F492967

General Info

Members Datasets Scaffolds Average Seq Length
1320 506 1278 98

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100029853|Ga0068859_1000298536
Length 107
Sequence MGQDCGDTCVKLLTGNDLATGDVTWWTGDGWSRHVEDAVDVGAQGEAIAHTEEGARRVNAPYVIDATAAPEGPRPAHIKDRIRALGPTVRPDLTLKPADPAVGSWVI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
12 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
15 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
16 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
17 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
18 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
19 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
20 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
21 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
22 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
23 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
24 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
25 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
26 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
27 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
28 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
29 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
30 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
31 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
32 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
33 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
34 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
35 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
36 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
37 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
38 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
39 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
40 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
41 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
42 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
43 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
44 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
45 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
52 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
79 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
98 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
182 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
249 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
272 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
273 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
281 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
285 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
286 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
287 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
290 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
291 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
292 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
293 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
294 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
295 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
296 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
297 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
298 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
299 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
300 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
301 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
302 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
303 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
304 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
305 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
306 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
313 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
326 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
327 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
328 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
329 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
333 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
351 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
355 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
376 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
379 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
382 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
390 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
391 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
392 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
393 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
394 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
395 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
396 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
419 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
420 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
421 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
422 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
423 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
424 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
425 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
426 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
427 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
428 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
429 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
430 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
431 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
432 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
433 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
434 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
435 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
438 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
439 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
440 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
441 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
442 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
446 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
447 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
450 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
453 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
454 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
460 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
461 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
462 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
463 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
464 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
465 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
466 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
467 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
468 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
469 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
470 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
471 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
472 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
473 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
474 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
475 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
476 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
477 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
478 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
479 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
480 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
481 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
482 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
483 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
484 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
485 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
486 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
487 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
488 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
489 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
490 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
493 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
496 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
497 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 1.89
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 17.05
Nodule 0.15
Rhizoplane 3.48
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2770192 2162886007 Bacteria 20530
2 SwRhRL2b_contig_433849 2162886007 Bacteria 2461
3 ARcpr5yngRDRAFT_c005141 3300000043 Bacteria 1215
4 JGI24736J21556_1006519 3300001904 Bacteria 1963
5 JGI24741J21665_1001599 3300001915 Bacteria 6361
6 JGI24741J21665_1002509 3300001915 Bacteria 4747
7 JGI24740J21852_10001016 3300001979 Bacteria 12545
8 JGI24739J22299_10000602 3300001989 Bacteria 12961
9 JGI24739J22299_10007241 3300001989 Bacteria 4171
10 JGI24739J22299_10016593 3300001989 Bacteria 2664
11 JGI24737J22298_10001956 3300001990 Bacteria 7369
12 JGI24737J22298_10008892 3300001990 Bacteria 3352
13 JGI24737J22298_10014616 3300001990 Bacteria 2547
14 JGI24737J22298_10044176 3300001990 Bacteria 1363
15 JGI24735J21928_10004916 3300002067 Bacteria 4455
16 JGI24738J21930_10002190 3300002075 Bacteria 5208
17 JGI24738J21930_10016432 3300002075 Bacteria 1563
18 JGI24035J26624_1005781 3300002126 Bacteria 1187
19 JGI24751J29686_10000159 3300002459 Bacteria 32221
20 JGI24751J29686_10026087 3300002459 Bacteria 1212
21 JGI25150J39212_1000213 3300002774 Bacteria 31530
22 JGI25151J46595_10052017 3300003187 Bacteria 1381
23 JGI25165J46597_1000012 3300003214 Bacteria 421074
24 JGI25153J46596_10000016 3300003215 Bacteria 285917
25 JGI25153J46596_10000036 3300003215 Bacteria 182205
26 JGI25153J46596_10028563 3300003215 Bacteria 1931
27 JGI25160J50197_1065978 3300003354 Bacteria 705
28 Ga0055539_1039470 3300003752 Bacteria 511
29 Ga0055525_1000035 3300003759 Bacteria 300887
30 Ga0055542_1000060 3300003762 Bacteria 162275
31 Ga0055529_1000043 3300003763 Bacteria 221704
32 Ga0055526_1000948 3300003771 Bacteria 21478
33 Ga0055537_1001825 3300003773 Bacteria 7709
34 Ga0055524_1000180 3300003775 Bacteria 71495
35 Ga0055536_1000520 3300003781 Bacteria 26554
36 Ga0055536_1006261 3300003781 Bacteria 5608
37 Ga0055536_1029291 3300003781 Bacteria 1481
38 Ga0055528_1037468 3300003790 Bacteria 1140
39 Ga0055528_1046726 3300003790 Bacteria 910
40 Ga0055530_10001171 3300003791 Bacteria 20279
41 Ga0055530_10001368 3300003791 Bacteria 18071
42 Ga0055530_10007997 3300003791 Bacteria 4322
43 Ga0055530_10020941 3300003791 Bacteria 1939
44 Ga0055530_10030601 3300003791 Bacteria 1423
45 Ga0055540_1001281 3300003792 Bacteria 15301
46 Ga0055540_1005532 3300003792 Bacteria 5280
47 Ga0055531_10000161 3300003794 Bacteria 76455
48 Ga0055531_10004136 3300003794 Bacteria 8964
49 Ga0055531_10008952 3300003794 Bacteria 5182
50 Ga0055531_10011225 3300003794 Bacteria 4350
51 Ga0055543_1054170 3300004625 Bacteria 653
52 Ga0065165_1001869 3300005262 Bacteria 20423
53 Ga0065165_1004474 3300005262 Bacteria 8626
54 Ga0065165_1017219 3300005262 Bacteria 2672
55 Ga0065165_1066773 3300005262 Bacteria 967
56 Ga0065165_1097225 3300005262 Bacteria 742
57 Ga0065165_1138182 3300005262 Bacteria 578
58 Ga0065704_10001418 3300005289 Bacteria 7876
59 Ga0065704_10072077 3300005289 Bacteria 9198
60 Ga0065704_10310336 3300005289 Bacteria 869
61 Ga0065707_10023450 3300005295 Bacteria 1631
62 Ga0065707_10082272 3300005295 Bacteria 17771
63 Ga0065707_10100910 3300005295 Bacteria 2896
64 Ga0065707_10107929 3300005295 Bacteria 2532
65 Ga0065707_10193463 3300005295 Bacteria 1348
66 Ga0065707_10312100 3300005295 Bacteria 983
67 Ga0070658_10044373 3300005327 Bacteria 3593
68 Ga0070658_10064042 3300005327 Bacteria 2998
69 Ga0070658_10472506 3300005327 Bacteria 1082
70 Ga0070658_10637336 3300005327 Bacteria 924
71 Ga0070658_11043948 3300005327 Bacteria 711
72 Ga0070658_11233995 3300005327 Bacteria 650
73 Ga0070658_11417436 3300005327 Bacteria 603
74 Ga0070676_11331128 3300005328 Bacteria 549
75 Ga0070683_100147795 3300005329 Bacteria 2227
76 Ga0070670_100000003 3300005331 Bacteria 529510
77 Ga0070670_100155226 3300005331 Bacteria 1982
78 Ga0070670_100245274 3300005331 Bacteria 1560
79 Ga0070670_100864713 3300005331 Bacteria 818
80 Ga0070670_100961164 3300005331 Bacteria 776
81 Ga0070677_10024455 3300005333 Bacteria 2246
82 Ga0070677_10559906 3300005333 Bacteria 628
83 Ga0070666_10000063 3300005335 Bacteria 80378
84 Ga0070666_10322469 3300005335 Bacteria 1102
85 Ga0070666_11310846 3300005335 Bacteria 540
86 Ga0068868_100962179 3300005338 Bacteria 779
87 Ga0070660_100269472 3300005339 Bacteria 1391
88 Ga0070660_101297513 3300005339 Bacteria 618
89 Ga0070660_101775554 3300005339 Bacteria 525
90 Ga0070660_101775555 3300005339 Bacteria 525
91 Ga0070687_100234450 3300005343 Bacteria 1131
92 Ga0070661_100112568 3300005344 Bacteria 2033
93 Ga0070661_100316764 3300005344 Bacteria 1217
94 Ga0070668_100013413 3300005347 Bacteria 6116
95 Ga0070668_100027226 3300005347 Bacteria 4340
96 Ga0070668_100056776 3300005347 Bacteria 3024
97 Ga0070668_100928378 3300005347 Bacteria 779
98 Ga0070668_100936694 3300005347 Bacteria 776
99 Ga0070668_101482836 3300005347 Bacteria 620
100 Ga0070669_100000042 3300005353 Bacteria 123396
101 Ga0070669_100000044 3300005353 Bacteria 121087
102 Ga0070669_100127069 3300005353 Bacteria 1952
103 Ga0070669_100167169 3300005353 Bacteria 1713
104 Ga0070669_100252260 3300005353 Bacteria 1405
105 Ga0070669_100256143 3300005353 Bacteria 1395
106 Ga0070669_100301438 3300005353 Bacteria 1289
107 Ga0070669_100663394 3300005353 Bacteria 878
108 Ga0070669_100689710 3300005353 Bacteria 862
109 Ga0070669_100761649 3300005353 Bacteria 821
110 Ga0070669_101996165 3300005353 Bacteria 507
111 Ga0070675_100572366 3300005354 Bacteria 1023
112 Ga0070675_100862714 3300005354 Bacteria 829
113 Ga0070671_100000002 3300005355 Bacteria 292733
114 Ga0070671_100043617 3300005355 Bacteria 3727
115 Ga0070671_100060147 3300005355 Bacteria 3163
116 Ga0070674_100000171 3300005356 Bacteria 30183
117 Ga0070674_100159052 3300005356 Bacteria 1712
118 Ga0070673_100203220 3300005364 Bacteria 1707
119 Ga0070673_101271275 3300005364 Bacteria 691
120 Ga0070659_100025300 3300005366 Bacteria 4557
121 Ga0070659_100081800 3300005366 Bacteria 2579
122 Ga0070659_100695800 3300005366 Bacteria 879
123 Ga0070667_100004979 3300005367 Bacteria 11135
124 Ga0070667_100035266 3300005367 Bacteria 4190
125 Ga0070667_100243171 3300005367 Bacteria 1607
126 Ga0070667_100547652 3300005367 Bacteria 1063
127 Ga0070667_101629213 3300005367 Bacteria 607
128 Ga0070700_101157030 3300005441 Bacteria 644
129 Ga0070663_100001785 3300005455 Bacteria 11967
130 Ga0070663_100347233 3300005455 Bacteria 1200
131 Ga0070663_101253680 3300005455 Bacteria 653
132 Ga0070678_100000584 3300005456 Bacteria 17915
133 Ga0070678_100478977 3300005456 Bacteria 1095
134 Ga0070662_100009003 3300005457 Bacteria 6513
135 Ga0070662_100277877 3300005457 Bacteria 1354
136 Ga0070662_101947430 3300005457 Bacteria 508
137 Ga0070662_101971406 3300005457 Bacteria 504
138 Ga0070685_10924414 3300005466 Bacteria 650
139 Ga0070685_11049281 3300005466 Bacteria 614
140 Ga0070707_100360654 3300005468 Bacteria 1412
141 Ga0070707_100687156 3300005468 Bacteria 986
142 Ga0070698_100548793 3300005471 Bacteria 1095
143 Ga0070679_100311083 3300005530 Bacteria 1525
144 Ga0070684_100060440 3300005535 Bacteria 3315
145 Ga0070684_100361698 3300005535 Bacteria 1335
146 Ga0068853_100252410 3300005539 Bacteria 1619
147 Ga0068853_100285758 3300005539 Bacteria 1521
148 Ga0068853_100891734 3300005539 Bacteria 854
149 Ga0068853_102094991 3300005539 Bacteria 548
150 Ga0070672_100290921 3300005543 Bacteria 1383
151 Ga0070686_101391044 3300005544 Bacteria 588
152 Ga0070665_100000186 3300005548 Bacteria 110750
153 Ga0070665_100073523 3300005548 Bacteria 3424
154 Ga0070665_100482368 3300005548 Bacteria 1251
155 Ga0070665_101001609 3300005548 Bacteria 848
156 Ga0070665_101634965 3300005548 Bacteria 652
157 Ga0070665_101979966 3300005548 Bacteria 588
158 Ga0068855_100003973 3300005563 Bacteria 18060
159 Ga0068855_100014816 3300005563 Bacteria 9389
160 Ga0068855_100182464 3300005563 Bacteria 2372
161 Ga0068855_100294139 3300005563 Bacteria 1800
162 Ga0068855_100326462 3300005563 Bacteria 1695
163 Ga0068855_101226911 3300005563 Bacteria 779
164 Ga0068855_101576146 3300005563 Bacteria 672
165 Ga0068855_102132109 3300005563 Bacteria 564
166 Ga0068855_102235263 3300005563 Bacteria 548
167 Ga0070664_100375736 3300005564 Bacteria 1296
168 Ga0070664_100701946 3300005564 Bacteria 943
169 Ga0068857_100029821 3300005577 Bacteria 4814
170 Ga0068857_100031231 3300005577 Bacteria 4707
171 Ga0068857_100094013 3300005577 Bacteria 2684
172 Ga0068857_100188529 3300005577 Bacteria 1878
173 Ga0068857_100234145 3300005577 Bacteria 1680
174 Ga0068857_100440521 3300005577 Bacteria 1217
175 Ga0068857_100936628 3300005577 Bacteria 832
176 Ga0068857_101694606 3300005577 Bacteria 618
177 Ga0068857_101785867 3300005577 Bacteria 602
178 Ga0068857_102247610 3300005577 Bacteria 535
179 Ga0068854_100016369 3300005578 Bacteria 4943
180 Ga0068854_100107513 3300005578 Bacteria 2100
181 Ga0068854_101042552 3300005578 Bacteria 726
182 Ga0068854_102286787 3300005578 Bacteria 501
183 Ga0068856_100027825 3300005614 Bacteria 5515
184 Ga0068856_100447260 3300005614 Bacteria 1313
185 Ga0068856_101018113 3300005614 Bacteria 846
186 Ga0068852_100109259 3300005616 Bacteria 2511
187 Ga0068852_100910838 3300005616 Bacteria 896
188 Ga0068852_101076526 3300005616 Bacteria 824
189 Ga0068852_101451985 3300005616 Bacteria 708
190 Ga0068859_100002597 3300005617 Bacteria 18383
191 Ga0068859_100004323 3300005617 Bacteria 14490
192 Ga0068859_100011775 3300005617 Bacteria 8788
193 Ga0068859_100029853 3300005617 Bacteria 5470
194 Ga0068864_100000005 3300005618 Bacteria 400840
195 Ga0068864_100000731 3300005618 Bacteria 27480
196 Ga0068864_100010775 3300005618 Bacteria 7554
197 Ga0068864_100432511 3300005618 Bacteria 1256
198 Ga0068864_100731752 3300005618 Bacteria 968
199 Ga0068861_100000108 3300005719 Bacteria 41584
200 Ga0068861_100000148 3300005719 Bacteria 36127
201 Ga0068861_100001464 3300005719 Bacteria 14949
202 Ga0068861_101917074 3300005719 Bacteria 590
203 Ga0068851_10012072 3300005834 Bacteria 4067
204 Ga0068851_10328221 3300005834 Bacteria 885
205 Ga0068851_10328223 3300005834 Bacteria 885
206 Ga0068863_100014281 3300005841 Bacteria 7649
207 Ga0068863_100053964 3300005841 Bacteria 3809
208 Ga0068858_100000583 3300005842 Bacteria 38259
209 Ga0068858_100000588 3300005842 Bacteria 38216
210 Ga0068858_100003492 3300005842 Bacteria 15587
211 Ga0068858_100122627 3300005842 Bacteria 2432
