 |
| 38 | iso_pu_bacteria | 2848297114 | 2848299364 | 94 |
| 39 | iso_pu_bacteria | 2852653556 | 2852654833 | 94 |
| 40 | iso_pu_bacteria | 2852680915 | 2852681644 | 94 |
| 41 | iso_pu_bacteria | 2879163058 | 2879164441 | 94 |
| 42 | iso_pu_bacteria | 2882806704 | 2882808494 | 94 |
| 43 | iso_pu_bacteria | 2885429604 | 2885430075 | 94 |
| 44 | iso_pu_bacteria | 2895880812 | 2895884215 | 94 |
| 45 | iso_pu_bacteria | 2896184354 | 2896186830 | 94 |
| 46 | iso_pu_bacteria | 2896253425 | 2896254593 | 94 |
| 47 | iso_pu_bacteria | 2928027323 | 2928029583 | 94 |
| 48 | iso_pu_bacteria | 2928526807 | 2928526931 | 94 |
| 49 | iso_pu_bacteria | 2928968154 | 2928969464 | 94 |
| 50 | iso_pu_bacteria | 2946787523 | 2946788259 | 94 |
| 51 | iso_pu_bacteria | 2984555340 | 2984557510 | 94 |
| 52 | iso_pu_bacteria | 2984564862 | 2984568127 | 94 |
| 53 | iso_pu_bacteria | 2990265787 | 2990266534 | 94 |
| 54 | iso_pu_bacteria | 2993356040 | 2993359172 | 94 |
| 55 | iso_pu_bacteria | 2993693658 | 2993695668 | 94 |
| 56 | iso_pu_bacteria | 8057101203 | 8057101755 | 94 |
| 57 | 3300005578 | Ga0068854_101042552 | Ga0068854_1010425522 | 95 |
| 58 | 3300005844 | Ga0068862_102156793 | Ga0068862_1021567932 | 95 |
| 59 | 3300021388 | Ga0213875_10000229 | Ga0213875_1000022934 | 95 |
| 60 | 3300031911 | Ga0307412_10002858 | Ga0307412_1000285812 | 95 |
| 61 | 3300045049 | Ga0466959_0522808 | Ga0466959_0522808_389_676 | 95 |
| 62 | 3300048920 | Ga0496117_0366028 | Ga0496117_0366028_152_442 | 95 |
| 63 | 3300059630 | Ga0587128_083613 | Ga0587128_083613_201_488 | 95 |
| 64 | 3300002126 | JGI24035J26624_1005781 | JGI24035J26624_10057812 | 96 |
| 65 | 3300002459 | JGI24751J29686_10026087 | JGI24751J29686_100260872 | 96 |
| 66 | 3300005327 | Ga0070658_10637336 | Ga0070658_106373362 | 96 |
| 67 | 3300005327 | Ga0070658_11043948 | Ga0070658_110439482 | 96 |
| 68 | 3300005331 | Ga0070670_100864713 | Ga0070670_1008647131 | 96 |
| 69 | 3300005335 | Ga0070666_10000063 | Ga0070666_1000006346 | 96 |
| 70 | 3300005347 | Ga0070668_100013413 | Ga0070668_1000134135 | 96 |
| 71 | 3300005353 | Ga0070669_100000042 | Ga0070669_100000042101 | 96 |
| 72 | 3300005355 | Ga0070671_100000002 | Ga0070671_10000000234 | 96 |
| 73 | 3300005367 | Ga0070667_100035266 | Ga0070667_1000352662 | 96 |
| 74 | 3300005544 | Ga0070686_101391044 | Ga0070686_1013910442 | 96 |
| 75 | 3300005548 | Ga0070665_100073523 | Ga0070665_1000735232 | 96 |
| 76 | 3300005617 | Ga0068859_100002597 | Ga0068859_1000025972 | 96 |
| 77 | 3300005618 | Ga0068864_100000731 | Ga0068864_10000073126 | 96 |
| 78 | 3300005719 | Ga0068861_100000148 | Ga0068861_10000014815 | 96 |
| 79 | 3300005841 | Ga0068863_100014281 | Ga0068863_1000142819 | 96 |
| 80 | 3300005842 | Ga0068858_100000588 | Ga0068858_10000058812 | 96 |
| 81 | 3300005842 | Ga0068858_100122627 | Ga0068858_1001226272 | 96 |
| 82 | 3300005843 | Ga0068860_100036289 | Ga0068860_1000362896 | 96 |
| 83 | 3300005844 | Ga0068862_100007384 | Ga0068862_10000738411 | 96 |
| 84 | 3300006931 | Ga0097620_100002597 | Ga0097620_1000025972 | 96 |
| 85 | 3300009011 | Ga0105251_10402660 | Ga0105251_104026602 | 96 |
| 86 | 3300009101 | Ga0105247_10001115 | Ga0105247_1000111515 | 96 |
| 87 | 3300009177 | Ga0105248_10019155 | Ga0105248_100191556 | 96 |
| 88 | 3300009553 | Ga0105249_10091346 | Ga0105249_100913462 | 96 |
| 89 | 3300013306 | Ga0163162_10003776 | Ga0163162_100037762 | 96 |
| 90 | 3300013306 | Ga0163162_10037626 | Ga0163162_100376262 | 96 |
| 91 | 3300013307 | Ga0157372_11515622 | Ga0157372_115156222 | 96 |
| 92 | 3300014325 | Ga0163163_10026383 | Ga0163163_100263836 | 96 |
| 93 | 3300014326 | Ga0157380_10079466 | Ga0157380_100794662 | 96 |
| 94 | 3300025315 | Ga0207697_10000130 | Ga0207697_1000013033 | 96 |
| 95 | 3300025735 | Ga0207713_1233720 | Ga0207713_12337202 | 96 |
| 96 | 3300025900 | Ga0207710_10009801 | Ga0207710_100098013 | 96 |
| 97 | 3300025903 | Ga0207680_10000033 | Ga0207680_100000336 | 96 |
| 98 | 3300025909 | Ga0207705_10455676 | Ga0207705_104556761 | 96 |
| 99 | 3300025909 | Ga0207705_10929522 | Ga0207705_109295222 | 96 |
| 100 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002420 | 96 |
| 101 | 3300025925 | Ga0207650_10018754 | Ga0207650_100187542 | 96 |
| 102 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002425 | 96 |
| 103 | 3300025941 | Ga0207711_10087405 | Ga0207711_100874052 | 96 |
| 104 | 3300025961 | Ga0207712_10001860 | Ga0207712_100018603 | 96 |
| 105 | 3300025972 | Ga0207668_10001038 | Ga0207668_100010384 | 96 |
| 106 | 3300025986 | Ga0207658_10017969 | Ga0207658_100179693 | 96 |
| 107 | 3300026035 | Ga0207703_10006058 | Ga0207703_100060589 | 96 |
| 108 | 3300026035 | Ga0207703_10157722 | Ga0207703_101577222 | 96 |
| 109 | 3300026088 | Ga0207641_10019831 | Ga0207641_100198316 | 96 |
| 110 | 3300026095 | Ga0207676_10000705 | Ga0207676_100007053 | 96 |
| 111 | 3300026118 | Ga0207675_100000355 | Ga0207675_10000035527 | 96 |
| 112 | 3300027876 | Ga0209974_10276072 | Ga0209974_102760722 | 96 |
| 113 | 3300028379 | Ga0268266_10054091 | Ga0268266_100540912 | 96 |
| 114 | 3300028380 | Ga0268265_10000361 | Ga0268265_1000036115 | 96 |
| 115 | 3300028381 | Ga0268264_10000116 | Ga0268264_1000011636 | 96 |
| 116 | 3300039437 | Ga0436365_1490641 | Ga0436365_1490641_107_403 | 96 |
| 117 | 3300047472 | Ga0495686_0001453 | Ga0495686_0001453_1197_1487 | 96 |
| 118 | 3300048905 | Ga0496102_0834760 | Ga0496102_0834760_232_528 | 96 |
| 119 | 3300006353 | Ga0075370_10074920 | Ga0075370_100749202 | 97 |
| 120 | 3300025934 | Ga0207686_11066050 | Ga0207686_110660501 | 97 |
| 121 | 3300027876 | Ga0209974_10012498 | Ga0209974_100124983 | 97 |
| 122 | 3300046460 | Ga0495638_0000011 | Ga0495638_0000011_368917_369210 | 97 |
| 123 | 3300046506 | Ga0495583_0000305 | Ga0495583_0000305_20819_21112 | 97 |
| 124 | 3300046519 | Ga0495632_0000538 | Ga0495632_0000538_29253_29546 | 97 |
| 125 | 3300046524 | Ga0495648_0000023 | Ga0495648_0000023_166637_166930 | 97 |
| 126 | 3300046692 | Ga0495671_0000012 | Ga0495671_0000012_66427_66720 | 97 |
| 127 | 3300047469 | Ga0495673_0000029 | Ga0495673_0000029_291913_292206 | 97 |
| 128 | 3300050496 | nmdc:mga07m45_253890_c1 | nmdc:mga07m45_253890_c1_699_998 | 97 |
| 129 | 3300053122 | Ga0500608_298128 | Ga0500608_298128_252_548 | 97 |
| 130 | 3300053136 | Ga0500559_0574737 | Ga0500559_0574737_150_449 | 97 |
| 131 | 3300053138 | Ga0500564_220754 | Ga0500564_220754_441_737 | 97 |
| 132 | 3300053146 | Ga0500588_0055704 | Ga0500588_0055704_750_1049 | 97 |
| 133 | 3300053148 | Ga0500590_097791 | Ga0500590_097791_624_920 | 97 |
| 134 | 3300053154 | Ga0500619_260087 | Ga0500619_260087_101_397 | 97 |
| 135 | 2162886007 | SwRhRL2b_contig_2770192 | SwRhRL2b_0210.00007630 | 98 |
| 136 | 2162886007 | SwRhRL2b_contig_433849 | SwRhRL2b_0511.00003330 | 98 |
| 137 | 3300000043 | ARcpr5yngRDRAFT_c005141 | ARcpr5yngRDRAFT_0051412 | 98 |
| 138 | 3300001904 | JGI24736J21556_1006519 | JGI24736J21556_10065192 | 98 |
| 139 | 3300001915 | JGI24741J21665_1001599 | JGI24741J21665_10015996 | 98 |
| 140 | 3300001915 | JGI24741J21665_1002509 | JGI24741J21665_10025093 | 98 |
| 141 | 3300001979 | JGI24740J21852_10001016 | JGI24740J21852_100010166 | 98 |
| 142 | 3300001989 | JGI24739J22299_10000602 | JGI24739J22299_100006023 | 98 |
| 143 | 3300001989 | JGI24739J22299_10007241 | JGI24739J22299_100072414 | 98 |
| 144 | 3300001989 | JGI24739J22299_10016593 | JGI24739J22299_100165932 | 98 |
| 145 | 3300001990 | JGI24737J22298_10001956 | JGI24737J22298_100019564 | 98 |
| 146 | 3300001990 | JGI24737J22298_10008892 | JGI24737J22298_100088923 | 98 |
| 147 | 3300001990 | JGI24737J22298_10014616 | JGI24737J22298_100146163 | 98 |
| 148 | 3300001990 | JGI24737J22298_10044176 | JGI24737J22298_100441762 | 98 |
| 149 | 3300002067 | JGI24735J21928_10004916 | JGI24735J21928_100049162 | 98 |
| 150 | 3300002075 | JGI24738J21930_10002190 | JGI24738J21930_100021907 | 98 |
| 151 | 3300002075 | JGI24738J21930_10016432 | JGI24738J21930_100164322 | 98 |
| 152 | 3300002459 | JGI24751J29686_10000159 | JGI24751J29686_1000015910 | 98 |
| 153 | 3300002774 | JGI25150J39212_1000213 | JGI25150J39212_100021318 | 98 |
| 154 | 3300003187 | JGI25151J46595_10052017 | JGI25151J46595_100520172 | 98 |
| 155 | 3300003214 | JGI25165J46597_1000012 | JGI25165J46597_1000012209 | 98 |
| 156 | 3300003215 | JGI25153J46596_10000016 | JGI25153J46596_1000001688 | 98 |
| 157 | 3300003215 | JGI25153J46596_10000036 | JGI25153J46596_1000003648 | 98 |
| 158 | 3300003215 | JGI25153J46596_10028563 | JGI25153J46596_100285632 | 98 |
| 159 | 3300003354 | JGI25160J50197_1065978 | JGI25160J50197_10659781 | 98 |
| 160 | 3300003752 | Ga0055539_1039470 | Ga0055539_10394701 | 98 |
| 161 | 3300003759 | Ga0055525_1000035 | Ga0055525_1000035124 | 98 |
| 162 | 3300003762 | Ga0055542_1000060 | Ga0055542_100006017 | 98 |
| 163 | 3300003763 | Ga0055529_1000043 | Ga0055529_1000043147 | 98 |
| 164 | 3300003771 | Ga0055526_1000948 | Ga0055526_100094817 | 98 |
| 165 | 3300003773 | Ga0055537_1001825 | Ga0055537_10018251 | 98 |
| 166 | 3300003775 | Ga0055524_1000180 | Ga0055524_100018061 | 98 |
| 167 | 3300003781 | Ga0055536_1000520 | Ga0055536_10005203 | 98 |
| 168 | 3300003781 | Ga0055536_1006261 | Ga0055536_10062613 | 98 |
| 169 | 3300003781 | Ga0055536_1029291 | Ga0055536_10292912 | 98 |
| 170 | 3300003790 | Ga0055528_1037468 | Ga0055528_10374681 | 98 |
| 171 | 3300003790 | Ga0055528_1046726 | Ga0055528_10467262 | 98 |
| 172 | 3300003791 | Ga0055530_10001171 | Ga0055530_100011716 | 98 |
| 173 | 3300003791 | Ga0055530_10001368 | Ga0055530_100013687 | 98 |
| 174 | 3300003791 | Ga0055530_10007997 | Ga0055530_100079972 | 98 |
| 175 | 3300003791 | Ga0055530_10020941 | Ga0055530_100209413 | 98 |
| 176 | 3300003791 | Ga0055530_10030601 | Ga0055530_100306012 | 98 |
| 177 | 3300003792 | Ga0055540_1001281 | Ga0055540_10012815 | 98 |
| 178 | 3300003792 | Ga0055540_1005532 | Ga0055540_10055326 | 98 |
| 179 | 3300003794 | Ga0055531_10000161 | Ga0055531_1000016119 | 98 |
| 180 | 3300003794 | Ga0055531_10004136 | Ga0055531_100041368 | 98 |
| 181 | 3300003794 | Ga0055531_10008952 | Ga0055531_100089525 | 98 |
| 182 | 3300003794 | Ga0055531_10011225 | Ga0055531_100112252 | 98 |
| 183 | 3300004625 | Ga0055543_1054170 | Ga0055543_10541701 | 98 |
| 184 | 3300005262 | Ga0065165_1001869 | Ga0065165_100186912 | 98 |
| 185 | 3300005262 | Ga0065165_1017219 | Ga0065165_10172193 | 98 |
| 186 | 3300005262 | Ga0065165_1066773 | Ga0065165_10667732 | 98 |
| 187 | 3300005262 | Ga0065165_1097225 | Ga0065165_10972252 | 98 |
| 188 | 3300005262 | Ga0065165_1138182 | Ga0065165_11381821 | 98 |
| 189 | 3300005289 | Ga0065704_10001418 | Ga0065704_100014184 | 98 |
| 190 | 3300005289 | Ga0065704_10072077 | Ga0065704_100720772 | 98 |
| 191 | 3300005289 | Ga0065704_10310336 | Ga0065704_103103362 | 98 |
| 192 | 3300005295 | Ga0065707_10023450 | Ga0065707_100234502 | 98 |
| 193 | 3300005295 | Ga0065707_10082272 | Ga0065707_1008227210 | 98 |
| 194 | 3300005295 | Ga0065707_10100910 | Ga0065707_101009103 | 98 |
| 195 | 3300005295 | Ga0065707_10107929 | Ga0065707_101079293 | 98 |
| 196 | 3300005295 | Ga0065707_10193463 | Ga0065707_101934632 | 98 |
| 197 | 3300005295 | Ga0065707_10312100 | Ga0065707_103121002 | 98 |
| 198 | 3300005327 | Ga0070658_10044373 | Ga0070658_100443734 | 98 |
| 199 | 3300005327 | Ga0070658_10064042 | Ga0070658_100640422 | 98 |
| 200 | 3300005327 | Ga0070658_10472506 | Ga0070658_104725062 | 98 |
| 201 | 3300005327 | Ga0070658_11233995 | Ga0070658_112339952 | 98 |
| 202 | 3300005327 | Ga0070658_11417436 | Ga0070658_114174362 | 98 |
| 203 | 3300005328 | Ga0070676_11331128 | Ga0070676_113311281 | 98 |
| 204 | 3300005329 | Ga0070683_100147795 | Ga0070683_1001477953 | 98 |
| 205 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003140 | 98 |