212 Ga0068858_100238411 3300005842 Bacteria 1725
213 Ga0068860_100023270 3300005843 Bacteria 5987
214 Ga0068860_100036289 3300005843 Bacteria 4724
215 Ga0068860_100264595 3300005843 Bacteria 1677
216 Ga0068860_100785965 3300005843 Bacteria 965
217 Ga0068862_100000001 3300005844 Bacteria 523031
218 Ga0068862_100000063 3300005844 Bacteria 124662
219 Ga0068862_100007384 3300005844 Bacteria 9116
220 Ga0068862_100010294 3300005844 Bacteria 7717
221 Ga0068862_102156793 3300005844 Bacteria 568
222 Ga0081539_10076735 3300005985 Bacteria 1770
223 Ga0075365_10010903 3300006038 Bacteria 5322
224 Ga0075368_10000252 3300006042 Bacteria 15267
225 Ga0075368_10008082 3300006042 Bacteria 3735
226 Ga0075363_100011199 3300006048 Bacteria 4288
227 Ga0075363_100013169 3300006048 Bacteria 4001
228 Ga0075364_10158281 3300006051 Bacteria 1528
229 Ga0075364_10391812 3300006051 Bacteria 948
230 Ga0075362_10031948 3300006177 Bacteria 2281
231 Ga0075362_10045995 3300006177 Bacteria 1940
232 Ga0075367_10000054 3300006178 Bacteria 27401
233 Ga0075367_10081583 3300006178 Bacteria 1957
234 Ga0075369_10041542 3300006186 Bacteria 1969
235 Ga0075369_10099471 3300006186 Bacteria 1304
236 Ga0075369_10137443 3300006186 Bacteria 1113
237 Ga0075366_10022732 3300006195 Bacteria 3651
238 Ga0075366_10061991 3300006195 Bacteria 2223
239 Ga0075366_10090192 3300006195 Bacteria 1836
240 Ga0075366_10132441 3300006195 Bacteria 1505
241 Ga0075366_10167482 3300006195 Bacteria 1333
242 Ga0075366_10353807 3300006195 Bacteria 902
243 Ga0075366_10501124 3300006195 Bacteria 751
244 Ga0075366_10537137 3300006195 Bacteria 724
245 Ga0097621_100144109 3300006237 Bacteria 2038
246 Ga0075370_10057920 3300006353 Bacteria 2203
247 Ga0075370_10074920 3300006353 Bacteria 1940
248 Ga0075370_10075998 3300006353 Bacteria 1926
249 Ga0075370_10092517 3300006353 Bacteria 1745
250 Ga0075370_10154405 3300006353 Bacteria 1346
251 Ga0075370_10665590 3300006353 Bacteria 632
252 Ga0068871_100016843 3300006358 Bacteria 5516
253 Ga0068871_100121930 3300006358 Bacteria 2203
254 Ga0068871_101057055 3300006358 Bacteria 758
255 Ga0068865_101884820 3300006881 Bacteria 541
256 Ga0097620_100002597 3300006931 Bacteria 18383
257 Ga0097620_100004323 3300006931 Bacteria 14490
258 Ga0097620_100011775 3300006931 Bacteria 8788
259 Ga0097620_100029854 3300006931 Bacteria 5470
260 Ga0079104_1031866 3300006946 Bacteria 1304
261 Ga0079104_1087498 3300006946 Bacteria 635
262 Ga0105251_10033437 3300009011 Bacteria 2553
263 Ga0105251_10402660 3300009011 Bacteria 629
264 Ga0105240_10000959 3300009093 Bacteria 51453
265 Ga0105240_10043982 3300009093 Bacteria 5679
266 Ga0105240_10229460 3300009093 Bacteria 2159
267 Ga0105240_10296092 3300009093 Bacteria 1853
268 Ga0111539_10440332 3300009094 Bacteria 1517
269 Ga0111539_11333045 3300009094 Bacteria 833
270 Ga0105245_10001709 3300009098 Bacteria 20004
271 Ga0105247_10001115 3300009101 Bacteria 20007
272 Ga0105247_10044573 3300009101 Bacteria 2721
273 Ga0114129_10128044 3300009147 Bacteria 3490
274 Ga0105243_10000122 3300009148 Bacteria 89527
275 Ga0105243_10309260 3300009148 Bacteria 1435
276 Ga0105243_11425044 3300009148 Bacteria 714
277 Ga0105241_10002257 3300009174 Bacteria 14478
278 Ga0105241_10002409 3300009174 Bacteria 14050
279 Ga0105241_10466667 3300009174 Bacteria 1120
280 Ga0105241_10948388 3300009174 Bacteria 802
281 Ga0105248_10000287 3300009177 Bacteria 59537
282 Ga0105248_10007934 3300009177 Bacteria 11668
283 Ga0105248_10016133 3300009177 Bacteria 8219
284 Ga0105248_10019155 3300009177 Bacteria 7571
285 Ga0105248_10025995 3300009177 Bacteria 6512
286 Ga0105248_10044942 3300009177 Bacteria 4953
287 Ga0105248_10180454 3300009177 Bacteria 2379
288 Ga0105248_11732468 3300009177 Bacteria 708
289 Ga0105237_10001281 3300009545 Bacteria 33535
290 Ga0105237_10007067 3300009545 Bacteria 12344
291 Ga0105237_10016910 3300009545 Bacteria 7569
292 Ga0105237_12136474 3300009545 Bacteria 569
293 Ga0105238_10172228 3300009551 Bacteria 2141
294 Ga0105238_10193883 3300009551 Bacteria 2007
295 Ga0105238_10317298 3300009551 Bacteria 1544
296 Ga0105238_11229716 3300009551 Bacteria 774
297 Ga0105238_12735462 3300009551 Bacteria 530
298 Ga0105249_10008807 3300009553 Bacteria 8809
299 Ga0105249_10091346 3300009553 Bacteria 2848
300 Ga0105249_10458298 3300009553 Bacteria 1315
301 Ga0105249_10485665 3300009553 Bacteria 1279
302 Ga0105249_11436545 3300009553 Bacteria 762
303 Ga0105148_100027 3300009978 Bacteria 21393
304 Ga0105239_10000156 3300010375 Bacteria 98400
305 Ga0105239_10007208 3300010375 Bacteria 12776
306 Ga0105239_10232710 3300010375 Bacteria 2067
307 Ga0105239_11127209 3300010375 Bacteria 903
308 Ga0105239_11149125 3300010375 Bacteria 894
309 Ga0105239_11265648 3300010375 Bacteria 851
310 Ga0105239_11314522 3300010375 Bacteria 834
311 Ga0105246_10000632 3300011119 Bacteria 19638
312 Ga0105246_10479629 3300011119 Bacteria 1052
313 Ga0157373_10024990 3300013100 Bacteria 4324
314 Ga0157373_10047725 3300013100 Bacteria 3054
315 Ga0157373_10128467 3300013100 Bacteria 1782
316 Ga0157373_10341584 3300013100 Bacteria 1067
317 Ga0157373_10464031 3300013100 Bacteria 912
318 Ga0157373_10732326 3300013100 Bacteria 726
319 Ga0157371_10000030 3300013102 Bacteria 241585
320 Ga0157371_10061175 3300013102 Bacteria 2670
321 Ga0157371_10128777 3300013102 Bacteria 1800
322 Ga0157371_10532220 3300013102 Bacteria 870
323 Ga0157370_10008634 3300013104 Bacteria 10966
324 Ga0157370_10302970 3300013104 Bacteria 1475
325 Ga0157370_10440254 3300013104 Bacteria 1199
326 Ga0157370_11141427 3300013104 Bacteria 704
327 Ga0157370_11346144 3300013104 Bacteria 643
328 Ga0157370_11783019 3300013104 Bacteria 552
329 Ga0157369_10241631 3300013105 Bacteria 1886
330 Ga0157369_10321648 3300013105 Bacteria 1608
331 Ga0157369_10800289 3300013105 Bacteria 968
332 Ga0157369_10990585 3300013105 Bacteria 861
333 Ga0157374_10110705 3300013296 Bacteria 2641
334 Ga0157374_11535133 3300013296 Bacteria 689
335 Ga0157378_10018055 3300013297 Bacteria 6195
336 Ga0157378_10021666 3300013297 Bacteria 5650
337 Ga0157378_10590595 3300013297 Bacteria 1120
338 Ga0157378_10755571 3300013297 Bacteria 995
339 Ga0157378_12278574 3300013297 Bacteria 593
340 Ga0163162_10003776 3300013306 Bacteria 14517
341 Ga0163162_10018196 3300013306 Bacteria 6881
342 Ga0163162_10037626 3300013306 Bacteria 4829
343 Ga0163162_10283936 3300013306 Bacteria 1787
344 Ga0163162_10437876 3300013306 Bacteria 1439
345 Ga0163162_10700924 3300013306 Bacteria 1134
346 Ga0163162_10829236 3300013306 Bacteria 1041
347 Ga0163162_11273318 3300013306 Bacteria 835
348 Ga0157372_10532860 3300013307 Bacteria 1369
349 Ga0157372_10588635 3300013307 Bacteria 1297
350 Ga0157372_11515622 3300013307 Bacteria 772
351 Ga0157372_11851521 3300013307 Bacteria 694
352 Ga0157375_10149491 3300013308 Bacteria 2470
353 Ga0157375_10745285 3300013308 Bacteria 1131
354 Ga0157375_10815281 3300013308 Bacteria 1081
355 Ga0157375_11299390 3300013308 Bacteria 855
356 Ga0157375_13309586 3300013308 Bacteria 537
357 Ga0163163_10015793 3300014325 Bacteria 6993
358 Ga0163163_10026383 3300014325 Bacteria 5552
359 Ga0163163_10340374 3300014325 Bacteria 1555
360 Ga0163163_11174288 3300014325 Bacteria 830
361 Ga0157380_10000673 3300014326 Bacteria 21168
362 Ga0157380_10000755 3300014326 Bacteria 20159
363 Ga0157380_10077149 3300014326 Bacteria 2714
364 Ga0157380_10079466 3300014326 Bacteria 2679
365 Ga0157380_10335578 3300014326 Bacteria 1408
366 Ga0157380_10351677 3300014326 Bacteria 1379
367 Ga0157380_11368554 3300014326 Bacteria 757
368 Ga0157377_11451075 3300014745 Bacteria 543
369 Ga0157379_10093716 3300014968 Bacteria 2694
370 Ga0157379_11099376 3300014968 Bacteria 761
371 Ga0157376_10239100 3300014969 Bacteria 1691
372 Ga0183363_1005 3300015690 Bacteria 403020
373 Ga0163161_10001996 3300017792 Bacteria 14773
374 Ga0163161_10033177 3300017792 Bacteria 3689
375 Ga0163161_10034292 3300017792 Bacteria 3630
376 Ga0163161_10222252 3300017792 Bacteria 1463
377 Ga0163161_10421299 3300017792 Bacteria 1074
378 Ga0163161_11343277 3300017792 Bacteria 623
379 Ga0163161_11518759 3300017792 Bacteria 588
380 Ga0163161_11979300 3300017792 Bacteria 518
381 Ga0197907_11373989 3300020069 Bacteria 643
382 Ga0206356_10423289 3300020070 Bacteria 1109
383 Ga0206351_10390730 3300020077 Bacteria 639
384 Ga0206353_10505260 3300020082 Bacteria 729
385 Ga0206353_10958977 3300020082 Bacteria 672
386 Ga0213874_10433940 3300021377 Bacteria 516
387 Ga0213876_10314389 3300021384 Bacteria 833
388 Ga0213875_10000229 3300021388 Bacteria 56654
389 Ga0224712_10056485 3300022467 Bacteria 1548
390 Ga0209674_104916 3300025226 Bacteria 2076
391 Ga0209147_100491 3300025229 Bacteria 23505
392 Ga0209563_100047 3300025230 Bacteria 366620
393 Ga0207425_1000037 3300025245 Bacteria 224645
394 Ga0209646_1004404 3300025246 Bacteria 2570
395 Ga0209026_1005891 3300025250 Bacteria 3151
396 Ga0209026_1041594 3300025250 Bacteria 665
397 Ga0209677_104802 3300025253 Bacteria 3747
398 Ga0209148_1000017 3300025254 Bacteria 787064
399 Ga0209129_1000363 3300025258 Bacteria 37614
400 Ga0209233_1000058 3300025261 Bacteria 421872
401 Ga0209565_1000012 3300025263 Bacteria 606500
402 Ga0209565_1000427 3300025263 Bacteria 34040
403 Ga0209565_1067009 3300025263 Bacteria 612
404 Ga0209455_1000005 3300025272 Bacteria 1416756
405 Ga0209673_1029026 3300025273 Bacteria 1768
406 Ga0209673_1045116 3300025273 Bacteria 1214
407 Ga0209675_1000097 3300025291 Bacteria 131546
408 Ga0209675_1023972 3300025291 Bacteria 1568
409 Ga0209676_1000060 3300025292 Bacteria 338238
410 Ga0209676_1000175 3300025292 Bacteria 153258
411 Ga0209676_1000298 3300025292 Bacteria 100554
412 Ga0209676_1002287 3300025292 Bacteria 13986
413 Ga0209676_1021394 3300025292 Bacteria 2174
414 Ga0209025_1000117 3300025294 Bacteria 215073
415 Ga0209025_1028779 3300025294 Bacteria 2710
416 Ga0209564_1003622 3300025295 Bacteria 10279
417 Ga0209564_1005290 3300025295 Bacteria 7438
418 Ga0209758_1000035 3300025297 Bacteria 448190
419 Ga0209758_1000103 3300025297 Bacteria 223968
420 Ga0209758_1041032 3300025297 Bacteria 1736
421 Ga0209050_1000001 3300025298 Bacteria 3563507
422 Ga0209050_1000014 3300025298 Bacteria 774327
423 Ga0209050_1001389 3300025298 Bacteria 26337
424 Ga0209050_1002628 3300025298 Bacteria 14768
425 Ga0209050_1004951 3300025298 Bacteria 8681
426 Ga0209050_1006341 3300025298 Bacteria 7038
427 Ga0209050_1014852 3300025298 Bacteria 3320
428 Ga0209050_1014985 3300025298 Bacteria 3292
429 Ga0209256_1000012 3300025299 Bacteria 790371
430 Ga0207426_1048373 3300025302 Bacteria 1278
431 Ga0209051_1003509 3300025303 Bacteria 10253
432 Ga0209257_1000019 3300025304 Bacteria 774261
433 Ga0209257_1000174 3300025304 Bacteria 165255
434 Ga0209257_1005036 3300025304 Bacteria 9613
435 Ga0209257_1005111 3300025304 Bacteria 9510
436 Ga0209257_1011340 3300025304 Bacteria 4307
437 Ga0209257_1015537 3300025304 Bacteria 3159
438 Ga0209257_1027653 3300025304 Bacteria 1885
439 Ga0209257_1077966 3300025304 Bacteria 857
440 Ga0207697_10000130 3300025315 Bacteria 36265
441 Ga0207697_10116410 3300025315 Bacteria 1148
442 Ga0207656_10018806 3300025321 Bacteria 2724
443 Ga0207656_10228920 3300025321 Bacteria 905
444 Ga0207713_1233720 3300025735 Bacteria 548
445 Ga0207682_10154897 3300025893 Bacteria 1035
446 Ga0207682_10184515 3300025893 Bacteria 954
447 Ga0207710_10009801 3300025900 Bacteria 4027
448 Ga0207710_10034124 3300025900 Bacteria 2234
449 Ga0207710_10243809 3300025900 Bacteria 897
450 Ga0207688_10018544 3300025901 Bacteria 3786
451 Ga0207688_10297330 3300025901 Bacteria 986
452 Ga0207680_10000033 3300025903 Bacteria 77177
453 Ga0207680_10159744 3300025903 Bacteria 1510
454 Ga0207680_10258292 3300025903 Bacteria 1205
455 Ga0207647_10008063 3300025904 Bacteria 7573
456 Ga0207647_10034522 3300025904 Bacteria 3228
457 Ga0207705_10000163 3300025909 Bacteria 71674
458 Ga0207705_10052748 3300025909 Bacteria 2929
459 Ga0207705_10206861 3300025909 Bacteria 1488
460 Ga0207705_10455676 3300025909 Bacteria 992
461 Ga0207705_10929522 3300025909 Bacteria 673
462 Ga0207654_10000852 3300025911 Bacteria 16833
463 Ga0207654_10340074 3300025911 Bacteria 1031
464 Ga0207695_10000521 3300025913 Bacteria 81496
465 Ga0207695_10015077 3300025913 Bacteria 9118
466 Ga0207695_10294189 3300025913 Bacteria 1516
467 Ga0207695_10737600 3300025913 Bacteria 865
468 Ga0207671_10000607 3300025914 Bacteria 47542
469 Ga0207671_10003706 3300025914 Bacteria 15059
470 Ga0207671_10046407 3300025914 Bacteria 3214
471 Ga0207671_10116984 3300025914 Bacteria 2034
472 Ga0207662_10296928 3300025918 Bacteria 1073
473 Ga0207657_10023497 3300025919 Bacteria 5739
474 Ga0207657_10124830 3300025919 Bacteria 2115
475 Ga0207657_10280892 3300025919 Bacteria 1322
476 Ga0207649_10000199 3300025920 Bacteria 49941
477 Ga0207649_10676515 3300025920 Bacteria 799
478 Ga0207652_10296559 3300025921 Bacteria 1459
479 Ga0207646_10380072 3300025922 Bacteria 1276
480 Ga0207646_10415378 3300025922 Bacteria 1215
481 Ga0207681_10000002 3300025923 Bacteria 985597
482 Ga0207681_10000041 3300025923 Bacteria 140201
483 Ga0207681_10045969 3300025923 Bacteria 2935
484 Ga0207681_10142103 3300025923 Bacteria 1789
485 Ga0207681_10177893 3300025923 Bacteria 1618
486 Ga0207681_10342918 3300025923 Bacteria 1194
487 Ga0207681_10491650 3300025923 Bacteria 1003
488 Ga0207681_10590246 3300025923 Bacteria 917
489 Ga0207681_11172944 3300025923 Bacteria 645
490 Ga0207681_11853343 3300025923 Bacteria 503
491 Ga0207694_10049988 3300025924 Bacteria 3237
492 Ga0207694_10078972 3300025924 Bacteria 2580
493 Ga0207694_10115061 3300025924 Bacteria 2142
494 Ga0207694_10161421 3300025924 Bacteria 1810
495 Ga0207650_10000004 3300025925 Bacteria 743372
496 Ga0207650_10018754 3300025925 Bacteria 4859
497 Ga0207650_10199865 3300025925 Bacteria 1601
498 Ga0207650_10230377 3300025925 Bacteria 1494
499 Ga0207659_10121130 3300025926 Bacteria 2005
500 Ga0207659_10678981 3300025926 Bacteria 881
501 Ga0207659_11038005 3300025926 Bacteria 705
502 Ga0207687_10009517 3300025927 Bacteria 6355
503 Ga0207644_10000002 3300025931 Bacteria 942221
504 Ga0207644_10026502 3300025931 Bacteria 3995
505 Ga0207690_10003817 3300025932 Bacteria 8918
506 Ga0207690_10045855 3300025932 Bacteria 2891
507 Ga0207690_10838160 3300025932 Bacteria 761
508 Ga0207706_10007087 3300025933 Bacteria 10368
509 Ga0207706_10017165 3300025933 Bacteria 6527
510 Ga0207706_10062160 3300025933 Bacteria 3289
511 Ga0207706_10529829 3300025933 Bacteria 1015
512 Ga0207706_10622765 3300025933 Bacteria 926
513 Ga0207706_11109105 3300025933 Bacteria 661
514 Ga0207686_11066050 3300025934 Bacteria 658
515 Ga0207709_10000083 3300025935 Bacteria 163025
516 Ga0207709_10144276 3300025935 Bacteria 1640
517 Ga0207709_10187733 3300025935 Bacteria 1465
518 Ga0207669_10000071 3300025937 Bacteria 51781
519 Ga0207669_10004349 3300025937 Bacteria 6222
520 Ga0207669_10647147 3300025937 Bacteria 864
521 Ga0207704_11659004 3300025938 Bacteria 549
522 Ga0207691_10217130 3300025940 Bacteria 1659
523 Ga0207711_10000480 3300025941 Bacteria 41229
524 Ga0207711_10017203 3300025941 Bacteria 6009
525 Ga0207711_10074305 3300025941 Bacteria 2956
526 Ga0207711_10087405 3300025941 Bacteria 2735
527 Ga0207711_10850183 3300025941 Bacteria 849
528 Ga0207689_10571751 3300025942 Bacteria 950
529 Ga0207661_10346723 3300025944 Bacteria 1339
530 Ga0207679_10114674 3300025945 Bacteria 2134
531 Ga0207679_10741231 3300025945 Bacteria 893
532 Ga0207679_11315222 3300025945 Bacteria 663
533 Ga0207667_10000004 3300025949 Bacteria 737718
534 Ga0207667_10001602 3300025949 Bacteria 28438
535 Ga0207667_10204288 3300025949 Bacteria 2026
536 Ga0207667_10451985 3300025949 Bacteria 1305
537 Ga0207667_10480450 3300025949 Bacteria 1261
538 Ga0207667_10665358 3300025949 Bacteria 1046
539 Ga0207667_11415234 3300025949 Bacteria 668
540 Ga0207651_10210381 3300025960 Bacteria 1565
541 Ga0207651_10370198 3300025960 Bacteria 1212
542 Ga0207651_10837605 3300025960 Bacteria 817
543 Ga0207712_10000069 3300025961 Bacteria 127318
544 Ga0207712_10001860 3300025961 Bacteria 13872
545 Ga0207712_10290754 3300025961 Bacteria 1337
546 Ga0207712_11093568 3300025961 Bacteria 709
547 Ga0207668_10001038 3300025972 Bacteria 16583
548 Ga0207668_10018151 3300025972 Bacteria 4420
549 Ga0207668_10041472 3300025972 Bacteria 3111
550 Ga0207668_10101044 3300025972 Bacteria 2143
551 Ga0207668_10369505 3300025972 Bacteria 1204
552 Ga0207668_10753815 3300025972 Bacteria 859
553 Ga0207668_11094158 3300025972 Bacteria 714
554 Ga0207668_11132687 3300025972 Bacteria 702
555 Ga0207640_10007619 3300025981 Bacteria 5976
556 Ga0207640_10011830 3300025981 Bacteria 4953
557 Ga0207640_10021447 3300025981 Bacteria 3850
558 Ga0207640_10028310 3300025981 Bacteria 3425
559 Ga0207640_10057450 3300025981 Bacteria 2559
560 Ga0207640_10688311 3300025981 Bacteria 875
561 Ga0207658_10009452 3300025986 Bacteria 6613
562 Ga0207658_10017969 3300025986 Bacteria 4874
563 Ga0207658_10183878 3300025986 Bacteria 1732
564 Ga0207658_10871864 3300025986 Bacteria 819
565 Ga0207658_11092955 3300025986 Bacteria 728
566 Ga0207658_11310604 3300025986 Bacteria 662
567 Ga0207677_11937663 3300026023 Bacteria 548
568 Ga0207703_10000715 3300026035 Bacteria 32705
569 Ga0207703_10001509 3300026035 Bacteria 21208
570 Ga0207703_10006058 3300026035 Bacteria 9671
571 Ga0207703_10135086 3300026035 Bacteria 2134
572 Ga0207703_10157722 3300026035 Bacteria 1985
573 Ga0207639_10000138 3300026041 Bacteria 54326
574 Ga0207639_10000414 3300026041 Bacteria 29581
575 Ga0207639_10000510 3300026041 Bacteria 26910
576 Ga0207639_10000631 3300026041 Bacteria 24265
577 Ga0207639_10011189 3300026041 Bacteria 6225
578 Ga0207639_10164033 3300026041 Bacteria 1875
579 Ga0207639_10227672 3300026041 Bacteria 1614
580 Ga0207678_10002459 3300026067 Bacteria 16827
581 Ga0207678_10003700 3300026067 Bacteria 13745
582 Ga0207702_10003043 3300026078 Bacteria 15581
583 Ga0207702_10531268 3300026078 Bacteria 1149
584 Ga0207641_10019831 3300026088 Bacteria 5518
585 Ga0207641_10041729 3300026088 Bacteria 3846
586 Ga0207676_10000006 3300026095 Bacteria 681936
587 Ga0207676_10000691 3300026095 Bacteria 26590
588 Ga0207676_10000705 3300026095 Bacteria 26301
589 Ga0207676_12156681 3300026095 Bacteria 555
590 Ga0207674_10006416 3300026116 Bacteria 13835
591 Ga0207674_10010631 3300026116 Bacteria 10407
592 Ga0207674_10036911 3300026116 Bacteria 5086
593 Ga0207674_10041762 3300026116 Bacteria 4741
594 Ga0207674_10297659 3300026116 Bacteria 1562
595 Ga0207674_10393357 3300026116 Bacteria 1340
596 Ga0207674_10514476 3300026116 Bacteria 1156
597 Ga0207674_12237726 3300026116 Bacteria 509
598 Ga0207675_100000309 3300026118 Bacteria 46765
599 Ga0207675_100000355 3300026118 Bacteria 43840
600 Ga0207675_100000400 3300026118 Bacteria 41588
601 Ga0207675_102505765 3300026118 Bacteria 527
602 Ga0207683_10001740 3300026121 Bacteria 19350
603 Ga0207683_10411708 3300026121 Bacteria 1244
604 Ga0207698_10001107 3300026142 Bacteria 15705
605 Ga0207698_10089829 3300026142 Bacteria 2511
606 Ga0207698_10491433 3300026142 Bacteria 1192
607 Ga0207698_10540719 3300026142 Bacteria 1140
608 Ga0207698_11077887 3300026142 Bacteria 816
609 Ga0207698_11787572 3300026142 Bacteria 630
610 Ga0209983_1024418 3300027665 Bacteria 1272
611 Ga0209813_10000063 3300027866 Bacteria 43741
612 Ga0209813_10002858 3300027866 Bacteria 3997
613 Ga0209974_10001093 3300027876 Bacteria 9608
614 Ga0209974_10012498 3300027876 Bacteria 2838
615 Ga0209974_10276072 3300027876 Bacteria 638
616 Ga0207428_11112655 3300027907 Bacteria 552
617 Ga0268266_10000002 3300028379 Bacteria 3059047
618 Ga0268266_10054091 3300028379 Bacteria 3450
619 Ga0268266_10456578 3300028379 Bacteria 1215
620 Ga0268266_10895661 3300028379 Bacteria 858
621 Ga0268266_11037509 3300028379 Bacteria 793
622 Ga0268266_11142570 3300028379 Bacteria 753
623 Ga0268265_10000001 3300028380 Bacteria 1230727
624 Ga0268265_10000055 3300028380 Bacteria 158947
625 Ga0268265_10000361 3300028380 Bacteria 49182
626 Ga0268265_10213788 3300028380 Bacteria 1682
627 Ga0268264_10000116 3300028381 Bacteria 198591
628 Ga0268264_10000381 3300028381 Bacteria 64651
629 Ga0307517_10065328 3300028786 Bacteria 3368
630 Ga0307517_10361308 3300028786 Bacteria 784
631 Ga0307515_10264001 3300028794 Bacteria 1453
632 Ga0307513_10010089 3300031456 Bacteria 11892
633 Ga0307513_10015055 3300031456 Bacteria 9388
634 Ga0307408_100044971 3300031548 Bacteria 3150
635 Ga0307408_100070707 3300031548 Bacteria 2577
636 Ga0307408_100084371 3300031548 Bacteria 2383
637 Ga0307408_100204844 3300031548 Bacteria 1599
638 Ga0307408_100250903 3300031548 Bacteria 1459
639 Ga0307408_100404388 3300031548 Bacteria 1173
640 Ga0307408_100431046 3300031548 Bacteria 1139
641 Ga0307408_100980300 3300031548 Bacteria 778
642 Ga0307408_101049808 3300031548 Bacteria 753
643 Ga0307408_102039583 3300031548 Bacteria 552
644 Ga0307508_10005365 3300031616 Bacteria 12204
645 Ga0307405_10004910 3300031731 Bacteria 6384
646 Ga0307405_10009565 3300031731 Bacteria 4975
647 Ga0307405_10082731 3300031731 Bacteria 2102
648 Ga0307405_10370699 3300031731 Bacteria 1111
649 Ga0307405_10762230 3300031731 Bacteria 807
650 Ga0307405_11050431 3300031731 Bacteria 697
651 Ga0307405_11133832 3300031731 Bacteria 673
652 Ga0316577_10092435 3300031733 Bacteria 1694
653 Ga0307413_10044933 3300031824 Bacteria 2614
654 Ga0307413_10073468 3300031824 Bacteria 2162
655 Ga0307413_10084823 3300031824 Bacteria 2043
656 Ga0307413_10103732 3300031824 Bacteria 1886
657 Ga0307413_10146455 3300031824 Bacteria 1640
658 Ga0307413_10169563 3300031824 Bacteria 1543
659 Ga0307413_10393412 3300031824 Bacteria 1084
660 Ga0307413_10605513 3300031824 Bacteria 897
661 Ga0307413_10697101 3300031824 Bacteria 843
662 Ga0307413_10844256 3300031824 Bacteria 773
663 Ga0307413_10963448 3300031824 Bacteria 729
664 Ga0307413_11554865 3300031824 Bacteria 586
665 Ga0307413_12103167 3300031824 Bacteria 510
666 Ga0307410_10190435 3300031852 Bacteria 1559
667 Ga0307410_10204849 3300031852 Bacteria 1508
668 Ga0307410_11037292 3300031852 Bacteria 708
669 Ga0307410_11175373 3300031852 Bacteria 667
670 Ga0307410_12043752 3300031852 Bacteria 512
671 Ga0307406_10002286 3300031901 Bacteria 10426
672 Ga0307406_10051820 3300031901 Bacteria 2607
673 Ga0307406_10328878 3300031901 Bacteria 1185
674 Ga0307406_10395285 3300031901 Bacteria 1094
675 Ga0307406_10496583 3300031901 Bacteria 988
676 Ga0307406_10686566 3300031901 Bacteria 853
677 Ga0307406_10862838 3300031901 Bacteria 768
678 Ga0307407_10044269 3300031903 Bacteria 2507
679 Ga0307407_10625440 3300031903 Bacteria 804
680 Ga0307412_10000950 3300031911 Bacteria 16577
681 Ga0307412_10002858 3300031911 Bacteria 9580
682 Ga0307412_10013155 3300031911 Bacteria 4843
683 Ga0307412_10035518 3300031911 Bacteria 3185
684 Ga0307412_10035799 3300031911 Bacteria 3174
685 Ga0307412_10062673 3300031911 Bacteria 2505
686 Ga0307412_10065616 3300031911 Bacteria 2457
687 Ga0307412_10071061 3300031911 Bacteria 2375
688 Ga0307412_10135036 3300031911 Bacteria 1798
689 Ga0307412_10181563 3300031911 Bacteria 1583
690 Ga0307412_10276572 3300031911 Bacteria 1316
691 Ga0307412_10279333 3300031911 Bacteria 1310
692 Ga0307412_10983596 3300031911 Bacteria 744
693 Ga0307412_11030838 3300031911 Bacteria 728
694 Ga0307412_11448082 3300031911 Bacteria 623
695 Ga0307412_11595562 3300031911 Bacteria 596
696 Ga0307409_100099251 3300031995 Bacteria 2411
697 Ga0307409_100124850 3300031995 Bacteria 2187
698 Ga0307409_100359727 3300031995 Bacteria 1376
699 Ga0307409_101075659 3300031995 Bacteria 825
700 Ga0307409_101395479 3300031995 Bacteria 727
701 Ga0307409_102251672 3300031995 Bacteria 574
702 Ga0307416_100014228 3300032002 Bacteria 5442
703 Ga0307416_100078949 3300032002 Bacteria 2772
704 Ga0307416_100195156 3300032002 Bacteria 1914
705 Ga0307416_100297322 3300032002 Bacteria 1602
706 Ga0307416_100595634 3300032002 Bacteria 1184
707 Ga0307416_101202531 3300032002 Bacteria 863
708 Ga0307416_101251196 3300032002 Bacteria 848
709 Ga0307414_10000402 3300032004 Bacteria 23465
710 Ga0307414_10001891 3300032004 Bacteria 10819
711 Ga0307414_10018465 3300032004 Bacteria 4295
712 Ga0307414_10038219 3300032004 Bacteria 3221
713 Ga0307414_10078400 3300032004 Bacteria 2408
714 Ga0307414_10121142 3300032004 Bacteria 2011
715 Ga0307414_10244896 3300032004 Bacteria 1486
716 Ga0307414_10273465 3300032004 Bacteria 1416
717 Ga0307414_10445182 3300032004 Bacteria 1135
718 Ga0307414_10472269 3300032004 Bacteria 1104
719 Ga0307414_10517500 3300032004 Bacteria 1058
720 Ga0307414_10654838 3300032004 Bacteria 947
721 Ga0307414_10673272 3300032004 Bacteria 934
722 Ga0307414_10903635 3300032004 Bacteria 810
723 Ga0307414_10966679 3300032004 Bacteria 783
724 Ga0307414_11186195 3300032004 Bacteria 707
725 Ga0307414_11259150 3300032004 Bacteria 686
726 Ga0307414_11323529 3300032004 Bacteria 669
727 Ga0307414_11449077 3300032004 Bacteria 638
728 Ga0307414_11569562 3300032004 Bacteria 613
729 Ga0307414_11697238 3300032004 Bacteria 589
730 Ga0307411_10301428 3300032005 Bacteria 1285
731 Ga0307411_10321106 3300032005 Bacteria 1250
732 Ga0307411_11142703 3300032005 Bacteria 704
733 Ga0307411_11252254 3300032005 Bacteria 674
734 Ga0307411_11273438 3300032005 Bacteria 669
735 Ga0307415_100098837 3300032126 Bacteria 2134
736 Ga0307415_101747886 3300032126 Bacteria 601
737 Ga0307415_102171547 3300032126 Bacteria 543
738 Ga0307510_10009662 3300033180 Bacteria 11493
739 Ga0316574_0706846 3300035398 Bacteria 618
740 Ga0316584_0510960 3300036712 Bacteria 843
741 Ga0395899_0178310 3300037312 Bacteria 1493
742 Ga0436364_0530420 3300037853 Bacteria 132998
743 Ga0436364_0928985 3300037853 Bacteria 2245
744 Ga0395901_0108157 3300038443 Bacteria 2919
745 Ga0395901_0205414 3300038443 Bacteria 2064
746 Ga0237819_00832 3300038705 Bacteria 9739
747 Ga0436365_0255801 3300039437 Bacteria 716
748 Ga0436365_0375564 3300039437 Bacteria 3278
749 Ga0436365_0571419 3300039437 Bacteria 1010
750 Ga0436365_1490641 3300039437 Bacteria 1165
751 Ga0436363_0495682 3300039450 Bacteria 843
752 Ga0436363_1680954 3300039450 Bacteria 714
753 Ga0439436_0018761 3300041404 Bacteria 2068
754 Ga0439436_0137832 3300041404 Bacteria 685
755 Ga0439461_0000282 3300041410 Bacteria 7317
756 Ga0439461_0140690 3300041410 Bacteria 617
757 Ga0439466_0065719 3300041411 Bacteria 1162
758 Ga0439465_0004149 3300041413 Bacteria 4715
759 Ga0451789_1323950 3300041443 Bacteria 620
760 Ga0451791_0004095 3300041451 Bacteria 569
761 Ga0451791_1323816 3300041451 Bacteria 839
762 Ga0451791_1781184 3300041451 Bacteria 611
763 Ga0451802_1880086 3300041460 Bacteria 675
764 Ga0451804_1088671 3300041463 Bacteria 692
765 Ga0451807_0190259 3300041486 Bacteria 571
766 Ga0451807_0329435 3300041486 Bacteria 532
767 Ga0451833_0606967 3300041491 Bacteria 636
768 Ga0451837_1233901 3300041494 Bacteria 1070
769 Ga0451841_0204279 3300041498 Bacteria 554
770 Ga0451841_0601808 3300041498 Bacteria 501
771 Ga0451843_0273453 3300041509 Bacteria 856
772 Ga0451843_0328850 3300041509 Bacteria 553
773 Ga0451855_1280009 3300041511 Bacteria 665
774 Ga0451853_1666297 3300041512 Bacteria 1002
775 Ga0439431_0065349 3300041997 Bacteria 962
776 Ga0439431_0136679 3300041997 Bacteria 690
777 Ga0439442_032520 3300042002 Bacteria 1090
778 Ga0439445_0003320 3300042004 Bacteria 3614
779 Ga0439445_0173222 3300042004 Bacteria 632
780 Ga0439432_003330 3300042006 Bacteria 5968
781 Ga0439457_052627 3300042014 Bacteria 915
782 Ga0439462_0008838 3300042015 Bacteria 2545
783 Ga0439462_0011511 3300042015 Bacteria 2253
784 Ga0450912_000546 3300042116 Bacteria 1910
785 Ga0450912_008590 3300042116 Bacteria 850
786 Ga0450920_044532 3300042122 Bacteria 887
787 Ga0439446_0100651 3300042156 Bacteria 914
788 Ga0439434_0001642 3300042435 Bacteria 6468
789 Ga0439435_0006215 3300042436 Bacteria 2674
790 Ga0450893_0030345 3300042532 Bacteria 962
791 Ga0451577_0183229 3300042876 Bacteria 1888
792 Ga0453684_0193386 3300044712 Bacteria 2378
793 Ga0466957_0218865 3300044842 Bacteria 1257
794 Ga0466959_0522808 3300045049 Bacteria 801
795 Ga0451576_0000588 3300045051 Bacteria 77026
796 Ga0451576_0181078 3300045051 Bacteria 2200
797 Ga0495617_262793 3300046452 Bacteria 530
798 Ga0495627_000193 3300046453 Bacteria 67253
799 Ga0495627_000478 3300046453 Bacteria 33914
800 Ga0495590_0267909 3300046457 Bacteria 638
801 Ga0495629_0044090 3300046459 Bacteria 3131
802 Ga0495638_0000011 3300046460 Bacteria 442453
803 Ga0495638_0000350 3300046460 Bacteria 57915
804 Ga0495638_0240756 3300046460 Bacteria 1002
805 Ga0495650_0000373 3300046471 Bacteria 78223
806 Ga0495650_0111234 3300046471 Bacteria 1017
807 Ga0495605_0443035 3300046474 Bacteria 536
808 Ga0495662_0082809 3300046476 Bacteria 1561
809 Ga0495584_0129371 3300046491 Bacteria 1280
810 Ga0495584_0156510 3300046491 Bacteria 1158
811 Ga0495585_0001259 3300046492 Bacteria 20359
812 Ga0495607_0057229 3300046501 Bacteria 2235
813 Ga0495607_0289913 3300046501 Bacteria 774
814 Ga0495583_0000305 3300046506 Bacteria 78306
815 Ga0495583_0001602 3300046506 Bacteria 22224
816 Ga0495583_0042926 3300046506 Bacteria 2108
817 Ga0495583_0068889 3300046506 Bacteria 1559
818 Ga0495583_0112543 3300046506 Bacteria 1152
819 Ga0495583_0173081 3300046506 Bacteria 886
820 Ga0495606_0000591 3300046507 Bacteria 57426
821 Ga0495606_0033962 3300046507 Bacteria 3509
822 Ga0495610_0001092 3300046512 Bacteria 24761
823 Ga0495610_0005829 3300046512 Bacteria 8656
824 Ga0495610_0031673 3300046512 Bacteria 2756
825 Ga0495631_0339081 3300046518 Bacteria 640
826 Ga0495631_0350275 3300046518 Bacteria 628
827 Ga0495632_0000042 3300046519 Bacteria 145186
828 Ga0495632_0000538 3300046519 Bacteria 35631
829 Ga0495637_0000626 3300046520 Bacteria 24967
830 Ga0495637_0251194 3300046520 Bacteria 636
831 Ga0495643_0000005 3300046522 Bacteria 443135
832 Ga0495643_0000027 3300046522 Bacteria 266446
833 Ga0495643_0005403 3300046522 Bacteria 8651
834 Ga0495643_0009293 3300046522 Bacteria 6121
835 Ga0495643_0036125 3300046522 Bacteria 2716
836 Ga0495643_0126700 3300046522 Bacteria 1285
837 Ga0495643_0152750 3300046522 Bacteria 1142
838 Ga0495648_0000023 3300046524 Bacteria 240174
839 Ga0495648_0000115 3300046524 Bacteria 98656
840 Ga0495648_0009282 3300046524 Bacteria 7645
841 Ga0495648_0011981 3300046524 Bacteria 6498
842 Ga0495648_0058400 3300046524 Bacteria 2307
843 Ga0495648_0065078 3300046524 Bacteria 2145
844 Ga0495648_0286746 3300046524 Bacteria 778
845 Ga0495663_0000015 3300046525 Bacteria 145185
846 Ga0495663_0003401 3300046525 Bacteria 4595
847 Ga0495663_0056048 3300046525 Bacteria 1230
848 Ga0495663_0229267 3300046525 Bacteria 655
849 Ga0495663_0266177 3300046525 Bacteria 611
850 Ga0495642_0107275 3300046528 Bacteria 1192
851 Ga0495654_0000595 3300046530 Bacteria 28928
852 Ga0495654_0018453 3300046530 Bacteria 3656
853 Ga0495654_0256201 3300046530 Bacteria 727
854 Ga0495587_0414242 3300046536 Bacteria 748
855 Ga0495598_0027069 3300046537 Bacteria 1578
856 Ga0495609_0407114 3300046538 Bacteria 544
857 Ga0495621_0026775 3300046539 Bacteria 1948
858 Ga0495621_0045810 3300046539 Bacteria 1550
859 Ga0495597_0088605 3300046542 Bacteria 1316
860 Ga0495597_0110442 3300046542 Bacteria 1153
861 Ga0495622_0012047 3300046557 Bacteria 3998
862 Ga0495633_0000197 3300046558 Bacteria 76903
863 Ga0495633_0000262 3300046558 Bacteria 62524
864 Ga0495633_0002089 3300046558 Bacteria 14358
865 Ga0495633_0002581 3300046558 Bacteria 12683
866 Ga0495633_0011568 3300046558 Bacteria 4749
867 Ga0495633_0033930 3300046558 Bacteria 2457
868 Ga0495656_0154145 3300046615 Bacteria 1112
869 Ga0495668_0000001 3300046616 Bacteria 1013420
870 Ga0495668_0000007 3300046616 Bacteria 552902
871 Ga0495668_0001393 3300046616 Bacteria 23542
872 Ga0495668_0019492 3300046616 Bacteria 3909
873 Ga0495668_0115889 3300046616 Bacteria 1465
874 Ga0495668_0193293 3300046616 Bacteria 1114
875 Ga0495668_0247004 3300046616 Bacteria 977
876 Ga0495668_0302435 3300046616 Bacteria 877
877 Ga0495668_0482226 3300046616 Bacteria 683
878 Ga0495611_0103287 3300046648 Bacteria 1325
879 Ga0495611_0472799 3300046648 Bacteria 570
880 Ga0495625_0000390 3300046660 Bacteria 66951
881 Ga0495625_0000503 3300046660 Bacteria 58118
882 Ga0495625_0001297 3300046660 Bacteria 31374
883 Ga0495625_0003168 3300046660 Bacteria 16742
884 Ga0495625_0003788 3300046660 Bacteria 14662
885 Ga0495625_0033137 3300046660 Bacteria 3823
886 Ga0495625_0097778 3300046660 Bacteria 2020
887 Ga0495625_0109644 3300046660 Bacteria 1888
888 Ga0495625_0128081 3300046660 Bacteria 1721
889 Ga0495625_0310558 3300046660 Bacteria 1006
890 Ga0495625_0384363 3300046660 Bacteria 880
891 Ga0495625_0665919 3300046660 Bacteria 618
892 Ga0495625_0670243 3300046660 Bacteria 616
893 Ga0495625_0809704 3300046660 Bacteria 544
894 Ga0495661_0524839 3300046665 Bacteria 562
895 Ga0495669_0000268 3300046684 Bacteria 29882
896 Ga0495670_0000066 3300046691 Bacteria 46500
897 Ga0495670_0177630 3300046691 Bacteria 1123
898 Ga0495670_0275580 3300046691 Bacteria 899
899 Ga0495671_0000007 3300046692 Bacteria 443069
900 Ga0495671_0000012 3300046692 Bacteria 358632
901 Ga0495671_0096391 3300046692 Bacteria 1447
902 Ga0495671_0100039 3300046692 Bacteria 1418
903 Ga0495671_0118696 3300046692 Bacteria 1291
904 Ga0495649_0121204 3300046694 Bacteria 1383
905 Ga0495600_0004421 3300046809 Bacteria 8408
906 Ga0495660_0215999 3300046810 Bacteria 907
907 Ga0495636_0216797 3300047318 Bacteria 878
908 Ga0495683_0004909 3300047323 Bacteria 7484
909 Ga0495683_0035493 3300047323 Bacteria 2534
910 Ga0495683_0283249 3300047323 Bacteria 717
911 Ga0495683_0397774 3300047323 Bacteria 573
912 Ga0495687_000055 3300047443 Bacteria 194477
913 Ga0495687_005115 3300047443 Bacteria 8496
914 Ga0495677_0003912 3300047445 Bacteria 5762
915 Ga0495673_0000029 3300047469 Bacteria 471019
916 Ga0495673_0260267 3300047469 Bacteria 631
917 Ga0495681_0000032 3300047470 Bacteria 127415
918 Ga0495681_0002596 3300047470 Bacteria 12823
919 Ga0495681_0037808 3300047470 Bacteria 2373
920 Ga0495681_0144421 3300047470 Bacteria 1002
921 Ga0495681_0154438 3300047470 Bacteria 960
922 Ga0495686_0001453 3300047472 Bacteria 25811
923 Ga0495686_0004143 3300047472 Bacteria 12066
924 Ga0495686_0008478 3300047472 Bacteria 7539
925 Ga0495686_0042206 3300047472 Bacteria 2902
926 Ga0495686_0078552 3300047472 Bacteria 2020
927 Ga0495686_0165401 3300047472 Bacteria 1290
928 Ga0495686_0438090 3300047472 Bacteria 696
929 Ga0495615_0018356 3300048090 Bacteria 1538
930 Ga0495615_0026748 3300048090 Bacteria 1349
931 Ga0496100_0927777 3300048903 Bacteria 684
932 Ga0496101_0106166 3300048904 Bacteria 2109
933 Ga0496101_1080129 3300048904 Bacteria 630
934 Ga0496101_1081136 3300048904 Bacteria 630
935 Ga0496102_0000049 3300048905 Bacteria 179480
936 Ga0496102_0011200 3300048905 Bacteria 7724
937 Ga0496102_0027205 3300048905 Bacteria 5108
938 Ga0496102_0834760 3300048905 Bacteria 844
939 Ga0496102_1270847 3300048905 Bacteria 655
940 Ga0496103_0000037 3300048906 Bacteria 179474
941 Ga0496103_0000151 3300048906 Bacteria 72539
942 Ga0496103_0796185 3300048906 Bacteria 596
943 Ga0496104_0046225 3300048907 Bacteria 4099
944 Ga0496104_0520997 3300048907 Bacteria 1100
945 Ga0496104_1696910 3300048907 Bacteria 534
946 Ga0496105_0002067 3300048908 Bacteria 14517
947 Ga0496107_0753502 3300048910 Bacteria 714
948 Ga0496108_0002067 3300048911 Bacteria 16059
949 Ga0496108_1232693 3300048911 Bacteria 631
950 Ga0496109_0134818 3300048912 Bacteria 2306
951 Ga0496109_0564467 3300048912 Bacteria 1073
952 Ga0496109_0724700 3300048912 Bacteria 932
953 Ga0496110_0058567 3300048913 Bacteria 3393
954 Ga0496110_0140354 3300048913 Bacteria 2184
955 Ga0496110_0156130 3300048913 Bacteria 2067
956 Ga0496110_1263689 3300048913 Bacteria 647
957 Ga0496111_0030916 3300048914 Bacteria 3810
958 Ga0496111_0112774 3300048914 Bacteria 2003
959 Ga0496112_0123702 3300048915 Bacteria 2558
960 Ga0496113_0004996 3300048916 Bacteria 8221
961 Ga0496113_0125999 3300048916 Bacteria 2006
962 Ga0496113_1263065 3300048916 Bacteria 575
963 Ga0496114_0014916 3300048917 Bacteria 6245
964 Ga0496114_0061205 3300048917 Bacteria 3148
965 Ga0496115_0000018 3300048918 Bacteria 182523
966 Ga0496115_0304870 3300048918 Bacteria 1304
967 Ga0496116_0000664 3300048919 Bacteria 44805
968 Ga0496116_0013868 3300048919 Bacteria 6469
969 Ga0496116_0330323 3300048919 Bacteria 709
970 Ga0496117_0000115 3300048920 Bacteria 179488
971 Ga0496117_0000408 3300048920 Bacteria 72369
972 Ga0496117_0018914 3300048920 Bacteria 5682
973 Ga0496117_0118200 3300048920 Bacteria 1635
974 Ga0496117_0366028 3300048920 Bacteria 739
975 Ga0496118_0000086 3300048921 Bacteria 179488
976 Ga0496118_0000600 3300048921 Bacteria 59661
977 Ga0496118_0001927 3300048921 Bacteria 29427
978 Ga0496118_0024471 3300048921 Bacteria 5208
979 Ga0496118_0111601 3300048921 Bacteria 1812
980 Ga0496118_0135646 3300048921 Bacteria 1571
981 Ga0496118_0547135 3300048921 Bacteria 565
982 Ga0496118_0609535 3300048921 Bacteria 521
983 Ga0496119_0011638 3300048922 Bacteria 7251
984 Ga0496119_0026037 3300048922 Bacteria 4067
985 Ga0496120_0116338 3300048923 Bacteria 1389
986 Ga0496121_0000208 3300048924 Bacteria 129753
987 Ga0496121_0000237 3300048924 Bacteria 118615
988 Ga0496121_0001774 3300048924 Bacteria 35047
989 Ga0496121_0010863 3300048924 Bacteria 10179
990 Ga0496121_0083746 3300048924 Bacteria 2517
991 Ga0496121_0107141 3300048924 Bacteria 2141
992 Ga0496121_0285376 3300048924 Bacteria 1127
993 Ga0496121_0303153 3300048924 Bacteria 1083
994 Ga0496122_0000970 3300048925 Bacteria 51487
995 Ga0496122_0010455 3300048925 Bacteria 9557
996 Ga0496122_0036922 3300048925 Bacteria 3942
997 Ga0496122_0170992 3300048925 Bacteria 1310
998 Ga0496122_0294950 3300048925 Bacteria 878
999 Ga0496122_0315114 3300048925 Bacteria 835