| 206 | 3300005331 | Ga0070670_100155226 | Ga0070670_1001552262 | 98 |
| 207 | 3300005331 | Ga0070670_100245274 | Ga0070670_1002452742 | 98 |
| 208 | 3300005331 | Ga0070670_100961164 | Ga0070670_1009611642 | 98 |
| 209 | 3300005333 | Ga0070677_10024455 | Ga0070677_100244553 | 98 |
| 210 | 3300005333 | Ga0070677_10559906 | Ga0070677_105599062 | 98 |
| 211 | 3300005335 | Ga0070666_10322469 | Ga0070666_103224692 | 98 |
| 212 | 3300005335 | Ga0070666_11310846 | Ga0070666_113108461 | 98 |
| 213 | 3300005338 | Ga0068868_100962179 | Ga0068868_1009621792 | 98 |
| 214 | 3300005339 | Ga0070660_100269472 | Ga0070660_1002694721 | 98 |
| 215 | 3300005339 | Ga0070660_101297513 | Ga0070660_1012975131 | 98 |
| 216 | 3300005339 | Ga0070660_101775554 | Ga0070660_1017755542 | 98 |
| 217 | 3300005339 | Ga0070660_101775555 | Ga0070660_1017755552 | 98 |
| 218 | 3300005343 | Ga0070687_100234450 | Ga0070687_1002344502 | 98 |
| 219 | 3300005344 | Ga0070661_100112568 | Ga0070661_1001125685 | 98 |
| 220 | 3300005344 | Ga0070661_100316764 | Ga0070661_1003167642 | 98 |
| 221 | 3300005347 | Ga0070668_100027226 | Ga0070668_1000272264 | 98 |
| 222 | 3300005347 | Ga0070668_100056776 | Ga0070668_1000567763 | 98 |
| 223 | 3300005347 | Ga0070668_100928378 | Ga0070668_1009283781 | 98 |
| 224 | 3300005347 | Ga0070668_100936694 | Ga0070668_1009366942 | 98 |
| 225 | 3300005347 | Ga0070668_101482836 | Ga0070668_1014828362 | 98 |
| 226 | 3300005353 | Ga0070669_100000044 | Ga0070669_10000004440 | 98 |
| 227 | 3300005353 | Ga0070669_100127069 | Ga0070669_1001270691 | 98 |
| 228 | 3300005353 | Ga0070669_100167169 | Ga0070669_1001671692 | 98 |
| 229 | 3300005353 | Ga0070669_100252260 | Ga0070669_1002522602 | 98 |
| 230 | 3300005353 | Ga0070669_100256143 | Ga0070669_1002561432 | 98 |
| 231 | 3300005353 | Ga0070669_100301438 | Ga0070669_1003014382 | 98 |
| 232 | 3300005353 | Ga0070669_100663394 | Ga0070669_1006633942 | 98 |
| 233 | 3300005353 | Ga0070669_100689710 | Ga0070669_1006897102 | 98 |
| 234 | 3300005353 | Ga0070669_100761649 | Ga0070669_1007616492 | 98 |
| 235 | 3300005353 | Ga0070669_101996165 | Ga0070669_1019961651 | 98 |
| 236 | 3300005354 | Ga0070675_100572366 | Ga0070675_1005723662 | 98 |
| 237 | 3300005354 | Ga0070675_100862714 | Ga0070675_1008627141 | 98 |
| 238 | 3300005355 | Ga0070671_100043617 | Ga0070671_1000436173 | 98 |
| 239 | 3300005355 | Ga0070671_100060147 | Ga0070671_1000601472 | 98 |
| 240 | 3300005356 | Ga0070674_100000171 | Ga0070674_10000017118 | 98 |
| 241 | 3300005356 | Ga0070674_100159052 | Ga0070674_1001590524 | 98 |
| 242 | 3300005364 | Ga0070673_100203220 | Ga0070673_1002032202 | 98 |
| 243 | 3300005364 | Ga0070673_101271275 | Ga0070673_1012712752 | 98 |
| 244 | 3300005366 | Ga0070659_100025300 | Ga0070659_1000253007 | 98 |
| 245 | 3300005366 | Ga0070659_100081800 | Ga0070659_1000818002 | 98 |
| 246 | 3300005366 | Ga0070659_100695800 | Ga0070659_1006958002 | 98 |
| 247 | 3300005367 | Ga0070667_100004979 | Ga0070667_1000049797 | 98 |
| 248 | 3300005367 | Ga0070667_100243171 | Ga0070667_1002431712 | 98 |
| 249 | 3300005367 | Ga0070667_100547652 | Ga0070667_1005476521 | 98 |
| 250 | 3300005367 | Ga0070667_101629213 | Ga0070667_1016292131 | 98 |
| 251 | 3300005441 | Ga0070700_101157030 | Ga0070700_1011570302 | 98 |
| 252 | 3300005455 | Ga0070663_100001785 | Ga0070663_10000178514 | 98 |
| 253 | 3300005455 | Ga0070663_100347233 | Ga0070663_1003472332 | 98 |
| 254 | 3300005455 | Ga0070663_101253680 | Ga0070663_1012536802 | 98 |
| 255 | 3300005456 | Ga0070678_100000584 | Ga0070678_10000058411 | 98 |
| 256 | 3300005456 | Ga0070678_100478977 | Ga0070678_1004789771 | 98 |
| 257 | 3300005457 | Ga0070662_100009003 | Ga0070662_1000090033 | 98 |
| 258 | 3300005457 | Ga0070662_100277877 | Ga0070662_1002778772 | 98 |
| 259 | 3300005457 | Ga0070662_101947430 | Ga0070662_1019474302 | 98 |
| 260 | 3300005457 | Ga0070662_101971406 | Ga0070662_1019714062 | 98 |
| 261 | 3300005466 | Ga0070685_10924414 | Ga0070685_109244141 | 98 |
| 262 | 3300005466 | Ga0070685_11049281 | Ga0070685_110492812 | 98 |
| 263 | 3300005468 | Ga0070707_100360654 | Ga0070707_1003606542 | 98 |
| 264 | 3300005468 | Ga0070707_100687156 | Ga0070707_1006871562 | 98 |
| 265 | 3300005471 | Ga0070698_100548793 | Ga0070698_1005487932 | 98 |
| 266 | 3300005530 | Ga0070679_100311083 | Ga0070679_1003110832 | 98 |
| 267 | 3300005535 | Ga0070684_100060440 | Ga0070684_1000604402 | 98 |
| 268 | 3300005535 | Ga0070684_100361698 | Ga0070684_1003616982 | 98 |
| 269 | 3300005539 | Ga0068853_100252410 | Ga0068853_1002524101 | 98 |
| 270 | 3300005539 | Ga0068853_100285758 | Ga0068853_1002857582 | 98 |
| 271 | 3300005539 | Ga0068853_100891734 | Ga0068853_1008917342 | 98 |
| 272 | 3300005539 | Ga0068853_102094991 | Ga0068853_1020949911 | 98 |
| 273 | 3300005543 | Ga0070672_100290921 | Ga0070672_1002909212 | 98 |
| 274 | 3300005548 | Ga0070665_100000186 | Ga0070665_10000018652 | 98 |
| 275 | 3300005548 | Ga0070665_100482368 | Ga0070665_1004823682 | 98 |
| 276 | 3300005548 | Ga0070665_101001609 | Ga0070665_1010016091 | 98 |
| 277 | 3300005548 | Ga0070665_101634965 | Ga0070665_1016349651 | 98 |
| 278 | 3300005548 | Ga0070665_101979966 | Ga0070665_1019799662 | 98 |
| 279 | 3300005563 | Ga0068855_100003973 | Ga0068855_1000039736 | 98 |
| 280 | 3300005563 | Ga0068855_100182464 | Ga0068855_1001824644 | 98 |
| 281 | 3300005563 | Ga0068855_100294139 | Ga0068855_1002941393 | 98 |
| 282 | 3300005563 | Ga0068855_100326462 | Ga0068855_1003264622 | 98 |
| 283 | 3300005563 | Ga0068855_101226911 | Ga0068855_1012269111 | 98 |
| 284 | 3300005563 | Ga0068855_101576146 | Ga0068855_1015761461 | 98 |
| 285 | 3300005563 | Ga0068855_102132109 | Ga0068855_1021321091 | 98 |
| 286 | 3300005563 | Ga0068855_102235263 | Ga0068855_1022352632 | 98 |
| 287 | 3300005564 | Ga0070664_100375736 | Ga0070664_1003757361 | 98 |
| 288 | 3300005564 | Ga0070664_100701946 | Ga0070664_1007019462 | 98 |
| 289 | 3300005577 | Ga0068857_100029821 | Ga0068857_1000298216 | 98 |
| 290 | 3300005577 | Ga0068857_100031231 | Ga0068857_1000312312 | 98 |
| 291 | 3300005577 | Ga0068857_100094013 | Ga0068857_1000940132 | 98 |
| 292 | 3300005577 | Ga0068857_100188529 | Ga0068857_1001885292 | 98 |
| 293 | 3300005577 | Ga0068857_100234145 | Ga0068857_1002341452 | 98 |
| 294 | 3300005577 | Ga0068857_100440521 | Ga0068857_1004405212 | 98 |
| 295 | 3300005577 | Ga0068857_100936628 | Ga0068857_1009366282 | 98 |
| 296 | 3300005577 | Ga0068857_101694606 | Ga0068857_1016946062 | 98 |
| 297 | 3300005577 | Ga0068857_101785867 | Ga0068857_1017858671 | 98 |
| 298 | 3300005577 | Ga0068857_102247610 | Ga0068857_1022476101 | 98 |
| 299 | 3300005578 | Ga0068854_100016369 | Ga0068854_1000163695 | 98 |
| 300 | 3300005578 | Ga0068854_100107513 | Ga0068854_1001075132 | 98 |
| 301 | 3300005578 | Ga0068854_102286787 | Ga0068854_1022867872 | 98 |
| 302 | 3300005614 | Ga0068856_100027825 | Ga0068856_1000278253 | 98 |
| 303 | 3300005614 | Ga0068856_100447260 | Ga0068856_1004472602 | 98 |
| 304 | 3300005614 | Ga0068856_101018113 | Ga0068856_1010181132 | 98 |
| 305 | 3300005616 | Ga0068852_100109259 | Ga0068852_1001092593 | 98 |
| 306 | 3300005616 | Ga0068852_100910838 | Ga0068852_1009108381 | 98 |
| 307 | 3300005616 | Ga0068852_101076526 | Ga0068852_1010765262 | 98 |
| 308 | 3300005616 | Ga0068852_101451985 | Ga0068852_1014519852 | 98 |
| 309 | 3300005617 | Ga0068859_100004323 | Ga0068859_1000043239 | 98 |
| 310 | 3300005617 | Ga0068859_100011775 | Ga0068859_1000117752 | 98 |
| 311 | 3300005617 | Ga0068859_100029853 | Ga0068859_1000298536 | 98 |
| 312 | 3300005618 | Ga0068864_100000005 | Ga0068864_1000000054 | 98 |
| 313 | 3300005618 | Ga0068864_100010775 | Ga0068864_1000107752 | 98 |
| 314 | 3300005618 | Ga0068864_100432511 | Ga0068864_1004325112 | 98 |
| 315 | 3300005618 | Ga0068864_100731752 | Ga0068864_1007317522 | 98 |
| 316 | 3300005719 | Ga0068861_100000108 | Ga0068861_10000010843 | 98 |
| 317 | 3300005719 | Ga0068861_100001464 | Ga0068861_10000146411 | 98 |
| 318 | 3300005719 | Ga0068861_101917074 | Ga0068861_1019170742 | 98 |
| 319 | 3300005834 | Ga0068851_10012072 | Ga0068851_100120722 | 98 |
| 320 | 3300005834 | Ga0068851_10328221 | Ga0068851_103282212 | 98 |
| 321 | 3300005834 | Ga0068851_10328223 | Ga0068851_103282232 | 98 |
| 322 | 3300005841 | Ga0068863_100053964 | Ga0068863_1000539642 | 98 |
| 323 | 3300005842 | Ga0068858_100000583 | Ga0068858_10000058337 | 98 |
| 324 | 3300005842 | Ga0068858_100003492 | Ga0068858_1000034922 | 98 |
| 325 | 3300005842 | Ga0068858_100238411 | Ga0068858_1002384112 | 98 |
| 326 | 3300005843 | Ga0068860_100023270 | Ga0068860_1000232707 | 98 |
| 327 | 3300005843 | Ga0068860_100264595 | Ga0068860_1002645952 | 98 |
| 328 | 3300005843 | Ga0068860_100785965 | Ga0068860_1007859652 | 98 |
| 329 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001464 | 98 |
| 330 | 3300005844 | Ga0068862_100000063 | Ga0068862_10000006341 | 98 |
| 331 | 3300005844 | Ga0068862_100010294 | Ga0068862_1000102948 | 98 |
| 332 | 3300005985 | Ga0081539_10076735 | Ga0081539_100767353 | 98 |
| 333 | 3300006038 | Ga0075365_10010903 | Ga0075365_100109034 | 98 |
| 334 | 3300006042 | Ga0075368_10000252 | Ga0075368_100002524 | 98 |
| 335 | 3300006042 | Ga0075368_10008082 | Ga0075368_100080822 | 98 |
| 336 | 3300006048 | Ga0075363_100011199 | Ga0075363_1000111993 | 98 |
| 337 | 3300006048 | Ga0075363_100013169 | Ga0075363_1000131692 | 98 |
| 338 | 3300006051 | Ga0075364_10158281 | Ga0075364_101582812 | 98 |
| 339 | 3300006051 | Ga0075364_10391812 | Ga0075364_103918122 | 98 |
| 340 | 3300006177 | Ga0075362_10031948 | Ga0075362_100319482 | 98 |
| 341 | 3300006177 | Ga0075362_10045995 | Ga0075362_100459952 | 98 |
| 342 | 3300006178 | Ga0075367_10000054 | Ga0075367_1000005419 | 98 |
| 343 | 3300006178 | Ga0075367_10081583 | Ga0075367_100815832 | 98 |
| 344 | 3300006186 | Ga0075369_10041542 | Ga0075369_100415422 | 98 |
| 345 | 3300006186 | Ga0075369_10099471 | Ga0075369_100994712 | 98 |
| 346 | 3300006186 | Ga0075369_10137443 | Ga0075369_101374432 | 98 |
| 347 | 3300006195 | Ga0075366_10022732 | Ga0075366_100227323 | 98 |
| 348 | 3300006195 | Ga0075366_10061991 | Ga0075366_100619913 | 98 |
| 349 | 3300006195 | Ga0075366_10090192 | Ga0075366_100901922 | 98 |
| 350 | 3300006195 | Ga0075366_10132441 | Ga0075366_101324412 | 98 |
| 351 | 3300006195 | Ga0075366_10167482 | Ga0075366_101674822 | 98 |
| 352 | 3300006195 | Ga0075366_10353807 | Ga0075366_103538072 | 98 |
| 353 | 3300006195 | Ga0075366_10501124 | Ga0075366_105011242 | 98 |
| 354 | 3300006195 | Ga0075366_10537137 | Ga0075366_105371372 | 98 |
| 355 | 3300006237 | Ga0097621_100144109 | Ga0097621_1001441092 | 98 |
| 356 | 3300006353 | Ga0075370_10057920 | Ga0075370_100579202 | 98 |
| 357 | 3300006353 | Ga0075370_10075998 | Ga0075370_100759982 | 98 |
| 358 | 3300006353 | Ga0075370_10092517 | Ga0075370_100925172 | 98 |
| 359 | 3300006353 | Ga0075370_10154405 | Ga0075370_101544052 | 98 |
| 360 | 3300006353 | Ga0075370_10665590 | Ga0075370_106655902 | 98 |
| 361 | 3300006358 | Ga0068871_100016843 | Ga0068871_1000168432 | 98 |
| 362 | 3300006358 | Ga0068871_100121930 | Ga0068871_1001219302 | 98 |
| 363 | 3300006358 | Ga0068871_101057055 | Ga0068871_1010570552 | 98 |
| 364 | 3300006881 | Ga0068865_101884820 | Ga0068865_1018848201 | 98 |
| 365 | 3300006931 | Ga0097620_100004323 | Ga0097620_1000043239 | 98 |
| 366 | 3300006931 | Ga0097620_100011775 | Ga0097620_1000117758 | 98 |
| 367 | 3300006931 | Ga0097620_100029854 | Ga0097620_1000298546 | 98 |
| 368 | 3300006946 | Ga0079104_1031866 | Ga0079104_10318662 | 98 |
| 369 | 3300006946 | Ga0079104_1087498 | Ga0079104_10874982 | 98 |
| 370 | 3300009011 | Ga0105251_10033437 | Ga0105251_100334372 | 98 |
| 371 | 3300009093 | Ga0105240_10000959 | Ga0105240_100009597 | 98 |
| 372 | 3300009093 | Ga0105240_10043982 | Ga0105240_100439826 | 98 |