1000 Ga0496123_0000286 3300048926 Bacteria 98752
1001 Ga0496123_0015139 3300048926 Bacteria 6347
1002 Ga0496123_0029909 3300048926 Bacteria 3998
1003 Ga0496123_0060522 3300048926 Bacteria 2441
1004 Ga0496123_0162083 3300048926 Bacteria 1191
1005 Ga0496123_0264775 3300048926 Bacteria 840
1006 Ga0496124_0000099 3300048927 Bacteria 182007
1007 Ga0496124_0000102 3300048927 Bacteria 179488
1008 Ga0496124_0002045 3300048927 Bacteria 27415
1009 Ga0496124_0002943 3300048927 Bacteria 21414
1010 Ga0496124_0013584 3300048927 Bacteria 7940
1011 Ga0496124_0052650 3300048927 Bacteria 3457
1012 Ga0496124_0053462 3300048927 Bacteria 3423
1013 Ga0496124_0059087 3300048927 Bacteria 3222
1014 Ga0496124_0205382 3300048927 Bacteria 1494
1015 Ga0496124_0216169 3300048927 Bacteria 1446
1016 Ga0496124_0536880 3300048927 Bacteria 775
1017 Ga0496124_0614764 3300048927 Bacteria 704
1018 Ga0496124_0883505 3300048927 Bacteria 544
1019 Ga0496125_0012876 3300048928 Bacteria 8263
1020 Ga0496125_0022088 3300048928 Bacteria 5916
1021 Ga0496125_0050166 3300048928 Bacteria 3458
1022 Ga0496125_0073878 3300048928 Bacteria 2647
1023 Ga0496125_0106291 3300048928 Bacteria 2049
1024 Ga0496125_0169773 3300048928 Bacteria 1468
1025 Ga0496125_0299026 3300048928 Bacteria 987
1026 Ga0496125_0304291 3300048928 Bacteria 975
1027 Ga0496125_0598961 3300048928 Bacteria 602
1028 Ga0496126_0000507 3300048929 Bacteria 76510
1029 Ga0496126_0048499 3300048929 Bacteria 3880
1030 Ga0496126_0116494 3300048929 Bacteria 2322
1031 Ga0496126_0141298 3300048929 Bacteria 2072
1032 Ga0496126_0455171 3300048929 Bacteria 1029
1033 Ga0496126_0789729 3300048929 Bacteria 729
1034 Ga0501306_101616 3300049127 Bacteria 515
1035 Ga0501305_009896 3300049161 Bacteria 1263
1036 Ga0501307_003277 3300049162 Bacteria 1578
1037 Ga0495678_013203 3300049459 Bacteria 3888
1038 Ga0495678_148894 3300049459 Bacteria 758
1039 Ga0501290_000239 3300049513 Bacteria 9080
1040 Ga0501291_140520 3300049514 Bacteria 539
1041 Ga0501292_000008 3300049515 Bacteria 83748
1042 Ga0501293_001729 3300049516 Bacteria 1645
1043 Ga0501293_023847 3300049516 Bacteria 617
1044 Ga0501294_009404 3300049517 Bacteria 959
1045 Ga0501300_000363 3300049523 Bacteria 6905
1046 Ga0501313_012426 3300049529 Bacteria 992
1047 Ga0501313_031360 3300049529 Bacteria 690
1048 Ga0501315_007923 3300049531 Bacteria 1223
1049 Ga0501317_011776 3300049533 Bacteria 1069
1050 Ga0501324_046489 3300049540 Bacteria 506
1051 Ga0501335_004555 3300049551 Bacteria 1214
1052 Ga0501031_0223725 3300049568 Bacteria 1225
1053 Ga0501031_0378666 3300049568 Bacteria 916
1054 Ga0501032_0056525 3300049569 Bacteria 2637
1055 Ga0501032_0228127 3300049569 Bacteria 1211
1056 Ga0501032_0415144 3300049569 Bacteria 864
1057 Ga0501033_0007915 3300049570 Bacteria 8232
1058 Ga0501033_0103136 3300049570 Bacteria 2080
1059 Ga0501033_0256012 3300049570 Bacteria 1240
1060 Ga0501033_0488746 3300049570 Bacteria 852
1061 Ga0501034_0024797 3300049571 Bacteria 6102
1062 Ga0501034_0143619 3300049571 Bacteria 2365
1063 Ga0501034_0175045 3300049571 Bacteria 2112
1064 Ga0501034_0383379 3300049571 Bacteria 1330
1065 Ga0501034_0570302 3300049571 Bacteria 1040
1066 Ga0501034_0648180 3300049571 Bacteria 958
1067 Ga0501034_0768735 3300049571 Bacteria 858
1068 Ga0501034_1636362 3300049571 Bacteria 517
1069 Ga0501036_0042413 3300049572 Bacteria 3852
1070 Ga0501036_0335592 3300049572 Bacteria 1263
1071 Ga0501036_0594917 3300049572 Bacteria 918
1072 Ga0501036_0682019 3300049572 Bacteria 850
1073 Ga0501037_0007067 3300049573 Bacteria 8202
1074 Ga0501037_0157079 3300049573 Bacteria 1623
1075 Ga0501037_0675456 3300049573 Bacteria 689
1076 Ga0501037_0721677 3300049573 Bacteria 662
1077 Ga0501038_0162575 3300049574 Bacteria 1813
1078 Ga0501038_0179345 3300049574 Bacteria 1710
1079 Ga0501038_0249511 3300049574 Bacteria 1406
1080 Ga0501038_1210606 3300049574 Bacteria 548
1081 Ga0501039_0069075 3300049575 Bacteria 2743
1082 Ga0501039_0667237 3300049575 Bacteria 814
1083 Ga0501039_1348332 3300049575 Bacteria 550
1084 Ga0501042_0766286 3300049578 Bacteria 702
1085 Ga0501042_0808800 3300049578 Bacteria 682
1086 Ga0501042_1453349 3300049578 Bacteria 500
1087 Ga0501043_0127668 3300049579 Bacteria 1994
1088 Ga0501043_0235691 3300049579 Bacteria 1412
1089 Ga0501043_0286073 3300049579 Bacteria 1263
1090 Ga0501043_0376967 3300049579 Bacteria 1074
1091 Ga0501046_0087795 3300049580 Bacteria 2396
1092 Ga0501046_0248471 3300049580 Bacteria 1310
1093 Ga0501047_0000876 3300049581 Bacteria 30712
1094 Ga0501047_0293727 3300049581 Bacteria 1468
1095 Ga0501047_0380991 3300049581 Bacteria 1245
1096 Ga0501047_0384774 3300049581 Bacteria 1237
1097 Ga0501047_0529825 3300049581 Bacteria 1003
1098 Ga0501047_1256300 3300049581 Bacteria 554
1099 Ga0501048_0063746 3300049582 Bacteria 2606
1100 Ga0501048_0439882 3300049582 Bacteria 933
1101 Ga0501067_0415310 3300049583 Bacteria 751
1102 Ga0501070_0209515 3300049586 Bacteria 1600
1103 Ga0501071_0505286 3300049587 Bacteria 927
1104 Ga0501071_0814569 3300049587 Bacteria 720
1105 Ga0501073_0753796 3300049589 Bacteria 671
1106 Ga0501202_010095 3300049652 Bacteria 1745
1107 Ga0501206_003593 3300049653 Bacteria 1970
1108 Ga0501206_006431 3300049653 Bacteria 1529
1109 Ga0501207_012775 3300049654 Bacteria 1265
1110 Ga0501208_077551 3300049655 Bacteria 678
1111 Ga0501222_000772 3300049662 Bacteria 4610
1112 Ga0501223_000004 3300049663 Bacteria 141027
1113 Ga0501223_000368 3300049663 Bacteria 11106
1114 Ga0501223_112769 3300049663 Bacteria 569
1115 Ga0501224_006184 3300049664 Bacteria 1732
1116 Ga0501224_019511 3300049664 Bacteria 1010
1117 Ga0501227_018690 3300049665 Bacteria 1575
1118 Ga0501233_039761 3300049668 Bacteria 1100
1119 Ga0501235_008987 3300049669 Bacteria 2181
1120 Ga0501235_011993 3300049669 Bacteria 1905
1121 Ga0501235_035994 3300049669 Bacteria 1125
1122 Ga0501236_002716 3300049670 Bacteria 2039
1123 Ga0501236_007445 3300049670 Bacteria 1368
1124 Ga0501249_000686 3300049679 Bacteria 7716
1125 Ga0501257_001004 3300049686 Bacteria 5686
1126 Ga0501257_037227 3300049686 Bacteria 1186
1127 Ga0501259_000589 3300049688 Bacteria 5813
1128 Ga0501261_000030 3300049690 Bacteria 32000
1129 Ga0501221_010535 3300049704 Bacteria 1644
1130 Ga0501225_0000003 3300049705 Bacteria 141070
1131 Ga0501225_0001931 3300049705 Bacteria 6489
1132 Ga0501225_0002873 3300049705 Bacteria 5287
1133 Ga0501245_002127 3300049708 Bacteria 2631
1134 Ga0501245_008085 3300049708 Bacteria 1494
1135 Ga0501080_0166082 3300049742 Bacteria 2037
1136 Ga0501241_010421 3300049758 Bacteria 1691
1137 Ga0501264_005550 3300049761 Bacteria 1150
1138 Ga0501279_000002 3300049775 Bacteria 205937
1139 Ga0501280_000010 3300049776 Bacteria 63153
1140 Ga0501280_008201 3300049776 Bacteria 1456
1141 Ga0501281_00100 3300049777 Bacteria 10298
1142 Ga0501281_11331 3300049777 Bacteria 634
1143 Ga0501282_000779 3300049778 Bacteria 3663
1144 Ga0501035_0007244 3300049822 Bacteria 10381
1145 Ga0501035_0299712 3300049822 Bacteria 1355
1146 Ga0501035_0659817 3300049822 Bacteria 847
1147 Ga0501044_0031887 3300049823 Bacteria 5542
1148 Ga0501044_0186702 3300049823 Bacteria 2037
1149 Ga0501044_0348005 3300049823 Bacteria 1402
1150 Ga0501044_0373081 3300049823 Bacteria 1343
1151 Ga0501044_0591466 3300049823 Bacteria 1003
1152 Ga0501044_0681022 3300049823 Bacteria 915
1153 Ga0501044_0880516 3300049823 Bacteria 771
1154 Ga0501045_0988261 3300049824 Bacteria 617
1155 nmdc:mga03683_191052_c1 3300050489 Bacteria 937
1156 nmdc:mga03683_229_c1 3300050489 Bacteria 17517
1157 nmdc:mga03n38_19603_c1 3300050490 Bacteria 2691
1158 nmdc:mga00v17_144311_c1 3300050491 Bacteria 1528
1159 nmdc:mga00v17_150524_c1 3300050491 Bacteria 1495
1160 nmdc:mga00v17_166252_c1 3300050491 Bacteria 1421
1161 nmdc:mga0yw44_141365_c1 3300050492 Bacteria 1565
1162 nmdc:mga0k408_223480_c1 3300050493 Bacteria 1124
1163 nmdc:mga0k408_29927_c1 3300050493 Bacteria 3103
1164 nmdc:mga0k408_42790_c1 3300050493 Bacteria 2608
1165 nmdc:mga0k408_61537_c1 3300050493 Bacteria 2182
1166 nmdc:mga0k408_779808_c1 3300050493 Bacteria 558
1167 nmdc:mga0k408_88899_c1 3300050493 Bacteria 1814
1168 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
1169 nmdc:mga06z11_646394_c1 3300050494 Bacteria 644
1170 nmdc:mga06z11_6554_c1 3300050494 Bacteria 4748
1171 nmdc:mga04h51_147_c1 3300050495 Bacteria 20575
1172 nmdc:mga04h51_4151_c1 3300050495 Bacteria 3577
1173 nmdc:mga07m45_253890_c1 3300050496 Bacteria 1023
1174 nmdc:mga07m45_33_c1 3300050496 Bacteria 75596
1175 nmdc:mga07m45_427415_c1 3300050496 Bacteria 768
1176 nmdc:mga07m45_471260_c1 3300050496 Bacteria 728
1177 nmdc:mga07m45_84542_c1 3300050496 Bacteria 1460
1178 nmdc:mga07m45_90862_c1 3300050496 Bacteria 1749
1179 nmdc:mga05p37_1296370_c1 3300050507 Bacteria 743
1180 nmdc:mga08y16_1661375_c1 3300050511 Bacteria 595
1181 nmdc:mga0sz30_59743_c1 3300050516 Bacteria 1627
1182 nmdc:mga0sz30_9117_c1 3300050516 Bacteria 3764
1183 Ga0495612_0327786 3300053078 Bacteria 689
1184 Ga0500610_0000496 3300053079 Bacteria 12112
1185 Ga0500643_000004 3300053087 Bacteria 857484
1186 Ga0500643_000065 3300053087 Bacteria 119995
1187 Ga0500643_001584 3300053087 Bacteria 12872
1188 Ga0500643_002759 3300053087 Bacteria 8794
1189 Ga0500643_003367 3300053087 Bacteria 7736
1190 Ga0500643_007933 3300053087 Bacteria 4224
1191 Ga0500643_010821 3300053087 Bacteria 3371
1192 Ga0500643_016304 3300053087 Bacteria 2519
1193 Ga0500643_016401 3300053087 Bacteria 2509
1194 Ga0500643_034447 3300053087 Bacteria 1525
1195 Ga0500583_0559113 3300053092 Bacteria 531
1196 Ga0500651_0289877 3300053093 Bacteria 942
1197 Ga0500651_0497111 3300053093 Bacteria 673
1198 Ga0500566_0002509 3300053094 Bacteria 10901
1199 Ga0500641_0093245 3300053096 Bacteria 1287
1200 Ga0500556_0000074 3300053104 Bacteria 98799
1201 Ga0500556_0265161 3300053104 Bacteria 675
1202 Ga0500562_076918 3300053108 Bacteria 902
1203 Ga0500562_224004 3300053108 Bacteria 508
1204 Ga0500572_016593 3300053111 Bacteria 1879
1205 Ga0500592_000118 3300053116 Bacteria 17080
1206 Ga0500592_000393 3300053116 Bacteria 7341
1207 Ga0500592_015653 3300053116 Bacteria 1217
1208 Ga0500594_0000572 3300053118 Bacteria 7889
1209 Ga0500594_0105044 3300053118 Bacteria 873
1210 Ga0500595_031857 3300053119 Bacteria 1765
1211 Ga0500595_106833 3300053119 Bacteria 798
1212 Ga0500597_003969 3300053120 Bacteria 4495
1213 Ga0500607_000098 3300053121 Bacteria 65919
1214 Ga0500608_007974 3300053122 Bacteria 4419
1215 Ga0500608_159037 3300053122 Bacteria 981
1216 Ga0500608_298128 3300053122 Bacteria 600
1217 Ga0500626_315636 3300053128 Bacteria 543
1218 Ga0500642_0000002 3300053130 Bacteria 795093
1219 Ga0500642_0000116 3300053130 Bacteria 37194
1220 Ga0500652_179255 3300053131 Bacteria 869
1221 Ga0500658_0043853 3300053134 Bacteria 1802
1222 Ga0500658_0091278 3300053134 Bacteria 1317
1223 Ga0500559_0060943 3300053136 Bacteria 1682
1224 Ga0500559_0065891 3300053136 Bacteria 1623
1225 Ga0500559_0130334 3300053136 Bacteria 1174
1226 Ga0500559_0309131 3300053136 Bacteria 742
1227 Ga0500559_0341614 3300053136 Bacteria 701
1228 Ga0500559_0345425 3300053136 Bacteria 696
1229 Ga0500559_0574737 3300053136 Bacteria 512
1230 Ga0500564_192633 3300053138 Bacteria 843
1231 Ga0500564_220754 3300053138 Bacteria 767
1232 Ga0500568_0007493 3300053139 Bacteria 5350
1233 Ga0500568_0115245 3300053139 Bacteria 1003
1234 Ga0500568_0162151 3300053139 Bacteria 825
1235 Ga0500573_0000046 3300053140 Bacteria 98723
1236 Ga0500573_0440291 3300053140 Bacteria 605
1237 Ga0500577_0516699 3300053142 Bacteria 521
1238 Ga0500588_0055704 3300053146 Bacteria 1249
1239 Ga0500590_097791 3300053148 Bacteria 1414
1240 Ga0500604_0017059 3300053151 Bacteria 2005
1241 Ga0500604_0105546 3300053151 Bacteria 932
1242 Ga0500604_0200470 3300053151 Bacteria 686
1243 Ga0500604_0225753 3300053151 Bacteria 646
1244 Ga0500604_0289952 3300053151 Bacteria 567
1245 Ga0500616_0116858 3300053153 Bacteria 1280
1246 Ga0500619_245683 3300053154 Bacteria 590
1247 Ga0500619_255005 3300053154 Bacteria 577
1248 Ga0500619_260087 3300053154 Bacteria 569
1249 Ga0500622_0229706 3300053156 Bacteria 827
1250 Ga0500624_000044 3300053157 Bacteria 90094
1251 Ga0500624_000053 3300053157 Bacteria 74086
1252 Ga0500627_0000054 3300053158 Bacteria 55229
1253 Ga0500627_0000508 3300053158 Bacteria 10461
1254 Ga0500627_0000799 3300053158 Bacteria 8399
1255 Ga0500627_0319549 3300053158 Bacteria 674
1256 Ga0500627_0463127 3300053158 Bacteria 532
1257 Ga0500633_0072786 3300053160 Bacteria 1230
1258 Ga0500636_0005811 3300053177 Bacteria 7063
1259 Ga0500637_0000008 3300053178 Bacteria 89244
1260 Ga0500611_000244 3300053727 Bacteria 6165
1261 Ga0500611_128595 3300053727 Bacteria 681
1262 Ga0500645_000009 3300053730 Bacteria 206177
1263 Ga0500645_000439 3300053730 Bacteria 28425
1264 Ga0500645_002373 3300053730 Bacteria 8483
1265 Ga0500645_007761 3300053730 Bacteria 3712
1266 Ga0500645_184279 3300053730 Bacteria 567
1267 Ga0500596_013713 3300053735 Bacteria 1222
1268 Ga0500661_071886 3300055283 Bacteria 633
1269 Ga0587077_030086 3300059493 Bacteria 1028
1270 Ga0587085_045596 3300059506 Bacteria 781
1271 Ga0587090_000313 3300059510 Bacteria 3797
1272 Ga0587090_114637 3300059510 Bacteria 578
1273 Ga0587101_152085 3300059623 Bacteria 502
1274 Ga0587115_024628 3300059626 Bacteria 860
1275 Ga0587128_083613 3300059630 Bacteria 643
1276 Ga0587072_135641 3300059643 Bacteria 583
1277 Ga0587107_141702 3300059652 Bacteria 514
1278 Ga0587111_0043277 3300060346 Bacteria 968

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_11141427 Ga0157370_111414271 87
2 3300005262 Ga0065165_1004474 Ga0065165_10044745 90
3 3300046491 Ga0495584_0129371 Ga0495584_0129371_67_363 90
4 3300046519 Ga0495632_0000042 Ga0495632_0000042_50440_50736 90
5 3300046522 Ga0495643_0000005 Ga0495643_0000005_392396_392692 90
6 3300046525 Ga0495663_0000015 Ga0495663_0000015_94450_94746 90
7 3300046558 Ga0495633_0000197 Ga0495633_0000197_21957_22253 90
8 3300046558 Ga0495633_0000262 Ga0495633_0000262_50440_50736 90
9 3300046660 Ga0495625_0809704 Ga0495625_0809704_14_310 90
10 3300046692 Ga0495671_0000007 Ga0495671_0000007_392330_392626 90
11 3300047323 Ga0495683_0283249 Ga0495683_0283249_387_683 90
12 3300047470 Ga0495681_0002596 Ga0495681_0002596_7249_7545 90
13 3300047472 Ga0495686_0078552 Ga0495686_0078552_761_1057 90
14 3300009177 Ga0105248_11732468 Ga0105248_117324682 91
15 3300017792 Ga0163161_10001996 Ga0163161_100019967 91
16 3300025900 Ga0207710_10243809 Ga0207710_102438092 91
17 3300048921 Ga0496118_0135646 Ga0496118_0135646_517_813 91
18 iso_pu_bacteria 2599185354 2600200736 91
19 iso_pu_bacteria 2751185897 2753765136 91
20 3300046520 Ga0495637_0000626 Ga0495637_0000626_17212_17508 92
21 3300005563 Ga0068855_100014816 Ga0068855_10001481611 93
22 3300013100 Ga0157373_10128467 Ga0157373_101284672 93
23 3300025949 Ga0207667_10480450 Ga0207667_104804502 93
24 iso_pu_bacteria 2512564014 2512644704 94
25 iso_pu_bacteria 2599185359 2600226335 94
26 iso_pu_bacteria 2643221541 2643730035 94
27 iso_pu_bacteria 2643221560 2643822900 94
28 iso_pu_bacteria 2643221563 2643832494 94
29 iso_pu_bacteria 2643221588 2643950306 94
30 iso_pu_bacteria 2643221605 2644039783 94
31 iso_pu_bacteria 2643221606 2644045521 94
32 iso_pu_bacteria 2643221608 2644053711 94
33 iso_pu_bacteria 2643221622 2644126963 94
34 iso_pu_bacteria 2643221671 2644392853 94
35 iso_pu_bacteria 2775507255 2778123875 94
36 iso_pu_bacteria 2818991466 2819712421 94
37 iso_pu_bacteria 2830075706 2830077899 94
38 iso_pu_bacteria 2848297114 2848299364 94
39 iso_pu_bacteria 2852653556 2852654833 94
40 iso_pu_bacteria 2852680915 2852681644 94
41 iso_pu_bacteria 2879163058 2879164441 94
42 iso_pu_bacteria 2882806704 2882808494 94
43 iso_pu_bacteria 2885429604 2885430075 94
44 iso_pu_bacteria 2895880812 2895884215 94
45 iso_pu_bacteria 2896184354 2896186830 94
46 iso_pu_bacteria 2896253425 2896254593 94
47 iso_pu_bacteria 2928027323 2928029583 94
48 iso_pu_bacteria 2928526807 2928526931 94
49 iso_pu_bacteria 2928968154 2928969464 94
50 iso_pu_bacteria 2946787523 2946788259 94
51 iso_pu_bacteria 2984555340 2984557510 94
52 iso_pu_bacteria 2984564862 2984568127 94
53 iso_pu_bacteria 2990265787 2990266534 94
54 iso_pu_bacteria 2993356040 2993359172 94
55 iso_pu_bacteria 2993693658 2993695668 94
56 iso_pu_bacteria 8057101203 8057101755 94
57 3300005578 Ga0068854_101042552 Ga0068854_1010425522 95
58 3300005844 Ga0068862_102156793 Ga0068862_1021567932 95
59 3300021388 Ga0213875_10000229 Ga0213875_1000022934 95
60 3300031911 Ga0307412_10002858 Ga0307412_1000285812 95
61 3300045049 Ga0466959_0522808 Ga0466959_0522808_389_676 95
62 3300048920 Ga0496117_0366028 Ga0496117_0366028_152_442 95
63 3300059630 Ga0587128_083613 Ga0587128_083613_201_488 95
64 3300002126 JGI24035J26624_1005781 JGI24035J26624_10057812 96
65 3300002459 JGI24751J29686_10026087 JGI24751J29686_100260872 96
66 3300005327 Ga0070658_10637336 Ga0070658_106373362 96
67 3300005327 Ga0070658_11043948 Ga0070658_110439482 96
68 3300005331 Ga0070670_100864713 Ga0070670_1008647131 96
69 3300005335 Ga0070666_10000063 Ga0070666_1000006346 96
70 3300005347 Ga0070668_100013413 Ga0070668_1000134135 96
71 3300005353 Ga0070669_100000042 Ga0070669_100000042101 96
72 3300005355 Ga0070671_100000002 Ga0070671_10000000234 96
73 3300005367 Ga0070667_100035266 Ga0070667_1000352662 96
74 3300005544 Ga0070686_101391044 Ga0070686_1013910442 96
75 3300005548 Ga0070665_100073523 Ga0070665_1000735232 96
76 3300005617 Ga0068859_100002597 Ga0068859_1000025972 96
77 3300005618 Ga0068864_100000731 Ga0068864_10000073126 96
78 3300005719 Ga0068861_100000148 Ga0068861_10000014815 96
79 3300005841 Ga0068863_100014281 Ga0068863_1000142819 96
80 3300005842 Ga0068858_100000588 Ga0068858_10000058812 96
81 3300005842 Ga0068858_100122627 Ga0068858_1001226272 96
82 3300005843 Ga0068860_100036289 Ga0068860_1000362896 96
83 3300005844 Ga0068862_100007384 Ga0068862_10000738411 96
84 3300006931 Ga0097620_100002597 Ga0097620_1000025972 96
85 3300009011 Ga0105251_10402660 Ga0105251_104026602 96
86 3300009101 Ga0105247_10001115 Ga0105247_1000111515 96
87 3300009177 Ga0105248_10019155 Ga0105248_100191556 96
88 3300009553 Ga0105249_10091346 Ga0105249_100913462 96
89 3300013306 Ga0163162_10003776 Ga0163162_100037762 96
90 3300013306 Ga0163162_10037626 Ga0163162_100376262 96
91 3300013307 Ga0157372_11515622 Ga0157372_115156222 96
92 3300014325 Ga0163163_10026383 Ga0163163_100263836 96
93 3300014326 Ga0157380_10079466 Ga0157380_100794662 96
94 3300025315 Ga0207697_10000130 Ga0207697_1000013033 96
95 3300025735 Ga0207713_1233720 Ga0207713_12337202 96
96 3300025900 Ga0207710_10009801 Ga0207710_100098013 96
97 3300025903 Ga0207680_10000033 Ga0207680_100000336 96
98 3300025909 Ga0207705_10455676 Ga0207705_104556761 96
99 3300025909 Ga0207705_10929522 Ga0207705_109295222 96
100 3300025923 Ga0207681_10000002 Ga0207681_10000002420 96