| 373 | 3300009093 | Ga0105240_10229460 | Ga0105240_102294602 | 98 |
| 374 | 3300009093 | Ga0105240_10296092 | Ga0105240_102960922 | 98 |
| 375 | 3300009094 | Ga0111539_10440332 | Ga0111539_104403322 | 98 |
| 376 | 3300009094 | Ga0111539_11333045 | Ga0111539_113330452 | 98 |
| 377 | 3300009098 | Ga0105245_10001709 | Ga0105245_100017096 | 98 |
| 378 | 3300009101 | Ga0105247_10044573 | Ga0105247_100445732 | 98 |
| 379 | 3300009147 | Ga0114129_10128044 | Ga0114129_101280442 | 98 |
| 380 | 3300009148 | Ga0105243_10000122 | Ga0105243_1000012267 | 98 |
| 381 | 3300009148 | Ga0105243_10309260 | Ga0105243_103092601 | 98 |
| 382 | 3300009148 | Ga0105243_11425044 | Ga0105243_114250442 | 98 |
| 383 | 3300009174 | Ga0105241_10002257 | Ga0105241_1000225713 | 98 |
| 384 | 3300009174 | Ga0105241_10002409 | Ga0105241_100024099 | 98 |
| 385 | 3300009174 | Ga0105241_10466667 | Ga0105241_104666672 | 98 |
| 386 | 3300009174 | Ga0105241_10948388 | Ga0105241_109483882 | 98 |
| 387 | 3300009177 | Ga0105248_10000287 | Ga0105248_1000028725 | 98 |
| 388 | 3300009177 | Ga0105248_10007934 | Ga0105248_100079346 | 98 |
| 389 | 3300009177 | Ga0105248_10016133 | Ga0105248_100161336 | 98 |
| 390 | 3300009177 | Ga0105248_10025995 | Ga0105248_100259957 | 98 |
| 391 | 3300009177 | Ga0105248_10044942 | Ga0105248_100449423 | 98 |
| 392 | 3300009177 | Ga0105248_10180454 | Ga0105248_101804543 | 98 |
| 393 | 3300009545 | Ga0105237_10001281 | Ga0105237_1000128130 | 98 |
| 394 | 3300009545 | Ga0105237_10007067 | Ga0105237_1000706710 | 98 |
| 395 | 3300009545 | Ga0105237_10016910 | Ga0105237_100169104 | 98 |
| 396 | 3300009545 | Ga0105237_12136474 | Ga0105237_121364742 | 98 |
| 397 | 3300009551 | Ga0105238_10172228 | Ga0105238_101722282 | 98 |
| 398 | 3300009551 | Ga0105238_10193883 | Ga0105238_101938832 | 98 |
| 399 | 3300009551 | Ga0105238_10317298 | Ga0105238_103172981 | 98 |
| 400 | 3300009551 | Ga0105238_11229716 | Ga0105238_112297161 | 98 |
| 401 | 3300009551 | Ga0105238_12735462 | Ga0105238_127354621 | 98 |
| 402 | 3300009553 | Ga0105249_10008807 | Ga0105249_100088078 | 98 |
| 403 | 3300009553 | Ga0105249_10458298 | Ga0105249_104582981 | 98 |
| 404 | 3300009553 | Ga0105249_10485665 | Ga0105249_104856653 | 98 |
| 405 | 3300009553 | Ga0105249_11436545 | Ga0105249_114365452 | 98 |
| 406 | 3300009978 | Ga0105148_100027 | Ga0105148_10002719 | 98 |
| 407 | 3300010375 | Ga0105239_10000156 | Ga0105239_1000015649 | 98 |
| 408 | 3300010375 | Ga0105239_10007208 | Ga0105239_100072087 | 98 |
| 409 | 3300010375 | Ga0105239_10232710 | Ga0105239_102327102 | 98 |
| 410 | 3300010375 | Ga0105239_11127209 | Ga0105239_111272092 | 98 |
| 411 | 3300010375 | Ga0105239_11149125 | Ga0105239_111491252 | 98 |
| 412 | 3300010375 | Ga0105239_11265648 | Ga0105239_112656482 | 98 |
| 413 | 3300010375 | Ga0105239_11314522 | Ga0105239_113145222 | 98 |
| 414 | 3300011119 | Ga0105246_10000632 | Ga0105246_1000063218 | 98 |
| 415 | 3300011119 | Ga0105246_10479629 | Ga0105246_104796292 | 98 |
| 416 | 3300013100 | Ga0157373_10024990 | Ga0157373_100249905 | 98 |
| 417 | 3300013100 | Ga0157373_10047725 | Ga0157373_100477254 | 98 |
| 418 | 3300013100 | Ga0157373_10341584 | Ga0157373_103415842 | 98 |
| 419 | 3300013100 | Ga0157373_10464031 | Ga0157373_104640312 | 98 |
| 420 | 3300013100 | Ga0157373_10732326 | Ga0157373_107323262 | 98 |
| 421 | 3300013102 | Ga0157371_10000030 | Ga0157371_1000003017 | 98 |
| 422 | 3300013102 | Ga0157371_10061175 | Ga0157371_100611753 | 98 |
| 423 | 3300013102 | Ga0157371_10128777 | Ga0157371_101287772 | 98 |
| 424 | 3300013102 | Ga0157371_10532220 | Ga0157371_105322202 | 98 |
| 425 | 3300013104 | Ga0157370_10008634 | Ga0157370_100086349 | 98 |
| 426 | 3300013104 | Ga0157370_10302970 | Ga0157370_103029702 | 98 |
| 427 | 3300013104 | Ga0157370_10440254 | Ga0157370_104402542 | 98 |
| 428 | 3300013104 | Ga0157370_11346144 | Ga0157370_113461442 | 98 |
| 429 | 3300013104 | Ga0157370_11783019 | Ga0157370_117830192 | 98 |
| 430 | 3300013105 | Ga0157369_10241631 | Ga0157369_102416312 | 98 |
| 431 | 3300013105 | Ga0157369_10321648 | Ga0157369_103216482 | 98 |
| 432 | 3300013105 | Ga0157369_10800289 | Ga0157369_108002892 | 98 |
| 433 | 3300013105 | Ga0157369_10990585 | Ga0157369_109905852 | 98 |
| 434 | 3300013296 | Ga0157374_10110705 | Ga0157374_101107052 | 98 |
| 435 | 3300013296 | Ga0157374_11535133 | Ga0157374_115351332 | 98 |
| 436 | 3300013297 | Ga0157378_10018055 | Ga0157378_100180556 | 98 |
| 437 | 3300013297 | Ga0157378_10021666 | Ga0157378_100216664 | 98 |
| 438 | 3300013297 | Ga0157378_10590595 | Ga0157378_105905952 | 98 |
| 439 | 3300013297 | Ga0157378_10755571 | Ga0157378_107555712 | 98 |
| 440 | 3300013297 | Ga0157378_12278574 | Ga0157378_122785742 | 98 |
| 441 | 3300013306 | Ga0163162_10018196 | Ga0163162_100181966 | 98 |
| 442 | 3300013306 | Ga0163162_10283936 | Ga0163162_102839362 | 98 |
| 443 | 3300013306 | Ga0163162_10437876 | Ga0163162_104378762 | 98 |
| 444 | 3300013306 | Ga0163162_10700924 | Ga0163162_107009242 | 98 |
| 445 | 3300013306 | Ga0163162_10829236 | Ga0163162_108292362 | 98 |
| 446 | 3300013306 | Ga0163162_11273318 | Ga0163162_112733182 | 98 |
| 447 | 3300013307 | Ga0157372_10532860 | Ga0157372_105328602 | 98 |
| 448 | 3300013307 | Ga0157372_10588635 | Ga0157372_105886352 | 98 |
| 449 | 3300013307 | Ga0157372_11851521 | Ga0157372_118515211 | 98 |
| 450 | 3300013308 | Ga0157375_10149491 | Ga0157375_101494912 | 98 |
| 451 | 3300013308 | Ga0157375_10745285 | Ga0157375_107452852 | 98 |
| 452 | 3300013308 | Ga0157375_10815281 | Ga0157375_108152812 | 98 |
| 453 | 3300013308 | Ga0157375_11299390 | Ga0157375_112993902 | 98 |
| 454 | 3300013308 | Ga0157375_13309586 | Ga0157375_133095862 | 98 |
| 455 | 3300014325 | Ga0163163_10015793 | Ga0163163_1001579310 | 98 |
| 456 | 3300014325 | Ga0163163_10340374 | Ga0163163_103403742 | 98 |
| 457 | 3300014325 | Ga0163163_11174288 | Ga0163163_111742881 | 98 |
| 458 | 3300014326 | Ga0157380_10000673 | Ga0157380_100006735 | 98 |
| 459 | 3300014326 | Ga0157380_10000755 | Ga0157380_1000075516 | 98 |
| 460 | 3300014326 | Ga0157380_10077149 | Ga0157380_100771492 | 98 |
| 461 | 3300014326 | Ga0157380_10335578 | Ga0157380_103355782 | 98 |
| 462 | 3300014326 | Ga0157380_10351677 | Ga0157380_103516772 | 98 |
| 463 | 3300014326 | Ga0157380_11368554 | Ga0157380_113685542 | 98 |
| 464 | 3300014745 | Ga0157377_11451075 | Ga0157377_114510751 | 98 |
| 465 | 3300014968 | Ga0157379_10093716 | Ga0157379_100937162 | 98 |
| 466 | 3300014968 | Ga0157379_11099376 | Ga0157379_110993762 | 98 |
| 467 | 3300014969 | Ga0157376_10239100 | Ga0157376_102391003 | 98 |
| 468 | 3300015690 | Ga0183363_1005 | Ga0183363_1005200 | 98 |
| 469 | 3300017792 | Ga0163161_10033177 | Ga0163161_100331775 | 98 |
| 470 | 3300017792 | Ga0163161_10034292 | Ga0163161_100342924 | 98 |
| 471 | 3300017792 | Ga0163161_10222252 | Ga0163161_102222522 | 98 |
| 472 | 3300017792 | Ga0163161_10421299 | Ga0163161_104212992 | 98 |
| 473 | 3300017792 | Ga0163161_11343277 | Ga0163161_113432772 | 98 |
| 474 | 3300017792 | Ga0163161_11518759 | Ga0163161_115187592 | 98 |
| 475 | 3300017792 | Ga0163161_11979300 | Ga0163161_119793002 | 98 |
| 476 | 3300020069 | Ga0197907_11373989 | Ga0197907_113739892 | 98 |
| 477 | 3300020070 | Ga0206356_10423289 | Ga0206356_104232891 | 98 |
| 478 | 3300020077 | Ga0206351_10390730 | Ga0206351_103907301 | 98 |
| 479 | 3300020082 | Ga0206353_10505260 | Ga0206353_105052602 | 98 |
| 480 | 3300020082 | Ga0206353_10958977 | Ga0206353_109589772 | 98 |
| 481 | 3300021377 | Ga0213874_10433940 | Ga0213874_104339402 | 98 |
| 482 | 3300021384 | Ga0213876_10314389 | Ga0213876_103143892 | 98 |
| 483 | 3300022467 | Ga0224712_10056485 | Ga0224712_100564852 | 98 |
| 484 | 3300025226 | Ga0209674_104916 | Ga0209674_1049162 | 98 |
| 485 | 3300025229 | Ga0209147_100491 | Ga0209147_1004916 | 98 |
| 486 | 3300025230 | Ga0209563_100047 | Ga0209563_100047229 | 98 |
| 487 | 3300025245 | Ga0207425_1000037 | Ga0207425_1000037106 | 98 |
| 488 | 3300025246 | Ga0209646_1004404 | Ga0209646_10044043 | 98 |
| 489 | 3300025250 | Ga0209026_1005891 | Ga0209026_10058913 | 98 |
| 490 | 3300025250 | Ga0209026_1041594 | Ga0209026_10415941 | 98 |
| 491 | 3300025253 | Ga0209677_104802 | Ga0209677_1048024 | 98 |
| 492 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017171 | 98 |
| 493 | 3300025258 | Ga0209129_1000363 | Ga0209129_100036320 | 98 |
| 494 | 3300025261 | Ga0209233_1000058 | Ga0209233_1000058208 | 98 |
| 495 | 3300025263 | Ga0209565_1000012 | Ga0209565_1000012187 | 98 |
| 496 | 3300025263 | Ga0209565_1000427 | Ga0209565_100042722 | 98 |
| 497 | 3300025263 | Ga0209565_1067009 | Ga0209565_10670092 | 98 |
| 498 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005171 | 98 |
| 499 | 3300025273 | Ga0209673_1029026 | Ga0209673_10290262 | 98 |
| 500 | 3300025273 | Ga0209673_1045116 | Ga0209673_10451162 | 98 |
| 501 | 3300025291 | Ga0209675_1000097 | Ga0209675_1000097110 | 98 |
| 502 | 3300025291 | Ga0209675_1023972 | Ga0209675_10239722 | 98 |
| 503 | 3300025292 | Ga0209676_1000060 | Ga0209676_100006075 | 98 |
| 504 | 3300025292 | Ga0209676_1000175 | Ga0209676_100017544 | 98 |
| 505 | 3300025292 | Ga0209676_1000298 | Ga0209676_100029856 | 98 |
| 506 | 3300025292 | Ga0209676_1002287 | Ga0209676_10022877 | 98 |
| 507 | 3300025292 | Ga0209676_1021394 | Ga0209676_10213943 | 98 |
| 508 | 3300025294 | Ga0209025_1000117 | Ga0209025_100011766 | 98 |
| 509 | 3300025294 | Ga0209025_1028779 | Ga0209025_10287792 | 98 |
| 510 | 3300025295 | Ga0209564_1003622 | Ga0209564_10036226 | 98 |
| 511 | 3300025295 | Ga0209564_1005290 | Ga0209564_10052902 | 98 |
| 512 | 3300025297 | Ga0209758_1000035 | Ga0209758_1000035159 | 98 |
| 513 | 3300025297 | Ga0209758_1000103 | Ga0209758_1000103106 | 98 |
| 514 | 3300025297 | Ga0209758_1041032 | Ga0209758_10410322 | 98 |
| 515 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000013341 | 98 |
| 516 | 3300025298 | Ga0209050_1000014 | Ga0209050_1000014492 | 98 |
| 517 | 3300025298 | Ga0209050_1001389 | Ga0209050_10013897 | 98 |
| 518 | 3300025298 | Ga0209050_1002628 | Ga0209050_10026284 | 98 |
| 519 | 3300025298 | Ga0209050_1004951 | Ga0209050_10049513 | 98 |
| 520 | 3300025298 | Ga0209050_1006341 | Ga0209050_10063412 | 98 |
| 521 | 3300025298 | Ga0209050_1014852 | Ga0209050_10148523 | 98 |
| 522 | 3300025298 | Ga0209050_1014985 | Ga0209050_10149851 | 98 |
| 523 | 3300025299 | Ga0209256_1000012 | Ga0209256_1000012378 | 98 |
| 524 | 3300025302 | Ga0207426_1048373 | Ga0207426_10483732 | 98 |
| 525 | 3300025303 | Ga0209051_1003509 | Ga0209051_10035097 | 98 |
| 526 | 3300025304 | Ga0209257_1000019 | Ga0209257_1000019200 | 98 |
| 527 | 3300025304 | Ga0209257_1000174 | Ga0209257_1000174120 | 98 |
| 528 | 3300025304 | Ga0209257_1005036 | Ga0209257_10050366 | 98 |
| 529 | 3300025304 | Ga0209257_1005111 | Ga0209257_10051115 | 98 |
| 530 | 3300025304 | Ga0209257_1011340 | Ga0209257_10113405 | 98 |
| 531 | 3300025304 | Ga0209257_1015537 | Ga0209257_10155373 | 98 |
| 532 | 3300025304 | Ga0209257_1027653 | Ga0209257_10276532 | 98 |
| 533 | 3300025304 | Ga0209257_1077966 | Ga0209257_10779662 | 98 |
| 534 | 3300025315 | Ga0207697_10116410 | Ga0207697_101164102 | 98 |
| 535 | 3300025321 | Ga0207656_10018806 | Ga0207656_100188062 | 98 |
| 536 | 3300025321 | Ga0207656_10228920 | Ga0207656_102289201 | 98 |
| 537 | 3300025893 | Ga0207682_10154897 | Ga0207682_101548972 | 98 |
| 538 | 3300025893 | Ga0207682_10184515 | Ga0207682_101845152 | 98 |
| 539 | 3300025900 | Ga0207710_10034124 | Ga0207710_100341242 | 98 |
| 540 | 3300025901 | Ga0207688_10018544 | Ga0207688_100185442 | 98 |
| 541 | 3300025901 | Ga0207688_10297330 | Ga0207688_102973302 | 98 |
| 542 | 3300025903 | Ga0207680_10159744 | Ga0207680_101597443 | 98 |
| 543 | 3300025903 | Ga0207680_10258292 | Ga0207680_102582922 | 98 |