101 3300025925 Ga0207650_10018754 Ga0207650_100187542 96
102 3300025931 Ga0207644_10000002 Ga0207644_10000002425 96
103 3300025941 Ga0207711_10087405 Ga0207711_100874052 96
104 3300025961 Ga0207712_10001860 Ga0207712_100018603 96
105 3300025972 Ga0207668_10001038 Ga0207668_100010384 96
106 3300025986 Ga0207658_10017969 Ga0207658_100179693 96
107 3300026035 Ga0207703_10006058 Ga0207703_100060589 96
108 3300026035 Ga0207703_10157722 Ga0207703_101577222 96
109 3300026088 Ga0207641_10019831 Ga0207641_100198316 96
110 3300026095 Ga0207676_10000705 Ga0207676_100007053 96
111 3300026118 Ga0207675_100000355 Ga0207675_10000035527 96
112 3300027876 Ga0209974_10276072 Ga0209974_102760722 96
113 3300028379 Ga0268266_10054091 Ga0268266_100540912 96
114 3300028380 Ga0268265_10000361 Ga0268265_1000036115 96
115 3300028381 Ga0268264_10000116 Ga0268264_1000011636 96
116 3300039437 Ga0436365_1490641 Ga0436365_1490641_107_403 96
117 3300047472 Ga0495686_0001453 Ga0495686_0001453_1197_1487 96
118 3300048905 Ga0496102_0834760 Ga0496102_0834760_232_528 96
119 3300006353 Ga0075370_10074920 Ga0075370_100749202 97
120 3300025934 Ga0207686_11066050 Ga0207686_110660501 97
121 3300027876 Ga0209974_10012498 Ga0209974_100124983 97
122 3300046460 Ga0495638_0000011 Ga0495638_0000011_368917_369210 97
123 3300046506 Ga0495583_0000305 Ga0495583_0000305_20819_21112 97
124 3300046519 Ga0495632_0000538 Ga0495632_0000538_29253_29546 97
125 3300046524 Ga0495648_0000023 Ga0495648_0000023_166637_166930 97
126 3300046692 Ga0495671_0000012 Ga0495671_0000012_66427_66720 97
127 3300047469 Ga0495673_0000029 Ga0495673_0000029_291913_292206 97
128 3300050496 nmdc:mga07m45_253890_c1 nmdc:mga07m45_253890_c1_699_998 97
129 3300053122 Ga0500608_298128 Ga0500608_298128_252_548 97
130 3300053136 Ga0500559_0574737 Ga0500559_0574737_150_449 97
131 3300053138 Ga0500564_220754 Ga0500564_220754_441_737 97
132 3300053146 Ga0500588_0055704 Ga0500588_0055704_750_1049 97
133 3300053148 Ga0500590_097791 Ga0500590_097791_624_920 97
134 3300053154 Ga0500619_260087 Ga0500619_260087_101_397 97
135 2162886007 SwRhRL2b_contig_2770192 SwRhRL2b_0210.00007630 98
136 2162886007 SwRhRL2b_contig_433849 SwRhRL2b_0511.00003330 98
137 3300000043 ARcpr5yngRDRAFT_c005141 ARcpr5yngRDRAFT_0051412 98
138 3300001904 JGI24736J21556_1006519 JGI24736J21556_10065192 98
139 3300001915 JGI24741J21665_1001599 JGI24741J21665_10015996 98
140 3300001915 JGI24741J21665_1002509 JGI24741J21665_10025093 98
141 3300001979 JGI24740J21852_10001016 JGI24740J21852_100010166 98
142 3300001989 JGI24739J22299_10000602 JGI24739J22299_100006023 98
143 3300001989 JGI24739J22299_10007241 JGI24739J22299_100072414 98
144 3300001989 JGI24739J22299_10016593 JGI24739J22299_100165932 98
145 3300001990 JGI24737J22298_10001956 JGI24737J22298_100019564 98
146 3300001990 JGI24737J22298_10008892 JGI24737J22298_100088923 98
147 3300001990 JGI24737J22298_10014616 JGI24737J22298_100146163 98
148 3300001990 JGI24737J22298_10044176 JGI24737J22298_100441762 98
149 3300002067 JGI24735J21928_10004916 JGI24735J21928_100049162 98
150 3300002075 JGI24738J21930_10002190 JGI24738J21930_100021907 98
151 3300002075 JGI24738J21930_10016432 JGI24738J21930_100164322 98
152 3300002459 JGI24751J29686_10000159 JGI24751J29686_1000015910 98
153 3300002774 JGI25150J39212_1000213 JGI25150J39212_100021318 98
154 3300003187 JGI25151J46595_10052017 JGI25151J46595_100520172 98
155 3300003214 JGI25165J46597_1000012 JGI25165J46597_1000012209 98
156 3300003215 JGI25153J46596_10000016 JGI25153J46596_1000001688 98
157 3300003215 JGI25153J46596_10000036 JGI25153J46596_1000003648 98
158 3300003215 JGI25153J46596_10028563 JGI25153J46596_100285632 98
159 3300003354 JGI25160J50197_1065978 JGI25160J50197_10659781 98
160 3300003752 Ga0055539_1039470 Ga0055539_10394701 98
161 3300003759 Ga0055525_1000035 Ga0055525_1000035124 98
162 3300003762 Ga0055542_1000060 Ga0055542_100006017 98
163 3300003763 Ga0055529_1000043 Ga0055529_1000043147 98
164 3300003771 Ga0055526_1000948 Ga0055526_100094817 98
165 3300003773 Ga0055537_1001825 Ga0055537_10018251 98
166 3300003775 Ga0055524_1000180 Ga0055524_100018061 98
167 3300003781 Ga0055536_1000520 Ga0055536_10005203 98
168 3300003781 Ga0055536_1006261 Ga0055536_10062613 98
169 3300003781 Ga0055536_1029291 Ga0055536_10292912 98
170 3300003790 Ga0055528_1037468 Ga0055528_10374681 98
171 3300003790 Ga0055528_1046726 Ga0055528_10467262 98
172 3300003791 Ga0055530_10001171 Ga0055530_100011716 98
173 3300003791 Ga0055530_10001368 Ga0055530_100013687 98
174 3300003791 Ga0055530_10007997 Ga0055530_100079972 98
175 3300003791 Ga0055530_10020941 Ga0055530_100209413 98
176 3300003791 Ga0055530_10030601 Ga0055530_100306012 98
177 3300003792 Ga0055540_1001281 Ga0055540_10012815 98
178 3300003792 Ga0055540_1005532 Ga0055540_10055326 98
179 3300003794 Ga0055531_10000161 Ga0055531_1000016119 98
180 3300003794 Ga0055531_10004136 Ga0055531_100041368 98
181 3300003794 Ga0055531_10008952 Ga0055531_100089525 98
182 3300003794 Ga0055531_10011225 Ga0055531_100112252 98
183 3300004625 Ga0055543_1054170 Ga0055543_10541701 98
184 3300005262 Ga0065165_1001869 Ga0065165_100186912 98
185 3300005262 Ga0065165_1017219 Ga0065165_10172193 98
186 3300005262 Ga0065165_1066773 Ga0065165_10667732 98
187 3300005262 Ga0065165_1097225 Ga0065165_10972252 98
188 3300005262 Ga0065165_1138182 Ga0065165_11381821 98
189 3300005289 Ga0065704_10001418 Ga0065704_100014184 98
190 3300005289 Ga0065704_10072077 Ga0065704_100720772 98
191 3300005289 Ga0065704_10310336 Ga0065704_103103362 98
192 3300005295 Ga0065707_10023450 Ga0065707_100234502 98
193 3300005295 Ga0065707_10082272 Ga0065707_1008227210 98
194 3300005295 Ga0065707_10100910 Ga0065707_101009103 98
195 3300005295 Ga0065707_10107929 Ga0065707_101079293 98
196 3300005295 Ga0065707_10193463 Ga0065707_101934632 98
197 3300005295 Ga0065707_10312100 Ga0065707_103121002 98
198 3300005327 Ga0070658_10044373 Ga0070658_100443734 98
199 3300005327 Ga0070658_10064042 Ga0070658_100640422 98
200 3300005327 Ga0070658_10472506 Ga0070658_104725062 98
201 3300005327 Ga0070658_11233995 Ga0070658_112339952 98
202 3300005327 Ga0070658_11417436 Ga0070658_114174362 98
203 3300005328 Ga0070676_11331128 Ga0070676_113311281 98
204 3300005329 Ga0070683_100147795 Ga0070683_1001477953 98
205 3300005331 Ga0070670_100000003 Ga0070670_100000003140 98
206 3300005331 Ga0070670_100155226 Ga0070670_1001552262 98
207 3300005331 Ga0070670_100245274 Ga0070670_1002452742 98
208 3300005331 Ga0070670_100961164 Ga0070670_1009611642 98
209 3300005333 Ga0070677_10024455 Ga0070677_100244553 98
210 3300005333 Ga0070677_10559906 Ga0070677_105599062 98
211 3300005335 Ga0070666_10322469 Ga0070666_103224692 98
212 3300005335 Ga0070666_11310846 Ga0070666_113108461 98
213 3300005338 Ga0068868_100962179 Ga0068868_1009621792 98
214 3300005339 Ga0070660_100269472 Ga0070660_1002694721 98
215 3300005339 Ga0070660_101297513 Ga0070660_1012975131 98
216 3300005339 Ga0070660_101775554 Ga0070660_1017755542 98
217 3300005339 Ga0070660_101775555 Ga0070660_1017755552 98
218 3300005343 Ga0070687_100234450 Ga0070687_1002344502 98
219 3300005344 Ga0070661_100112568 Ga0070661_1001125685 98
220 3300005344 Ga0070661_100316764 Ga0070661_1003167642 98
221 3300005347 Ga0070668_100027226 Ga0070668_1000272264 98
222 3300005347 Ga0070668_100056776 Ga0070668_1000567763 98
223 3300005347 Ga0070668_100928378 Ga0070668_1009283781 98
224 3300005347 Ga0070668_100936694 Ga0070668_1009366942 98
225 3300005347 Ga0070668_101482836 Ga0070668_1014828362 98
226 3300005353 Ga0070669_100000044 Ga0070669_10000004440 98
227 3300005353 Ga0070669_100127069 Ga0070669_1001270691 98
228 3300005353 Ga0070669_100167169 Ga0070669_1001671692 98
229 3300005353 Ga0070669_100252260 Ga0070669_1002522602 98
230 3300005353 Ga0070669_100256143 Ga0070669_1002561432 98
231 3300005353 Ga0070669_100301438 Ga0070669_1003014382 98
232 3300005353 Ga0070669_100663394 Ga0070669_1006633942 98
233 3300005353 Ga0070669_100689710 Ga0070669_1006897102 98
234 3300005353 Ga0070669_100761649 Ga0070669_1007616492 98
235 3300005353 Ga0070669_101996165 Ga0070669_1019961651 98
236 3300005354 Ga0070675_100572366 Ga0070675_1005723662 98
237 3300005354 Ga0070675_100862714 Ga0070675_1008627141 98
238 3300005355 Ga0070671_100043617 Ga0070671_1000436173 98
239 3300005355 Ga0070671_100060147 Ga0070671_1000601472 98
240 3300005356 Ga0070674_100000171 Ga0070674_10000017118 98
241 3300005356 Ga0070674_100159052 Ga0070674_1001590524 98
242 3300005364 Ga0070673_100203220 Ga0070673_1002032202 98
243 3300005364 Ga0070673_101271275 Ga0070673_1012712752 98
244 3300005366 Ga0070659_100025300 Ga0070659_1000253007 98
245 3300005366 Ga0070659_100081800 Ga0070659_1000818002 98
246 3300005366 Ga0070659_100695800 Ga0070659_1006958002 98
247 3300005367 Ga0070667_100004979 Ga0070667_1000049797 98
248 3300005367 Ga0070667_100243171 Ga0070667_1002431712 98
249 3300005367 Ga0070667_100547652 Ga0070667_1005476521 98
250 3300005367 Ga0070667_101629213 Ga0070667_1016292131 98
251 3300005441 Ga0070700_101157030 Ga0070700_1011570302 98
252 3300005455 Ga0070663_100001785 Ga0070663_10000178514 98
253 3300005455 Ga0070663_100347233 Ga0070663_1003472332 98
254 3300005455 Ga0070663_101253680 Ga0070663_1012536802 98
255 3300005456 Ga0070678_100000584 Ga0070678_10000058411 98
256 3300005456 Ga0070678_100478977 Ga0070678_1004789771 98
257 3300005457 Ga0070662_100009003 Ga0070662_1000090033 98
258 3300005457 Ga0070662_100277877 Ga0070662_1002778772 98
259 3300005457 Ga0070662_101947430 Ga0070662_1019474302 98
260 3300005457 Ga0070662_101971406 Ga0070662_1019714062 98
261 3300005466 Ga0070685_10924414 Ga0070685_109244141 98
262 3300005466 Ga0070685_11049281 Ga0070685_110492812 98
263 3300005468 Ga0070707_100360654 Ga0070707_1003606542 98
264 3300005468 Ga0070707_100687156 Ga0070707_1006871562 98
265 3300005471 Ga0070698_100548793 Ga0070698_1005487932 98
266 3300005530 Ga0070679_100311083 Ga0070679_1003110832 98
267 3300005535 Ga0070684_100060440 Ga0070684_1000604402 98
268 3300005535 Ga0070684_100361698 Ga0070684_1003616982 98
269 3300005539 Ga0068853_100252410 Ga0068853_1002524101 98
270 3300005539 Ga0068853_100285758 Ga0068853_1002857582 98
271 3300005539 Ga0068853_100891734 Ga0068853_1008917342 98
272 3300005539 Ga0068853_102094991 Ga0068853_1020949911 98
273 3300005543 Ga0070672_100290921 Ga0070672_1002909212 98
274 3300005548 Ga0070665_100000186 Ga0070665_10000018652 98
275 3300005548 Ga0070665_100482368 Ga0070665_1004823682 98
276 3300005548 Ga0070665_101001609 Ga0070665_1010016091 98
277 3300005548 Ga0070665_101634965 Ga0070665_1016349651 98
278 3300005548 Ga0070665_101979966 Ga0070665_1019799662 98
279 3300005563 Ga0068855_100003973 Ga0068855_1000039736 98
280 3300005563 Ga0068855_100182464 Ga0068855_1001824644 98
281 3300005563 Ga0068855_100294139 Ga0068855_1002941393 98
282 3300005563 Ga0068855_100326462 Ga0068855_1003264622 98
283 3300005563 Ga0068855_101226911 Ga0068855_1012269111 98
284 3300005563 Ga0068855_101576146 Ga0068855_1015761461 98
285 3300005563 Ga0068855_102132109 Ga0068855_1021321091 98
286 3300005563 Ga0068855_102235263 Ga0068855_1022352632 98
287 3300005564 Ga0070664_100375736 Ga0070664_1003757361 98
288 3300005564 Ga0070664_100701946 Ga0070664_1007019462 98
289 3300005577 Ga0068857_100029821 Ga0068857_1000298216 98
290 3300005577 Ga0068857_100031231 Ga0068857_1000312312 98
291 3300005577 Ga0068857_100094013 Ga0068857_1000940132 98
292 3300005577 Ga0068857_100188529 Ga0068857_1001885292 98
293 3300005577 Ga0068857_100234145 Ga0068857_1002341452 98
294 3300005577 Ga0068857_100440521 Ga0068857_1004405212 98
295 3300005577 Ga0068857_100936628 Ga0068857_1009366282 98
296 3300005577 Ga0068857_101694606 Ga0068857_1016946062 98
297 3300005577 Ga0068857_101785867 Ga0068857_1017858671 98
298 3300005577 Ga0068857_102247610 Ga0068857_1022476101 98
299 3300005578 Ga0068854_100016369 Ga0068854_1000163695 98
300 3300005578 Ga0068854_100107513 Ga0068854_1001075132 98
301 3300005578 Ga0068854_102286787 Ga0068854_1022867872 98
302 3300005614 Ga0068856_100027825 Ga0068856_1000278253 98
303 3300005614 Ga0068856_100447260 Ga0068856_1004472602 98
304 3300005614 Ga0068856_101018113 Ga0068856_1010181132 98
305 3300005616 Ga0068852_100109259 Ga0068852_1001092593 98
306 3300005616 Ga0068852_100910838 Ga0068852_1009108381 98
307 3300005616 Ga0068852_101076526 Ga0068852_1010765262 98
308 3300005616 Ga0068852_101451985 Ga0068852_1014519852 98
309 3300005617 Ga0068859_100004323 Ga0068859_1000043239 98
310 3300005617 Ga0068859_100011775 Ga0068859_1000117752 98
311 3300005617 Ga0068859_100029853 Ga0068859_1000298536 98
312 3300005618 Ga0068864_100000005 Ga0068864_1000000054 98
313 3300005618 Ga0068864_100010775 Ga0068864_1000107752 98
314 3300005618 Ga0068864_100432511 Ga0068864_1004325112 98
315 3300005618 Ga0068864_100731752 Ga0068864_1007317522 98
316 3300005719 Ga0068861_100000108 Ga0068861_10000010843 98
317 3300005719 Ga0068861_100001464 Ga0068861_10000146411 98
318 3300005719 Ga0068861_101917074 Ga0068861_1019170742 98
319 3300005834 Ga0068851_10012072 Ga0068851_100120722 98
320 3300005834 Ga0068851_10328221 Ga0068851_103282212 98
321 3300005834 Ga0068851_10328223 Ga0068851_103282232 98
322 3300005841 Ga0068863_100053964 Ga0068863_1000539642 98
323 3300005842 Ga0068858_100000583 Ga0068858_10000058337 98
324 3300005842 Ga0068858_100003492 Ga0068858_1000034922 98
325 3300005842 Ga0068858_100238411 Ga0068858_1002384112 98
326 3300005843 Ga0068860_100023270 Ga0068860_1000232707 98
327 3300005843 Ga0068860_100264595 Ga0068860_1002645952 98
328 3300005843 Ga0068860_100785965 Ga0068860_1007859652 98
329 3300005844 Ga0068862_100000001 Ga0068862_100000001464 98
330 3300005844 Ga0068862_100000063 Ga0068862_10000006341 98
331 3300005844 Ga0068862_100010294 Ga0068862_1000102948 98
332 3300005985 Ga0081539_10076735 Ga0081539_100767353 98
333 3300006038 Ga0075365_10010903 Ga0075365_100109034 98
334 3300006042 Ga0075368_10000252 Ga0075368_100002524 98
335 3300006042 Ga0075368_10008082 Ga0075368_100080822 98
336 3300006048 Ga0075363_100011199 Ga0075363_1000111993 98
337 3300006048 Ga0075363_100013169 Ga0075363_1000131692 98
338 3300006051 Ga0075364_10158281 Ga0075364_101582812 98
339 3300006051 Ga0075364_10391812 Ga0075364_103918122 98
340 3300006177 Ga0075362_10031948 Ga0075362_100319482 98
341 3300006177 Ga0075362_10045995 Ga0075362_100459952 98
342 3300006178 Ga0075367_10000054 Ga0075367_1000005419 98
343 3300006178 Ga0075367_10081583 Ga0075367_100815832 98
344 3300006186 Ga0075369_10041542 Ga0075369_100415422 98
345 3300006186 Ga0075369_10099471 Ga0075369_100994712 98
346 3300006186 Ga0075369_10137443 Ga0075369_101374432 98
347 3300006195 Ga0075366_10022732 Ga0075366_100227323 98
348 3300006195 Ga0075366_10061991 Ga0075366_100619913 98
349 3300006195 Ga0075366_10090192 Ga0075366_100901922 98
350 3300006195 Ga0075366_10132441 Ga0075366_101324412 98
351 3300006195 Ga0075366_10167482 Ga0075366_101674822 98
352 3300006195 Ga0075366_10353807 Ga0075366_103538072 98
353 3300006195 Ga0075366_10501124 Ga0075366_105011242 98
354 3300006195 Ga0075366_10537137 Ga0075366_105371372 98
355 3300006237 Ga0097621_100144109 Ga0097621_1001441092 98
356 3300006353 Ga0075370_10057920 Ga0075370_100579202 98
357 3300006353 Ga0075370_10075998 Ga0075370_100759982 98
358 3300006353 Ga0075370_10092517 Ga0075370_100925172 98
359 3300006353 Ga0075370_10154405 Ga0075370_101544052 98
360 3300006353 Ga0075370_10665590 Ga0075370_106655902 98
361 3300006358 Ga0068871_100016843 Ga0068871_1000168432 98
362 3300006358 Ga0068871_100121930 Ga0068871_1001219302 98
363 3300006358 Ga0068871_101057055 Ga0068871_1010570552 98
364 3300006881 Ga0068865_101884820 Ga0068865_1018848201 98
365 3300006931 Ga0097620_100004323 Ga0097620_1000043239 98
366 3300006931 Ga0097620_100011775 Ga0097620_1000117758 98
367 3300006931 Ga0097620_100029854 Ga0097620_1000298546 98
368 3300006946 Ga0079104_1031866 Ga0079104_10318662 98
369 3300006946 Ga0079104_1087498 Ga0079104_10874982 98
370 3300009011 Ga0105251_10033437 Ga0105251_100334372 98
371 3300009093 Ga0105240_10000959 Ga0105240_100009597 98
372 3300009093 Ga0105240_10043982 Ga0105240_100439826 98
373 3300009093 Ga0105240_10229460 Ga0105240_102294602 98
374 3300009093 Ga0105240_10296092 Ga0105240_102960922 98
375 3300009094 Ga0111539_10440332 Ga0111539_104403322 98
376 3300009094 Ga0111539_11333045 Ga0111539_113330452 98
377 3300009098 Ga0105245_10001709 Ga0105245_100017096 98
378 3300009101 Ga0105247_10044573 Ga0105247_100445732 98
379 3300009147 Ga0114129_10128044 Ga0114129_101280442 98
380 3300009148 Ga0105243_10000122 Ga0105243_1000012267 98
381 3300009148 Ga0105243_10309260 Ga0105243_103092601 98
382 3300009148 Ga0105243_11425044 Ga0105243_114250442 98
383 3300009174 Ga0105241_10002257 Ga0105241_1000225713 98
384 3300009174 Ga0105241_10002409 Ga0105241_100024099 98
385 3300009174 Ga0105241_10466667 Ga0105241_104666672 98
386 3300009174 Ga0105241_10948388 Ga0105241_109483882 98
387 3300009177 Ga0105248_10000287 Ga0105248_1000028725 98
388 3300009177 Ga0105248_10007934 Ga0105248_100079346 98
389 3300009177 Ga0105248_10016133 Ga0105248_100161336 98
390 3300009177 Ga0105248_10025995 Ga0105248_100259957 98
391 3300009177 Ga0105248_10044942 Ga0105248_100449423 98
392 3300009177 Ga0105248_10180454 Ga0105248_101804543 98
393 3300009545 Ga0105237_10001281 Ga0105237_1000128130 98
394 3300009545 Ga0105237_10007067 Ga0105237_1000706710 98
395 3300009545 Ga0105237_10016910 Ga0105237_100169104 98
396 3300009545 Ga0105237_12136474 Ga0105237_121364742 98
397 3300009551 Ga0105238_10172228 Ga0105238_101722282 98
398 3300009551 Ga0105238_10193883 Ga0105238_101938832 98
399 3300009551 Ga0105238_10317298 Ga0105238_103172981 98
400 3300009551 Ga0105238_11229716 Ga0105238_112297161 98
401 3300009551 Ga0105238_12735462 Ga0105238_127354621 98
402 3300009553 Ga0105249_10008807 Ga0105249_100088078 98
403 3300009553 Ga0105249_10458298 Ga0105249_104582981 98
404 3300009553 Ga0105249_10485665 Ga0105249_104856653 98
405 3300009553 Ga0105249_11436545 Ga0105249_114365452 98
406 3300009978 Ga0105148_100027 Ga0105148_10002719 98
407 3300010375 Ga0105239_10000156 Ga0105239_1000015649 98
408 3300010375 Ga0105239_10007208 Ga0105239_100072087 98
409 3300010375 Ga0105239_10232710 Ga0105239_102327102 98
410 3300010375 Ga0105239_11127209 Ga0105239_111272092 98
411 3300010375 Ga0105239_11149125 Ga0105239_111491252 98
412 3300010375 Ga0105239_11265648 Ga0105239_112656482 98
413 3300010375 Ga0105239_11314522 Ga0105239_113145222 98
414 3300011119 Ga0105246_10000632 Ga0105246_1000063218 98
415 3300011119 Ga0105246_10479629 Ga0105246_104796292 98
416 3300013100 Ga0157373_10024990 Ga0157373_100249905 98
417 3300013100 Ga0157373_10047725 Ga0157373_100477254 98
418 3300013100 Ga0157373_10341584 Ga0157373_103415842 98
419 3300013100 Ga0157373_10464031 Ga0157373_104640312 98