| 544 | 3300025904 | Ga0207647_10008063 | Ga0207647_100080632 | 98 |
| 545 | 3300025904 | Ga0207647_10034522 | Ga0207647_100345224 | 98 |
| 546 | 3300025909 | Ga0207705_10000163 | Ga0207705_1000016349 | 98 |
| 547 | 3300025909 | Ga0207705_10052748 | Ga0207705_100527483 | 98 |
| 548 | 3300025909 | Ga0207705_10206861 | Ga0207705_102068612 | 98 |
| 549 | 3300025911 | Ga0207654_10000852 | Ga0207654_1000085212 | 98 |
| 550 | 3300025911 | Ga0207654_10340074 | Ga0207654_103400742 | 98 |
| 551 | 3300025913 | Ga0207695_10000521 | Ga0207695_1000052131 | 98 |
| 552 | 3300025913 | Ga0207695_10015077 | Ga0207695_100150772 | 98 |
| 553 | 3300025913 | Ga0207695_10294189 | Ga0207695_102941892 | 98 |
| 554 | 3300025913 | Ga0207695_10737600 | Ga0207695_107376002 | 98 |
| 555 | 3300025914 | Ga0207671_10000607 | Ga0207671_1000060723 | 98 |
| 556 | 3300025914 | Ga0207671_10003706 | Ga0207671_100037064 | 98 |
| 557 | 3300025914 | Ga0207671_10046407 | Ga0207671_100464074 | 98 |
| 558 | 3300025914 | Ga0207671_10116984 | Ga0207671_101169842 | 98 |
| 559 | 3300025918 | Ga0207662_10296928 | Ga0207662_102969282 | 98 |
| 560 | 3300025919 | Ga0207657_10023497 | Ga0207657_100234975 | 98 |
| 561 | 3300025919 | Ga0207657_10124830 | Ga0207657_101248302 | 98 |
| 562 | 3300025919 | Ga0207657_10280892 | Ga0207657_102808922 | 98 |
| 563 | 3300025920 | Ga0207649_10000199 | Ga0207649_1000019932 | 98 |
| 564 | 3300025920 | Ga0207649_10676515 | Ga0207649_106765152 | 98 |
| 565 | 3300025921 | Ga0207652_10296559 | Ga0207652_102965592 | 98 |
| 566 | 3300025922 | Ga0207646_10380072 | Ga0207646_103800722 | 98 |
| 567 | 3300025922 | Ga0207646_10415378 | Ga0207646_104153782 | 98 |
| 568 | 3300025923 | Ga0207681_10000041 | Ga0207681_1000004191 | 98 |
| 569 | 3300025923 | Ga0207681_10045969 | Ga0207681_100459692 | 98 |
| 570 | 3300025923 | Ga0207681_10142103 | Ga0207681_101421032 | 98 |
| 571 | 3300025923 | Ga0207681_10177893 | Ga0207681_101778933 | 98 |
| 572 | 3300025923 | Ga0207681_10342918 | Ga0207681_103429182 | 98 |
| 573 | 3300025923 | Ga0207681_10491650 | Ga0207681_104916502 | 98 |
| 574 | 3300025923 | Ga0207681_10590246 | Ga0207681_105902462 | 98 |
| 575 | 3300025923 | Ga0207681_11172944 | Ga0207681_111729442 | 98 |
| 576 | 3300025923 | Ga0207681_11853343 | Ga0207681_118533432 | 98 |
| 577 | 3300025924 | Ga0207694_10049988 | Ga0207694_100499882 | 98 |
| 578 | 3300025924 | Ga0207694_10078972 | Ga0207694_100789723 | 98 |
| 579 | 3300025924 | Ga0207694_10115061 | Ga0207694_101150613 | 98 |
| 580 | 3300025924 | Ga0207694_10161421 | Ga0207694_101614212 | 98 |
| 581 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004137 | 98 |
| 582 | 3300025925 | Ga0207650_10199865 | Ga0207650_101998652 | 98 |
| 583 | 3300025925 | Ga0207650_10230377 | Ga0207650_102303772 | 98 |
| 584 | 3300025926 | Ga0207659_10121130 | Ga0207659_101211302 | 98 |
| 585 | 3300025926 | Ga0207659_10678981 | Ga0207659_106789812 | 98 |
| 586 | 3300025926 | Ga0207659_11038005 | Ga0207659_110380052 | 98 |
| 587 | 3300025927 | Ga0207687_10009517 | Ga0207687_100095177 | 98 |
| 588 | 3300025931 | Ga0207644_10026502 | Ga0207644_100265024 | 98 |
| 589 | 3300025932 | Ga0207690_10003817 | Ga0207690_100038178 | 98 |
| 590 | 3300025932 | Ga0207690_10045855 | Ga0207690_100458554 | 98 |
| 591 | 3300025932 | Ga0207690_10838160 | Ga0207690_108381602 | 98 |
| 592 | 3300025933 | Ga0207706_10007087 | Ga0207706_100070873 | 98 |
| 593 | 3300025933 | Ga0207706_10017165 | Ga0207706_100171653 | 98 |
| 594 | 3300025933 | Ga0207706_10062160 | Ga0207706_100621602 | 98 |
| 595 | 3300025933 | Ga0207706_10529829 | Ga0207706_105298292 | 98 |
| 596 | 3300025933 | Ga0207706_10622765 | Ga0207706_106227652 | 98 |
| 597 | 3300025933 | Ga0207706_11109105 | Ga0207706_111091052 | 98 |
| 598 | 3300025935 | Ga0207709_10000083 | Ga0207709_1000008366 | 98 |
| 599 | 3300025935 | Ga0207709_10144276 | Ga0207709_101442761 | 98 |
| 600 | 3300025935 | Ga0207709_10187733 | Ga0207709_101877332 | 98 |
| 601 | 3300025937 | Ga0207669_10000071 | Ga0207669_1000007136 | 98 |
| 602 | 3300025937 | Ga0207669_10004349 | Ga0207669_100043495 | 98 |
| 603 | 3300025937 | Ga0207669_10647147 | Ga0207669_106471472 | 98 |
| 604 | 3300025938 | Ga0207704_11659004 | Ga0207704_116590042 | 98 |
| 605 | 3300025940 | Ga0207691_10217130 | Ga0207691_102171302 | 98 |
| 606 | 3300025941 | Ga0207711_10000480 | Ga0207711_1000048042 | 98 |
| 607 | 3300025941 | Ga0207711_10017203 | Ga0207711_100172034 | 98 |
| 608 | 3300025941 | Ga0207711_10074305 | Ga0207711_100743052 | 98 |
| 609 | 3300025941 | Ga0207711_10850183 | Ga0207711_108501832 | 98 |
| 610 | 3300025942 | Ga0207689_10571751 | Ga0207689_105717512 | 98 |
| 611 | 3300025944 | Ga0207661_10346723 | Ga0207661_103467232 | 98 |
| 612 | 3300025945 | Ga0207679_10114674 | Ga0207679_101146742 | 98 |
| 613 | 3300025945 | Ga0207679_10741231 | Ga0207679_107412312 | 98 |
| 614 | 3300025945 | Ga0207679_11315222 | Ga0207679_113152222 | 98 |
| 615 | 3300025949 | Ga0207667_10000004 | Ga0207667_10000004162 | 98 |
| 616 | 3300025949 | Ga0207667_10001602 | Ga0207667_1000160223 | 98 |
| 617 | 3300025949 | Ga0207667_10204288 | Ga0207667_102042882 | 98 |
| 618 | 3300025949 | Ga0207667_10451985 | Ga0207667_104519852 | 98 |
| 619 | 3300025949 | Ga0207667_10665358 | Ga0207667_106653582 | 98 |
| 620 | 3300025949 | Ga0207667_11415234 | Ga0207667_114152342 | 98 |
| 621 | 3300025960 | Ga0207651_10210381 | Ga0207651_102103812 | 98 |
| 622 | 3300025960 | Ga0207651_10370198 | Ga0207651_103701982 | 98 |
| 623 | 3300025960 | Ga0207651_10837605 | Ga0207651_108376052 | 98 |
| 624 | 3300025961 | Ga0207712_10000069 | Ga0207712_10000069129 | 98 |
| 625 | 3300025961 | Ga0207712_10290754 | Ga0207712_102907542 | 98 |
| 626 | 3300025961 | Ga0207712_11093568 | Ga0207712_110935682 | 98 |
| 627 | 3300025972 | Ga0207668_10018151 | Ga0207668_100181512 | 98 |
| 628 | 3300025972 | Ga0207668_10041472 | Ga0207668_100414722 | 98 |
| 629 | 3300025972 | Ga0207668_10101044 | Ga0207668_101010442 | 98 |
| 630 | 3300025972 | Ga0207668_10369505 | Ga0207668_103695052 | 98 |
| 631 | 3300025972 | Ga0207668_10753815 | Ga0207668_107538152 | 98 |
| 632 | 3300025972 | Ga0207668_11094158 | Ga0207668_110941582 | 98 |
| 633 | 3300025972 | Ga0207668_11132687 | Ga0207668_111326872 | 98 |
| 634 | 3300025981 | Ga0207640_10007619 | Ga0207640_100076197 | 98 |
| 635 | 3300025981 | Ga0207640_10011830 | Ga0207640_100118305 | 98 |
| 636 | 3300025981 | Ga0207640_10021447 | Ga0207640_100214474 | 98 |
| 637 | 3300025981 | Ga0207640_10028310 | Ga0207640_100283102 | 98 |
| 638 | 3300025981 | Ga0207640_10057450 | Ga0207640_100574503 | 98 |
| 639 | 3300025981 | Ga0207640_10688311 | Ga0207640_106883112 | 98 |
| 640 | 3300025986 | Ga0207658_10009452 | Ga0207658_100094526 | 98 |
| 641 | 3300025986 | Ga0207658_10183878 | Ga0207658_101838782 | 98 |
| 642 | 3300025986 | Ga0207658_10871864 | Ga0207658_108718642 | 98 |
| 643 | 3300025986 | Ga0207658_11092955 | Ga0207658_110929551 | 98 |
| 644 | 3300025986 | Ga0207658_11310604 | Ga0207658_113106042 | 98 |
| 645 | 3300026023 | Ga0207677_11937663 | Ga0207677_119376632 | 98 |
| 646 | 3300026035 | Ga0207703_10000715 | Ga0207703_1000071533 | 98 |
| 647 | 3300026035 | Ga0207703_10001509 | Ga0207703_100015092 | 98 |
| 648 | 3300026035 | Ga0207703_10135086 | Ga0207703_101350863 | 98 |
| 649 | 3300026041 | Ga0207639_10000138 | Ga0207639_1000013822 | 98 |
| 650 | 3300026041 | Ga0207639_10000414 | Ga0207639_100004142 | 98 |
| 651 | 3300026041 | Ga0207639_10000510 | Ga0207639_1000051025 | 98 |
| 652 | 3300026041 | Ga0207639_10000631 | Ga0207639_100006312 | 98 |
| 653 | 3300026041 | Ga0207639_10011189 | Ga0207639_100111895 | 98 |
| 654 | 3300026041 | Ga0207639_10164033 | Ga0207639_101640332 | 98 |
| 655 | 3300026041 | Ga0207639_10227672 | Ga0207639_102276721 | 98 |
| 656 | 3300026067 | Ga0207678_10002459 | Ga0207678_1000245912 | 98 |
| 657 | 3300026067 | Ga0207678_10003700 | Ga0207678_100037005 | 98 |
| 658 | 3300026078 | Ga0207702_10003043 | Ga0207702_100030432 | 98 |
| 659 | 3300026078 | Ga0207702_10531268 | Ga0207702_105312682 | 98 |
| 660 | 3300026088 | Ga0207641_10041729 | Ga0207641_100417292 | 98 |
| 661 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006573 | 98 |
| 662 | 3300026095 | Ga0207676_10000691 | Ga0207676_1000069122 | 98 |
| 663 | 3300026095 | Ga0207676_12156681 | Ga0207676_121566812 | 98 |
| 664 | 3300026116 | Ga0207674_10006416 | Ga0207674_1000641617 | 98 |
| 665 | 3300026116 | Ga0207674_10010631 | Ga0207674_1001063110 | 98 |
| 666 | 3300026116 | Ga0207674_10036911 | Ga0207674_100369116 | 98 |
| 667 | 3300026116 | Ga0207674_10041762 | Ga0207674_100417623 | 98 |
| 668 | 3300026116 | Ga0207674_10297659 | Ga0207674_102976593 | 98 |
| 669 | 3300026116 | Ga0207674_10393357 | Ga0207674_103933571 | 98 |
| 670 | 3300026116 | Ga0207674_10514476 | Ga0207674_105144762 | 98 |
| 671 | 3300026116 | Ga0207674_12237726 | Ga0207674_122377261 | 98 |
| 672 | 3300026118 | Ga0207675_100000309 | Ga0207675_10000030937 | 98 |
| 673 | 3300026118 | Ga0207675_100000400 | Ga0207675_10000040040 | 98 |
| 674 | 3300026118 | Ga0207675_102505765 | Ga0207675_1025057652 | 98 |
| 675 | 3300026121 | Ga0207683_10001740 | Ga0207683_100017407 | 98 |
| 676 | 3300026121 | Ga0207683_10411708 | Ga0207683_104117082 | 98 |
| 677 | 3300026142 | Ga0207698_10001107 | Ga0207698_100011072 | 98 |
| 678 | 3300026142 | Ga0207698_10089829 | Ga0207698_100898292 | 98 |
| 679 | 3300026142 | Ga0207698_10491433 | Ga0207698_104914332 | 98 |
| 680 | 3300026142 | Ga0207698_10540719 | Ga0207698_105407192 | 98 |
| 681 | 3300026142 | Ga0207698_11077887 | Ga0207698_110778872 | 98 |
| 682 | 3300026142 | Ga0207698_11787572 | Ga0207698_117875722 | 98 |
| 683 | 3300027665 | Ga0209983_1024418 | Ga0209983_10244182 | 98 |
| 684 | 3300027866 | Ga0209813_10000063 | Ga0209813_1000006336 | 98 |
| 685 | 3300027866 | Ga0209813_10002858 | Ga0209813_100028584 | 98 |
| 686 | 3300027876 | Ga0209974_10001093 | Ga0209974_100010936 | 98 |
| 687 | 3300027907 | Ga0207428_11112655 | Ga0207428_111126551 | 98 |
| 688 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021809 | 98 |
| 689 | 3300028379 | Ga0268266_10456578 | Ga0268266_104565782 | 98 |
| 690 | 3300028379 | Ga0268266_10895661 | Ga0268266_108956612 | 98 |
| 691 | 3300028379 | Ga0268266_11037509 | Ga0268266_110375092 | 98 |
| 692 | 3300028379 | Ga0268266_11142570 | Ga0268266_111425701 | 98 |
| 693 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001572 | 98 |
| 694 | 3300028380 | Ga0268265_10000055 | Ga0268265_10000055119 | 98 |
| 695 | 3300028380 | Ga0268265_10213788 | Ga0268265_102137882 | 98 |
| 696 | 3300028381 | Ga0268264_10000381 | Ga0268264_1000038164 | 98 |
| 697 | 3300028786 | Ga0307517_10065328 | Ga0307517_100653285 | 98 |
| 698 | 3300028786 | Ga0307517_10361308 | Ga0307517_103613082 | 98 |
| 699 | 3300028794 | Ga0307515_10264001 | Ga0307515_102640011 | 98 |
| 700 | 3300031456 | Ga0307513_10010089 | Ga0307513_100100893 | 98 |
| 701 | 3300031456 | Ga0307513_10015055 | Ga0307513_100150552 | 98 |
| 702 | 3300031548 | Ga0307408_100044971 | Ga0307408_1000449714 | 98 |
| 703 | 3300031548 | Ga0307408_100070707 | Ga0307408_1000707073 | 98 |
| 704 | 3300031548 | Ga0307408_100084371 | Ga0307408_1000843713 | 98 |
| 705 | 3300031548 | Ga0307408_100204844 | Ga0307408_1002048442 | 98 |
| 706 | 3300031548 | Ga0307408_100250903 | Ga0307408_1002509032 | 98 |
| 707 | 3300031548 | Ga0307408_100404388 | Ga0307408_1004043881 | 98 |
| 708 | 3300031548 | Ga0307408_100431046 | Ga0307408_1004310462 | 98 |
| 709 | 3300031548 | Ga0307408_100980300 | Ga0307408_1009803002 | 98 |
| 710 | 3300031548 | Ga0307408_101049808 | Ga0307408_1010498082 | 98 |
| 711 | 3300031548 | Ga0307408_102039583 | Ga0307408_1020395831 | 98 |
| 712 | 3300031616 | Ga0307508_10005365 | Ga0307508_100053659 | 98 |
| 713 | 3300031731 | Ga0307405_10004910 | Ga0307405_100049106 | 98 |
| 714 | 3300031731 | Ga0307405_10009565 | Ga0307405_100095654 | 98 |
| 715 | 3300031731 | Ga0307405_10082731 | Ga0307405_100827312 | 98 |
| 716 | 3300031731 | Ga0307405_10370699 | Ga0307405_103706992 | 98 |
| 717 | 3300031731 | Ga0307405_10762230 | Ga0307405_107622302 | 98 |
| 718 | 3300031731 | Ga0307405_11050431 | Ga0307405_110504312 | 98 |
| 719 | 3300031731 | Ga0307405_11133832 | Ga0307405_111338322 | 98 |
| 720 | 3300031733 | Ga0316577_10092435 | Ga0316577_100924352 | 98 |
| 721 | 3300031824 | Ga0307413_10044933 | Ga0307413_100449332 | 98 |
| 722 | 3300031824 | Ga0307413_10073468 | Ga0307413_100734683 | 98 |
| 723 | 3300031824 | Ga0307413_10084823 | Ga0307413_100848233 | 98 |
| 724 | 3300031824 | Ga0307413_10103732 | Ga0307413_101037322 | 98 |
| 725 | 3300031824 | Ga0307413_10146455 | Ga0307413_101464552 | 98 |
| 726 | 3300031824 | Ga0307413_10169563 | Ga0307413_101695632 | 98 |
| 727 | 3300031824 | Ga0307413_10393412 | Ga0307413_103934122 | 98 |
| 728 | 3300031824 | Ga0307413_10605513 | Ga0307413_106055132 | 98 |
| 729 | 3300031824 | Ga0307413_10697101 | Ga0307413_106971012 | 98 |
| 730 | 3300031824 | Ga0307413_10844256 | Ga0307413_108442562 | 98 |
| 731 | 3300031824 | Ga0307413_10963448 | Ga0307413_109634482 | 98 |
| 732 | 3300031824 | Ga0307413_11554865 | Ga0307413_115548652 | 98 |
| 733 | 3300031824 | Ga0307413_12103167 | Ga0307413_121031672 | 98 |
| 734 | 3300031852 | Ga0307410_10190435 | Ga0307410_101904352 | 98 |
| 735 | 3300031852 | Ga0307410_10204849 | Ga0307410_102048492 | 98 |
| 736 | 3300031852 | Ga0307410_11037292 | Ga0307410_110372922 | 98 |
| 737 | 3300031852 | Ga0307410_11175373 | Ga0307410_111753732 | 98 |
| 738 | 3300031852 | Ga0307410_12043752 | Ga0307410_120437522 | 98 |
| 739 | 3300031901 | Ga0307406_10002286 | Ga0307406_100022863 | 98 |
| 740 | 3300031901 | Ga0307406_10051820 | Ga0307406_100518202 | 98 |
| 741 | 3300031901 | Ga0307406_10328878 | Ga0307406_103288782 | 98 |
| 742 | 3300031901 | Ga0307406_10395285 | Ga0307406_103952852 | 98 |
| 743 | 3300031901 | Ga0307406_10496583 | Ga0307406_104965832 | 98 |
| 744 | 3300031901 | Ga0307406_10686566 | Ga0307406_106865662 | 98 |
| 745 | 3300031901 | Ga0307406_10862838 | Ga0307406_108628382 | 98 |
| 746 | 3300031903 | Ga0307407_10044269 | Ga0307407_100442693 | 98 |
| 747 | 3300031903 | Ga0307407_10625440 | Ga0307407_106254402 | 98 |
| 748 | 3300031911 | Ga0307412_10000950 | Ga0307412_1000095012 | 98 |
| 749 | 3300031911 | Ga0307412_10013155 | Ga0307412_100131554 | 98 |
| 750 | 3300031911 | Ga0307412_10035518 | Ga0307412_100355184 | 98 |
| 751 | 3300031911 | Ga0307412_10035799 | Ga0307412_100357993 | 98 |
| 752 | 3300031911 | Ga0307412_10062673 | Ga0307412_100626733 | 98 |
| 753 | 3300031911 | Ga0307412_10065616 | Ga0307412_100656163 | 98 |
| 754 | 3300031911 | Ga0307412_10071061 | Ga0307412_100710612 | 98 |
| 755 | 3300031911 | Ga0307412_10135036 | Ga0307412_101350362 | 98 |
| 756 | 3300031911 | Ga0307412_10181563 | Ga0307412_101815632 | 98 |
| 757 | 3300031911 | Ga0307412_10276572 | Ga0307412_102765721 | 98 |
| 758 | 3300031911 | Ga0307412_10279333 | Ga0307412_102793332 | 98 |
| 759 | 3300031911 | Ga0307412_10983596 | Ga0307412_109835962 | 98 |
| 760 | 3300031911 | Ga0307412_11030838 | Ga0307412_110308382 | 98 |
| 761 | 3300031911 | Ga0307412_11448082 | Ga0307412_114480822 | 98 |
| 762 | 3300031911 | Ga0307412_11595562 | Ga0307412_115955622 | 98 |
| 763 | 3300031995 | Ga0307409_100099251 | Ga0307409_1000992512 | 98 |
| 764 | 3300031995 | Ga0307409_100124850 | Ga0307409_1001248502 | 98 |
| 765 | 3300031995 | Ga0307409_100359727 | Ga0307409_1003597272 | 98 |
| 766 | 3300031995 | Ga0307409_101075659 | Ga0307409_1010756592 | 98 |
| 767 | 3300031995 | Ga0307409_101395479 | Ga0307409_1013954791 | 98 |
| 768 | 3300031995 | Ga0307409_102251672 | Ga0307409_1022516722 | 98 |
| 769 | 3300032002 | Ga0307416_100014228 | Ga0307416_1000142282 | 98 |
| 770 | 3300032002 | Ga0307416_100078949 | Ga0307416_1000789493 | 98 |
| 771 | 3300032002 | Ga0307416_100195156 | Ga0307416_1001951562 | 98 |
| 772 | 3300032002 | Ga0307416_100297322 | Ga0307416_1002973222 | 98 |
| 773 | 3300032002 | Ga0307416_100595634 | Ga0307416_1005956342 | 98 |
| 774 | 3300032002 | Ga0307416_101202531 | Ga0307416_1012025312 | 98 |
| 775 | 3300032002 | Ga0307416_101251196 | Ga0307416_1012511962 | 98 |
| 776 | 3300032004 | Ga0307414_10000402 | Ga0307414_1000040215 | 98 |
| 777 | 3300032004 | Ga0307414_10001891 | Ga0307414_100018915 | 98 |
| 778 | 3300032004 | Ga0307414_10018465 | Ga0307414_100184654 | 98 |
| 779 | 3300032004 | Ga0307414_10038219 | Ga0307414_100382192 | 98 |
| 780 | 3300032004 | Ga0307414_10078400 | Ga0307414_100784002 | 98 |
| 781 | 3300032004 | Ga0307414_10121142 | Ga0307414_101211423 | 98 |
| 782 | 3300032004 | Ga0307414_10244896 | Ga0307414_102448962 | 98 |
| 783 | 3300032004 | Ga0307414_10273465 | Ga0307414_102734652 | 98 |
| 784 | 3300032004 | Ga0307414_10445182 | Ga0307414_104451822 | 98 |
| 785 | 3300032004 | Ga0307414_10472269 | Ga0307414_104722691 | 98 |
| 786 | 3300032004 | Ga0307414_10517500 | Ga0307414_105175002 | 98 |
| 787 | 3300032004 | Ga0307414_10654838 | Ga0307414_106548382 | 98 |
| 788 | 3300032004 | Ga0307414_10673272 | Ga0307414_106732722 | 98 |
| 789 | 3300032004 | Ga0307414_10903635 | Ga0307414_109036351 | 98 |
| 790 | 3300032004 | Ga0307414_10966679 | Ga0307414_109666792 | 98 |
| 791 | 3300032004 | Ga0307414_11186195 | Ga0307414_111861951 | 98 |
| 792 | 3300032004 | Ga0307414_11259150 | Ga0307414_112591501 | 98 |
| 793 | 3300032004 | Ga0307414_11323529 | Ga0307414_113235292 | 98 |
| 794 | 3300032004 | Ga0307414_11449077 | Ga0307414_114490772 | 98 |
| 795 | 3300032004 | Ga0307414_11569562 | Ga0307414_115695622 | 98 |
| 796 | 3300032004 | Ga0307414_11697238 | Ga0307414_116972382 | 98 |
| 797 | 3300032005 | Ga0307411_10301428 | Ga0307411_103014282 | 98 |
| 798 | 3300032005 | Ga0307411_10321106 | Ga0307411_103211062 | 98 |
| 799 | 3300032005 | Ga0307411_11142703 | Ga0307411_111427032 | 98 |
| 800 | 3300032005 | Ga0307411_11252254 | Ga0307411_112522542 | 98 |
| 801 | 3300032005 | Ga0307411_11273438 | Ga0307411_112734382 | 98 |
| 802 | 3300032126 | Ga0307415_100098837 | Ga0307415_1000988372 | 98 |
| 803 | 3300032126 | Ga0307415_101747886 | Ga0307415_1017478862 | 98 |
| 804 | 3300032126 | Ga0307415_102171547 | Ga0307415_1021715472 | 98 |
| 805 | 3300033180 | Ga0307510_10009662 | Ga0307510_1000966210 | 98 |
| 806 | 3300035398 | Ga0316574_0706846 | Ga0316574_0706846_22_321 | 98 |
| 807 | 3300036712 | Ga0316584_0510960 | Ga0316584_0510960_182_481 | 98 |
| 808 | 3300037312 | Ga0395899_0178310 | Ga0395899_0178310_653_976 | 98 |
| 809 | 3300037853 | Ga0436364_0530420 | Ga0436364_0530420_86303_86599 | 98 |
| 810 | 3300037853 | Ga0436364_0928985 | Ga0436364_0928985_1742_2038 | 98 |
| 811 | 3300038443 | Ga0395901_0108157 | Ga0395901_0108157_1186_1482 | 98 |
| 812 | 3300038443 | Ga0395901_0205414 | Ga0395901_0205414_1560_1856 | 98 |
| 813 | 3300038705 | Ga0237819_00832 | Ga0237819_00832_6771_7067 | 98 |
| 814 | 3300039437 | Ga0436365_0255801 | Ga0436365_0255801_237_533 | 98 |
| 815 | 3300039437 | Ga0436365_0375564 | Ga0436365_0375564_1273_1569 | 98 |
| 816 | 3300039437 | Ga0436365_0571419 | Ga0436365_0571419_42_338 | 98 |
| 817 | 3300039450 | Ga0436363_0495682 | Ga0436363_0495682_186_482 | 98 |
| 818 | 3300039450 | Ga0436363_1680954 | Ga0436363_1680954_314_640 | 98 |
| 819 | 3300041404 | Ga0439436_0018761 | Ga0439436_0018761_1475_1771 | 98 |
| 820 | 3300041404 | Ga0439436_0137832 | Ga0439436_0137832_198_494 | 98 |
| 821 | 3300041410 | Ga0439461_0000282 | Ga0439461_0000282_2998_3294 | 98 |
| 822 | 3300041410 | Ga0439461_0140690 | Ga0439461_0140690_229_531 | 98 |
| 823 | 3300041411 | Ga0439466_0065719 | Ga0439466_0065719_670_966 | 98 |
| 824 | 3300041413 | Ga0439465_0004149 | Ga0439465_0004149_3606_3902 | 98 |
| 825 | 3300041443 | Ga0451789_1323950 | Ga0451789_1323950_214_510 | 98 |
| 826 | 3300041451 | Ga0451791_0004095 | Ga0451791_0004095_244_546 | 98 |
| 827 | 3300041451 | Ga0451791_1323816 | Ga0451791_1323816_133_429 | 98 |
| 828 | 3300041451 | Ga0451791_1781184 | Ga0451791_1781184_203_499 | 98 |
| 829 | 3300041460 | Ga0451802_1880086 | Ga0451802_1880086_176_475 | 98 |
| 830 | 3300041463 | Ga0451804_1088671 | Ga0451804_1088671_91_393 | 98 |
| 831 | 3300041486 | Ga0451807_0190259 | Ga0451807_0190259_214_510 | 98 |
| 832 | 3300041486 | Ga0451807_0329435 | Ga0451807_0329435_108_404 | 98 |
| 833 | 3300041491 | Ga0451833_0606967 | Ga0451833_0606967_301_600 | 98 |
| 834 | 3300041494 | Ga0451837_1233901 | Ga0451837_1233901_29_325 | 98 |
| 835 | 3300041498 | Ga0451841_0204279 | Ga0451841_0204279_115_411 | 98 |
| 836 | 3300041498 | Ga0451841_0601808 | Ga0451841_0601808_124_426 | 98 |
| 837 | 3300041509 | Ga0451843_0273453 | Ga0451843_0273453_505_801 | 98 |
| 838 | 3300041509 | Ga0451843_0328850 | Ga0451843_0328850_128_424 | 98 |
| 839 | 3300041511 | Ga0451855_1280009 | Ga0451855_1280009_123_419 | 98 |
| 840 | 3300041512 | Ga0451853_1666297 | Ga0451853_1666297_248_544 | 98 |
| 841 | 3300041997 | Ga0439431_0065349 | Ga0439431_0065349_394_690 | 98 |
| 842 | 3300041997 | Ga0439431_0136679 | Ga0439431_0136679_43_339 | 98 |
| 843 | 3300042002 | Ga0439442_032520 | Ga0439442_032520_456_752 | 98 |
| 844 | 3300042004 | Ga0439445_0003320 | Ga0439445_0003320_1361_1657 | 98 |
| 845 | 3300042004 | Ga0439445_0173222 | Ga0439445_0173222_76_372 | 98 |
| 846 | 3300042006 | Ga0439432_003330 | Ga0439432_003330_329_625 | 98 |
| 847 | 3300042014 | Ga0439457_052627 | Ga0439457_052627_250_546 | 98 |
| 848 | 3300042015 | Ga0439462_0008838 | Ga0439462_0008838_575_871 | 98 |
| 849 | 3300042015 | Ga0439462_0011511 | Ga0439462_0011511_172_468 | 98 |
| 850 | 3300042116 | Ga0450912_000546 | Ga0450912_000546_610_912 | 98 |
| 851 | 3300042116 | Ga0450912_008590 | Ga0450912_008590_431_727 | 98 |
| 852 | 3300042122 | Ga0450920_044532 | Ga0450920_044532_456_758 | 98 |
| 853 | 3300042156 | Ga0439446_0100651 | Ga0439446_0100651_164_460 | 98 |
| 854 | 3300042435 | Ga0439434_0001642 | Ga0439434_0001642_5473_5769 | 98 |
| 855 | 3300042436 | Ga0439435_0006215 | Ga0439435_0006215_1396_1698 | 98 |
| 856 | 3300042532 | Ga0450893_0030345 | Ga0450893_0030345_358_660 | 98 |
| 857 | 3300042876 | Ga0451577_0183229 | Ga0451577_0183229_1111_1407 | 98 |
| 858 | 3300044712 | Ga0453684_0193386 | Ga0453684_0193386_584_880 | 98 |
| 859 | 3300044842 | Ga0466957_0218865 | Ga0466957_0218865_405_704 | 98 |
| 860 | 3300045051 | Ga0451576_0000588 | Ga0451576_0000588_25554_25853 | 98 |
| 861 | 3300045051 | Ga0451576_0181078 | Ga0451576_0181078_1182_1478 | 98 |
| 862 | 3300046452 | Ga0495617_262793 | Ga0495617_262793_95_391 | 98 |
| 863 | 3300046453 | Ga0495627_000193 | Ga0495627_000193_51102_51398 | 98 |
| 864 | 3300046453 | Ga0495627_000478 | Ga0495627_000478_24318_24614 | 98 |
| 865 | 3300046457 | Ga0495590_0267909 | Ga0495590_0267909_35_331 | 98 |
| 866 | 3300046459 | Ga0495629_0044090 | Ga0495629_0044090_369_665 | 98 |
| 867 | 3300046460 | Ga0495638_0000350 | Ga0495638_0000350_36527_36823 | 98 |
| 868 | 3300046460 | Ga0495638_0240756 | Ga0495638_0240756_194_490 | 98 |
| 869 | 3300046471 | Ga0495650_0000373 | Ga0495650_0000373_27456_27752 | 98 |
| 870 | 3300046471 | Ga0495650_0111234 | Ga0495650_0111234_99_395 | 98 |
| 871 | 3300046474 | Ga0495605_0443035 | Ga0495605_0443035_145_441 | 98 |
| 872 | 3300046476 | Ga0495662_0082809 | Ga0495662_0082809_474_770 | 98 |
| 873 | 3300046491 | Ga0495584_0156510 | Ga0495584_0156510_166_462 | 98 |
| 874 | 3300046492 | Ga0495585_0001259 | Ga0495585_0001259_1285_1581 | 98 |
| 875 | 3300046501 | Ga0495607_0057229 | Ga0495607_0057229_1000_1296 | 98 |
| 876 | 3300046501 | Ga0495607_0289913 | Ga0495607_0289913_118_414 | 98 |