420 3300013100 Ga0157373_10732326 Ga0157373_107323262 98
421 3300013102 Ga0157371_10000030 Ga0157371_1000003017 98
422 3300013102 Ga0157371_10061175 Ga0157371_100611753 98
423 3300013102 Ga0157371_10128777 Ga0157371_101287772 98
424 3300013102 Ga0157371_10532220 Ga0157371_105322202 98
425 3300013104 Ga0157370_10008634 Ga0157370_100086349 98
426 3300013104 Ga0157370_10302970 Ga0157370_103029702 98
427 3300013104 Ga0157370_10440254 Ga0157370_104402542 98
428 3300013104 Ga0157370_11346144 Ga0157370_113461442 98
429 3300013104 Ga0157370_11783019 Ga0157370_117830192 98
430 3300013105 Ga0157369_10241631 Ga0157369_102416312 98
431 3300013105 Ga0157369_10321648 Ga0157369_103216482 98
432 3300013105 Ga0157369_10800289 Ga0157369_108002892 98
433 3300013105 Ga0157369_10990585 Ga0157369_109905852 98
434 3300013296 Ga0157374_10110705 Ga0157374_101107052 98
435 3300013296 Ga0157374_11535133 Ga0157374_115351332 98
436 3300013297 Ga0157378_10018055 Ga0157378_100180556 98
437 3300013297 Ga0157378_10021666 Ga0157378_100216664 98
438 3300013297 Ga0157378_10590595 Ga0157378_105905952 98
439 3300013297 Ga0157378_10755571 Ga0157378_107555712 98
440 3300013297 Ga0157378_12278574 Ga0157378_122785742 98
441 3300013306 Ga0163162_10018196 Ga0163162_100181966 98
442 3300013306 Ga0163162_10283936 Ga0163162_102839362 98
443 3300013306 Ga0163162_10437876 Ga0163162_104378762 98
444 3300013306 Ga0163162_10700924 Ga0163162_107009242 98
445 3300013306 Ga0163162_10829236 Ga0163162_108292362 98
446 3300013306 Ga0163162_11273318 Ga0163162_112733182 98
447 3300013307 Ga0157372_10532860 Ga0157372_105328602 98
448 3300013307 Ga0157372_10588635 Ga0157372_105886352 98
449 3300013307 Ga0157372_11851521 Ga0157372_118515211 98
450 3300013308 Ga0157375_10149491 Ga0157375_101494912 98
451 3300013308 Ga0157375_10745285 Ga0157375_107452852 98
452 3300013308 Ga0157375_10815281 Ga0157375_108152812 98
453 3300013308 Ga0157375_11299390 Ga0157375_112993902 98
454 3300013308 Ga0157375_13309586 Ga0157375_133095862 98
455 3300014325 Ga0163163_10015793 Ga0163163_1001579310 98
456 3300014325 Ga0163163_10340374 Ga0163163_103403742 98
457 3300014325 Ga0163163_11174288 Ga0163163_111742881 98
458 3300014326 Ga0157380_10000673 Ga0157380_100006735 98
459 3300014326 Ga0157380_10000755 Ga0157380_1000075516 98
460 3300014326 Ga0157380_10077149 Ga0157380_100771492 98
461 3300014326 Ga0157380_10335578 Ga0157380_103355782 98
462 3300014326 Ga0157380_10351677 Ga0157380_103516772 98
463 3300014326 Ga0157380_11368554 Ga0157380_113685542 98
464 3300014745 Ga0157377_11451075 Ga0157377_114510751 98
465 3300014968 Ga0157379_10093716 Ga0157379_100937162 98
466 3300014968 Ga0157379_11099376 Ga0157379_110993762 98
467 3300014969 Ga0157376_10239100 Ga0157376_102391003 98
468 3300015690 Ga0183363_1005 Ga0183363_1005200 98
469 3300017792 Ga0163161_10033177 Ga0163161_100331775 98
470 3300017792 Ga0163161_10034292 Ga0163161_100342924 98
471 3300017792 Ga0163161_10222252 Ga0163161_102222522 98
472 3300017792 Ga0163161_10421299 Ga0163161_104212992 98
473 3300017792 Ga0163161_11343277 Ga0163161_113432772 98
474 3300017792 Ga0163161_11518759 Ga0163161_115187592 98
475 3300017792 Ga0163161_11979300 Ga0163161_119793002 98
476 3300020069 Ga0197907_11373989 Ga0197907_113739892 98
477 3300020070 Ga0206356_10423289 Ga0206356_104232891 98
478 3300020077 Ga0206351_10390730 Ga0206351_103907301 98
479 3300020082 Ga0206353_10505260 Ga0206353_105052602 98
480 3300020082 Ga0206353_10958977 Ga0206353_109589772 98
481 3300021377 Ga0213874_10433940 Ga0213874_104339402 98
482 3300021384 Ga0213876_10314389 Ga0213876_103143892 98
483 3300022467 Ga0224712_10056485 Ga0224712_100564852 98
484 3300025226 Ga0209674_104916 Ga0209674_1049162 98
485 3300025229 Ga0209147_100491 Ga0209147_1004916 98
486 3300025230 Ga0209563_100047 Ga0209563_100047229 98
487 3300025245 Ga0207425_1000037 Ga0207425_1000037106 98
488 3300025246 Ga0209646_1004404 Ga0209646_10044043 98
489 3300025250 Ga0209026_1005891 Ga0209026_10058913 98
490 3300025250 Ga0209026_1041594 Ga0209026_10415941 98
491 3300025253 Ga0209677_104802 Ga0209677_1048024 98
492 3300025254 Ga0209148_1000017 Ga0209148_1000017171 98
493 3300025258 Ga0209129_1000363 Ga0209129_100036320 98
494 3300025261 Ga0209233_1000058 Ga0209233_1000058208 98
495 3300025263 Ga0209565_1000012 Ga0209565_1000012187 98
496 3300025263 Ga0209565_1000427 Ga0209565_100042722 98
497 3300025263 Ga0209565_1067009 Ga0209565_10670092 98
498 3300025272 Ga0209455_1000005 Ga0209455_1000005171 98
499 3300025273 Ga0209673_1029026 Ga0209673_10290262 98
500 3300025273 Ga0209673_1045116 Ga0209673_10451162 98
501 3300025291 Ga0209675_1000097 Ga0209675_1000097110 98
502 3300025291 Ga0209675_1023972 Ga0209675_10239722 98
503 3300025292 Ga0209676_1000060 Ga0209676_100006075 98
504 3300025292 Ga0209676_1000175 Ga0209676_100017544 98
505 3300025292 Ga0209676_1000298 Ga0209676_100029856 98
506 3300025292 Ga0209676_1002287 Ga0209676_10022877 98
507 3300025292 Ga0209676_1021394 Ga0209676_10213943 98
508 3300025294 Ga0209025_1000117 Ga0209025_100011766 98
509 3300025294 Ga0209025_1028779 Ga0209025_10287792 98
510 3300025295 Ga0209564_1003622 Ga0209564_10036226 98
511 3300025295 Ga0209564_1005290 Ga0209564_10052902 98
512 3300025297 Ga0209758_1000035 Ga0209758_1000035159 98
513 3300025297 Ga0209758_1000103 Ga0209758_1000103106 98
514 3300025297 Ga0209758_1041032 Ga0209758_10410322 98
515 3300025298 Ga0209050_1000001 Ga0209050_10000013341 98
516 3300025298 Ga0209050_1000014 Ga0209050_1000014492 98
517 3300025298 Ga0209050_1001389 Ga0209050_10013897 98
518 3300025298 Ga0209050_1002628 Ga0209050_10026284 98
519 3300025298 Ga0209050_1004951 Ga0209050_10049513 98
520 3300025298 Ga0209050_1006341 Ga0209050_10063412 98
521 3300025298 Ga0209050_1014852 Ga0209050_10148523 98
522 3300025298 Ga0209050_1014985 Ga0209050_10149851 98
523 3300025299 Ga0209256_1000012 Ga0209256_1000012378 98
524 3300025302 Ga0207426_1048373 Ga0207426_10483732 98
525 3300025303 Ga0209051_1003509 Ga0209051_10035097 98
526 3300025304 Ga0209257_1000019 Ga0209257_1000019200 98
527 3300025304 Ga0209257_1000174 Ga0209257_1000174120 98
528 3300025304 Ga0209257_1005036 Ga0209257_10050366 98
529 3300025304 Ga0209257_1005111 Ga0209257_10051115 98
530 3300025304 Ga0209257_1011340 Ga0209257_10113405 98
531 3300025304 Ga0209257_1015537 Ga0209257_10155373 98
532 3300025304 Ga0209257_1027653 Ga0209257_10276532 98
533 3300025304 Ga0209257_1077966 Ga0209257_10779662 98
534 3300025315 Ga0207697_10116410 Ga0207697_101164102 98
535 3300025321 Ga0207656_10018806 Ga0207656_100188062 98
536 3300025321 Ga0207656_10228920 Ga0207656_102289201 98
537 3300025893 Ga0207682_10154897 Ga0207682_101548972 98
538 3300025893 Ga0207682_10184515 Ga0207682_101845152 98
539 3300025900 Ga0207710_10034124 Ga0207710_100341242 98
540 3300025901 Ga0207688_10018544 Ga0207688_100185442 98
541 3300025901 Ga0207688_10297330 Ga0207688_102973302 98
542 3300025903 Ga0207680_10159744 Ga0207680_101597443 98
543 3300025903 Ga0207680_10258292 Ga0207680_102582922 98
544 3300025904 Ga0207647_10008063 Ga0207647_100080632 98
545 3300025904 Ga0207647_10034522 Ga0207647_100345224 98
546 3300025909 Ga0207705_10000163 Ga0207705_1000016349 98
547 3300025909 Ga0207705_10052748 Ga0207705_100527483 98
548 3300025909 Ga0207705_10206861 Ga0207705_102068612 98
549 3300025911 Ga0207654_10000852 Ga0207654_1000085212 98
550 3300025911 Ga0207654_10340074 Ga0207654_103400742 98
551 3300025913 Ga0207695_10000521 Ga0207695_1000052131 98
552 3300025913 Ga0207695_10015077 Ga0207695_100150772 98
553 3300025913 Ga0207695_10294189 Ga0207695_102941892 98
554 3300025913 Ga0207695_10737600 Ga0207695_107376002 98
555 3300025914 Ga0207671_10000607 Ga0207671_1000060723 98
556 3300025914 Ga0207671_10003706 Ga0207671_100037064 98
557 3300025914 Ga0207671_10046407 Ga0207671_100464074 98
558 3300025914 Ga0207671_10116984 Ga0207671_101169842 98
559 3300025918 Ga0207662_10296928 Ga0207662_102969282 98
560 3300025919 Ga0207657_10023497 Ga0207657_100234975 98
561 3300025919 Ga0207657_10124830 Ga0207657_101248302 98
562 3300025919 Ga0207657_10280892 Ga0207657_102808922 98
563 3300025920 Ga0207649_10000199 Ga0207649_1000019932 98
564 3300025920 Ga0207649_10676515 Ga0207649_106765152 98
565 3300025921 Ga0207652_10296559 Ga0207652_102965592 98
566 3300025922 Ga0207646_10380072 Ga0207646_103800722 98
567 3300025922 Ga0207646_10415378 Ga0207646_104153782 98
568 3300025923 Ga0207681_10000041 Ga0207681_1000004191 98
569 3300025923 Ga0207681_10045969 Ga0207681_100459692 98
570 3300025923 Ga0207681_10142103 Ga0207681_101421032 98
571 3300025923 Ga0207681_10177893 Ga0207681_101778933 98
572 3300025923 Ga0207681_10342918 Ga0207681_103429182 98
573 3300025923 Ga0207681_10491650 Ga0207681_104916502 98
574 3300025923 Ga0207681_10590246 Ga0207681_105902462 98
575 3300025923 Ga0207681_11172944 Ga0207681_111729442 98
576 3300025923 Ga0207681_11853343 Ga0207681_118533432 98
577 3300025924 Ga0207694_10049988 Ga0207694_100499882 98
578 3300025924 Ga0207694_10078972 Ga0207694_100789723 98
579 3300025924 Ga0207694_10115061 Ga0207694_101150613 98
580 3300025924 Ga0207694_10161421 Ga0207694_101614212 98
581 3300025925 Ga0207650_10000004 Ga0207650_10000004137 98
582 3300025925 Ga0207650_10199865 Ga0207650_101998652 98
583 3300025925 Ga0207650_10230377 Ga0207650_102303772 98
584 3300025926 Ga0207659_10121130 Ga0207659_101211302 98
585 3300025926 Ga0207659_10678981 Ga0207659_106789812 98
586 3300025926 Ga0207659_11038005 Ga0207659_110380052 98
587 3300025927 Ga0207687_10009517 Ga0207687_100095177 98
588 3300025931 Ga0207644_10026502 Ga0207644_100265024 98
589 3300025932 Ga0207690_10003817 Ga0207690_100038178 98
590 3300025932 Ga0207690_10045855 Ga0207690_100458554 98
591 3300025932 Ga0207690_10838160 Ga0207690_108381602 98
592 3300025933 Ga0207706_10007087 Ga0207706_100070873 98
593 3300025933 Ga0207706_10017165 Ga0207706_100171653 98
594 3300025933 Ga0207706_10062160 Ga0207706_100621602 98
595 3300025933 Ga0207706_10529829 Ga0207706_105298292 98
596 3300025933 Ga0207706_10622765 Ga0207706_106227652 98
597 3300025933 Ga0207706_11109105 Ga0207706_111091052 98
598 3300025935 Ga0207709_10000083 Ga0207709_1000008366 98
599 3300025935 Ga0207709_10144276 Ga0207709_101442761 98
600 3300025935 Ga0207709_10187733 Ga0207709_101877332 98
601 3300025937 Ga0207669_10000071 Ga0207669_1000007136 98
602 3300025937 Ga0207669_10004349 Ga0207669_100043495 98
603 3300025937 Ga0207669_10647147 Ga0207669_106471472 98
604 3300025938 Ga0207704_11659004 Ga0207704_116590042 98
605 3300025940 Ga0207691_10217130 Ga0207691_102171302 98
606 3300025941 Ga0207711_10000480 Ga0207711_1000048042 98
607 3300025941 Ga0207711_10017203 Ga0207711_100172034 98
608 3300025941 Ga0207711_10074305 Ga0207711_100743052 98
609 3300025941 Ga0207711_10850183 Ga0207711_108501832 98
610 3300025942 Ga0207689_10571751 Ga0207689_105717512 98
611 3300025944 Ga0207661_10346723 Ga0207661_103467232 98
612 3300025945 Ga0207679_10114674 Ga0207679_101146742 98
613 3300025945 Ga0207679_10741231 Ga0207679_107412312 98
614 3300025945 Ga0207679_11315222 Ga0207679_113152222 98
615 3300025949 Ga0207667_10000004 Ga0207667_10000004162 98
616 3300025949 Ga0207667_10001602 Ga0207667_1000160223 98
617 3300025949 Ga0207667_10204288 Ga0207667_102042882 98
618 3300025949 Ga0207667_10451985 Ga0207667_104519852 98
619 3300025949 Ga0207667_10665358 Ga0207667_106653582 98
620 3300025949 Ga0207667_11415234 Ga0207667_114152342 98
621 3300025960 Ga0207651_10210381 Ga0207651_102103812 98
622 3300025960 Ga0207651_10370198 Ga0207651_103701982 98
623 3300025960 Ga0207651_10837605 Ga0207651_108376052 98
624 3300025961 Ga0207712_10000069 Ga0207712_10000069129 98
625 3300025961 Ga0207712_10290754 Ga0207712_102907542 98
626 3300025961 Ga0207712_11093568 Ga0207712_110935682 98
627 3300025972 Ga0207668_10018151 Ga0207668_100181512 98
628 3300025972 Ga0207668_10041472 Ga0207668_100414722 98
629 3300025972 Ga0207668_10101044 Ga0207668_101010442 98
630 3300025972 Ga0207668_10369505 Ga0207668_103695052 98
631 3300025972 Ga0207668_10753815 Ga0207668_107538152 98
632 3300025972 Ga0207668_11094158 Ga0207668_110941582 98
633 3300025972 Ga0207668_11132687 Ga0207668_111326872 98
634 3300025981 Ga0207640_10007619 Ga0207640_100076197 98
635 3300025981 Ga0207640_10011830 Ga0207640_100118305 98
636 3300025981 Ga0207640_10021447 Ga0207640_100214474 98
637 3300025981 Ga0207640_10028310 Ga0207640_100283102 98
638 3300025981 Ga0207640_10057450 Ga0207640_100574503 98
639 3300025981 Ga0207640_10688311 Ga0207640_106883112 98
640 3300025986 Ga0207658_10009452 Ga0207658_100094526 98
641 3300025986 Ga0207658_10183878 Ga0207658_101838782 98
642 3300025986 Ga0207658_10871864 Ga0207658_108718642 98
643 3300025986 Ga0207658_11092955 Ga0207658_110929551 98
644 3300025986 Ga0207658_11310604 Ga0207658_113106042 98
645 3300026023 Ga0207677_11937663 Ga0207677_119376632 98
646 3300026035 Ga0207703_10000715 Ga0207703_1000071533 98
647 3300026035 Ga0207703_10001509 Ga0207703_100015092 98
648 3300026035 Ga0207703_10135086 Ga0207703_101350863 98
649 3300026041 Ga0207639_10000138 Ga0207639_1000013822 98
650 3300026041 Ga0207639_10000414 Ga0207639_100004142 98
651 3300026041 Ga0207639_10000510 Ga0207639_1000051025 98
652 3300026041 Ga0207639_10000631 Ga0207639_100006312 98
653 3300026041 Ga0207639_10011189 Ga0207639_100111895 98
654 3300026041 Ga0207639_10164033 Ga0207639_101640332 98
655 3300026041 Ga0207639_10227672 Ga0207639_102276721 98
656 3300026067 Ga0207678_10002459 Ga0207678_1000245912 98
657 3300026067 Ga0207678_10003700 Ga0207678_100037005 98
658 3300026078 Ga0207702_10003043 Ga0207702_100030432 98
659 3300026078 Ga0207702_10531268 Ga0207702_105312682 98
660 3300026088 Ga0207641_10041729 Ga0207641_100417292 98
661 3300026095 Ga0207676_10000006 Ga0207676_10000006573 98
662 3300026095 Ga0207676_10000691 Ga0207676_1000069122 98
663 3300026095 Ga0207676_12156681 Ga0207676_121566812 98
664 3300026116 Ga0207674_10006416 Ga0207674_1000641617 98
665 3300026116 Ga0207674_10010631 Ga0207674_1001063110 98
666 3300026116 Ga0207674_10036911 Ga0207674_100369116 98
667 3300026116 Ga0207674_10041762 Ga0207674_100417623 98
668 3300026116 Ga0207674_10297659 Ga0207674_102976593 98
669 3300026116 Ga0207674_10393357 Ga0207674_103933571 98
670 3300026116 Ga0207674_10514476 Ga0207674_105144762 98
671 3300026116 Ga0207674_12237726 Ga0207674_122377261 98
672 3300026118 Ga0207675_100000309 Ga0207675_10000030937 98
673 3300026118 Ga0207675_100000400 Ga0207675_10000040040 98
674 3300026118 Ga0207675_102505765 Ga0207675_1025057652 98
675 3300026121 Ga0207683_10001740 Ga0207683_100017407 98
676 3300026121 Ga0207683_10411708 Ga0207683_104117082 98
677 3300026142 Ga0207698_10001107 Ga0207698_100011072 98
678 3300026142 Ga0207698_10089829 Ga0207698_100898292 98
679 3300026142 Ga0207698_10491433 Ga0207698_104914332 98
680 3300026142 Ga0207698_10540719 Ga0207698_105407192 98
681 3300026142 Ga0207698_11077887 Ga0207698_110778872 98
682 3300026142 Ga0207698_11787572 Ga0207698_117875722 98
683 3300027665 Ga0209983_1024418 Ga0209983_10244182 98
684 3300027866 Ga0209813_10000063 Ga0209813_1000006336 98
685 3300027866 Ga0209813_10002858 Ga0209813_100028584 98
686 3300027876 Ga0209974_10001093 Ga0209974_100010936 98
687 3300027907 Ga0207428_11112655 Ga0207428_111126551 98
688 3300028379 Ga0268266_10000002 Ga0268266_100000021809 98
689 3300028379 Ga0268266_10456578 Ga0268266_104565782 98
690 3300028379 Ga0268266_10895661 Ga0268266_108956612 98
691 3300028379 Ga0268266_11037509 Ga0268266_110375092 98
692 3300028379 Ga0268266_11142570 Ga0268266_111425701 98
693 3300028380 Ga0268265_10000001 Ga0268265_10000001572 98
694 3300028380 Ga0268265_10000055 Ga0268265_10000055119 98
695 3300028380 Ga0268265_10213788 Ga0268265_102137882 98
696 3300028381 Ga0268264_10000381 Ga0268264_1000038164 98
697 3300028786 Ga0307517_10065328 Ga0307517_100653285 98
698 3300028786 Ga0307517_10361308 Ga0307517_103613082 98
699 3300028794 Ga0307515_10264001 Ga0307515_102640011 98
700 3300031456 Ga0307513_10010089 Ga0307513_100100893 98
701 3300031456 Ga0307513_10015055 Ga0307513_100150552 98
702 3300031548 Ga0307408_100044971 Ga0307408_1000449714 98
703 3300031548 Ga0307408_100070707 Ga0307408_1000707073 98
704 3300031548 Ga0307408_100084371 Ga0307408_1000843713 98
705 3300031548 Ga0307408_100204844 Ga0307408_1002048442 98
706 3300031548 Ga0307408_100250903 Ga0307408_1002509032 98
707 3300031548 Ga0307408_100404388 Ga0307408_1004043881 98
708 3300031548 Ga0307408_100431046 Ga0307408_1004310462 98
709 3300031548 Ga0307408_100980300 Ga0307408_1009803002 98
710 3300031548 Ga0307408_101049808 Ga0307408_1010498082 98
711 3300031548 Ga0307408_102039583 Ga0307408_1020395831 98
712 3300031616 Ga0307508_10005365 Ga0307508_100053659 98
713 3300031731 Ga0307405_10004910 Ga0307405_100049106 98
714 3300031731 Ga0307405_10009565 Ga0307405_100095654 98
715 3300031731 Ga0307405_10082731 Ga0307405_100827312 98
716 3300031731 Ga0307405_10370699 Ga0307405_103706992 98
717 3300031731 Ga0307405_10762230 Ga0307405_107622302 98
718 3300031731 Ga0307405_11050431 Ga0307405_110504312 98
719 3300031731 Ga0307405_11133832 Ga0307405_111338322 98
720 3300031733 Ga0316577_10092435 Ga0316577_100924352 98
721 3300031824 Ga0307413_10044933 Ga0307413_100449332 98
722 3300031824 Ga0307413_10073468 Ga0307413_100734683 98
723 3300031824 Ga0307413_10084823 Ga0307413_100848233 98
724 3300031824 Ga0307413_10103732 Ga0307413_101037322 98
725 3300031824 Ga0307413_10146455 Ga0307413_101464552 98
726 3300031824 Ga0307413_10169563 Ga0307413_101695632 98
727 3300031824 Ga0307413_10393412 Ga0307413_103934122 98
728 3300031824 Ga0307413_10605513 Ga0307413_106055132 98
729 3300031824 Ga0307413_10697101 Ga0307413_106971012 98
730 3300031824 Ga0307413_10844256 Ga0307413_108442562 98
731 3300031824 Ga0307413_10963448 Ga0307413_109634482 98
732 3300031824 Ga0307413_11554865 Ga0307413_115548652 98
733 3300031824 Ga0307413_12103167 Ga0307413_121031672 98
734 3300031852 Ga0307410_10190435 Ga0307410_101904352 98
735 3300031852 Ga0307410_10204849 Ga0307410_102048492 98
736 3300031852 Ga0307410_11037292 Ga0307410_110372922 98
737 3300031852 Ga0307410_11175373 Ga0307410_111753732 98
738 3300031852 Ga0307410_12043752 Ga0307410_120437522 98
739 3300031901 Ga0307406_10002286 Ga0307406_100022863 98
740 3300031901 Ga0307406_10051820 Ga0307406_100518202 98
741 3300031901 Ga0307406_10328878 Ga0307406_103288782 98
742 3300031901 Ga0307406_10395285 Ga0307406_103952852 98
743 3300031901 Ga0307406_10496583 Ga0307406_104965832 98
744 3300031901 Ga0307406_10686566 Ga0307406_106865662 98
745 3300031901 Ga0307406_10862838 Ga0307406_108628382 98
746 3300031903 Ga0307407_10044269 Ga0307407_100442693 98
747 3300031903 Ga0307407_10625440 Ga0307407_106254402 98
748 3300031911 Ga0307412_10000950 Ga0307412_1000095012 98