| 877 | 3300046506 | Ga0495583_0001602 | Ga0495583_0001602_1281_1577 | 98 |
| 878 | 3300046506 | Ga0495583_0042926 | Ga0495583_0042926_590_886 | 98 |
| 879 | 3300046506 | Ga0495583_0068889 | Ga0495583_0068889_476_772 | 98 |
| 880 | 3300046506 | Ga0495583_0112543 | Ga0495583_0112543_377_673 | 98 |
| 881 | 3300046506 | Ga0495583_0173081 | Ga0495583_0173081_481_777 | 98 |
| 882 | 3300046507 | Ga0495606_0000591 | Ga0495606_0000591_8478_8774 | 98 |
| 883 | 3300046507 | Ga0495606_0033962 | Ga0495606_0033962_2353_2676 | 98 |
| 884 | 3300046512 | Ga0495610_0001092 | Ga0495610_0001092_5675_5971 | 98 |
| 885 | 3300046512 | Ga0495610_0005829 | Ga0495610_0005829_5304_5600 | 98 |
| 886 | 3300046512 | Ga0495610_0031673 | Ga0495610_0031673_2184_2480 | 98 |
| 887 | 3300046518 | Ga0495631_0339081 | Ga0495631_0339081_201_497 | 98 |
| 888 | 3300046518 | Ga0495631_0350275 | Ga0495631_0350275_161_457 | 98 |
| 889 | 3300046520 | Ga0495637_0251194 | Ga0495637_0251194_143_439 | 98 |
| 890 | 3300046522 | Ga0495643_0000027 | Ga0495643_0000027_195067_195363 | 98 |
| 891 | 3300046522 | Ga0495643_0005403 | Ga0495643_0005403_4670_4966 | 98 |
| 892 | 3300046522 | Ga0495643_0009293 | Ga0495643_0009293_715_1011 | 98 |
| 893 | 3300046522 | Ga0495643_0036125 | Ga0495643_0036125_1629_1925 | 98 |
| 894 | 3300046522 | Ga0495643_0126700 | Ga0495643_0126700_481_777 | 98 |
| 895 | 3300046522 | Ga0495643_0152750 | Ga0495643_0152750_630_926 | 98 |
| 896 | 3300046524 | Ga0495648_0000115 | Ga0495648_0000115_13062_13358 | 98 |
| 897 | 3300046524 | Ga0495648_0009282 | Ga0495648_0009282_2635_2931 | 98 |
| 898 | 3300046524 | Ga0495648_0011981 | Ga0495648_0011981_216_512 | 98 |
| 899 | 3300046524 | Ga0495648_0058400 | Ga0495648_0058400_1854_2150 | 98 |
| 900 | 3300046524 | Ga0495648_0065078 | Ga0495648_0065078_1746_2042 | 98 |
| 901 | 3300046524 | Ga0495648_0286746 | Ga0495648_0286746_36_332 | 98 |
| 902 | 3300046525 | Ga0495663_0003401 | Ga0495663_0003401_3983_4279 | 98 |
| 903 | 3300046525 | Ga0495663_0056048 | Ga0495663_0056048_69_365 | 98 |
| 904 | 3300046525 | Ga0495663_0229267 | Ga0495663_0229267_223_519 | 98 |
| 905 | 3300046525 | Ga0495663_0266177 | Ga0495663_0266177_133_429 | 98 |
| 906 | 3300046528 | Ga0495642_0107275 | Ga0495642_0107275_35_358 | 98 |
| 907 | 3300046530 | Ga0495654_0000595 | Ga0495654_0000595_16299_16595 | 98 |
| 908 | 3300046530 | Ga0495654_0018453 | Ga0495654_0018453_2397_2693 | 98 |
| 909 | 3300046530 | Ga0495654_0256201 | Ga0495654_0256201_232_528 | 98 |
| 910 | 3300046536 | Ga0495587_0414242 | Ga0495587_0414242_243_539 | 98 |
| 911 | 3300046537 | Ga0495598_0027069 | Ga0495598_0027069_186_488 | 98 |
| 912 | 3300046538 | Ga0495609_0407114 | Ga0495609_0407114_101_397 | 98 |
| 913 | 3300046539 | Ga0495621_0026775 | Ga0495621_0026775_1078_1380 | 98 |
| 914 | 3300046539 | Ga0495621_0045810 | Ga0495621_0045810_804_1103 | 98 |
| 915 | 3300046542 | Ga0495597_0088605 | Ga0495597_0088605_432_728 | 98 |
| 916 | 3300046542 | Ga0495597_0110442 | Ga0495597_0110442_425_721 | 98 |
| 917 | 3300046557 | Ga0495622_0012047 | Ga0495622_0012047_2633_2929 | 98 |
| 918 | 3300046558 | Ga0495633_0002089 | Ga0495633_0002089_12735_13031 | 98 |
| 919 | 3300046558 | Ga0495633_0002581 | Ga0495633_0002581_3414_3710 | 98 |
| 920 | 3300046558 | Ga0495633_0011568 | Ga0495633_0011568_3658_3954 | 98 |
| 921 | 3300046558 | Ga0495633_0033930 | Ga0495633_0033930_1891_2187 | 98 |
| 922 | 3300046615 | Ga0495656_0154145 | Ga0495656_0154145_367_666 | 98 |
| 923 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_138760_139056 | 98 |
| 924 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_522394_522690 | 98 |
| 925 | 3300046616 | Ga0495668_0001393 | Ga0495668_0001393_14107_14403 | 98 |
| 926 | 3300046616 | Ga0495668_0019492 | Ga0495668_0019492_3518_3814 | 98 |
| 927 | 3300046616 | Ga0495668_0115889 | Ga0495668_0115889_290_586 | 98 |
| 928 | 3300046616 | Ga0495668_0193293 | Ga0495668_0193293_34_330 | 98 |
| 929 | 3300046616 | Ga0495668_0247004 | Ga0495668_0247004_379_675 | 98 |
| 930 | 3300046616 | Ga0495668_0302435 | Ga0495668_0302435_542_838 | 98 |
| 931 | 3300046616 | Ga0495668_0482226 | Ga0495668_0482226_169_465 | 98 |
| 932 | 3300046648 | Ga0495611_0103287 | Ga0495611_0103287_333_629 | 98 |
| 933 | 3300046648 | Ga0495611_0472799 | Ga0495611_0472799_228_524 | 98 |
| 934 | 3300046660 | Ga0495625_0000390 | Ga0495625_0000390_12978_13274 | 98 |
| 935 | 3300046660 | Ga0495625_0000503 | Ga0495625_0000503_54626_54922 | 98 |
| 936 | 3300046660 | Ga0495625_0001297 | Ga0495625_0001297_30128_30424 | 98 |
| 937 | 3300046660 | Ga0495625_0003168 | Ga0495625_0003168_722_1018 | 98 |
| 938 | 3300046660 | Ga0495625_0003788 | Ga0495625_0003788_6497_6793 | 98 |
| 939 | 3300046660 | Ga0495625_0033137 | Ga0495625_0033137_3019_3315 | 98 |
| 940 | 3300046660 | Ga0495625_0097778 | Ga0495625_0097778_765_1061 | 98 |
| 941 | 3300046660 | Ga0495625_0109644 | Ga0495625_0109644_358_654 | 98 |
| 942 | 3300046660 | Ga0495625_0128081 | Ga0495625_0128081_464_760 | 98 |
| 943 | 3300046660 | Ga0495625_0310558 | Ga0495625_0310558_571_867 | 98 |
| 944 | 3300046660 | Ga0495625_0384363 | Ga0495625_0384363_499_795 | 98 |
| 945 | 3300046660 | Ga0495625_0665919 | Ga0495625_0665919_189_485 | 98 |
| 946 | 3300046660 | Ga0495625_0670243 | Ga0495625_0670243_292_588 | 98 |
| 947 | 3300046665 | Ga0495661_0524839 | Ga0495661_0524839_82_378 | 98 |
| 948 | 3300046684 | Ga0495669_0000268 | Ga0495669_0000268_12320_12616 | 98 |
| 949 | 3300046691 | Ga0495670_0000066 | Ga0495670_0000066_6197_6493 | 98 |
| 950 | 3300046691 | Ga0495670_0177630 | Ga0495670_0177630_132_428 | 98 |
| 951 | 3300046691 | Ga0495670_0275580 | Ga0495670_0275580_95_391 | 98 |
| 952 | 3300046692 | Ga0495671_0096391 | Ga0495671_0096391_260_556 | 98 |
| 953 | 3300046692 | Ga0495671_0100039 | Ga0495671_0100039_363_659 | 98 |
| 954 | 3300046692 | Ga0495671_0118696 | Ga0495671_0118696_69_365 | 98 |
| 955 | 3300046694 | Ga0495649_0121204 | Ga0495649_0121204_937_1233 | 98 |
| 956 | 3300046809 | Ga0495600_0004421 | Ga0495600_0004421_7122_7418 | 98 |
| 957 | 3300046810 | Ga0495660_0215999 | Ga0495660_0215999_317_613 | 98 |
| 958 | 3300047318 | Ga0495636_0216797 | Ga0495636_0216797_362_658 | 98 |
| 959 | 3300047323 | Ga0495683_0004909 | Ga0495683_0004909_2091_2387 | 98 |
| 960 | 3300047323 | Ga0495683_0035493 | Ga0495683_0035493_1643_1939 | 98 |
| 961 | 3300047323 | Ga0495683_0397774 | Ga0495683_0397774_13_309 | 98 |
| 962 | 3300047443 | Ga0495687_000055 | Ga0495687_000055_167240_167536 | 98 |
| 963 | 3300047443 | Ga0495687_005115 | Ga0495687_005115_3230_3526 | 98 |
| 964 | 3300047445 | Ga0495677_0003912 | Ga0495677_0003912_525_848 | 98 |
| 965 | 3300047469 | Ga0495673_0260267 | Ga0495673_0260267_146_442 | 98 |
| 966 | 3300047470 | Ga0495681_0000032 | Ga0495681_0000032_54306_54602 | 98 |
| 967 | 3300047470 | Ga0495681_0037808 | Ga0495681_0037808_486_782 | 98 |
| 968 | 3300047470 | Ga0495681_0144421 | Ga0495681_0144421_544_840 | 98 |
| 969 | 3300047470 | Ga0495681_0154438 | Ga0495681_0154438_306_602 | 98 |
| 970 | 3300047472 | Ga0495686_0004143 | Ga0495686_0004143_1364_1660 | 98 |
| 971 | 3300047472 | Ga0495686_0008478 | Ga0495686_0008478_3921_4217 | 98 |
| 972 | 3300047472 | Ga0495686_0042206 | Ga0495686_0042206_2308_2604 | 98 |
| 973 | 3300047472 | Ga0495686_0165401 | Ga0495686_0165401_500_796 | 98 |
| 974 | 3300047472 | Ga0495686_0438090 | Ga0495686_0438090_93_389 | 98 |
| 975 | 3300048090 | Ga0495615_0018356 | Ga0495615_0018356_937_1236 | 98 |
| 976 | 3300048090 | Ga0495615_0026748 | Ga0495615_0026748_1030_1326 | 98 |
| 977 | 3300048903 | Ga0496100_0927777 | Ga0496100_0927777_31_327 | 98 |
| 978 | 3300048904 | Ga0496101_0106166 | Ga0496101_0106166_541_837 | 98 |
| 979 | 3300048904 | Ga0496101_1080129 | Ga0496101_1080129_317_613 | 98 |
| 980 | 3300048904 | Ga0496101_1081136 | Ga0496101_1081136_93_389 | 98 |
| 981 | 3300048905 | Ga0496102_0000049 | Ga0496102_0000049_146046_146342 | 98 |
| 982 | 3300048905 | Ga0496102_0011200 | Ga0496102_0011200_1540_1836 | 98 |
| 983 | 3300048905 | Ga0496102_0027205 | Ga0496102_0027205_795_1091 | 98 |
| 984 | 3300048905 | Ga0496102_1270847 | Ga0496102_1270847_19_315 | 98 |
| 985 | 3300048906 | Ga0496103_0000037 | Ga0496103_0000037_33133_33429 | 98 |
| 986 | 3300048906 | Ga0496103_0000151 | Ga0496103_0000151_16671_16967 | 98 |
| 987 | 3300048906 | Ga0496103_0796185 | Ga0496103_0796185_20_316 | 98 |
| 988 | 3300048907 | Ga0496104_0046225 | Ga0496104_0046225_849_1145 | 98 |
| 989 | 3300048907 | Ga0496104_0520997 | Ga0496104_0520997_316_615 | 98 |
| 990 | 3300048907 | Ga0496104_1696910 | Ga0496104_1696910_136_432 | 98 |
| 991 | 3300048908 | Ga0496105_0002067 | Ga0496105_0002067_14032_14328 | 98 |
| 992 | 3300048910 | Ga0496107_0753502 | Ga0496107_0753502_286_582 | 98 |
| 993 | 3300048911 | Ga0496108_0002067 | Ga0496108_0002067_14434_14730 | 98 |
| 994 | 3300048911 | Ga0496108_1232693 | Ga0496108_1232693_71_367 | 98 |
| 995 | 3300048912 | Ga0496109_0134818 | Ga0496109_0134818_1491_1787 | 98 |
| 996 | 3300048912 | Ga0496109_0564467 | Ga0496109_0564467_538_834 | 98 |
| 997 | 3300048912 | Ga0496109_0724700 | Ga0496109_0724700_301_597 | 98 |
| 998 | 3300048913 | Ga0496110_0058567 | Ga0496110_0058567_1524_1820 | 98 |
| 999 | 3300048913 | Ga0496110_0140354 | Ga0496110_0140354_985_1281 | 98 |
| 1000 | 3300048913 | Ga0496110_0156130 | Ga0496110_0156130_1532_1828 | 98 |
| 1001 | 3300048913 | Ga0496110_1263689 | Ga0496110_1263689_158_454 | 98 |
| 1002 | 3300048914 | Ga0496111_0030916 | Ga0496111_0030916_578_874 | 98 |
| 1003 | 3300048914 | Ga0496111_0112774 | Ga0496111_0112774_807_1103 | 98 |
| 1004 | 3300048915 | Ga0496112_0123702 | Ga0496112_0123702_1081_1377 | 98 |
| 1005 | 3300048916 | Ga0496113_0004996 | Ga0496113_0004996_4813_5109 | 98 |
| 1006 | 3300048916 | Ga0496113_0125999 | Ga0496113_0125999_20_316 | 98 |
| 1007 | 3300048916 | Ga0496113_1263065 | Ga0496113_1263065_115_411 | 98 |
| 1008 | 3300048917 | Ga0496114_0014916 | Ga0496114_0014916_1436_1732 | 98 |
| 1009 | 3300048917 | Ga0496114_0061205 | Ga0496114_0061205_1913_2209 | 98 |
| 1010 | 3300048918 | Ga0496115_0000018 | Ga0496115_0000018_152190_152486 | 98 |
| 1011 | 3300048918 | Ga0496115_0304870 | Ga0496115_0304870_278_574 | 98 |
| 1012 | 3300048919 | Ga0496116_0000664 | Ga0496116_0000664_32834_33130 | 98 |
| 1013 | 3300048919 | Ga0496116_0013868 | Ga0496116_0013868_4688_4984 | 98 |
| 1014 | 3300048919 | Ga0496116_0330323 | Ga0496116_0330323_310_606 | 98 |
| 1015 | 3300048920 | Ga0496117_0000115 | Ga0496117_0000115_146046_146342 | 98 |
| 1016 | 3300048920 | Ga0496117_0000408 | Ga0496117_0000408_29399_29695 | 98 |
| 1017 | 3300048920 | Ga0496117_0018914 | Ga0496117_0018914_1617_1913 | 98 |
| 1018 | 3300048920 | Ga0496117_0118200 | Ga0496117_0118200_363_659 | 98 |
| 1019 | 3300048921 | Ga0496118_0000086 | Ga0496118_0000086_33147_33443 | 98 |
| 1020 | 3300048921 | Ga0496118_0000600 | Ga0496118_0000600_16697_16993 | 98 |
| 1021 | 3300048921 | Ga0496118_0001927 | Ga0496118_0001927_3834_4130 | 98 |
| 1022 | 3300048921 | Ga0496118_0024471 | Ga0496118_0024471_1847_2143 | 98 |
| 1023 | 3300048921 | Ga0496118_0111601 | Ga0496118_0111601_177_491 | 98 |
| 1024 | 3300048921 | Ga0496118_0547135 | Ga0496118_0547135_213_509 | 98 |
| 1025 | 3300048921 | Ga0496118_0609535 | Ga0496118_0609535_164_460 | 98 |
| 1026 | 3300048922 | Ga0496119_0011638 | Ga0496119_0011638_1521_1817 | 98 |
| 1027 | 3300048922 | Ga0496119_0026037 | Ga0496119_0026037_934_1230 | 98 |
| 1028 | 3300048923 | Ga0496120_0116338 | Ga0496120_0116338_960_1256 | 98 |
| 1029 | 3300048924 | Ga0496121_0000208 | Ga0496121_0000208_42635_42931 | 98 |
| 1030 | 3300048924 | Ga0496121_0000237 | Ga0496121_0000237_88222_88545 | 98 |
| 1031 | 3300048924 | Ga0496121_0001774 | Ga0496121_0001774_7565_7861 | 98 |