749 3300031911 Ga0307412_10013155 Ga0307412_100131554 98
750 3300031911 Ga0307412_10035518 Ga0307412_100355184 98
751 3300031911 Ga0307412_10035799 Ga0307412_100357993 98
752 3300031911 Ga0307412_10062673 Ga0307412_100626733 98
753 3300031911 Ga0307412_10065616 Ga0307412_100656163 98
754 3300031911 Ga0307412_10071061 Ga0307412_100710612 98
755 3300031911 Ga0307412_10135036 Ga0307412_101350362 98
756 3300031911 Ga0307412_10181563 Ga0307412_101815632 98
757 3300031911 Ga0307412_10276572 Ga0307412_102765721 98
758 3300031911 Ga0307412_10279333 Ga0307412_102793332 98
759 3300031911 Ga0307412_10983596 Ga0307412_109835962 98
760 3300031911 Ga0307412_11030838 Ga0307412_110308382 98
761 3300031911 Ga0307412_11448082 Ga0307412_114480822 98
762 3300031911 Ga0307412_11595562 Ga0307412_115955622 98
763 3300031995 Ga0307409_100099251 Ga0307409_1000992512 98
764 3300031995 Ga0307409_100124850 Ga0307409_1001248502 98
765 3300031995 Ga0307409_100359727 Ga0307409_1003597272 98
766 3300031995 Ga0307409_101075659 Ga0307409_1010756592 98
767 3300031995 Ga0307409_101395479 Ga0307409_1013954791 98
768 3300031995 Ga0307409_102251672 Ga0307409_1022516722 98
769 3300032002 Ga0307416_100014228 Ga0307416_1000142282 98
770 3300032002 Ga0307416_100078949 Ga0307416_1000789493 98
771 3300032002 Ga0307416_100195156 Ga0307416_1001951562 98
772 3300032002 Ga0307416_100297322 Ga0307416_1002973222 98
773 3300032002 Ga0307416_100595634 Ga0307416_1005956342 98
774 3300032002 Ga0307416_101202531 Ga0307416_1012025312 98
775 3300032002 Ga0307416_101251196 Ga0307416_1012511962 98
776 3300032004 Ga0307414_10000402 Ga0307414_1000040215 98
777 3300032004 Ga0307414_10001891 Ga0307414_100018915 98
778 3300032004 Ga0307414_10018465 Ga0307414_100184654 98
779 3300032004 Ga0307414_10038219 Ga0307414_100382192 98
780 3300032004 Ga0307414_10078400 Ga0307414_100784002 98
781 3300032004 Ga0307414_10121142 Ga0307414_101211423 98
782 3300032004 Ga0307414_10244896 Ga0307414_102448962 98
783 3300032004 Ga0307414_10273465 Ga0307414_102734652 98
784 3300032004 Ga0307414_10445182 Ga0307414_104451822 98
785 3300032004 Ga0307414_10472269 Ga0307414_104722691 98
786 3300032004 Ga0307414_10517500 Ga0307414_105175002 98
787 3300032004 Ga0307414_10654838 Ga0307414_106548382 98
788 3300032004 Ga0307414_10673272 Ga0307414_106732722 98
789 3300032004 Ga0307414_10903635 Ga0307414_109036351 98
790 3300032004 Ga0307414_10966679 Ga0307414_109666792 98
791 3300032004 Ga0307414_11186195 Ga0307414_111861951 98
792 3300032004 Ga0307414_11259150 Ga0307414_112591501 98
793 3300032004 Ga0307414_11323529 Ga0307414_113235292 98
794 3300032004 Ga0307414_11449077 Ga0307414_114490772 98
795 3300032004 Ga0307414_11569562 Ga0307414_115695622 98
796 3300032004 Ga0307414_11697238 Ga0307414_116972382 98
797 3300032005 Ga0307411_10301428 Ga0307411_103014282 98
798 3300032005 Ga0307411_10321106 Ga0307411_103211062 98
799 3300032005 Ga0307411_11142703 Ga0307411_111427032 98
800 3300032005 Ga0307411_11252254 Ga0307411_112522542 98
801 3300032005 Ga0307411_11273438 Ga0307411_112734382 98
802 3300032126 Ga0307415_100098837 Ga0307415_1000988372 98
803 3300032126 Ga0307415_101747886 Ga0307415_1017478862 98
804 3300032126 Ga0307415_102171547 Ga0307415_1021715472 98
805 3300033180 Ga0307510_10009662 Ga0307510_1000966210 98
806 3300035398 Ga0316574_0706846 Ga0316574_0706846_22_321 98
807 3300036712 Ga0316584_0510960 Ga0316584_0510960_182_481 98
808 3300037312 Ga0395899_0178310 Ga0395899_0178310_653_976 98
809 3300037853 Ga0436364_0530420 Ga0436364_0530420_86303_86599 98
810 3300037853 Ga0436364_0928985 Ga0436364_0928985_1742_2038 98
811 3300038443 Ga0395901_0108157 Ga0395901_0108157_1186_1482 98
812 3300038443 Ga0395901_0205414 Ga0395901_0205414_1560_1856 98
813 3300038705 Ga0237819_00832 Ga0237819_00832_6771_7067 98
814 3300039437 Ga0436365_0255801 Ga0436365_0255801_237_533 98
815 3300039437 Ga0436365_0375564 Ga0436365_0375564_1273_1569 98
816 3300039437 Ga0436365_0571419 Ga0436365_0571419_42_338 98
817 3300039450 Ga0436363_0495682 Ga0436363_0495682_186_482 98
818 3300039450 Ga0436363_1680954 Ga0436363_1680954_314_640 98
819 3300041404 Ga0439436_0018761 Ga0439436_0018761_1475_1771 98
820 3300041404 Ga0439436_0137832 Ga0439436_0137832_198_494 98
821 3300041410 Ga0439461_0000282 Ga0439461_0000282_2998_3294 98
822 3300041410 Ga0439461_0140690 Ga0439461_0140690_229_531 98
823 3300041411 Ga0439466_0065719 Ga0439466_0065719_670_966 98
824 3300041413 Ga0439465_0004149 Ga0439465_0004149_3606_3902 98
825 3300041443 Ga0451789_1323950 Ga0451789_1323950_214_510 98
826 3300041451 Ga0451791_0004095 Ga0451791_0004095_244_546 98
827 3300041451 Ga0451791_1323816 Ga0451791_1323816_133_429 98
828 3300041451 Ga0451791_1781184 Ga0451791_1781184_203_499 98
829 3300041460 Ga0451802_1880086 Ga0451802_1880086_176_475 98
830 3300041463 Ga0451804_1088671 Ga0451804_1088671_91_393 98
831 3300041486 Ga0451807_0190259 Ga0451807_0190259_214_510 98
832 3300041486 Ga0451807_0329435 Ga0451807_0329435_108_404 98
833 3300041491 Ga0451833_0606967 Ga0451833_0606967_301_600 98
834 3300041494 Ga0451837_1233901 Ga0451837_1233901_29_325 98
835 3300041498 Ga0451841_0204279 Ga0451841_0204279_115_411 98
836 3300041498 Ga0451841_0601808 Ga0451841_0601808_124_426 98
837 3300041509 Ga0451843_0273453 Ga0451843_0273453_505_801 98
838 3300041509 Ga0451843_0328850 Ga0451843_0328850_128_424 98
839 3300041511 Ga0451855_1280009 Ga0451855_1280009_123_419 98
840 3300041512 Ga0451853_1666297 Ga0451853_1666297_248_544 98
841 3300041997 Ga0439431_0065349 Ga0439431_0065349_394_690 98
842 3300041997 Ga0439431_0136679 Ga0439431_0136679_43_339 98
843 3300042002 Ga0439442_032520 Ga0439442_032520_456_752 98
844 3300042004 Ga0439445_0003320 Ga0439445_0003320_1361_1657 98
845 3300042004 Ga0439445_0173222 Ga0439445_0173222_76_372 98
846 3300042006 Ga0439432_003330 Ga0439432_003330_329_625 98
847 3300042014 Ga0439457_052627 Ga0439457_052627_250_546 98
848 3300042015 Ga0439462_0008838 Ga0439462_0008838_575_871 98
849 3300042015 Ga0439462_0011511 Ga0439462_0011511_172_468 98
850 3300042116 Ga0450912_000546 Ga0450912_000546_610_912 98
851 3300042116 Ga0450912_008590 Ga0450912_008590_431_727 98
852 3300042122 Ga0450920_044532 Ga0450920_044532_456_758 98
853 3300042156 Ga0439446_0100651 Ga0439446_0100651_164_460 98
854 3300042435 Ga0439434_0001642 Ga0439434_0001642_5473_5769 98
855 3300042436 Ga0439435_0006215 Ga0439435_0006215_1396_1698 98
856 3300042532 Ga0450893_0030345 Ga0450893_0030345_358_660 98
857 3300042876 Ga0451577_0183229 Ga0451577_0183229_1111_1407 98
858 3300044712 Ga0453684_0193386 Ga0453684_0193386_584_880 98
859 3300044842 Ga0466957_0218865 Ga0466957_0218865_405_704 98
860 3300045051 Ga0451576_0000588 Ga0451576_0000588_25554_25853 98
861 3300045051 Ga0451576_0181078 Ga0451576_0181078_1182_1478 98
862 3300046452 Ga0495617_262793 Ga0495617_262793_95_391 98
863 3300046453 Ga0495627_000193 Ga0495627_000193_51102_51398 98
864 3300046453 Ga0495627_000478 Ga0495627_000478_24318_24614 98
865 3300046457 Ga0495590_0267909 Ga0495590_0267909_35_331 98
866 3300046459 Ga0495629_0044090 Ga0495629_0044090_369_665 98
867 3300046460 Ga0495638_0000350 Ga0495638_0000350_36527_36823 98
868 3300046460 Ga0495638_0240756 Ga0495638_0240756_194_490 98
869 3300046471 Ga0495650_0000373 Ga0495650_0000373_27456_27752 98
870 3300046471 Ga0495650_0111234 Ga0495650_0111234_99_395 98
871 3300046474 Ga0495605_0443035 Ga0495605_0443035_145_441 98
872 3300046476 Ga0495662_0082809 Ga0495662_0082809_474_770 98
873 3300046491 Ga0495584_0156510 Ga0495584_0156510_166_462 98
874 3300046492 Ga0495585_0001259 Ga0495585_0001259_1285_1581 98
875 3300046501 Ga0495607_0057229 Ga0495607_0057229_1000_1296 98
876 3300046501 Ga0495607_0289913 Ga0495607_0289913_118_414 98
877 3300046506 Ga0495583_0001602 Ga0495583_0001602_1281_1577 98
878 3300046506 Ga0495583_0042926 Ga0495583_0042926_590_886 98
879 3300046506 Ga0495583_0068889 Ga0495583_0068889_476_772 98
880 3300046506 Ga0495583_0112543 Ga0495583_0112543_377_673 98
881 3300046506 Ga0495583_0173081 Ga0495583_0173081_481_777 98
882 3300046507 Ga0495606_0000591 Ga0495606_0000591_8478_8774 98
883 3300046507 Ga0495606_0033962 Ga0495606_0033962_2353_2676 98
884 3300046512 Ga0495610_0001092 Ga0495610_0001092_5675_5971 98
885 3300046512 Ga0495610_0005829 Ga0495610_0005829_5304_5600 98
886 3300046512 Ga0495610_0031673 Ga0495610_0031673_2184_2480 98
887 3300046518 Ga0495631_0339081 Ga0495631_0339081_201_497 98
888 3300046518 Ga0495631_0350275 Ga0495631_0350275_161_457 98
889 3300046520 Ga0495637_0251194 Ga0495637_0251194_143_439 98
890 3300046522 Ga0495643_0000027 Ga0495643_0000027_195067_195363 98
891 3300046522 Ga0495643_0005403 Ga0495643_0005403_4670_4966 98
892 3300046522 Ga0495643_0009293 Ga0495643_0009293_715_1011 98
893 3300046522 Ga0495643_0036125 Ga0495643_0036125_1629_1925 98
894 3300046522 Ga0495643_0126700 Ga0495643_0126700_481_777 98
895 3300046522 Ga0495643_0152750 Ga0495643_0152750_630_926 98
896 3300046524 Ga0495648_0000115 Ga0495648_0000115_13062_13358 98
897 3300046524 Ga0495648_0009282 Ga0495648_0009282_2635_2931 98
898 3300046524 Ga0495648_0011981 Ga0495648_0011981_216_512 98
899 3300046524 Ga0495648_0058400 Ga0495648_0058400_1854_2150 98
900 3300046524 Ga0495648_0065078 Ga0495648_0065078_1746_2042 98
901 3300046524 Ga0495648_0286746 Ga0495648_0286746_36_332 98
902 3300046525 Ga0495663_0003401 Ga0495663_0003401_3983_4279 98
903 3300046525 Ga0495663_0056048 Ga0495663_0056048_69_365 98
904 3300046525 Ga0495663_0229267 Ga0495663_0229267_223_519 98
905 3300046525 Ga0495663_0266177 Ga0495663_0266177_133_429 98
906 3300046528 Ga0495642_0107275 Ga0495642_0107275_35_358 98
907 3300046530 Ga0495654_0000595 Ga0495654_0000595_16299_16595 98
908 3300046530 Ga0495654_0018453 Ga0495654_0018453_2397_2693 98
909 3300046530 Ga0495654_0256201 Ga0495654_0256201_232_528 98
910 3300046536 Ga0495587_0414242 Ga0495587_0414242_243_539 98
911 3300046537 Ga0495598_0027069 Ga0495598_0027069_186_488 98
912 3300046538 Ga0495609_0407114 Ga0495609_0407114_101_397 98
913 3300046539 Ga0495621_0026775 Ga0495621_0026775_1078_1380 98
914 3300046539 Ga0495621_0045810 Ga0495621_0045810_804_1103 98
915 3300046542 Ga0495597_0088605 Ga0495597_0088605_432_728 98
916 3300046542 Ga0495597_0110442 Ga0495597_0110442_425_721 98
917 3300046557 Ga0495622_0012047 Ga0495622_0012047_2633_2929 98
918 3300046558 Ga0495633_0002089 Ga0495633_0002089_12735_13031 98
919 3300046558 Ga0495633_0002581 Ga0495633_0002581_3414_3710 98
920 3300046558 Ga0495633_0011568 Ga0495633_0011568_3658_3954 98
921 3300046558 Ga0495633_0033930 Ga0495633_0033930_1891_2187 98
922 3300046615 Ga0495656_0154145 Ga0495656_0154145_367_666 98
923 3300046616 Ga0495668_0000001 Ga0495668_0000001_138760_139056 98
924 3300046616 Ga0495668_0000007 Ga0495668_0000007_522394_522690 98
925 3300046616 Ga0495668_0001393 Ga0495668_0001393_14107_14403 98
926 3300046616 Ga0495668_0019492 Ga0495668_0019492_3518_3814 98
927 3300046616 Ga0495668_0115889 Ga0495668_0115889_290_586 98
928 3300046616 Ga0495668_0193293 Ga0495668_0193293_34_330 98
929 3300046616 Ga0495668_0247004 Ga0495668_0247004_379_675 98
930 3300046616 Ga0495668_0302435 Ga0495668_0302435_542_838 98
931 3300046616 Ga0495668_0482226 Ga0495668_0482226_169_465 98
932 3300046648 Ga0495611_0103287 Ga0495611_0103287_333_629 98
933 3300046648 Ga0495611_0472799 Ga0495611_0472799_228_524 98
934 3300046660 Ga0495625_0000390 Ga0495625_0000390_12978_13274 98
935 3300046660 Ga0495625_0000503 Ga0495625_0000503_54626_54922 98
936 3300046660 Ga0495625_0001297 Ga0495625_0001297_30128_30424 98
937 3300046660 Ga0495625_0003168 Ga0495625_0003168_722_1018 98
938 3300046660 Ga0495625_0003788 Ga0495625_0003788_6497_6793 98
939 3300046660 Ga0495625_0033137 Ga0495625_0033137_3019_3315 98
940 3300046660 Ga0495625_0097778 Ga0495625_0097778_765_1061 98
941 3300046660 Ga0495625_0109644 Ga0495625_0109644_358_654 98
942 3300046660 Ga0495625_0128081 Ga0495625_0128081_464_760 98
943 3300046660 Ga0495625_0310558 Ga0495625_0310558_571_867 98
944 3300046660 Ga0495625_0384363 Ga0495625_0384363_499_795 98
945 3300046660 Ga0495625_0665919 Ga0495625_0665919_189_485 98
946 3300046660 Ga0495625_0670243 Ga0495625_0670243_292_588 98
947 3300046665 Ga0495661_0524839 Ga0495661_0524839_82_378 98
948 3300046684 Ga0495669_0000268 Ga0495669_0000268_12320_12616 98
949 3300046691 Ga0495670_0000066 Ga0495670_0000066_6197_6493 98
950 3300046691 Ga0495670_0177630 Ga0495670_0177630_132_428 98
951 3300046691 Ga0495670_0275580 Ga0495670_0275580_95_391 98
952 3300046692 Ga0495671_0096391 Ga0495671_0096391_260_556 98
953 3300046692 Ga0495671_0100039 Ga0495671_0100039_363_659 98
954 3300046692 Ga0495671_0118696 Ga0495671_0118696_69_365 98
955 3300046694 Ga0495649_0121204 Ga0495649_0121204_937_1233 98
956 3300046809 Ga0495600_0004421 Ga0495600_0004421_7122_7418 98
957 3300046810 Ga0495660_0215999 Ga0495660_0215999_317_613 98
958 3300047318 Ga0495636_0216797 Ga0495636_0216797_362_658 98
959 3300047323 Ga0495683_0004909 Ga0495683_0004909_2091_2387 98
960 3300047323 Ga0495683_0035493 Ga0495683_0035493_1643_1939 98
961 3300047323 Ga0495683_0397774 Ga0495683_0397774_13_309 98
962 3300047443 Ga0495687_000055 Ga0495687_000055_167240_167536 98
963 3300047443 Ga0495687_005115 Ga0495687_005115_3230_3526 98
964 3300047445 Ga0495677_0003912 Ga0495677_0003912_525_848 98
965 3300047469 Ga0495673_0260267 Ga0495673_0260267_146_442 98
966 3300047470 Ga0495681_0000032 Ga0495681_0000032_54306_54602 98
967 3300047470 Ga0495681_0037808 Ga0495681_0037808_486_782 98
968 3300047470 Ga0495681_0144421 Ga0495681_0144421_544_840 98
969 3300047470 Ga0495681_0154438 Ga0495681_0154438_306_602 98
970 3300047472 Ga0495686_0004143 Ga0495686_0004143_1364_1660 98
971 3300047472 Ga0495686_0008478 Ga0495686_0008478_3921_4217 98
972 3300047472 Ga0495686_0042206 Ga0495686_0042206_2308_2604 98
973 3300047472 Ga0495686_0165401 Ga0495686_0165401_500_796 98
974 3300047472 Ga0495686_0438090 Ga0495686_0438090_93_389 98
975 3300048090 Ga0495615_0018356 Ga0495615_0018356_937_1236 98
976 3300048090 Ga0495615_0026748 Ga0495615_0026748_1030_1326 98
977 3300048903 Ga0496100_0927777 Ga0496100_0927777_31_327 98
978 3300048904 Ga0496101_0106166 Ga0496101_0106166_541_837 98
979 3300048904 Ga0496101_1080129 Ga0496101_1080129_317_613 98
980 3300048904 Ga0496101_1081136 Ga0496101_1081136_93_389 98
981 3300048905 Ga0496102_0000049 Ga0496102_0000049_146046_146342 98
982 3300048905 Ga0496102_0011200 Ga0496102_0011200_1540_1836 98
983 3300048905 Ga0496102_0027205 Ga0496102_0027205_795_1091 98
984 3300048905 Ga0496102_1270847 Ga0496102_1270847_19_315 98
985 3300048906 Ga0496103_0000037 Ga0496103_0000037_33133_33429 98
986 3300048906 Ga0496103_0000151 Ga0496103_0000151_16671_16967 98
987 3300048906 Ga0496103_0796185 Ga0496103_0796185_20_316 98
988 3300048907 Ga0496104_0046225 Ga0496104_0046225_849_1145 98
989 3300048907 Ga0496104_0520997 Ga0496104_0520997_316_615 98
990 3300048907 Ga0496104_1696910 Ga0496104_1696910_136_432 98
991 3300048908 Ga0496105_0002067 Ga0496105_0002067_14032_14328 98
992 3300048910 Ga0496107_0753502 Ga0496107_0753502_286_582 98
993 3300048911 Ga0496108_0002067 Ga0496108_0002067_14434_14730 98
994 3300048911 Ga0496108_1232693 Ga0496108_1232693_71_367 98
995 3300048912 Ga0496109_0134818 Ga0496109_0134818_1491_1787 98
996 3300048912 Ga0496109_0564467 Ga0496109_0564467_538_834 98
997 3300048912 Ga0496109_0724700 Ga0496109_0724700_301_597 98
998 3300048913 Ga0496110_0058567 Ga0496110_0058567_1524_1820 98
999 3300048913 Ga0496110_0140354 Ga0496110_0140354_985_1281 98
1000 3300048913 Ga0496110_0156130 Ga0496110_0156130_1532_1828 98
1001 3300048913 Ga0496110_1263689 Ga0496110_1263689_158_454 98
1002 3300048914 Ga0496111_0030916 Ga0496111_0030916_578_874 98
1003 3300048914 Ga0496111_0112774 Ga0496111_0112774_807_1103 98
1004 3300048915 Ga0496112_0123702 Ga0496112_0123702_1081_1377 98
1005 3300048916 Ga0496113_0004996 Ga0496113_0004996_4813_5109 98
1006 3300048916 Ga0496113_0125999 Ga0496113_0125999_20_316 98
1007 3300048916 Ga0496113_1263065 Ga0496113_1263065_115_411 98
1008 3300048917 Ga0496114_0014916 Ga0496114_0014916_1436_1732 98
1009 3300048917 Ga0496114_0061205 Ga0496114_0061205_1913_2209 98
1010 3300048918 Ga0496115_0000018 Ga0496115_0000018_152190_152486 98
1011 3300048918 Ga0496115_0304870 Ga0496115_0304870_278_574 98
1012 3300048919 Ga0496116_0000664 Ga0496116_0000664_32834_33130 98
1013 3300048919 Ga0496116_0013868 Ga0496116_0013868_4688_4984 98
1014 3300048919 Ga0496116_0330323 Ga0496116_0330323_310_606 98
1015 3300048920 Ga0496117_0000115 Ga0496117_0000115_146046_146342 98
1016 3300048920 Ga0496117_0000408 Ga0496117_0000408_29399_29695 98
1017 3300048920 Ga0496117_0018914 Ga0496117_0018914_1617_1913 98
1018 3300048920 Ga0496117_0118200 Ga0496117_0118200_363_659 98
1019 3300048921 Ga0496118_0000086 Ga0496118_0000086_33147_33443 98
1020 3300048921 Ga0496118_0000600 Ga0496118_0000600_16697_16993 98
1021 3300048921 Ga0496118_0001927 Ga0496118_0001927_3834_4130 98
1022 3300048921 Ga0496118_0024471 Ga0496118_0024471_1847_2143 98
1023 3300048921 Ga0496118_0111601 Ga0496118_0111601_177_491 98
1024 3300048921 Ga0496118_0547135 Ga0496118_0547135_213_509 98
1025 3300048921 Ga0496118_0609535 Ga0496118_0609535_164_460 98
1026 3300048922 Ga0496119_0011638 Ga0496119_0011638_1521_1817 98
1027 3300048922 Ga0496119_0026037 Ga0496119_0026037_934_1230 98
1028 3300048923 Ga0496120_0116338 Ga0496120_0116338_960_1256 98
1029 3300048924 Ga0496121_0000208 Ga0496121_0000208_42635_42931 98
1030 3300048924 Ga0496121_0000237 Ga0496121_0000237_88222_88545 98
1031 3300048924 Ga0496121_0001774 Ga0496121_0001774_7565_7861 98
1032 3300048924 Ga0496121_0010863 Ga0496121_0010863_5027_5323 98
1033 3300048924 Ga0496121_0083746 Ga0496121_0083746_1130_1426 98
1034 3300048924 Ga0496121_0107141 Ga0496121_0107141_1450_1746 98
1035 3300048924 Ga0496121_0285376 Ga0496121_0285376_289_585 98
1036 3300048924 Ga0496121_0303153 Ga0496121_0303153_407_703 98
1037 3300048925 Ga0496122_0000970 Ga0496122_0000970_13030_13326 98
1038 3300048925 Ga0496122_0010455 Ga0496122_0010455_1897_2193 98
1039 3300048925 Ga0496122_0036922 Ga0496122_0036922_2938_3234 98
1040 3300048925 Ga0496122_0170992 Ga0496122_0170992_791_1087 98
1041 3300048925 Ga0496122_0294950 Ga0496122_0294950_129_425 98
1042 3300048925 Ga0496122_0315114 Ga0496122_0315114_496_792 98
1043 3300048926 Ga0496123_0000286 Ga0496123_0000286_38223_38519 98
1044 3300048926 Ga0496123_0015139 Ga0496123_0015139_4470_4766 98
1045 3300048926 Ga0496123_0029909 Ga0496123_0029909_3294_3590 98
1046 3300048926 Ga0496123_0060522 Ga0496123_0060522_1408_1704 98
1047 3300048926 Ga0496123_0162083 Ga0496123_0162083_381_677 98
1048 3300048926 Ga0496123_0264775 Ga0496123_0264775_263_559 98
1049 3300048927 Ga0496124_0000099 Ga0496124_0000099_29449_29745 98
1050 3300048927 Ga0496124_0000102 Ga0496124_0000102_33147_33443 98
1051 3300048927 Ga0496124_0002045 Ga0496124_0002045_23839_24135 98
1052 3300048927 Ga0496124_0002943 Ga0496124_0002943_20705_21001 98
1053 3300048927 Ga0496124_0013584 Ga0496124_0013584_1277_1573 98
1054 3300048927 Ga0496124_0052650 Ga0496124_0052650_1177_1473 98
1055 3300048927 Ga0496124_0053462 Ga0496124_0053462_1171_1467 98
1056 3300048927 Ga0496124_0059087 Ga0496124_0059087_1755_2051 98
1057 3300048927 Ga0496124_0205382 Ga0496124_0205382_626_922 98
1058 3300048927 Ga0496124_0216169 Ga0496124_0216169_865_1161 98
1059 3300048927 Ga0496124_0536880 Ga0496124_0536880_201_497 98
1060 3300048927 Ga0496124_0614764 Ga0496124_0614764_320_616 98
1061 3300048927 Ga0496124_0883505 Ga0496124_0883505_61_357 98
1062 3300048928 Ga0496125_0012876 Ga0496125_0012876_6401_6697 98
1063 3300048928 Ga0496125_0022088 Ga0496125_0022088_4947_5243 98
1064 3300048928 Ga0496125_0050166 Ga0496125_0050166_582_878 98
1065 3300048928 Ga0496125_0073878 Ga0496125_0073878_1309_1605 98
1066 3300048928 Ga0496125_0106291 Ga0496125_0106291_1471_1767 98
1067 3300048928 Ga0496125_0169773 Ga0496125_0169773_352_648 98
1068 3300048928 Ga0496125_0299026 Ga0496125_0299026_638_934 98
1069 3300048928 Ga0496125_0304291 Ga0496125_0304291_314_610 98
1070 3300048928 Ga0496125_0598961 Ga0496125_0598961_96_392 98
1071 3300048929 Ga0496126_0000507 Ga0496126_0000507_33458_33754 98
1072 3300048929 Ga0496126_0048499 Ga0496126_0048499_2332_2628 98
1073 3300048929 Ga0496126_0116494 Ga0496126_0116494_42_341 98
1074 3300048929 Ga0496126_0141298 Ga0496126_0141298_1645_1941 98
1075 3300048929 Ga0496126_0455171 Ga0496126_0455171_439_735 98
1076 3300048929 Ga0496126_0789729 Ga0496126_0789729_18_314 98
1077 3300049127 Ga0501306_101616 Ga0501306_101616_49_348 98
1078 3300049161 Ga0501305_009896 Ga0501305_009896_469_765 98
1079 3300049162 Ga0501307_003277 Ga0501307_003277_490_786 98
1080 3300049459 Ga0495678_013203 Ga0495678_013203_1094_1390 98
1081 3300049459 Ga0495678_148894 Ga0495678_148894_393_689 98
1082 3300049513 Ga0501290_000239 Ga0501290_000239_8156_8452 98
1083 3300049514 Ga0501291_140520 Ga0501291_140520_143_442 98
1084 3300049515 Ga0501292_000008 Ga0501292_000008_37829_38125 98
1085 3300049516 Ga0501293_001729 Ga0501293_001729_815_1111 98
1086 3300049516 Ga0501293_023847 Ga0501293_023847_260_556 98
1087 3300049517 Ga0501294_009404 Ga0501294_009404_651_947 98
1088 3300049523 Ga0501300_000363 Ga0501300_000363_3227_3523 98
1089 3300049529 Ga0501313_012426 Ga0501313_012426_264_560 98
1090 3300049529 Ga0501313_031360 Ga0501313_031360_277_573 98
1091 3300049531 Ga0501315_007923 Ga0501315_007923_458_754 98
1092 3300049533 Ga0501317_011776 Ga0501317_011776_521_817 98
1093 3300049540 Ga0501324_046489 Ga0501324_046489_38_361 98
1094 3300049551 Ga0501335_004555 Ga0501335_004555_308_604 98
1095 3300049568 Ga0501031_0223725 Ga0501031_0223725_480_776 98
1096 3300049568 Ga0501031_0378666 Ga0501031_0378666_252_551 98
1097 3300049569 Ga0501032_0056525 Ga0501032_0056525_1649_1945 98
1098 3300049569 Ga0501032_0228127 Ga0501032_0228127_478_774 98
1099 3300049569 Ga0501032_0415144 Ga0501032_0415144_258_557 98
1100 3300049570 Ga0501033_0007915 Ga0501033_0007915_6644_6940 98
1101 3300049570 Ga0501033_0103136 Ga0501033_0103136_981_1277 98
1102 3300049570 Ga0501033_0256012 Ga0501033_0256012_179_475 98
1103 3300049570 Ga0501033_0488746 Ga0501033_0488746_210_506 98
1104 3300049571 Ga0501034_0024797 Ga0501034_0024797_4968_5264 98
1105 3300049571 Ga0501034_0143619 Ga0501034_0143619_1206_1505 98
1106 3300049571 Ga0501034_0175045 Ga0501034_0175045_1417_1713 98
1107 3300049571 Ga0501034_0383379 Ga0501034_0383379_967_1263 98
1108 3300049571 Ga0501034_0570302 Ga0501034_0570302_226_522 98
1109 3300049571 Ga0501034_0648180 Ga0501034_0648180_169_465 98
1110 3300049571 Ga0501034_0768735 Ga0501034_0768735_41_337 98
1111 3300049571 Ga0501034_1636362 Ga0501034_1636362_45_341 98
1112 3300049572 Ga0501036_0042413 Ga0501036_0042413_2403_2699 98
1113 3300049572 Ga0501036_0335592 Ga0501036_0335592_292_588 98
1114 3300049572 Ga0501036_0594917 Ga0501036_0594917_124_423 98
1115 3300049572 Ga0501036_0682019 Ga0501036_0682019_47_343 98
1116 3300049573 Ga0501037_0007067 Ga0501037_0007067_6084_6380 98
1117 3300049573 Ga0501037_0157079 Ga0501037_0157079_1159_1458 98
1118 3300049573 Ga0501037_0675456 Ga0501037_0675456_284_580 98
1119 3300049573 Ga0501037_0721677 Ga0501037_0721677_278_574 98
1120 3300049574 Ga0501038_0162575 Ga0501038_0162575_787_1083 98
1121 3300049574 Ga0501038_0179345 Ga0501038_0179345_476_772 98
1122 3300049574 Ga0501038_0249511 Ga0501038_0249511_180_476 98
1123 3300049574 Ga0501038_1210606 Ga0501038_1210606_220_516 98
1124 3300049575 Ga0501039_0069075 Ga0501039_0069075_1697_1993 98
1125 3300049575 Ga0501039_0667237 Ga0501039_0667237_435_734 98
1126 3300049575 Ga0501039_1348332 Ga0501039_1348332_107_403 98
1127 3300049578 Ga0501042_0766286 Ga0501042_0766286_258_560 98
1128 3300049578 Ga0501042_0808800 Ga0501042_0808800_149_445 98
1129 3300049578 Ga0501042_1453349 Ga0501042_1453349_25_321 98
1130 3300049579 Ga0501043_0127668 Ga0501043_0127668_410_706 98
1131 3300049579 Ga0501043_0235691 Ga0501043_0235691_399_695 98
1132 3300049579 Ga0501043_0286073 Ga0501043_0286073_487_783 98
1133 3300049579 Ga0501043_0376967 Ga0501043_0376967_301_597 98
1134 3300049580 Ga0501046_0087795 Ga0501046_0087795_1548_1844 98
1135 3300049580 Ga0501046_0248471 Ga0501046_0248471_492_788 98
1136 3300049581 Ga0501047_0000876 Ga0501047_0000876_26966_27262 98
1137 3300049581 Ga0501047_0293727 Ga0501047_0293727_675_971 98
1138 3300049581 Ga0501047_0380991 Ga0501047_0380991_801_1097 98
1139 3300049581 Ga0501047_0384774 Ga0501047_0384774_163_459 98
1140 3300049581 Ga0501047_0529825 Ga0501047_0529825_524_820 98
1141 3300049581 Ga0501047_1256300 Ga0501047_1256300_66_362 98
1142 3300049582 Ga0501048_0063746 Ga0501048_0063746_2030_2326 98
1143 3300049582 Ga0501048_0439882 Ga0501048_0439882_593_889 98
1144 3300049583 Ga0501067_0415310 Ga0501067_0415310_411_710 98
1145 3300049586 Ga0501070_0209515 Ga0501070_0209515_195_491 98
1146 3300049587 Ga0501071_0505286 Ga0501071_0505286_324_620 98
1147 3300049587 Ga0501071_0814569 Ga0501071_0814569_164_460 98
1148 3300049589 Ga0501073_0753796 Ga0501073_0753796_51_347 98
1149 3300049652 Ga0501202_010095 Ga0501202_010095_736_1032 98
1150 3300049653 Ga0501206_003593 Ga0501206_003593_1277_1573 98
1151 3300049653 Ga0501206_006431 Ga0501206_006431_819_1115 98
1152 3300049654 Ga0501207_012775 Ga0501207_012775_768_1064 98
1153 3300049655 Ga0501208_077551 Ga0501208_077551_73_369 98
1154 3300049662 Ga0501222_000772 Ga0501222_000772_2574_2870 98
1155 3300049663 Ga0501223_000004 Ga0501223_000004_16774_17070 98
1156 3300049663 Ga0501223_000368 Ga0501223_000368_9328_9624 98
1157 3300049663 Ga0501223_112769 Ga0501223_112769_180_476 98
1158 3300049664 Ga0501224_006184 Ga0501224_006184_977_1273 98
1159 3300049664 Ga0501224_019511 Ga0501224_019511_698_997 98
1160 3300049665 Ga0501227_018690 Ga0501227_018690_669_965 98
1161 3300049668 Ga0501233_039761 Ga0501233_039761_270_566 98
1162 3300049669 Ga0501235_008987 Ga0501235_008987_712_1008 98
1163 3300049669 Ga0501235_011993 Ga0501235_011993_981_1277 98
1164 3300049669 Ga0501235_035994 Ga0501235_035994_122_418 98
1165 3300049670 Ga0501236_002716 Ga0501236_002716_1118_1414 98
1166 3300049670 Ga0501236_007445 Ga0501236_007445_448_744 98
1167 3300049679 Ga0501249_000686 Ga0501249_000686_6442_6738 98
1168 3300049686 Ga0501257_001004 Ga0501257_001004_1063_1359 98
1169 3300049686 Ga0501257_037227 Ga0501257_037227_335_631 98
1170 3300049688 Ga0501259_000589 Ga0501259_000589_1239_1535 98
1171 3300049690 Ga0501261_000030 Ga0501261_000030_1180_1476 98
1172 3300049704 Ga0501221_010535 Ga0501221_010535_434_730 98
1173 3300049705 Ga0501225_0000003 Ga0501225_0000003_123755_124051 98
1174 3300049705 Ga0501225_0001931 Ga0501225_0001931_5801_6097 98
1175 3300049705 Ga0501225_0002873 Ga0501225_0002873_728_1024 98
1176 3300049708 Ga0501245_002127 Ga0501245_002127_1568_1864 98
1177 3300049708 Ga0501245_008085 Ga0501245_008085_337_633 98
1178 3300049742 Ga0501080_0166082 Ga0501080_0166082_1202_1501 98
1179 3300049758 Ga0501241_010421 Ga0501241_010421_1098_1394 98
1180 3300049761 Ga0501264_005550 Ga0501264_005550_306_602 98
1181 3300049775 Ga0501279_000002 Ga0501279_000002_109761_110057 98
1182 3300049776 Ga0501280_000010 Ga0501280_000010_9896_10192 98
1183 3300049776 Ga0501280_008201 Ga0501280_008201_97_393 98
1184 3300049777 Ga0501281_00100 Ga0501281_00100_1189_1485 98
1185 3300049777 Ga0501281_11331 Ga0501281_11331_310_606 98
1186 3300049778 Ga0501282_000779 Ga0501282_000779_657_953 98
1187 3300049822 Ga0501035_0007244 Ga0501035_0007244_3079_3375 98
1188 3300049822 Ga0501035_0299712 Ga0501035_0299712_538_834 98
1189 3300049822 Ga0501035_0659817 Ga0501035_0659817_249_545 98
1190 3300049823 Ga0501044_0031887 Ga0501044_0031887_981_1277 98
1191 3300049823 Ga0501044_0186702 Ga0501044_0186702_1269_1568 98
1192 3300049823 Ga0501044_0348005 Ga0501044_0348005_334_630 98
1193 3300049823 Ga0501044_0373081 Ga0501044_0373081_813_1109 98
1194 3300049823 Ga0501044_0591466 Ga0501044_0591466_14_310 98
1195 3300049823 Ga0501044_0681022 Ga0501044_0681022_328_627 98
1196 3300049823 Ga0501044_0880516 Ga0501044_0880516_314_610 98
1197 3300049824 Ga0501045_0988261 Ga0501045_0988261_27_323 98
1198 3300050489 nmdc:mga03683_191052_c1 nmdc:mga03683_191052_c1_105_401 98
1199 3300050489 nmdc:mga03683_229_c1 nmdc:mga03683_229_c1_12191_12487 98
1200 3300050490 nmdc:mga03n38_19603_c1 nmdc:mga03n38_19603_c1_355_651 98
1201 3300050491 nmdc:mga00v17_144311_c1 nmdc:mga00v17_144311_c1_625_921 98
1202 3300050491 nmdc:mga00v17_150524_c1 nmdc:mga00v17_150524_c1_1088_1384 98
1203 3300050491 nmdc:mga00v17_166252_c1 nmdc:mga00v17_166252_c1_415_711 98
1204 3300050492 nmdc:mga0yw44_141365_c1 nmdc:mga0yw44_141365_c1_216_512 98
1205 3300050493 nmdc:mga0k408_223480_c1 nmdc:mga0k408_223480_c1_251_547 98
1206 3300050493 nmdc:mga0k408_29927_c1 nmdc:mga0k408_29927_c1_294_590 98
1207 3300050493 nmdc:mga0k408_42790_c1 nmdc:mga0k408_42790_c1_1102_1398 98
1208 3300050493 nmdc:mga0k408_61537_c1 nmdc:mga0k408_61537_c1_1170_1466 98
1209 3300050493 nmdc:mga0k408_779808_c1 nmdc:mga0k408_779808_c1_78_374 98
1210 3300050493 nmdc:mga0k408_88899_c1 nmdc:mga0k408_88899_c1_327_629 98
1211 3300050494 nmdc:mga06z11_27_c1 nmdc:mga06z11_27_c1_37464_37760 98
1212 3300050494 nmdc:mga06z11_646394_c1 nmdc:mga06z11_646394_c1_242_538 98
1213 3300050494 nmdc:mga06z11_6554_c1 nmdc:mga06z11_6554_c1_2987_3283 98
1214 3300050495 nmdc:mga04h51_147_c1 nmdc:mga04h51_147_c1_10846_11142 98
1215 3300050495 nmdc:mga04h51_4151_c1 nmdc:mga04h51_4151_c1_1531_1827 98
1216 3300050496 nmdc:mga07m45_33_c1 nmdc:mga07m45_33_c1_30172_30468 98
1217 3300050496 nmdc:mga07m45_427415_c1 nmdc:mga07m45_427415_c1_385_681 98
1218 3300050496 nmdc:mga07m45_471260_c1 nmdc:mga07m45_471260_c1_358_654 98
1219 3300050496 nmdc:mga07m45_84542_c1 nmdc:mga07m45_84542_c1_268_564 98
1220 3300050496 nmdc:mga07m45_90862_c1 nmdc:mga07m45_90862_c1_519_815 98
1221 3300050507 nmdc:mga05p37_1296370_c1 nmdc:mga05p37_1296370_c1_102_398 98
1222 3300050511 nmdc:mga08y16_1661375_c1 nmdc:mga08y16_1661375_c1_251_553 98
1223 3300050516 nmdc:mga0sz30_59743_c1 nmdc:mga0sz30_59743_c1_972_1268 98
1224 3300050516 nmdc:mga0sz30_9117_c1 nmdc:mga0sz30_9117_c1_3005_3301 98
1225 3300053078 Ga0495612_0327786 Ga0495612_0327786_116_412 98
1226 3300053079 Ga0500610_0000496 Ga0500610_0000496_2308_2604 98
1227 3300053087 Ga0500643_000004 Ga0500643_000004_154693_154989 98
1228 3300053087 Ga0500643_000065 Ga0500643_000065_118579_118875 98
1229 3300053087 Ga0500643_001584 Ga0500643_001584_9323_9619 98
1230 3300053087 Ga0500643_002759 Ga0500643_002759_8133_8429 98
1231 3300053087 Ga0500643_003367 Ga0500643_003367_159_455 98
1232 3300053087 Ga0500643_007933 Ga0500643_007933_3520_3816 98
1233 3300053087 Ga0500643_010821 Ga0500643_010821_1845_2141 98
1234 3300053087 Ga0500643_016304 Ga0500643_016304_1608_1904 98
1235 3300053087 Ga0500643_016401 Ga0500643_016401_1738_2034 98
1236 3300053087 Ga0500643_034447 Ga0500643_034447_1149_1445 98
1237 3300053092 Ga0500583_0559113 Ga0500583_0559113_73_369 98
1238 3300053093 Ga0500651_0289877 Ga0500651_0289877_497_793 98
1239 3300053093 Ga0500651_0497111 Ga0500651_0497111_83_379 98
1240 3300053094 Ga0500566_0002509 Ga0500566_0002509_10241_10537 98
1241 3300053096 Ga0500641_0093245 Ga0500641_0093245_83_385 98
1242 3300053104 Ga0500556_0000074 Ga0500556_0000074_54355_54651 98
1243 3300053104 Ga0500556_0265161 Ga0500556_0265161_31_327 98
1244 3300053108 Ga0500562_076918 Ga0500562_076918_298_594 98
1245 3300053108 Ga0500562_224004 Ga0500562_224004_183_479 98
1246 3300053111 Ga0500572_016593 Ga0500572_016593_1549_1845 98
1247 3300053116 Ga0500592_000118 Ga0500592_000118_15598_15894 98
1248 3300053116 Ga0500592_000393 Ga0500592_000393_6862_7158 98
1249 3300053116 Ga0500592_015653 Ga0500592_015653_302_598 98
1250 3300053118 Ga0500594_0000572 Ga0500594_0000572_6189_6485 98
1251 3300053118 Ga0500594_0105044 Ga0500594_0105044_292_588 98
1252 3300053119 Ga0500595_031857 Ga0500595_031857_1271_1567 98
1253 3300053119 Ga0500595_106833 Ga0500595_106833_319_615 98
1254 3300053120 Ga0500597_003969 Ga0500597_003969_113_409 98
1255 3300053121 Ga0500607_000098 Ga0500607_000098_8663_8959 98
1256 3300053122 Ga0500608_007974 Ga0500608_007974_3940_4236 98
1257 3300053122 Ga0500608_159037 Ga0500608_159037_344_640 98
1258 3300053128 Ga0500626_315636 Ga0500626_315636_149_445 98
1259 3300053130 Ga0500642_0000002 Ga0500642_0000002_541443_541739 98
1260 3300053130 Ga0500642_0000116 Ga0500642_0000116_20680_20976 98
1261 3300053131 Ga0500652_179255 Ga0500652_179255_316_612 98
1262 3300053134 Ga0500658_0043853 Ga0500658_0043853_872_1168 98
1263 3300053134 Ga0500658_0091278 Ga0500658_0091278_43_339 98
1264 3300053136 Ga0500559_0060943 Ga0500559_0060943_56_352 98
1265 3300053136 Ga0500559_0065891 Ga0500559_0065891_1169_1465 98
1266 3300053136 Ga0500559_0130334 Ga0500559_0130334_788_1084 98
1267 3300053136 Ga0500559_0309131 Ga0500559_0309131_285_581 98
1268 3300053136 Ga0500559_0341614 Ga0500559_0341614_13_309 98
1269 3300053136 Ga0500559_0345425 Ga0500559_0345425_115_429 98
1270 3300053138 Ga0500564_192633 Ga0500564_192633_242_538 98
1271 3300053139 Ga0500568_0007493 Ga0500568_0007493_1993_2289 98
1272 3300053139 Ga0500568_0115245 Ga0500568_0115245_59_355 98
1273 3300053139 Ga0500568_0162151 Ga0500568_0162151_246_542 98
1274 3300053140 Ga0500573_0000046 Ga0500573_0000046_73263_73559 98
1275 3300053140 Ga0500573_0440291 Ga0500573_0440291_66_362 98
1276 3300053142 Ga0500577_0516699 Ga0500577_0516699_48_344 98
1277 3300053151 Ga0500604_0017059 Ga0500604_0017059_1633_1929 98
1278 3300053151 Ga0500604_0105546 Ga0500604_0105546_220_516 98
1279 3300053151 Ga0500604_0200470 Ga0500604_0200470_233_529 98
1280 3300053151 Ga0500604_0225753 Ga0500604_0225753_279_575 98
1281 3300053151 Ga0500604_0289952 Ga0500604_0289952_73_369 98
1282 3300053153 Ga0500616_0116858 Ga0500616_0116858_130_426 98
1283 3300053154 Ga0500619_245683 Ga0500619_245683_72_368 98
1284 3300053154 Ga0500619_255005 Ga0500619_255005_119_415 98
1285 3300053156 Ga0500622_0229706 Ga0500622_0229706_448_747 98
1286 3300053157 Ga0500624_000044 Ga0500624_000044_10884_11180 98
1287 3300053157 Ga0500624_000053 Ga0500624_000053_15468_15764 98
1288 3300053158 Ga0500627_0000054 Ga0500627_0000054_10454_10750 98
1289 3300053158 Ga0500627_0000508 Ga0500627_0000508_9206_9502 98
1290 3300053158 Ga0500627_0000799 Ga0500627_0000799_5534_5830 98
1291 3300053158 Ga0500627_0319549 Ga0500627_0319549_117_413 98
1292 3300053158 Ga0500627_0463127 Ga0500627_0463127_178_474 98
1293 3300053160 Ga0500633_0072786 Ga0500633_0072786_347_670 98
1294 3300053177 Ga0500636_0005811 Ga0500636_0005811_5457_5753 98
1295 3300053178 Ga0500637_0000008 Ga0500637_0000008_10893_11189 98
1296 3300053727 Ga0500611_000244 Ga0500611_000244_4861_5157 98
1297 3300053727 Ga0500611_128595 Ga0500611_128595_185_481 98
1298 3300053730 Ga0500645_000009 Ga0500645_000009_12517_12813 98
1299 3300053730 Ga0500645_000439 Ga0500645_000439_1955_2251 98
1300 3300053730 Ga0500645_002373 Ga0500645_002373_4853_5149 98
1301 3300053730 Ga0500645_007761 Ga0500645_007761_2544_2840 98
1302 3300053730 Ga0500645_184279 Ga0500645_184279_184_480 98
1303 3300053735 Ga0500596_013713 Ga0500596_013713_666_962 98
1304 3300055283 Ga0500661_071886 Ga0500661_071886_53_349 98
1305 3300059493 Ga0587077_030086 Ga0587077_030086_88_384 98
1306 3300059506 Ga0587085_045596 Ga0587085_045596_97_393 98
1307 3300059510 Ga0587090_000313 Ga0587090_000313_777_1073 98
1308 3300059510 Ga0587090_114637 Ga0587090_114637_257_553 98
1309 3300059623 Ga0587101_152085 Ga0587101_152085_26_322 98
1310 3300059626 Ga0587115_024628 Ga0587115_024628_319_615 98
1311 3300059643 Ga0587072_135641 Ga0587072_135641_115_411 98
1312 3300059652 Ga0587107_141702 Ga0587107_141702_126_422 98
1313 3300060346 Ga0587111_0043277 Ga0587111_0043277_508_804 98
1314 iso_pu_bacteria 2738541275 2738709704 98
1315 iso_pu_bacteria 2738541301 2738848129 98
1316 iso_pu_bacteria 2738541304 2738863858 98
1317 iso_pu_bacteria 2738543022 2739296376 98
1318 iso_pu_bacteria 2738543033 2739358054 98
1319 iso_pu_bacteria 2928100450 2928101260 98
1320 iso_pu_bacteria 2928959182 2928960329 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11011

DUF2849

Protein of unknown function (DUF2849)

11

92

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hgk-assembly1.cif.gz_A crystal structure of human clpp in complex with zk53 0.4798 55 73
1ybt-assembly1.cif.gz_B mycobacterium tuberculosis adenylyl cyclase, rv1900c chd 0.4596 52 76
3zdt-assembly2.cif.gz_B crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a 0.4576 2 54
6cb0-assembly2.cif.gz_B crystal structure of the fak ferm domain 0.4023 2 54
4cye-assembly1.cif.gz_A crystal structure of avian fak ferm domain fak31-405 at 3.2a 0.3971 2 54
ID Description Score Start End Superfamily
6c07B01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.6476 52 66 3.30.300.10
1t6eX01 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.626 1 16 2.40.70.10
3fjyB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.6237 52 69 3.40.50.1240
af_O43542_77_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6141 52 68 3.40.50.300
af_Q5JMK2_32_218_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.5861 1 27 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A430EEV2-F1-model_v4 DUF2849 domain-containing protein 0.9981 1 65
AF-A0A430EEV2-F1-model_v4 DUF2849 domain-containing protein 0.9831 1 65
AF-A0A7W9F0H9-F1-model_v4 DUF2849 domain-containing protein 0.951 1 83
AF-A0A7X2FYH6-F1-model_v4 DUF2849 domain-containing protein 0.8908 2 79
AF-A0A1G5NPN2-F1-model_v4 DUF2849 domain-containing protein 0.8768 2 82

Feature Viewer

pLDDT pTM Quality
86.92 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map