| 1032 | 3300048924 | Ga0496121_0010863 | Ga0496121_0010863_5027_5323 | 98 |
| 1033 | 3300048924 | Ga0496121_0083746 | Ga0496121_0083746_1130_1426 | 98 |
| 1034 | 3300048924 | Ga0496121_0107141 | Ga0496121_0107141_1450_1746 | 98 |
| 1035 | 3300048924 | Ga0496121_0285376 | Ga0496121_0285376_289_585 | 98 |
| 1036 | 3300048924 | Ga0496121_0303153 | Ga0496121_0303153_407_703 | 98 |
| 1037 | 3300048925 | Ga0496122_0000970 | Ga0496122_0000970_13030_13326 | 98 |
| 1038 | 3300048925 | Ga0496122_0010455 | Ga0496122_0010455_1897_2193 | 98 |
| 1039 | 3300048925 | Ga0496122_0036922 | Ga0496122_0036922_2938_3234 | 98 |
| 1040 | 3300048925 | Ga0496122_0170992 | Ga0496122_0170992_791_1087 | 98 |
| 1041 | 3300048925 | Ga0496122_0294950 | Ga0496122_0294950_129_425 | 98 |
| 1042 | 3300048925 | Ga0496122_0315114 | Ga0496122_0315114_496_792 | 98 |
| 1043 | 3300048926 | Ga0496123_0000286 | Ga0496123_0000286_38223_38519 | 98 |
| 1044 | 3300048926 | Ga0496123_0015139 | Ga0496123_0015139_4470_4766 | 98 |
| 1045 | 3300048926 | Ga0496123_0029909 | Ga0496123_0029909_3294_3590 | 98 |
| 1046 | 3300048926 | Ga0496123_0060522 | Ga0496123_0060522_1408_1704 | 98 |
| 1047 | 3300048926 | Ga0496123_0162083 | Ga0496123_0162083_381_677 | 98 |
| 1048 | 3300048926 | Ga0496123_0264775 | Ga0496123_0264775_263_559 | 98 |
| 1049 | 3300048927 | Ga0496124_0000099 | Ga0496124_0000099_29449_29745 | 98 |
| 1050 | 3300048927 | Ga0496124_0000102 | Ga0496124_0000102_33147_33443 | 98 |
| 1051 | 3300048927 | Ga0496124_0002045 | Ga0496124_0002045_23839_24135 | 98 |
| 1052 | 3300048927 | Ga0496124_0002943 | Ga0496124_0002943_20705_21001 | 98 |
| 1053 | 3300048927 | Ga0496124_0013584 | Ga0496124_0013584_1277_1573 | 98 |
| 1054 | 3300048927 | Ga0496124_0052650 | Ga0496124_0052650_1177_1473 | 98 |
| 1055 | 3300048927 | Ga0496124_0053462 | Ga0496124_0053462_1171_1467 | 98 |
| 1056 | 3300048927 | Ga0496124_0059087 | Ga0496124_0059087_1755_2051 | 98 |
| 1057 | 3300048927 | Ga0496124_0205382 | Ga0496124_0205382_626_922 | 98 |
| 1058 | 3300048927 | Ga0496124_0216169 | Ga0496124_0216169_865_1161 | 98 |
| 1059 | 3300048927 | Ga0496124_0536880 | Ga0496124_0536880_201_497 | 98 |
| 1060 | 3300048927 | Ga0496124_0614764 | Ga0496124_0614764_320_616 | 98 |
| 1061 | 3300048927 | Ga0496124_0883505 | Ga0496124_0883505_61_357 | 98 |
| 1062 | 3300048928 | Ga0496125_0012876 | Ga0496125_0012876_6401_6697 | 98 |
| 1063 | 3300048928 | Ga0496125_0022088 | Ga0496125_0022088_4947_5243 | 98 |
| 1064 | 3300048928 | Ga0496125_0050166 | Ga0496125_0050166_582_878 | 98 |
| 1065 | 3300048928 | Ga0496125_0073878 | Ga0496125_0073878_1309_1605 | 98 |
| 1066 | 3300048928 | Ga0496125_0106291 | Ga0496125_0106291_1471_1767 | 98 |
| 1067 | 3300048928 | Ga0496125_0169773 | Ga0496125_0169773_352_648 | 98 |
| 1068 | 3300048928 | Ga0496125_0299026 | Ga0496125_0299026_638_934 | 98 |
| 1069 | 3300048928 | Ga0496125_0304291 | Ga0496125_0304291_314_610 | 98 |
| 1070 | 3300048928 | Ga0496125_0598961 | Ga0496125_0598961_96_392 | 98 |
| 1071 | 3300048929 | Ga0496126_0000507 | Ga0496126_0000507_33458_33754 | 98 |
| 1072 | 3300048929 | Ga0496126_0048499 | Ga0496126_0048499_2332_2628 | 98 |
| 1073 | 3300048929 | Ga0496126_0116494 | Ga0496126_0116494_42_341 | 98 |
| 1074 | 3300048929 | Ga0496126_0141298 | Ga0496126_0141298_1645_1941 | 98 |
| 1075 | 3300048929 | Ga0496126_0455171 | Ga0496126_0455171_439_735 | 98 |
| 1076 | 3300048929 | Ga0496126_0789729 | Ga0496126_0789729_18_314 | 98 |
| 1077 | 3300049127 | Ga0501306_101616 | Ga0501306_101616_49_348 | 98 |
| 1078 | 3300049161 | Ga0501305_009896 | Ga0501305_009896_469_765 | 98 |
| 1079 | 3300049162 | Ga0501307_003277 | Ga0501307_003277_490_786 | 98 |
| 1080 | 3300049459 | Ga0495678_013203 | Ga0495678_013203_1094_1390 | 98 |
| 1081 | 3300049459 | Ga0495678_148894 | Ga0495678_148894_393_689 | 98 |
| 1082 | 3300049513 | Ga0501290_000239 | Ga0501290_000239_8156_8452 | 98 |
| 1083 | 3300049514 | Ga0501291_140520 | Ga0501291_140520_143_442 | 98 |
| 1084 | 3300049515 | Ga0501292_000008 | Ga0501292_000008_37829_38125 | 98 |
| 1085 | 3300049516 | Ga0501293_001729 | Ga0501293_001729_815_1111 | 98 |
| 1086 | 3300049516 | Ga0501293_023847 | Ga0501293_023847_260_556 | 98 |
| 1087 | 3300049517 | Ga0501294_009404 | Ga0501294_009404_651_947 | 98 |
| 1088 | 3300049523 | Ga0501300_000363 | Ga0501300_000363_3227_3523 | 98 |
| 1089 | 3300049529 | Ga0501313_012426 | Ga0501313_012426_264_560 | 98 |
| 1090 | 3300049529 | Ga0501313_031360 | Ga0501313_031360_277_573 | 98 |
| 1091 | 3300049531 | Ga0501315_007923 | Ga0501315_007923_458_754 | 98 |
| 1092 | 3300049533 | Ga0501317_011776 | Ga0501317_011776_521_817 | 98 |
| 1093 | 3300049540 | Ga0501324_046489 | Ga0501324_046489_38_361 | 98 |
| 1094 | 3300049551 | Ga0501335_004555 | Ga0501335_004555_308_604 | 98 |
| 1095 | 3300049568 | Ga0501031_0223725 | Ga0501031_0223725_480_776 | 98 |
| 1096 | 3300049568 | Ga0501031_0378666 | Ga0501031_0378666_252_551 | 98 |
| 1097 | 3300049569 | Ga0501032_0056525 | Ga0501032_0056525_1649_1945 | 98 |
| 1098 | 3300049569 | Ga0501032_0228127 | Ga0501032_0228127_478_774 | 98 |
| 1099 | 3300049569 | Ga0501032_0415144 | Ga0501032_0415144_258_557 | 98 |
| 1100 | 3300049570 | Ga0501033_0007915 | Ga0501033_0007915_6644_6940 | 98 |
| 1101 | 3300049570 | Ga0501033_0103136 | Ga0501033_0103136_981_1277 | 98 |
| 1102 | 3300049570 | Ga0501033_0256012 | Ga0501033_0256012_179_475 | 98 |
| 1103 | 3300049570 | Ga0501033_0488746 | Ga0501033_0488746_210_506 | 98 |
| 1104 | 3300049571 | Ga0501034_0024797 | Ga0501034_0024797_4968_5264 | 98 |
| 1105 | 3300049571 | Ga0501034_0143619 | Ga0501034_0143619_1206_1505 | 98 |
| 1106 | 3300049571 | Ga0501034_0175045 | Ga0501034_0175045_1417_1713 | 98 |
| 1107 | 3300049571 | Ga0501034_0383379 | Ga0501034_0383379_967_1263 | 98 |
| 1108 | 3300049571 | Ga0501034_0570302 | Ga0501034_0570302_226_522 | 98 |
| 1109 | 3300049571 | Ga0501034_0648180 | Ga0501034_0648180_169_465 | 98 |
| 1110 | 3300049571 | Ga0501034_0768735 | Ga0501034_0768735_41_337 | 98 |
| 1111 | 3300049571 | Ga0501034_1636362 | Ga0501034_1636362_45_341 | 98 |
| 1112 | 3300049572 | Ga0501036_0042413 | Ga0501036_0042413_2403_2699 | 98 |
| 1113 | 3300049572 | Ga0501036_0335592 | Ga0501036_0335592_292_588 | 98 |
| 1114 | 3300049572 | Ga0501036_0594917 | Ga0501036_0594917_124_423 | 98 |
| 1115 | 3300049572 | Ga0501036_0682019 | Ga0501036_0682019_47_343 | 98 |
| 1116 | 3300049573 | Ga0501037_0007067 | Ga0501037_0007067_6084_6380 | 98 |
| 1117 | 3300049573 | Ga0501037_0157079 | Ga0501037_0157079_1159_1458 | 98 |
| 1118 | 3300049573 | Ga0501037_0675456 | Ga0501037_0675456_284_580 | 98 |
| 1119 | 3300049573 | Ga0501037_0721677 | Ga0501037_0721677_278_574 | 98 |
| 1120 | 3300049574 | Ga0501038_0162575 | Ga0501038_0162575_787_1083 | 98 |
| 1121 | 3300049574 | Ga0501038_0179345 | Ga0501038_0179345_476_772 | 98 |
| 1122 | 3300049574 | Ga0501038_0249511 | Ga0501038_0249511_180_476 | 98 |
| 1123 | 3300049574 | Ga0501038_1210606 | Ga0501038_1210606_220_516 | 98 |
| 1124 | 3300049575 | Ga0501039_0069075 | Ga0501039_0069075_1697_1993 | 98 |
| 1125 | 3300049575 | Ga0501039_0667237 | Ga0501039_0667237_435_734 | 98 |
| 1126 | 3300049575 | Ga0501039_1348332 | Ga0501039_1348332_107_403 | 98 |
| 1127 | 3300049578 | Ga0501042_0766286 | Ga0501042_0766286_258_560 | 98 |
| 1128 | 3300049578 | Ga0501042_0808800 | Ga0501042_0808800_149_445 | 98 |
| 1129 | 3300049578 | Ga0501042_1453349 | Ga0501042_1453349_25_321 | 98 |
| 1130 | 3300049579 | Ga0501043_0127668 | Ga0501043_0127668_410_706 | 98 |
| 1131 | 3300049579 | Ga0501043_0235691 | Ga0501043_0235691_399_695 | 98 |
| 1132 | 3300049579 | Ga0501043_0286073 | Ga0501043_0286073_487_783 | 98 |
| 1133 | 3300049579 | Ga0501043_0376967 | Ga0501043_0376967_301_597 | 98 |
| 1134 | 3300049580 | Ga0501046_0087795 | Ga0501046_0087795_1548_1844 | 98 |
| 1135 | 3300049580 | Ga0501046_0248471 | Ga0501046_0248471_492_788 | 98 |
| 1136 | 3300049581 | Ga0501047_0000876 | Ga0501047_0000876_26966_27262 | 98 |
| 1137 | 3300049581 | Ga0501047_0293727 | Ga0501047_0293727_675_971 | 98 |
| 1138 | 3300049581 | Ga0501047_0380991 | Ga0501047_0380991_801_1097 | 98 |
| 1139 | 3300049581 | Ga0501047_0384774 | Ga0501047_0384774_163_459 | 98 |
| 1140 | 3300049581 | Ga0501047_0529825 | Ga0501047_0529825_524_820 | 98 |
| 1141 | 3300049581 | Ga0501047_1256300 | Ga0501047_1256300_66_362 | 98 |
| 1142 | 3300049582 | Ga0501048_0063746 | Ga0501048_0063746_2030_2326 | 98 |
| 1143 | 3300049582 | Ga0501048_0439882 | Ga0501048_0439882_593_889 | 98 |
| 1144 | 3300049583 | Ga0501067_0415310 | Ga0501067_0415310_411_710 | 98 |
| 1145 | 3300049586 | Ga0501070_0209515 | Ga0501070_0209515_195_491 | 98 |
| 1146 | 3300049587 | Ga0501071_0505286 | Ga0501071_0505286_324_620 | 98 |
| 1147 | 3300049587 | Ga0501071_0814569 | Ga0501071_0814569_164_460 | 98 |
| 1148 | 3300049589 | Ga0501073_0753796 | Ga0501073_0753796_51_347 | 98 |
| 1149 | 3300049652 | Ga0501202_010095 | Ga0501202_010095_736_1032 | 98 |
| 1150 | 3300049653 | Ga0501206_003593 | Ga0501206_003593_1277_1573 | 98 |
| 1151 | 3300049653 | Ga0501206_006431 | Ga0501206_006431_819_1115 | 98 |
| 1152 | 3300049654 | Ga0501207_012775 | Ga0501207_012775_768_1064 | 98 |
| 1153 | 3300049655 | Ga0501208_077551 | Ga0501208_077551_73_369 | 98 |
| 1154 | 3300049662 | Ga0501222_000772 | Ga0501222_000772_2574_2870 | 98 |
| 1155 | 3300049663 | Ga0501223_000004 | Ga0501223_000004_16774_17070 | 98 |
| 1156 | 3300049663 | Ga0501223_000368 | Ga0501223_000368_9328_9624 | 98 |
| 1157 | 3300049663 | Ga0501223_112769 | Ga0501223_112769_180_476 | 98 |
| 1158 | 3300049664 | Ga0501224_006184 | Ga0501224_006184_977_1273 | 98 |
| 1159 | 3300049664 | Ga0501224_019511 | Ga0501224_019511_698_997 | 98 |
| 1160 | 3300049665 | Ga0501227_018690 | Ga0501227_018690_669_965 | 98 |
| 1161 | 3300049668 | Ga0501233_039761 | Ga0501233_039761_270_566 | 98 |
| 1162 | 3300049669 | Ga0501235_008987 | Ga0501235_008987_712_1008 | 98 |
| 1163 | 3300049669 | Ga0501235_011993 | Ga0501235_011993_981_1277 | 98 |
| 1164 | 3300049669 | Ga0501235_035994 | Ga0501235_035994_122_418 | 98 |
| 1165 | 3300049670 | Ga0501236_002716 | Ga0501236_002716_1118_1414 | 98 |
| 1166 | 3300049670 | Ga0501236_007445 | Ga0501236_007445_448_744 | 98 |
| 1167 | 3300049679 | Ga0501249_000686 | Ga0501249_000686_6442_6738 | 98 |
| 1168 | 3300049686 | Ga0501257_001004 | Ga0501257_001004_1063_1359 | 98 |
| 1169 | 3300049686 | Ga0501257_037227 | Ga0501257_037227_335_631 | 98 |
| 1170 | 3300049688 | Ga0501259_000589 | Ga0501259_000589_1239_1535 | 98 |
| 1171 | 3300049690 | Ga0501261_000030 | Ga0501261_000030_1180_1476 | 98 |
| 1172 | 3300049704 | Ga0501221_010535 | Ga0501221_010535_434_730 | 98 |
| 1173 | 3300049705 | Ga0501225_0000003 | Ga0501225_0000003_123755_124051 | 98 |
| 1174 | 3300049705 | Ga0501225_0001931 | Ga0501225_0001931_5801_6097 | 98 |
| 1175 | 3300049705 | Ga0501225_0002873 | Ga0501225_0002873_728_1024 | 98 |
| 1176 | 3300049708 | Ga0501245_002127 | Ga0501245_002127_1568_1864 | 98 |
| 1177 | 3300049708 | Ga0501245_008085 | Ga0501245_008085_337_633 | 98 |
| 1178 | 3300049742 | Ga0501080_0166082 | Ga0501080_0166082_1202_1501 | 98 |
| 1179 | 3300049758 | Ga0501241_010421 | Ga0501241_010421_1098_1394 | 98 |
| 1180 | 3300049761 | Ga0501264_005550 | Ga0501264_005550_306_602 | 98 |
| 1181 | 3300049775 | Ga0501279_000002 | Ga0501279_000002_109761_110057 | 98 |
| 1182 | 3300049776 | Ga0501280_000010 | Ga0501280_000010_9896_10192 | 98 |
| 1183 | 3300049776 | Ga0501280_008201 | Ga0501280_008201_97_393 | 98 |
| 1184 | 3300049777 | Ga0501281_00100 | Ga0501281_00100_1189_1485 | 98 |
| 1185 | 3300049777 | Ga0501281_11331 | Ga0501281_11331_310_606 | 98 |
| 1186 | 3300049778 | Ga0501282_000779 | Ga0501282_000779_657_953 | 98 |
| 1187 | 3300049822 | Ga0501035_0007244 | Ga0501035_0007244_3079_3375 | 98 |
| 1188 | 3300049822 | Ga0501035_0299712 | Ga0501035_0299712_538_834 | 98 |
| 1189 | 3300049822 | Ga0501035_0659817 | Ga0501035_0659817_249_545 | 98 |
| 1190 | 3300049823 | Ga0501044_0031887 | Ga0501044_0031887_981_1277 | 98 |
| 1191 | 3300049823 | Ga0501044_0186702 | Ga0501044_0186702_1269_1568 | 98 |
| 1192 | 3300049823 | Ga0501044_0348005 | Ga0501044_0348005_334_630 | 98 |
| 1193 | 3300049823 | Ga0501044_0373081 | Ga0501044_0373081_813_1109 | 98 |
| 1194 | 3300049823 | Ga0501044_0591466 | Ga0501044_0591466_14_310 | 98 |
| 1195 | 3300049823 | Ga0501044_0681022 | Ga0501044_0681022_328_627 | 98 |
| 1196 | 3300049823 | Ga0501044_0880516 | Ga0501044_0880516_314_610 | 98 |
| 1197 | 3300049824 | Ga0501045_0988261 | Ga0501045_0988261_27_323 | 98 |
| 1198 | 3300050489 | nmdc:mga03683_191052_c1 | nmdc:mga03683_191052_c1_105_401 | 98 |
| 1199 | 3300050489 | nmdc:mga03683_229_c1 | nmdc:mga03683_229_c1_12191_12487 | 98 |
| 1200 | 3300050490 | nmdc:mga03n38_19603_c1 | nmdc:mga03n38_19603_c1_355_651 | 98 |
| 1201 | 3300050491 | nmdc:mga00v17_144311_c1 | nmdc:mga00v17_144311_c1_625_921 | 98 |
| 1202 | 3300050491 | nmdc:mga00v17_150524_c1 | nmdc:mga00v17_150524_c1_1088_1384 | 98 |
| 1203 | 3300050491 | nmdc:mga00v17_166252_c1 | nmdc:mga00v17_166252_c1_415_711 | 98 |
| 1204 | 3300050492 | nmdc:mga0yw44_141365_c1 | nmdc:mga0yw44_141365_c1_216_512 | 98 |
| 1205 | 3300050493 | nmdc:mga0k408_223480_c1 | nmdc:mga0k408_223480_c1_251_547 | 98 |
| 1206 | 3300050493 | nmdc:mga0k408_29927_c1 | nmdc:mga0k408_29927_c1_294_590 | 98 |
| 1207 | 3300050493 | nmdc:mga0k408_42790_c1 | nmdc:mga0k408_42790_c1_1102_1398 | 98 |
| 1208 | 3300050493 | nmdc:mga0k408_61537_c1 | nmdc:mga0k408_61537_c1_1170_1466 | 98 |
| 1209 | 3300050493 | nmdc:mga0k408_779808_c1 | nmdc:mga0k408_779808_c1_78_374 | 98 |
| 1210 | 3300050493 | nmdc:mga0k408_88899_c1 | nmdc:mga0k408_88899_c1_327_629 | 98 |
| 1211 | 3300050494 | nmdc:mga06z11_27_c1 | nmdc:mga06z11_27_c1_37464_37760 | 98 |
| 1212 | 3300050494 | nmdc:mga06z11_646394_c1 | nmdc:mga06z11_646394_c1_242_538 | 98 |
| 1213 | 3300050494 | nmdc:mga06z11_6554_c1 | nmdc:mga06z11_6554_c1_2987_3283 | 98 |
| 1214 | 3300050495 | nmdc:mga04h51_147_c1 | nmdc:mga04h51_147_c1_10846_11142 | 98 |
| 1215 | 3300050495 | nmdc:mga04h51_4151_c1 | nmdc:mga04h51_4151_c1_1531_1827 | 98 |
| 1216 | 3300050496 | nmdc:mga07m45_33_c1 | nmdc:mga07m45_33_c1_30172_30468 | 98 |
| 1217 | 3300050496 | nmdc:mga07m45_427415_c1 | nmdc:mga07m45_427415_c1_385_681 | 98 |
| 1218 | 3300050496 | nmdc:mga07m45_471260_c1 | nmdc:mga07m45_471260_c1_358_654 | 98 |
| 1219 | 3300050496 | nmdc:mga07m45_84542_c1 | nmdc:mga07m45_84542_c1_268_564 | 98 |
| 1220 | 3300050496 | nmdc:mga07m45_90862_c1 | nmdc:mga07m45_90862_c1_519_815 | 98 |
| 1221 | 3300050507 | nmdc:mga05p37_1296370_c1 | nmdc:mga05p37_1296370_c1_102_398 | 98 |
| 1222 | 3300050511 | nmdc:mga08y16_1661375_c1 | nmdc:mga08y16_1661375_c1_251_553 | 98 |
| 1223 | 3300050516 | nmdc:mga0sz30_59743_c1 | nmdc:mga0sz30_59743_c1_972_1268 | 98 |
| 1224 | 3300050516 | nmdc:mga0sz30_9117_c1 | nmdc:mga0sz30_9117_c1_3005_3301 | 98 |
| 1225 | 3300053078 | Ga0495612_0327786 | Ga0495612_0327786_116_412 | 98 |
| 1226 | 3300053079 | Ga0500610_0000496 | Ga0500610_0000496_2308_2604 | 98 |
| 1227 | 3300053087 | Ga0500643_000004 | Ga0500643_000004_154693_154989 | 98 |
| 1228 | 3300053087 | Ga0500643_000065 | Ga0500643_000065_118579_118875 | 98 |
| 1229 | 3300053087 | Ga0500643_001584 | Ga0500643_001584_9323_9619 | 98 |
| 1230 | 3300053087 | Ga0500643_002759 | Ga0500643_002759_8133_8429 | 98 |
| 1231 | 3300053087 | Ga0500643_003367 | Ga0500643_003367_159_455 | 98 |
| 1232 | 3300053087 | Ga0500643_007933 | Ga0500643_007933_3520_3816 | 98 |
| 1233 | 3300053087 | Ga0500643_010821 | Ga0500643_010821_1845_2141 | 98 |
| 1234 | 3300053087 | Ga0500643_016304 | Ga0500643_016304_1608_1904 | 98 |
| 1235 | 3300053087 | Ga0500643_016401 | Ga0500643_016401_1738_2034 | 98 |
| 1236 | 3300053087 | Ga0500643_034447 | Ga0500643_034447_1149_1445 | 98 |
| 1237 | 3300053092 | Ga0500583_0559113 | Ga0500583_0559113_73_369 | 98 |
| 1238 | 3300053093 | Ga0500651_0289877 | Ga0500651_0289877_497_793 | 98 |
| 1239 | 3300053093 | Ga0500651_0497111 | Ga0500651_0497111_83_379 | 98 |
| 1240 | 3300053094 | Ga0500566_0002509 | Ga0500566_0002509_10241_10537 | 98 |
| 1241 | 3300053096 | Ga0500641_0093245 | Ga0500641_0093245_83_385 | 98 |
| 1242 | 3300053104 | Ga0500556_0000074 | Ga0500556_0000074_54355_54651 | 98 |
| 1243 | 3300053104 | Ga0500556_0265161 | Ga0500556_0265161_31_327 | 98 |
| 1244 | 3300053108 | Ga0500562_076918 | Ga0500562_076918_298_594 | 98 |
| 1245 | 3300053108 | Ga0500562_224004 | Ga0500562_224004_183_479 | 98 |
| 1246 | 3300053111 | Ga0500572_016593 | Ga0500572_016593_1549_1845 | 98 |
| 1247 | 3300053116 | Ga0500592_000118 | Ga0500592_000118_15598_15894 | 98 |
| 1248 | 3300053116 | Ga0500592_000393 | Ga0500592_000393_6862_7158 | 98 |
| 1249 | 3300053116 | Ga0500592_015653 | Ga0500592_015653_302_598 | 98 |
| 1250 | 3300053118 | Ga0500594_0000572 | Ga0500594_0000572_6189_6485 | 98 |
| 1251 | 3300053118 | Ga0500594_0105044 | Ga0500594_0105044_292_588 | 98 |
| 1252 | 3300053119 | Ga0500595_031857 | Ga0500595_031857_1271_1567 | 98 |
| 1253 | 3300053119 | Ga0500595_106833 | Ga0500595_106833_319_615 | 98 |
| 1254 | 3300053120 | Ga0500597_003969 | Ga0500597_003969_113_409 | 98 |
| 1255 | 3300053121 | Ga0500607_000098 | Ga0500607_000098_8663_8959 | 98 |
| 1256 | 3300053122 | Ga0500608_007974 | Ga0500608_007974_3940_4236 | 98 |
| 1257 | 3300053122 | Ga0500608_159037 | Ga0500608_159037_344_640 | 98 |
| 1258 | 3300053128 | Ga0500626_315636 | Ga0500626_315636_149_445 | 98 |
| 1259 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_541443_541739 | 98 |
| 1260 | 3300053130 | Ga0500642_0000116 | Ga0500642_0000116_20680_20976 | 98 |
| 1261 | 3300053131 | Ga0500652_179255 | Ga0500652_179255_316_612 | 98 |
| 1262 | 3300053134 | Ga0500658_0043853 | Ga0500658_0043853_872_1168 | 98 |
| 1263 | 3300053134 | Ga0500658_0091278 | Ga0500658_0091278_43_339 | 98 |
| 1264 | 3300053136 | Ga0500559_0060943 | Ga0500559_0060943_56_352 | 98 |
| 1265 | 3300053136 | Ga0500559_0065891 | Ga0500559_0065891_1169_1465 | 98 |
| 1266 | 3300053136 | Ga0500559_0130334 | Ga0500559_0130334_788_1084 | 98 |
| 1267 | 3300053136 | Ga0500559_0309131 | Ga0500559_0309131_285_581 | 98 |
| 1268 | 3300053136 | Ga0500559_0341614 | Ga0500559_0341614_13_309 | 98 |
| 1269 | 3300053136 | Ga0500559_0345425 | Ga0500559_0345425_115_429 | 98 |
| 1270 | 3300053138 | Ga0500564_192633 | Ga0500564_192633_242_538 | 98 |
| 1271 | 3300053139 | Ga0500568_0007493 | Ga0500568_0007493_1993_2289 | 98 |
| 1272 | 3300053139 | Ga0500568_0115245 | Ga0500568_0115245_59_355 | 98 |
| 1273 | 3300053139 | Ga0500568_0162151 | Ga0500568_0162151_246_542 | 98 |
| 1274 | 3300053140 | Ga0500573_0000046 | Ga0500573_0000046_73263_73559 | 98 |
| 1275 | 3300053140 | Ga0500573_0440291 | Ga0500573_0440291_66_362 | 98 |
| 1276 | 3300053142 | Ga0500577_0516699 | Ga0500577_0516699_48_344 | 98 |
| 1277 | 3300053151 | Ga0500604_0017059 | Ga0500604_0017059_1633_1929 | 98 |
| 1278 | 3300053151 | Ga0500604_0105546 | Ga0500604_0105546_220_516 | 98 |
| 1279 | 3300053151 | Ga0500604_0200470 | Ga0500604_0200470_233_529 | 98 |
| 1280 | 3300053151 | Ga0500604_0225753 | Ga0500604_0225753_279_575 | 98 |
| 1281 | 3300053151 | Ga0500604_0289952 | Ga0500604_0289952_73_369 | 98 |
| 1282 | 3300053153 | Ga0500616_0116858 | Ga0500616_0116858_130_426 | 98 |
| 1283 | 3300053154 | Ga0500619_245683 | Ga0500619_245683_72_368 | 98 |
| 1284 | 3300053154 | Ga0500619_255005 | Ga0500619_255005_119_415 | 98 |
| 1285 | 3300053156 | Ga0500622_0229706 | Ga0500622_0229706_448_747 | 98 |
| 1286 | 3300053157 | Ga0500624_000044 | Ga0500624_000044_10884_11180 | 98 |
| 1287 | 3300053157 | Ga0500624_000053 | Ga0500624_000053_15468_15764 | 98 |
| 1288 | 3300053158 | Ga0500627_0000054 | Ga0500627_0000054_10454_10750 | 98 |
| 1289 | 3300053158 | Ga0500627_0000508 | Ga0500627_0000508_9206_9502 | 98 |
| 1290 | 3300053158 | Ga0500627_0000799 | Ga0500627_0000799_5534_5830 | 98 |
| 1291 | 3300053158 | Ga0500627_0319549 | Ga0500627_0319549_117_413 | 98 |
| 1292 | 3300053158 | Ga0500627_0463127 | Ga0500627_0463127_178_474 | 98 |
| 1293 | 3300053160 | Ga0500633_0072786 | Ga0500633_0072786_347_670 | 98 |
| 1294 | 3300053177 | Ga0500636_0005811 | Ga0500636_0005811_5457_5753 | 98 |
| 1295 | 3300053178 | Ga0500637_0000008 | Ga0500637_0000008_10893_11189 | 98 |
| 1296 | 3300053727 | Ga0500611_000244 | Ga0500611_000244_4861_5157 | 98 |
| 1297 | 3300053727 | Ga0500611_128595 | Ga0500611_128595_185_481 | 98 |
| 1298 | 3300053730 | Ga0500645_000009 | Ga0500645_000009_12517_12813 | 98 |
| 1299 | 3300053730 | Ga0500645_000439 | Ga0500645_000439_1955_2251 | 98 |
| 1300 | 3300053730 | Ga0500645_002373 | Ga0500645_002373_4853_5149 | 98 |
| 1301 | 3300053730 | Ga0500645_007761 | Ga0500645_007761_2544_2840 | 98 |
| 1302 | 3300053730 | Ga0500645_184279 | Ga0500645_184279_184_480 | 98 |
| 1303 | 3300053735 | Ga0500596_013713 | Ga0500596_013713_666_962 | 98 |
| 1304 | 3300055283 | Ga0500661_071886 | Ga0500661_071886_53_349 | 98 |
| 1305 | 3300059493 | Ga0587077_030086 | Ga0587077_030086_88_384 | 98 |
| 1306 | 3300059506 | Ga0587085_045596 | Ga0587085_045596_97_393 | 98 |
| 1307 | 3300059510 | Ga0587090_000313 | Ga0587090_000313_777_1073 | 98 |
| 1308 | 3300059510 | Ga0587090_114637 | Ga0587090_114637_257_553 | 98 |
| 1309 | 3300059623 | Ga0587101_152085 | Ga0587101_152085_26_322 | 98 |
| 1310 | 3300059626 | Ga0587115_024628 | Ga0587115_024628_319_615 | 98 |
| 1311 | 3300059643 | Ga0587072_135641 | Ga0587072_135641_115_411 | 98 |
| 1312 | 3300059652 | Ga0587107_141702 | Ga0587107_141702_126_422 | 98 |
| 1313 | 3300060346 | Ga0587111_0043277 | Ga0587111_0043277_508_804 | 98 |
| 1314 | iso_pu_bacteria | 2738541275 | 2738709704 | 98 |
| 1315 | iso_pu_bacteria | 2738541301 | 2738848129 | 98 |
| 1316 | iso_pu_bacteria | 2738541304 | 2738863858 | 98 |
| 1317 | iso_pu_bacteria | 2738543022 | 2739296376 | 98 |
| 1318 | iso_pu_bacteria | 2738543033 | 2739358054 | 98 |
| 1319 | iso_pu_bacteria | 2928100450 | 2928101260 | 98 |
| 1320 | iso_pu_bacteria | 2928959182 | 2928960329 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hgk-assembly1.cif.gz_A | crystal structure of human clpp in complex with zk53 | 0.4798 | 55 | 73 |
| 1ybt-assembly1.cif.gz_B | mycobacterium tuberculosis adenylyl cyclase, rv1900c chd | 0.4596 | 52 | 76 |
| 3zdt-assembly2.cif.gz_B | crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a | 0.4576 | 2 | 54 |
| 6cb0-assembly2.cif.gz_B | crystal structure of the fak ferm domain | 0.4023 | 2 | 54 |
| 4cye-assembly1.cif.gz_A | crystal structure of avian fak ferm domain fak31-405 at 3.2a | 0.3971 | 2 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6c07B01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.6476 | 52 | 66 | 3.30.300.10 |
| 1t6eX01 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.626 | 1 | 16 | 2.40.70.10 |
| 3fjyB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.6237 | 52 | 69 | 3.40.50.1240 |
| af_O43542_77_341_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6141 | 52 | 68 | 3.40.50.300 |
| af_Q5JMK2_32_218_2.40.70.10 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.5861 | 1 | 27 | 2.40.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A430EEV2-F1-model_v4 | DUF2849 domain-containing protein | 0.9981 | 1 | 65 |
|
| AF-A0A430EEV2-F1-model_v4 | DUF2849 domain-containing protein | 0.9831 | 1 | 65 |
|
| AF-A0A7W9F0H9-F1-model_v4 | DUF2849 domain-containing protein | 0.951 | 1 | 83 |
|
| AF-A0A7X2FYH6-F1-model_v4 | DUF2849 domain-containing protein | 0.8908 | 2 | 79 |
|
| AF-A0A1G5NPN2-F1-model_v4 | DUF2849 domain-containing protein | 0.8768 | 2 | 82 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar