F492649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1292 | 800 | 953 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300026095|Ga0207676_10188791|Ga0207676_101887913 |
| Length | 343 |
| Sequence | MTRTGRVDRAEVRRRDPQLAAAYEALHPEAADEIADARSERAQRGSTSMMIDGPQDVTSAVLDAMRRTSDPRLREIMVSLAAHLHAFATEVRLTETELRQGAALLAEMGKLTTATHNEFILMAGSLGLSSLVCLQNHGGGERTSHSLLGPFWRMHSPPTRNGGTLVRSPTPGADLLVSGRVVDRSGKAIAGAEVDVWHASPVGLYENQDPAQADMNLRGKFVTDGDGRFRFHTVKMVGYPIPTDGVVGRLLRAQRRHPYRPAHLHVLVVKPGFEVLISQTYDPADPNIGSDAQFGVTRALLGDYVRHDEPHPDDESVAAPWYSLDHTYVMEPGKTVLPAPPIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 5 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 8 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 9 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 10 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 11 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 12 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 24 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 25 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 26 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 27 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 31 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 32 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 33 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 34 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 35 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 36 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 37 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 38 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 39 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 40 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 41 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 42 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 43 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 44 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 45 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 46 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 47 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 48 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 49 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 50 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 51 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 52 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 53 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 54 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 55 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 56 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 57 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 58 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 59 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 60 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 61 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 62 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 63 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 64 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 65 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 66 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 67 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 68 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 69 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 70 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 71 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 72 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 73 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 74 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 75 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 76 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 77 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 78 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 79 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 80 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 81 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 82 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 83 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 84 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 85 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 86 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 87 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 88 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 89 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 90 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 91 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 92 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 93 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 94 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 95 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 96 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 97 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 98 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 99 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 100 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 101 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 102 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 103 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 104 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 105 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 106 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 107 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 108 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 109 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 110 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 111 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 112 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 113 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 114 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 115 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 116 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 117 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 118 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 119 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 120 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 121 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 122 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 123 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 124 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 125 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 126 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 127 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 128 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 129 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 130 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 131 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 132 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 133 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 134 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 135 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 136 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 137 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 138 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 139 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 140 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 141 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 142 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 143 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 144 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 145 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 146 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 147 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 148 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 149 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 150 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 151 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 152 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 153 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 154 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 155 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 156 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 157 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 158 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 159 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 160 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 161 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 162 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 163 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 164 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 165 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 166 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 167 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 168 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 169 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 170 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 171 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 172 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 173 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 174 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 175 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 176 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 177 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 178 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 179 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 180 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 181 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 182 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 183 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 184 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 185 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 186 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 187 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 188 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 189 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 190 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 191 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 192 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 193 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 194 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 195 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 196 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 197 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 198 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 199 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 200 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 201 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 202 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 203 | 2922368715 | |||
| 204 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 205 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 206 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 207 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 208 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 209 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 210 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 211 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 212 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 213 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 214 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 215 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 216 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 217 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 218 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 219 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 220 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 221 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 222 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 223 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 224 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 225 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 226 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 227 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 228 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 229 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 230 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 231 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 232 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 233 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 234 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 235 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 236 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 237 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 238 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 239 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 240 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 241 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 242 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 243 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 244 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 245 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 246 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 247 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 248 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 249 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 250 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 251 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 252 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 253 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 254 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 255 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 256 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 257 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 258 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 259 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 260 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 261 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 262 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 263 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 264 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 265 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 266 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 267 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 268 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 269 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 270 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 271 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 272 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 273 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 274 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 275 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 276 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 277 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 278 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 279 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 280 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 281 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 282 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 283 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 284 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 285 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 286 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 287 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 288 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 289 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 290 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 291 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 292 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 293 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 294 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 295 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 296 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 297 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 298 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 299 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 300 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 301 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 302 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 303 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 304 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 305 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 306 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 307 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 308 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 309 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 310 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 311 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 312 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 313 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 314 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 315 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 316 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 317 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 320 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 321 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 322 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 323 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 324 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 325 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 326 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 328 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 335 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 337 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 338 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 341 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 342 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 343 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 344 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 345 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 346 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 347 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 349 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 350 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 351 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 352 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 354 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 355 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 357 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 358 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 360 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 361 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 362 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 364 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 365 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 366 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 367 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 368 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 369 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 370 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 371 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 372 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 373 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 374 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 375 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 376 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 377 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 378 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 379 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 380 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 381 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 382 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 383 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 384 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 385 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 386 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 387 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 388 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 389 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 391 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 392 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 393 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 394 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 395 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 396 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 397 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 398 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 399 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 401 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 402 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 403 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 404 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 407 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 408 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 412 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 413 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 414 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 415 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 416 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 417 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 418 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 419 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 422 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 423 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 424 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 425 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 426 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 427 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 428 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 429 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 430 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 431 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 432 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 433 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 434 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 435 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 436 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 437 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 438 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 439 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 440 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 441 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 442 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 443 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 444 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 445 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 446 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 447 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 448 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 449 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 450 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 451 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 453 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 455 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 457 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 458 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 461 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 518 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 519 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 520 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 524 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 525 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 529 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 530 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 531 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 532 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 533 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 534 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 535 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 536 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 537 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 538 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 539 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 540 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 541 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 542 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 543 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 544 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 545 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 546 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 547 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 548 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 549 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 550 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 551 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 552 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 553 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 554 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 555 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 556 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 557 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 558 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 559 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 560 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 561 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 562 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 563 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 564 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 565 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 566 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 567 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 568 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 569 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 570 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 571 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 572 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 573 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 574 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 575 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 576 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 577 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 578 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 579 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 580 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 581 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 582 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 583 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 584 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 585 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 586 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 587 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 588 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 589 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 590 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 591 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 592 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 655 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 656 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 657 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 658 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 659 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 660 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 661 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 662 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 663 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 664 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 665 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 666 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 667 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 668 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 669 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 670 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 671 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 672 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 673 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 674 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 675 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 676 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 677 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 678 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 679 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 680 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 682 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 683 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 684 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 685 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 687 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 688 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 689 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 690 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 691 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 692 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 693 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 695 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 697 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 698 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 699 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 700 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 701 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 702 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 703 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 704 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 705 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 706 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 707 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 708 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 709 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 710 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 711 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 712 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 713 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 714 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 715 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 716 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 717 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 718 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 721 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 722 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 723 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 724 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 725 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 726 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 727 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 728 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 729 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 730 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 731 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 732 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 733 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 734 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 735 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 736 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 737 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 738 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 739 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 740 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 741 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 742 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 743 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 744 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 745 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 746 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 747 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 748 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 749 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 750 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 751 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 752 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 753 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 754 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 755 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 756 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 757 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 758 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 759 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 760 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 761 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 762 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 763 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 764 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 765 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 766 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 767 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 768 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 769 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 770 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 771 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 772 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 773 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 774 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 775 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 776 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 777 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 778 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 779 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 780 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 781 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 782 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 783 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 784 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 785 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 786 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 787 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 788 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 789 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 790 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 791 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 792 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 793 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 794 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 795 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 796 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 797 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 798 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 799 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 800 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.82 |
| Metatranscriptomes | 0 |
| Isolates | 26.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.56 |
| Nodule | 21.67 |
| Rhizoplane | 2.86 |
| Rhizosphere | 46.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000112 | 3300002704 | Bacteria | 42157 |
| 2 | JGI25156J39149_1000197 | 3300002705 | Bacteria | 42157 |
| 3 | JGI25154J39366_1000492 | 3300002738 | Bacteria | 20254 |
| 4 | JGI25154J39366_1001559 | 3300002738 | Bacteria | 7886 |
| 5 | JGI25157J39369_1000239 | 3300002741 | Bacteria | 42158 |
| 6 | JGI25152J39213_1023134 | 3300002773 | Bacteria | 1063 |
| 7 | JGI25150J39212_1013973 | 3300002774 | Bacteria | 1375 |
| 8 | JGI25159J45721_1007982 | 3300002987 | Bacteria | 2962 |
| 9 | JGI25151J46595_10001139 | 3300003187 | Bacteria | 19314 |
| 10 | JGI25151J46595_10002242 | 3300003187 | Bacteria | 11876 |
| 11 | JGI25151J46595_10007087 | 3300003187 | Bacteria | 5532 |
| 12 | JGI25151J46595_10022426 | 3300003187 | Bacteria | 2622 |
| 13 | JGI25151J46595_10023263 | 3300003187 | Bacteria | 2557 |
| 14 | JGI25406J46586_10010495 | 3300003203 | Bacteria | 4107 |
| 15 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 16 | JGI25153J46596_10000445 | 3300003215 | Bacteria | 26572 |
| 17 | JGI25153J46596_10000538 | 3300003215 | Bacteria | 23717 |
| 18 | JGI25153J46596_10001836 | 3300003215 | Bacteria | 12600 |
| 19 | JGI25153J46596_10001953 | 3300003215 | Bacteria | 12220 |
| 20 | JGI25153J46596_10002991 | 3300003215 | Bacteria | 9566 |
| 21 | rootH2_10003773 | 3300003320 | Bacteria | 14955 |
| 22 | rootH2_10038800 | 3300003320 | Bacteria | 24431 |
| 23 | rootL2_10003291 | 3300003322 | Bacteria | 28178 |
| 24 | JGI25160J50197_1001189 | 3300003354 | Bacteria | 13266 |
| 25 | JGI25404J52841_10004891 | 3300003659 | Bacteria | 2750 |
| 26 | JGI25404J52841_10008719 | 3300003659 | Bacteria | 2165 |
| 27 | Ga0055526_1000294 | 3300003771 | Bacteria | 41838 |
| 28 | Ga0055526_1003052 | 3300003771 | Bacteria | 10880 |
| 29 | Ga0055526_1004955 | 3300003771 | Bacteria | 7819 |
| 30 | Ga0055526_1007171 | 3300003771 | Bacteria | 5867 |
| 31 | Ga0055524_1000329 | 3300003775 | Bacteria | 44069 |
| 32 | Ga0055524_1005364 | 3300003775 | Bacteria | 5738 |
| 33 | Ga0055536_1002017 | 3300003781 | Bacteria | 11645 |
| 34 | Ga0055536_1015902 | 3300003781 | Bacteria | 2546 |
| 35 | Ga0055528_1005515 | 3300003790 | Bacteria | 5872 |
| 36 | Ga0055528_1005551 | 3300003790 | Bacteria | 5844 |
| 37 | Ga0055530_10010995 | 3300003791 | Bacteria | 3287 |
| 38 | Ga0055540_1016013 | 3300003792 | Bacteria | 2153 |
| 39 | Ga0055531_10000729 | 3300003794 | Bacteria | 27835 |
| 40 | Ga0055543_1002209 | 3300004625 | Bacteria | 6648 |
| 41 | Ga0065165_1001097 | 3300005262 | Bacteria | 32174 |
| 42 | Ga0065165_1002055 | 3300005262 | Bacteria | 18607 |
| 43 | Ga0065165_1002735 | 3300005262 | Bacteria | 14081 |
| 44 | Ga0065165_1005168 | 3300005262 | Bacteria | 7543 |
| 45 | Ga0070658_10361909 | 3300005327 | Bacteria | 1242 |
| 46 | Ga0070676_10190605 | 3300005328 | Bacteria | 1338 |
| 47 | Ga0070676_10230841 | 3300005328 | Bacteria | 1227 |
| 48 | Ga0070683_100086993 | 3300005329 | Bacteria | 2931 |
| 49 | Ga0070670_100014283 | 3300005331 | Bacteria | 6813 |
| 50 | Ga0070677_10000277 | 3300005333 | Bacteria | 17961 |
| 51 | Ga0068869_100019363 | 3300005334 | Bacteria | 4649 |
| 52 | Ga0068869_100034767 | 3300005334 | Bacteria | 3567 |
| 53 | Ga0070680_100177673 | 3300005336 | Unclassified | 1792 |
| 54 | Ga0068868_100040441 | 3300005338 | Bacteria | 3629 |
| 55 | Ga0068868_100227193 | 3300005338 | Bacteria | 1565 |
| 56 | Ga0068868_100309955 | 3300005338 | Bacteria | 1343 |
| 57 | Ga0070691_10005506 | 3300005341 | Bacteria | 5762 |
| 58 | Ga0070668_100002093 | 3300005347 | Bacteria | 14597 |
| 59 | Ga0070668_100012180 | 3300005347 | Bacteria | 6404 |
| 60 | Ga0070668_100038940 | 3300005347 | Bacteria | 3636 |
| 61 | Ga0070668_100067604 | 3300005347 | Bacteria | 2776 |
| 62 | Ga0070668_100088506 | 3300005347 | Bacteria | 2438 |
| 63 | Ga0070668_100458226 | 3300005347 | Bacteria | 1097 |
| 64 | Ga0070669_100009057 | 3300005353 | Bacteria | 7099 |
| 65 | Ga0070669_100016819 | 3300005353 | Bacteria | 5220 |
| 66 | Ga0070675_100000224 | 3300005354 | Bacteria | 36200 |
| 67 | Ga0070675_100055476 | 3300005354 | Bacteria | 3262 |
| 68 | Ga0070671_100001015 | 3300005355 | Bacteria | 20626 |
| 69 | Ga0070671_100034845 | 3300005355 | Bacteria | 4168 |
| 70 | Ga0070671_100112725 | 3300005355 | Bacteria | 2285 |
| 71 | Ga0070674_100000094 | 3300005356 | Bacteria | 41372 |
| 72 | Ga0070673_100000132 | 3300005364 | Bacteria | 35383 |
| 73 | Ga0070673_100019247 | 3300005364 | Bacteria | 4900 |
| 74 | Ga0070673_100117539 | 3300005364 | Bacteria | 2213 |
| 75 | Ga0070673_100313669 | 3300005364 | Bacteria | 1384 |
| 76 | Ga0070659_100036188 | 3300005366 | Bacteria | 3847 |
| 77 | Ga0070667_100002751 | 3300005367 | Bacteria | 15217 |
| 78 | Ga0070667_100135029 | 3300005367 | Bacteria | 2157 |
| 79 | Ga0070709_10001902 | 3300005434 | Bacteria | 11340 |
| 80 | Ga0070709_10012965 | 3300005434 | Bacteria | 4675 |
| 81 | Ga0070714_100033431 | 3300005435 | Bacteria | 4298 |
| 82 | Ga0070714_100063866 | 3300005435 | Bacteria | 3167 |
| 83 | Ga0070714_100108307 | 3300005435 | Bacteria | 2457 |
| 84 | Ga0070713_100158950 | 3300005436 | Bacteria | 2016 |
| 85 | Ga0070713_100191331 | 3300005436 | Bacteria | 1844 |
| 86 | Ga0070710_10007353 | 3300005437 | Bacteria | 5331 |
| 87 | Ga0070710_10019031 | 3300005437 | Bacteria | 3543 |
| 88 | Ga0070710_10020006 | 3300005437 | Bacteria | 3468 |
| 89 | Ga0070710_10105297 | 3300005437 | Bacteria | 1686 |
| 90 | Ga0070711_100003318 | 3300005439 | Bacteria | 9369 |
| 91 | Ga0070711_100035905 | 3300005439 | Bacteria | 3318 |
| 92 | Ga0070711_100103701 | 3300005439 | Bacteria | 2073 |
| 93 | Ga0070705_100072833 | 3300005440 | Bacteria | 2083 |
| 94 | Ga0070700_100002099 | 3300005441 | Bacteria | 10127 |
| 95 | Ga0070694_100178884 | 3300005444 | Bacteria | 1568 |
| 96 | Ga0070663_100025078 | 3300005455 | Bacteria | 4022 |
| 97 | Ga0070663_100245350 | 3300005455 | Bacteria | 1415 |
| 98 | Ga0070678_100000658 | 3300005456 | Bacteria | 16936 |
| 99 | Ga0070678_100015205 | 3300005456 | Bacteria | 4884 |
| 100 | Ga0070678_100113954 | 3300005456 | Bacteria | 2120 |
| 101 | Ga0070662_100074005 | 3300005457 | Bacteria | 2519 |
| 102 | Ga0070681_10037922 | 3300005458 | Bacteria | 4833 |
| 103 | Ga0070681_10085431 | 3300005458 | Bacteria | 3108 |
| 104 | Ga0070681_10348024 | 3300005458 | Bacteria | 1392 |
| 105 | Ga0068867_100000183 | 3300005459 | Bacteria | 41353 |
| 106 | Ga0068867_100059626 | 3300005459 | Bacteria | 2829 |
| 107 | Ga0070699_100404947 | 3300005518 | Bacteria | 1234 |
| 108 | Ga0070679_100078285 | 3300005530 | Bacteria | 3295 |
| 109 | Ga0070684_100003721 | 3300005535 | Bacteria | 11509 |
| 110 | Ga0070697_100005598 | 3300005536 | Bacteria | 9683 |
| 111 | Ga0070697_100093937 | 3300005536 | Bacteria | 2484 |
| 112 | Ga0068853_100134956 | 3300005539 | Bacteria | 2211 |
| 113 | Ga0070672_100026539 | 3300005543 | Bacteria | 4312 |
| 114 | Ga0070672_100514159 | 3300005543 | Bacteria | 1037 |
| 115 | Ga0070695_100032449 | 3300005545 | Bacteria | 3265 |
| 116 | Ga0070696_100074707 | 3300005546 | Bacteria | 2390 |
| 117 | Ga0070696_100302296 | 3300005546 | Bacteria | 1226 |
| 118 | Ga0070665_100001793 | 3300005548 | Bacteria | 24412 |
| 119 | Ga0070665_100101470 | 3300005548 | Bacteria | 2881 |
| 120 | Ga0070665_100264287 | 3300005548 | Bacteria | 1722 |
| 121 | Ga0070704_100002950 | 3300005549 | Bacteria | 9676 |
| 122 | Ga0070704_100157057 | 3300005549 | Unclassified | 1795 |
| 123 | Ga0068855_100431984 | 3300005563 | Bacteria | 1439 |
| 124 | Ga0070664_100100002 | 3300005564 | Bacteria | 2521 |
| 125 | Ga0068857_100210607 | 3300005577 | Bacteria | 1774 |
| 126 | Ga0068854_100284263 | 3300005578 | Bacteria | 1333 |
| 127 | Ga0068856_100033647 | 3300005614 | Bacteria | 5019 |
| 128 | Ga0068856_100058870 | 3300005614 | Bacteria | 3794 |
| 129 | Ga0070702_100054816 | 3300005615 | Bacteria | 2296 |
| 130 | Ga0070702_100122904 | 3300005615 | Bacteria | 1628 |
| 131 | Ga0068852_100001003 | 3300005616 | Bacteria | 18632 |
| 132 | Ga0068852_100302172 | 3300005616 | Bacteria | 1549 |
| 133 | Ga0068859_100013871 | 3300005617 | Bacteria | 8081 |
| 134 | Ga0068859_100232140 | 3300005617 | Bacteria | 1933 |
| 135 | Ga0068859_100260537 | 3300005617 | Bacteria | 1825 |
| 136 | Ga0068864_100001387 | 3300005618 | Bacteria | 20080 |
| 137 | Ga0068864_100012763 | 3300005618 | Bacteria | 6945 |
| 138 | Ga0068864_100092506 | 3300005618 | Bacteria | 2670 |
| 139 | Ga0068864_100196195 | 3300005618 | Bacteria | 1853 |
| 140 | Ga0068866_10102620 | 3300005718 | Bacteria | 1581 |
| 141 | Ga0068861_100008698 | 3300005719 | Bacteria | 6984 |
| 142 | Ga0068861_100067100 | 3300005719 | Bacteria | 2767 |
| 143 | Ga0068870_10070933 | 3300005840 | Bacteria | 1900 |
| 144 | Ga0068863_100003575 | 3300005841 | Bacteria | 15335 |
| 145 | Ga0068863_100028496 | 3300005841 | Bacteria | 5333 |
| 146 | Ga0068863_100116394 | 3300005841 | Bacteria | 2547 |
| 147 | Ga0068858_100016761 | 3300005842 | Bacteria | 6881 |
| 148 | Ga0068858_100116179 | 3300005842 | Bacteria | 2501 |
| 149 | Ga0068858_100250114 | 3300005842 | Bacteria | 1684 |
| 150 | Ga0068860_100011049 | 3300005843 | Bacteria | 8902 |
| 151 | Ga0068860_100011142 | 3300005843 | Bacteria | 8858 |
| 152 | Ga0068860_100100480 | 3300005843 | Bacteria | 2760 |
| 153 | Ga0068860_100179659 | 3300005843 | Bacteria | 2045 |
| 154 | Ga0068862_100005845 | 3300005844 | Bacteria | 10248 |
| 155 | Ga0068862_100035365 | 3300005844 | Bacteria | 4230 |
| 156 | Ga0068862_100077601 | 3300005844 | Bacteria | 2877 |
| 157 | Ga0081455_10014700 | 3300005937 | Bacteria | 7645 |
| 158 | Ga0081455_10030982 | 3300005937 | Bacteria | 4848 |
| 159 | Ga0081455_10033538 | 3300005937 | Bacteria | 4612 |
| 160 | Ga0081455_10090038 | 3300005937 | Bacteria | 2489 |
| 161 | Ga0081455_10131260 | 3300005937 | Bacteria | 1959 |
| 162 | Ga0081538_10005050 | 3300005981 | Bacteria | 11996 |
| 163 | Ga0081540_1000287 | 3300005983 | Bacteria | 52759 |
| 164 | Ga0081540_1006462 | 3300005983 | Bacteria | 8532 |
| 165 | Ga0081540_1017035 | 3300005983 | Bacteria | 4516 |
| 166 | Ga0081540_1019445 | 3300005983 | Bacteria | 4125 |
| 167 | Ga0081540_1022824 | 3300005983 | Bacteria | 3684 |
| 168 | Ga0081540_1022968 | 3300005983 | Bacteria | 3666 |
| 169 | Ga0081540_1037387 | 3300005983 | Bacteria | 2574 |
| 170 | Ga0081540_1041655 | 3300005983 | Bacteria | 2379 |
| 171 | Ga0081539_10002840 | 3300005985 | Bacteria | 23102 |
| 172 | Ga0081539_10160343 | 3300005985 | Bacteria | 1072 |
| 173 | Ga0070717_10077764 | 3300006028 | Bacteria | 2779 |
| 174 | Ga0075365_10004444 | 3300006038 | Bacteria | 7430 |
| 175 | Ga0075365_10031780 | 3300006038 | Bacteria | 3388 |
| 176 | Ga0075365_10067396 | 3300006038 | Bacteria | 2403 |
| 177 | Ga0075365_10088963 | 3300006038 | Bacteria | 2102 |
| 178 | Ga0075365_10098570 | 3300006038 | Bacteria | 1999 |
| 179 | Ga0075365_10114483 | 3300006038 | Bacteria | 1856 |
| 180 | Ga0075365_10198549 | 3300006038 | Bacteria | 1405 |
| 181 | Ga0075368_10004886 | 3300006042 | Bacteria | 4572 |
| 182 | Ga0075368_10016228 | 3300006042 | Bacteria | 2775 |
| 183 | Ga0075368_10111814 | 3300006042 | Bacteria | 1127 |
| 184 | Ga0075363_100010972 | 3300006048 | Bacteria | 4324 |
| 185 | Ga0075363_100015751 | 3300006048 | Bacteria | 3722 |
| 186 | Ga0075364_10001365 | 3300006051 | Bacteria | 13166 |
| 187 | Ga0075364_10007672 | 3300006051 | Bacteria | 6418 |
| 188 | Ga0075364_10028066 | 3300006051 | Bacteria | 3600 |
| 189 | Ga0070715_10002633 | 3300006163 | Bacteria | 5553 |
| 190 | Ga0070715_10005023 | 3300006163 | Bacteria | 4385 |
| 191 | Ga0070716_100046680 | 3300006173 | Bacteria | 2439 |
| 192 | Ga0070716_100192214 | 3300006173 | Bacteria | 1349 |
| 193 | Ga0070712_100002895 | 3300006175 | Bacteria | 10646 |
| 194 | Ga0070712_100015634 | 3300006175 | Bacteria | 4893 |
| 195 | Ga0075362_10012412 | 3300006177 | Bacteria | 3384 |
| 196 | Ga0075362_10061449 | 3300006177 | Bacteria | 1700 |
| 197 | Ga0075367_10000941 | 3300006178 | Bacteria | 11832 |
| 198 | Ga0075367_10007827 | 3300006178 | Bacteria | 5498 |
| 199 | Ga0075367_10063112 | 3300006178 | Bacteria | 2214 |
| 200 | Ga0075369_10012242 | 3300006186 | Bacteria | 3388 |
| 201 | Ga0075369_10025703 | 3300006186 | Bacteria | 2451 |
| 202 | Ga0075369_10062278 | 3300006186 | Bacteria | 1629 |
| 203 | Ga0075369_10071521 | 3300006186 | Bacteria | 1527 |
| 204 | Ga0075369_10099870 | 3300006186 | Bacteria | 1301 |
| 205 | Ga0075366_10001108 | 3300006195 | Bacteria | 13249 |
| 206 | Ga0075366_10012683 | 3300006195 | Bacteria | 4786 |
| 207 | Ga0075366_10092393 | 3300006195 | Bacteria | 1813 |
| 208 | Ga0075366_10152563 | 3300006195 | Bacteria | 1399 |
| 209 | Ga0097621_100016114 | 3300006237 | Bacteria | 5643 |
| 210 | Ga0097621_100101508 | 3300006237 | Bacteria | 2421 |
| 211 | Ga0097621_100604493 | 3300006237 | Bacteria | 1003 |
| 212 | Ga0075370_10015332 | 3300006353 | Bacteria | 4100 |
| 213 | Ga0075370_10073167 | 3300006353 | Bacteria | 1962 |
| 214 | Ga0075370_10102129 | 3300006353 | Bacteria | 1660 |
| 215 | Ga0068871_100002062 | 3300006358 | Bacteria | 13621 |
| 216 | Ga0075428_100013745 | 3300006844 | Bacteria | 9015 |
| 217 | Ga0075428_100024178 | 3300006844 | Bacteria | 6721 |
| 218 | Ga0075428_100214898 | 3300006844 | Bacteria | 2077 |
| 219 | Ga0075430_100014044 | 3300006846 | Bacteria | 6827 |
| 220 | Ga0075430_100016966 | 3300006846 | Bacteria | 6200 |
| 221 | Ga0075430_100046100 | 3300006846 | Bacteria | 3681 |
| 222 | Ga0075431_100351630 | 3300006847 | Bacteria | 1481 |
| 223 | Ga0075431_100408676 | 3300006847 | Bacteria | 1358 |
| 224 | Ga0075433_10001822 | 3300006852 | Bacteria | 16017 |
| 225 | Ga0075433_10062737 | 3300006852 | Bacteria | 3255 |
| 226 | Ga0075434_100176014 | 3300006871 | Bacteria | 2159 |
| 227 | Ga0075434_100260298 | 3300006871 | Bacteria | 1754 |
| 228 | Ga0075429_100162557 | 3300006880 | Bacteria | 1955 |
| 229 | Ga0075429_100291968 | 3300006880 | Bacteria | 1427 |
| 230 | Ga0068865_100057377 | 3300006881 | Bacteria | 2716 |
| 231 | Ga0068865_100148238 | 3300006881 | Bacteria | 1777 |
| 232 | Ga0097620_100013871 | 3300006931 | Bacteria | 8081 |
| 233 | Ga0097620_100232137 | 3300006931 | Bacteria | 1933 |
| 234 | Ga0097620_100260548 | 3300006931 | Bacteria | 1825 |
| 235 | Ga0099824_1022087 | 3300006942 | Bacteria | 4274 |
| 236 | Ga0099794_10015436 | 3300007265 | Bacteria | 3372 |
| 237 | Ga0099794_10020399 | 3300007265 | Bacteria | 2999 |
| 238 | Ga0099795_10031309 | 3300007788 | Bacteria | 1831 |
| 239 | Ga0105250_10084800 | 3300009092 | Bacteria | 1286 |
| 240 | Ga0105240_10000052 | 3300009093 | Bacteria | 232583 |
| 241 | Ga0105240_10060989 | 3300009093 | Bacteria | 4701 |
| 242 | Ga0105240_10110542 | 3300009093 | Bacteria | 3326 |
| 243 | Ga0111539_10019063 | 3300009094 | Bacteria | 8478 |
| 244 | Ga0111539_10046861 | 3300009094 | Bacteria | 5170 |
| 245 | Ga0111539_10064023 | 3300009094 | Bacteria | 4351 |
| 246 | Ga0111539_10104075 | 3300009094 | Bacteria | 3331 |
| 247 | Ga0111539_10170741 | 3300009094 | Bacteria | 2541 |
| 248 | Ga0111539_10277782 | 3300009094 | Bacteria | 1949 |
| 249 | Ga0105245_10055768 | 3300009098 | Bacteria | 3550 |
| 250 | Ga0105245_10107778 | 3300009098 | Bacteria | 2586 |
| 251 | Ga0105245_10233051 | 3300009098 | Bacteria | 1781 |
| 252 | Ga0105245_10379769 | 3300009098 | Bacteria | 1407 |
| 253 | Ga0105245_10620932 | 3300009098 | Bacteria | 1109 |
| 254 | Ga0105245_10647798 | 3300009098 | Bacteria | 1086 |
| 255 | Ga0105247_10016792 | 3300009101 | Bacteria | 4389 |
| 256 | Ga0114129_10037785 | 3300009147 | Bacteria | 6814 |
| 257 | Ga0114129_10047181 | 3300009147 | Bacteria | 6054 |
| 258 | Ga0114129_10538960 | 3300009147 | Bacteria | 1519 |
| 259 | Ga0114129_10793909 | 3300009147 | Bacteria | 1208 |
| 260 | Ga0105243_10725442 | 3300009148 | Bacteria | 972 |
| 261 | Ga0105241_10233679 | 3300009174 | Bacteria | 1551 |
| 262 | Ga0105248_10143155 | 3300009177 | Bacteria | 2697 |
| 263 | Ga0105248_10166735 | 3300009177 | Bacteria | 2483 |
| 264 | Ga0105248_10530893 | 3300009177 | Bacteria | 1327 |
| 265 | Ga0105237_10011301 | 3300009545 | Bacteria | 9447 |
| 266 | Ga0105237_10014185 | 3300009545 | Bacteria | 8343 |
| 267 | Ga0105237_10020492 | 3300009545 | Bacteria | 6813 |
| 268 | Ga0105237_10034201 | 3300009545 | Bacteria | 5147 |
| 269 | Ga0105237_10130618 | 3300009545 | Bacteria | 2506 |
| 270 | Ga0105237_10465549 | 3300009545 | Bacteria | 1270 |
| 271 | Ga0105238_10156933 | 3300009551 | Bacteria | 2251 |
| 272 | Ga0105238_10192322 | 3300009551 | Bacteria | 2016 |
| 273 | Ga0105238_10401500 | 3300009551 | Bacteria | 1364 |
| 274 | Ga0105249_10042784 | 3300009553 | Bacteria | 4121 |
| 275 | Ga0105249_10164237 | 3300009553 | Bacteria | 2148 |
| 276 | Ga0123341_1000004 | 3300009765 | Bacteria | 153727 |
| 277 | Ga0123341_1000928 | 3300009765 | Bacteria | 20507 |
| 278 | Ga0123342_1012789 | 3300009766 | Bacteria | 8622 |
| 279 | Ga0105239_10022996 | 3300010375 | Bacteria | 6873 |
| 280 | Ga0105239_10080181 | 3300010375 | Bacteria | 3591 |
| 281 | Ga0105239_10085808 | 3300010375 | Bacteria | 3470 |
| 282 | Ga0105239_10111798 | 3300010375 | Bacteria | 3029 |
| 283 | Ga0105239_10335359 | 3300010375 | Bacteria | 1706 |
| 284 | Ga0105246_10071539 | 3300011119 | Bacteria | 2442 |
| 285 | Ga0105246_10071630 | 3300011119 | Bacteria | 2441 |
| 286 | Ga0105246_10111269 | 3300011119 | Bacteria | 2012 |
| 287 | Ga0105246_10253810 | 3300011119 | Bacteria | 1397 |
| 288 | Ga0157373_10002385 | 3300013100 | Bacteria | 14270 |
| 289 | Ga0157371_10001149 | 3300013102 | Bacteria | 28495 |
| 290 | Ga0157370_10003466 | 3300013104 | Bacteria | 18505 |
| 291 | Ga0157369_10101634 | 3300013105 | Bacteria | 3064 |
| 292 | Ga0171463_1005 | 3300013249 | Bacteria | 358236 |
| 293 | Ga0171462_1036 | 3300013250 | Bacteria | 79177 |
| 294 | Ga0157374_10015447 | 3300013296 | Bacteria | 6696 |
| 295 | Ga0157374_10177414 | 3300013296 | Bacteria | 2080 |
| 296 | Ga0157378_10001817 | 3300013297 | Bacteria | 19130 |
| 297 | Ga0157378_10080000 | 3300013297 | Bacteria | 2952 |
| 298 | Ga0163162_10208117 | 3300013306 | Bacteria | 2085 |
| 299 | Ga0163162_10357376 | 3300013306 | Bacteria | 1594 |
| 300 | Ga0163162_10465892 | 3300013306 | Bacteria | 1395 |
| 301 | Ga0157375_10001014 | 3300013308 | Bacteria | 24305 |
| 302 | Ga0157375_10025670 | 3300013308 | Bacteria | 5480 |
| 303 | Ga0157375_10148137 | 3300013308 | Bacteria | 2480 |
| 304 | Ga0157375_10169634 | 3300013308 | Bacteria | 2329 |
| 305 | Ga0163163_10022458 | 3300014325 | Bacteria | 5975 |
| 306 | Ga0163163_10195174 | 3300014325 | Bacteria | 2072 |
| 307 | Ga0157380_10043207 | 3300014326 | Bacteria | 3527 |
| 308 | Ga0157377_10260516 | 3300014745 | Bacteria | 1128 |
| 309 | Ga0157379_10155023 | 3300014968 | Bacteria | 2066 |
| 310 | Ga0157379_10302728 | 3300014968 | Bacteria | 1457 |
| 311 | Ga0183363_1022 | 3300015690 | Bacteria | 57453 |
| 312 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 313 | Ga0214544_1000130 | 3300021320 | Bacteria | 108844 |
| 314 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 315 | Ga0214542_1000014 | 3300021321 | Bacteria | 233825 |
| 316 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 317 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 318 | Ga0214543_1000146 | 3300021327 | Bacteria | 98609 |
| 319 | Ga0214543_1012039 | 3300021327 | Bacteria | 11763 |
| 320 | Ga0213876_10001150 | 3300021384 | Bacteria | 16749 |
| 321 | Ga0213875_10061127 | 3300021388 | Bacteria | 1761 |
| 322 | Ga0213875_10074731 | 3300021388 | Bacteria | 1581 |
| 323 | Ga0209435_100089 | 3300025206 | Bacteria | 42209 |
| 324 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 325 | Ga0207425_1006786 | 3300025245 | Bacteria | 3094 |
| 326 | Ga0207425_1007610 | 3300025245 | Bacteria | 2843 |
| 327 | Ga0207425_1023781 | 3300025245 | Bacteria | 1278 |
| 328 | Ga0209646_1000293 | 3300025246 | Bacteria | 42209 |
| 329 | Ga0209026_1000364 | 3300025250 | Bacteria | 42209 |
| 330 | Ga0209677_106350 | 3300025253 | Bacteria | 2814 |
| 331 | Ga0209148_1004847 | 3300025254 | Bacteria | 3203 |
| 332 | Ga0209759_1000508 | 3300025256 | Bacteria | 42209 |
| 333 | Ga0209129_1000249 | 3300025258 | Bacteria | 56453 |
| 334 | Ga0209129_1008239 | 3300025258 | Bacteria | 2932 |
| 335 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 336 | Ga0209233_1005792 | 3300025261 | Bacteria | 4060 |
| 337 | Ga0209565_1020364 | 3300025263 | Bacteria | 1400 |
| 338 | Ga0209455_1002341 | 3300025272 | Bacteria | 7411 |
| 339 | Ga0209455_1004862 | 3300025272 | Bacteria | 4281 |
| 340 | Ga0209673_1000846 | 3300025273 | Bacteria | 39927 |
| 341 | Ga0209673_1001554 | 3300025273 | Bacteria | 20714 |
| 342 | Ga0209673_1011769 | 3300025273 | Bacteria | 3581 |
| 343 | Ga0209130_1001589 | 3300025284 | Bacteria | 14264 |
| 344 | Ga0209675_1001292 | 3300025291 | Bacteria | 14874 |
| 345 | Ga0209675_1009170 | 3300025291 | Bacteria | 3522 |
| 346 | Ga0209676_1002007 | 3300025292 | Bacteria | 16064 |
| 347 | Ga0209676_1006744 | 3300025292 | Bacteria | 5584 |
| 348 | Ga0209676_1013963 | 3300025292 | Bacteria | 3054 |
| 349 | Ga0209025_1000121 | 3300025294 | Bacteria | 208700 |
| 350 | Ga0209025_1001108 | 3300025294 | Bacteria | 38669 |
| 351 | Ga0209025_1001350 | 3300025294 | Bacteria | 32991 |
| 352 | Ga0209025_1002685 | 3300025294 | Bacteria | 18158 |
| 353 | Ga0209025_1006909 | 3300025294 | Bacteria | 8646 |
| 354 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 355 | Ga0209564_1000341 | 3300025295 | Bacteria | 89262 |
| 356 | Ga0209564_1002099 | 3300025295 | Bacteria | 17049 |
| 357 | Ga0209564_1002240 | 3300025295 | Bacteria | 15932 |
| 358 | Ga0209564_1004061 | 3300025295 | Bacteria | 9232 |
| 359 | Ga0209564_1051806 | 3300025295 | Bacteria | 992 |
| 360 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 361 | Ga0209758_1000335 | 3300025297 | Bacteria | 87764 |
| 362 | Ga0209758_1000445 | 3300025297 | Bacteria | 69196 |
| 363 | Ga0209758_1002632 | 3300025297 | Bacteria | 17829 |
| 364 | Ga0209758_1002782 | 3300025297 | Bacteria | 17126 |
| 365 | Ga0209758_1009164 | 3300025297 | Bacteria | 6227 |
| 366 | Ga0209758_1039146 | 3300025297 | Bacteria | 1807 |
| 367 | Ga0209758_1040308 | 3300025297 | Bacteria | 1763 |
| 368 | Ga0209050_1002265 | 3300025298 | Bacteria | 17075 |
| 369 | Ga0209050_1013214 | 3300025298 | Bacteria | 3691 |
| 370 | Ga0209256_1000176 | 3300025299 | Bacteria | 126545 |
| 371 | Ga0209256_1000205 | 3300025299 | Bacteria | 111530 |
| 372 | Ga0209256_1000403 | 3300025299 | Bacteria | 68377 |
| 373 | Ga0209256_1000534 | 3300025299 | Bacteria | 55095 |
| 374 | Ga0207426_1000201 | 3300025302 | Bacteria | 143975 |
| 375 | Ga0207426_1007422 | 3300025302 | Bacteria | 4594 |
| 376 | Ga0209051_1007468 | 3300025303 | Bacteria | 5968 |
| 377 | Ga0209051_1008435 | 3300025303 | Bacteria | 5455 |
| 378 | Ga0209257_1000599 | 3300025304 | Bacteria | 59865 |
| 379 | Ga0209257_1001779 | 3300025304 | Bacteria | 23779 |
| 380 | Ga0209257_1008569 | 3300025304 | Bacteria | 5766 |
| 381 | Ga0207697_10006269 | 3300025315 | Bacteria | 5405 |
| 382 | Ga0207682_10000084 | 3300025893 | Bacteria | 42038 |
| 383 | Ga0207692_10000985 | 3300025898 | Bacteria | 10379 |
| 384 | Ga0207642_10060513 | 3300025899 | Bacteria | 1757 |
| 385 | Ga0207710_10014600 | 3300025900 | Bacteria | 3315 |
| 386 | Ga0207688_10120688 | 3300025901 | Bacteria | 1529 |
| 387 | Ga0207647_10023900 | 3300025904 | Bacteria | 4036 |
| 388 | Ga0207647_10164332 | 3300025904 | Bacteria | 1294 |
| 389 | Ga0207685_10010851 | 3300025905 | Bacteria | 2712 |
| 390 | Ga0207699_10008567 | 3300025906 | Bacteria | 5054 |
| 391 | Ga0207699_10145192 | 3300025906 | Bacteria | 1563 |
| 392 | Ga0207645_10000663 | 3300025907 | Bacteria | 28554 |
| 393 | Ga0207645_10018670 | 3300025907 | Bacteria | 4555 |
| 394 | Ga0207645_10070694 | 3300025907 | Bacteria | 2233 |
| 395 | Ga0207643_10069191 | 3300025908 | Bacteria | 2029 |
| 396 | Ga0207643_10222293 | 3300025908 | Bacteria | 1156 |
| 397 | Ga0207654_10018655 | 3300025911 | Bacteria | 3645 |
| 398 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 399 | Ga0207695_10000122 | 3300025913 | Bacteria | 232677 |
| 400 | Ga0207695_10251590 | 3300025913 | Bacteria | 1666 |
| 401 | Ga0207671_10018466 | 3300025914 | Bacteria | 5351 |
| 402 | Ga0207671_10025951 | 3300025914 | Bacteria | 4396 |
| 403 | Ga0207671_10353055 | 3300025914 | Bacteria | 1166 |
| 404 | Ga0207693_10029022 | 3300025915 | Bacteria | 4372 |
| 405 | Ga0207693_10042330 | 3300025915 | Bacteria | 3585 |
| 406 | Ga0207663_10112064 | 3300025916 | Bacteria | 1853 |
| 407 | Ga0207663_10194828 | 3300025916 | Bacteria | 1458 |
| 408 | Ga0207652_10016276 | 3300025921 | Bacteria | 6069 |
| 409 | Ga0207681_10006311 | 3300025923 | Bacteria | 7277 |
| 410 | Ga0207681_10259235 | 3300025923 | Bacteria | 1361 |
| 411 | Ga0207694_10262412 | 3300025924 | Bacteria | 1415 |
| 412 | Ga0207650_10013219 | 3300025925 | Bacteria | 5711 |
| 413 | Ga0207650_10069612 | 3300025925 | Bacteria | 2644 |
| 414 | Ga0207650_10079425 | 3300025925 | Bacteria | 2485 |
| 415 | Ga0207659_10003329 | 3300025926 | Bacteria | 9633 |
| 416 | Ga0207687_10029665 | 3300025927 | Bacteria | 3681 |
| 417 | Ga0207687_10034122 | 3300025927 | Bacteria | 3454 |
| 418 | Ga0207687_10115510 | 3300025927 | Bacteria | 2000 |
| 419 | Ga0207700_10000320 | 3300025928 | Bacteria | 28180 |
| 420 | Ga0207700_10031277 | 3300025928 | Bacteria | 3779 |
| 421 | Ga0207700_10249639 | 3300025928 | Bacteria | 1515 |
| 422 | Ga0207664_10016641 | 3300025929 | Bacteria | 5370 |
| 423 | Ga0207664_10129290 | 3300025929 | Bacteria | 2124 |
| 424 | Ga0207644_10004187 | 3300025931 | Bacteria | 9361 |
| 425 | Ga0207690_10121767 | 3300025932 | Bacteria | 1896 |
| 426 | Ga0207706_10016538 | 3300025933 | Bacteria | 6659 |
| 427 | Ga0207706_10099488 | 3300025933 | Bacteria | 2559 |
| 428 | Ga0207709_10068782 | 3300025935 | Bacteria | 2239 |
| 429 | Ga0207709_10117239 | 3300025935 | Bacteria | 1791 |
| 430 | Ga0207670_10041017 | 3300025936 | Bacteria | 3042 |
| 431 | Ga0207704_10015461 | 3300025938 | Bacteria | 3890 |
| 432 | Ga0207704_10047997 | 3300025938 | Bacteria | 2557 |
| 433 | Ga0207704_10143993 | 3300025938 | Bacteria | 1671 |
| 434 | Ga0207704_10203711 | 3300025938 | Bacteria | 1450 |
| 435 | Ga0207704_10577748 | 3300025938 | Bacteria | 917 |
| 436 | Ga0207665_10018294 | 3300025939 | Bacteria | 4602 |
| 437 | Ga0207665_10029914 | 3300025939 | Bacteria | 3599 |
| 438 | Ga0207665_10244428 | 3300025939 | Bacteria | 1324 |
| 439 | Ga0207691_10000018 | 3300025940 | Bacteria | 134343 |
| 440 | Ga0207691_10000087 | 3300025940 | Bacteria | 78167 |
| 441 | Ga0207691_10148321 | 3300025940 | Bacteria | 2063 |
| 442 | Ga0207691_10204300 | 3300025940 | Bacteria | 1718 |
| 443 | Ga0207711_10032525 | 3300025941 | Bacteria | 4410 |
| 444 | Ga0207711_10213603 | 3300025941 | Bacteria | 1763 |
| 445 | Ga0207689_10040619 | 3300025942 | Bacteria | 3850 |
| 446 | Ga0207661_10000633 | 3300025944 | Bacteria | 22606 |
| 447 | Ga0207667_10045957 | 3300025949 | Bacteria | 4623 |
| 448 | Ga0207651_10251636 | 3300025960 | Bacteria | 1446 |
| 449 | Ga0207712_10045112 | 3300025961 | Bacteria | 3051 |
| 450 | Ga0207668_10000899 | 3300025972 | Bacteria | 17976 |
| 451 | Ga0207668_10007626 | 3300025972 | Bacteria | 6443 |
| 452 | Ga0207668_10031173 | 3300025972 | Bacteria | 3509 |
| 453 | Ga0207668_10063662 | 3300025972 | Bacteria | 2603 |
| 454 | Ga0207668_10279070 | 3300025972 | Bacteria | 1369 |
| 455 | Ga0207640_10144707 | 3300025981 | Bacteria | 1738 |
| 456 | Ga0207640_10162833 | 3300025981 | Bacteria | 1653 |
| 457 | Ga0207640_10165198 | 3300025981 | Bacteria | 1643 |
| 458 | Ga0207658_10013727 | 3300025986 | Bacteria | 5540 |
| 459 | Ga0207658_10637251 | 3300025986 | Bacteria | 960 |
| 460 | Ga0207703_10092104 | 3300026035 | Bacteria | 2550 |
| 461 | Ga0207639_10078615 | 3300026041 | Bacteria | 2604 |
| 462 | Ga0207639_10218291 | 3300026041 | Bacteria | 1645 |
| 463 | Ga0207678_10036869 | 3300026067 | Bacteria | 4256 |
| 464 | Ga0207678_10225011 | 3300026067 | Bacteria | 1606 |
| 465 | Ga0207708_10000242 | 3300026075 | Bacteria | 43205 |
| 466 | Ga0207708_10107400 | 3300026075 | Bacteria | 2164 |
| 467 | Ga0207702_10007536 | 3300026078 | Bacteria | 9279 |
| 468 | Ga0207702_10107345 | 3300026078 | Bacteria | 2476 |
| 469 | Ga0207702_10156910 | 3300026078 | Bacteria | 2075 |
| 470 | Ga0207641_10004243 | 3300026088 | Bacteria | 12491 |
| 471 | Ga0207641_10150138 | 3300026088 | Bacteria | 2110 |
| 472 | Ga0207641_10298338 | 3300026088 | Bacteria | 1521 |
| 473 | Ga0207648_10000526 | 3300026089 | Bacteria | 42837 |
| 474 | Ga0207648_10215753 | 3300026089 | Bacteria | 1704 |
| 475 | Ga0207676_10134075 | 3300026095 | Bacteria | 2110 |
| 476 | Ga0207676_10188791 | 3300026095 | Bacteria | 1811 |
| 477 | Ga0207676_10244249 | 3300026095 | Bacteria | 1612 |
| 478 | Ga0207674_10014693 | 3300026116 | Bacteria | 8634 |
| 479 | Ga0207674_10195908 | 3300026116 | Bacteria | 1970 |
| 480 | Ga0207675_100014392 | 3300026118 | Bacteria | 7375 |
| 481 | Ga0207675_100023306 | 3300026118 | Bacteria | 5757 |
| 482 | Ga0207675_100053073 | 3300026118 | Bacteria | 3783 |
| 483 | Ga0207675_100228366 | 3300026118 | Bacteria | 1795 |
| 484 | Ga0207675_100271945 | 3300026118 | Bacteria | 1644 |
| 485 | Ga0207675_100408817 | 3300026118 | Bacteria | 1339 |
| 486 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 487 | Ga0207683_10057745 | 3300026121 | Bacteria | 3407 |
| 488 | Ga0207683_10123371 | 3300026121 | Bacteria | 2327 |
| 489 | Ga0207683_10164091 | 3300026121 | Bacteria | 2010 |
| 490 | Ga0207698_10046918 | 3300026142 | Bacteria | 3267 |
| 491 | Ga0207698_10133811 | 3300026142 | Bacteria | 2123 |
| 492 | Ga0207698_10197657 | 3300026142 | Bacteria | 1798 |
| 493 | Ga0209389_1000051 | 3300027296 | Bacteria | 110364 |
| 494 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 495 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 496 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 497 | Ga0210000_1006512 | 3300027462 | Bacteria | 1700 |
| 498 | Ga0209999_1014530 | 3300027543 | Bacteria | 1431 |
| 499 | Ga0209588_1057082 | 3300027671 | Unclassified | 1262 |
| 500 | Ga0209813_10003733 | 3300027866 | Bacteria | 3588 |
| 501 | Ga0209813_10004512 | 3300027866 | Bacteria | 3330 |
| 502 | Ga0207428_10011801 | 3300027907 | Bacteria | 7701 |
| 503 | Ga0207428_10217992 | 3300027907 | Bacteria | 1431 |
| 504 | Ga0268266_10003057 | 3300028379 | Bacteria | 17106 |
| 505 | Ga0268266_10003873 | 3300028379 | Bacteria | 14581 |
| 506 | Ga0268266_10161514 | 3300028379 | Bacteria | 2027 |
| 507 | Ga0268265_10009040 | 3300028380 | Bacteria | 6738 |
| 508 | Ga0268265_10039034 | 3300028380 | Bacteria | 3496 |
| 509 | Ga0268264_10000050 | 3300028381 | Bacteria | 323697 |
| 510 | Ga0268264_10177202 | 3300028381 | Bacteria | 1933 |
| 511 | Ga0265334_10009976 | 3300028573 | Bacteria | 4015 |
| 512 | Ga0265318_10028345 | 3300028577 | Bacteria | 2191 |
| 513 | Ga0265323_10000915 | 3300028653 | Bacteria | 15566 |
| 514 | Ga0265336_10000355 | 3300028666 | Bacteria | 29857 |
| 515 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 516 | Ga0307517_10106896 | 3300028786 | Bacteria | 2161 |
| 517 | Ga0307515_10062665 | 3300028794 | Bacteria | 5244 |
| 518 | Ga0307515_10157752 | 3300028794 | Bacteria | 2332 |
| 519 | Ga0307515_10286493 | 3300028794 | Bacteria | 1348 |
| 520 | Ga0265338_10000256 | 3300028800 | Bacteria | 97079 |
| 521 | Ga0265338_10012635 | 3300028800 | Bacteria | 9614 |
| 522 | Ga0265338_10035197 | 3300028800 | Bacteria | 4821 |
| 523 | Ga0265324_10007574 | 3300029957 | Bacteria | 4385 |
| 524 | Ga0307511_10074184 | 3300030521 | Bacteria | 2454 |
| 525 | Ga0265332_10007225 | 3300031238 | Bacteria | 5028 |
| 526 | Ga0265340_10029663 | 3300031247 | Bacteria | 2748 |
| 527 | Ga0265339_10001455 | 3300031249 | Bacteria | 17539 |
| 528 | Ga0307513_10024502 | 3300031456 | Bacteria | 7020 |
| 529 | Ga0307513_10106247 | 3300031456 | Bacteria | 2814 |
| 530 | Ga0307509_10025858 | 3300031507 | Bacteria | 6555 |
| 531 | Ga0307509_10037192 | 3300031507 | Bacteria | 5322 |
| 532 | Ga0307509_10085801 | 3300031507 | Bacteria | 3238 |
| 533 | Ga0307508_10000199 | 3300031616 | Bacteria | 72296 |
| 534 | Ga0307508_10025882 | 3300031616 | Bacteria | 5320 |
| 535 | Ga0307508_10191074 | 3300031616 | Bacteria | 1649 |
| 536 | Ga0307516_10014367 | 3300031730 | Bacteria | 8380 |
| 537 | Ga0307516_10042849 | 3300031730 | Bacteria | 4487 |
| 538 | Ga0307516_10104092 | 3300031730 | Bacteria | 2651 |
| 539 | Ga0307516_10105246 | 3300031730 | Bacteria | 2633 |
| 540 | Ga0307406_10283481 | 3300031901 | Bacteria | 1265 |
| 541 | Ga0307416_100461414 | 3300032002 | Bacteria | 1325 |
| 542 | Ga0307411_10158656 | 3300032005 | Bacteria | 1691 |
| 543 | Ga0307507_10139984 | 3300033179 | Bacteria | 1859 |
| 544 | Ga0307510_10010134 | 3300033180 | Bacteria | 11205 |
| 545 | Ga0307510_10011942 | 3300033180 | Bacteria | 10295 |
| 546 | Ga0307510_10038357 | 3300033180 | Bacteria | 5298 |
| 547 | Ga0307510_10104473 | 3300033180 | Bacteria | 2606 |
| 548 | Ga0307510_10232981 | 3300033180 | Bacteria | 1342 |
| 549 | Ga0316215_1000671 | 3300033544 | Bacteria | 3558 |
| 550 | Ga0373956_0034348 | 3300035119 | Bacteria | 2233 |
| 551 | Ga0373957_0074036 | 3300035120 | Bacteria | 1336 |
| 552 | Ga0373943_0076738 | 3300035170 | Bacteria | 1705 |
| 553 | Ga0373935_0189638 | 3300035692 | Bacteria | 1415 |
| 554 | Ga0373927_0008680 | 3300035695 | Bacteria | 6830 |
| 555 | Ga0373927_0019914 | 3300035695 | Bacteria | 4400 |
| 556 | Ga0373927_0058978 | 3300035695 | Bacteria | 2482 |
| 557 | Ga0373927_0093128 | 3300035695 | Bacteria | 1957 |
| 558 | Ga0373933_0063953 | 3300035724 | Bacteria | 2225 |
| 559 | Ga0373933_0185399 | 3300035724 | Bacteria | 1328 |
| 560 | Ga0373937_0449555 | 3300036401 | Bacteria | 1223 |
| 561 | Ga0373925_0012149 | 3300037068 | Bacteria | 6233 |
| 562 | Ga0373925_0019685 | 3300037068 | Bacteria | 4912 |
| 563 | Ga0373925_0322689 | 3300037068 | Bacteria | 1250 |
| 564 | Ga0395900_0380205 | 3300037418 | Bacteria | 1380 |
| 565 | Ga0395905_0030027 | 3300037471 | Bacteria | 5123 |
| 566 | Ga0395905_0038103 | 3300037471 | Bacteria | 4510 |
| 567 | Ga0395905_0386613 | 3300037471 | Bacteria | 1294 |
| 568 | Ga0436364_0081523 | 3300037853 | Bacteria | 4404 |
| 569 | Ga0436364_1308571 | 3300037853 | Bacteria | 4215 |
| 570 | Ga0436364_1377077 | 3300037853 | Bacteria | 1591 |
| 571 | Ga0395901_0182403 | 3300038443 | Bacteria | 2202 |
| 572 | Ga0436365_0468054 | 3300039437 | Bacteria | 4352 |
| 573 | Ga0436365_0508557 | 3300039437 | Bacteria | 4799 |
| 574 | Ga0436365_0553610 | 3300039437 | Bacteria | 2763 |
| 575 | Ga0436365_0957587 | 3300039437 | Bacteria | 1450 |
| 576 | Ga0436365_1117592 | 3300039437 | Bacteria | 2378 |
| 577 | Ga0436365_1191157 | 3300039437 | Bacteria | 979 |
| 578 | Ga0436360_0310240 | 3300039438 | Bacteria | 1608 |
| 579 | Ga0436361_0085496 | 3300039447 | Bacteria | 2512 |
| 580 | Ga0436361_0395780 | 3300039447 | Bacteria | 3886 |
| 581 | Ga0436363_0876054 | 3300039450 | Bacteria | 1344 |
| 582 | Ga0436363_1243528 | 3300039450 | Bacteria | 2903 |
| 583 | Ga0436363_1520079 | 3300039450 | Bacteria | 1377 |
| 584 | Ga0436362_0666995 | 3300039453 | Bacteria | 3105 |
| 585 | Ga0439436_0051973 | 3300041404 | Bacteria | 1156 |
| 586 | Ga0439466_0030058 | 3300041411 | Bacteria | 1866 |
| 587 | Ga0439465_0000416 | 3300041413 | Bacteria | 12460 |
| 588 | Ga0451839_1153228 | 3300041496 | Bacteria | 3653 |
| 589 | Ga0451841_1398578 | 3300041498 | Bacteria | 1274 |
| 590 | Ga0451851_1104365 | 3300041507 | Bacteria | 3416 |
| 591 | Ga0451843_1054068 | 3300041509 | Bacteria | 1420 |
| 592 | Ga0451843_1533294 | 3300041509 | Bacteria | 1282 |
| 593 | Ga0451853_0114604 | 3300041512 | Bacteria | 1300 |
| 594 | Ga0451853_1561911 | 3300041512 | Bacteria | 11386 |
| 595 | Ga0439449_0060430 | 3300042007 | Bacteria | 1398 |
| 596 | Ga0439462_0029823 | 3300042015 | Bacteria | 1443 |
| 597 | Ga0439462_0034116 | 3300042015 | Bacteria | 1350 |
| 598 | Ga0439434_0000009 | 3300042435 | Bacteria | 49282 |
| 599 | Ga0439435_0000008 | 3300042436 | Bacteria | 21650 |
| 600 | Ga0439435_0020317 | 3300042436 | Bacteria | 1711 |
| 601 | Ga0466969_0067369 | 3300044656 | Bacteria | 1727 |
| 602 | Ga0466972_0000059 | 3300044658 | Bacteria | 110350 |
| 603 | Ga0466972_0032827 | 3300044658 | Bacteria | 2548 |
| 604 | Ga0466972_0120294 | 3300044658 | Bacteria | 1239 |
| 605 | Ga0466965_0086877 | 3300044683 | Bacteria | 1587 |
| 606 | Ga0466966_0004126 | 3300044684 | Bacteria | 9593 |
| 607 | Ga0466961_0000019 | 3300044693 | Bacteria | 107624 |
| 608 | Ga0466963_0281247 | 3300044694 | Bacteria | 1169 |
| 609 | Ga0466964_0081393 | 3300044706 | Bacteria | 1391 |
| 610 | Ga0453684_0232302 | 3300044712 | Bacteria | 2129 |
| 611 | Ga0466971_0037246 | 3300044719 | Bacteria | 2180 |
| 612 | Ga0466970_0113948 | 3300044765 | Bacteria | 1478 |
| 613 | Ga0466957_0021158 | 3300044842 | Bacteria | 3831 |
| 614 | Ga0466960_0044563 | 3300044901 | Bacteria | 2115 |
| 615 | Ga0466960_0194016 | 3300044901 | Bacteria | 1106 |
| 616 | Ga0466959_0008440 | 3300045049 | Bacteria | 7285 |
| 617 | Ga0495617_020512 | 3300046452 | Bacteria | 2233 |
| 618 | Ga0495592_0000332 | 3300046454 | Bacteria | 39286 |
| 619 | Ga0495592_0011643 | 3300046454 | Bacteria | 6661 |
| 620 | Ga0495592_0036556 | 3300046454 | Bacteria | 3698 |
| 621 | Ga0495603_0005987 | 3300046455 | Bacteria | 7272 |
| 622 | Ga0495629_0005134 | 3300046459 | Bacteria | 9794 |
| 623 | Ga0495629_0067398 | 3300046459 | Bacteria | 2498 |
| 624 | Ga0495641_0046899 | 3300046461 | Bacteria | 1986 |
| 625 | Ga0495641_0101056 | 3300046461 | Bacteria | 1287 |
| 626 | Ga0495651_0000620 | 3300046462 | Bacteria | 27509 |
| 627 | Ga0495651_0044564 | 3300046462 | Bacteria | 3437 |
| 628 | Ga0495651_0050445 | 3300046462 | Bacteria | 3210 |
| 629 | Ga0495651_0073110 | 3300046462 | Bacteria | 2603 |
| 630 | Ga0495653_0055671 | 3300046463 | Bacteria | 3017 |
| 631 | Ga0495653_0267069 | 3300046463 | Unclassified | 1128 |
| 632 | Ga0495582_0073037 | 3300046473 | Bacteria | 1899 |
| 633 | Ga0495582_0084329 | 3300046473 | Bacteria | 1766 |
| 634 | Ga0495662_0009913 | 3300046476 | Bacteria | 4679 |
| 635 | Ga0495662_0055337 | 3300046476 | Bacteria | 1917 |
| 636 | Ga0495664_0020161 | 3300046477 | Bacteria | 3843 |
| 637 | Ga0495664_0104039 | 3300046477 | Bacteria | 1711 |
| 638 | Ga0495584_0148627 | 3300046491 | Bacteria | 1190 |
| 639 | Ga0495596_0110807 | 3300046500 | Bacteria | 1066 |
| 640 | Ga0495583_0005356 | 3300046506 | Bacteria | 8749 |
| 641 | Ga0495606_0076479 | 3300046507 | Bacteria | 2092 |
| 642 | Ga0495608_0003907 | 3300046511 | Bacteria | 10714 |
| 643 | Ga0495608_0050502 | 3300046511 | Bacteria | 2759 |
| 644 | Ga0495610_0085517 | 3300046512 | Bacteria | 1439 |
| 645 | Ga0495616_0062178 | 3300046513 | Bacteria | 1829 |
| 646 | Ga0495616_0084295 | 3300046513 | Bacteria | 1515 |
| 647 | Ga0495618_0019213 | 3300046514 | Bacteria | 4202 |
| 648 | Ga0495618_0046804 | 3300046514 | Unclassified | 2730 |
| 649 | Ga0495620_0024339 | 3300046515 | Bacteria | 2881 |
| 650 | Ga0495620_0066338 | 3300046515 | Bacteria | 1487 |
| 651 | Ga0495628_0089696 | 3300046516 | Unclassified | 2380 |
| 652 | Ga0495628_0113209 | 3300046516 | Bacteria | 2085 |
| 653 | Ga0495628_0245187 | 3300046516 | Bacteria | 1339 |
| 654 | Ga0495630_0022706 | 3300046517 | Bacteria | 4634 |
| 655 | Ga0495643_0010133 | 3300046522 | Bacteria | 5812 |
| 656 | Ga0495643_0167823 | 3300046522 | Bacteria | 1075 |
| 657 | Ga0495648_0001886 | 3300046524 | Bacteria | 20051 |
| 658 | Ga0495648_0005722 | 3300046524 | Bacteria | 10264 |
| 659 | Ga0495648_0051065 | 3300046524 | Bacteria | 2522 |
| 660 | Ga0495648_0146645 | 3300046524 | Bacteria | 1236 |
| 661 | Ga0495666_0015279 | 3300046526 | Unclassified | 3824 |
| 662 | Ga0495652_0067434 | 3300046529 | Bacteria | 3000 |
| 663 | Ga0495652_0075289 | 3300046529 | Unclassified | 2804 |
| 664 | Ga0495652_0203825 | 3300046529 | Bacteria | 1499 |
| 665 | Ga0495640_0032096 | 3300046533 | Bacteria | 3743 |
| 666 | Ga0495640_0036214 | 3300046533 | Bacteria | 3487 |
| 667 | Ga0495640_0050283 | 3300046533 | Unclassified | 2872 |
| 668 | Ga0495586_0000443 | 3300046535 | Bacteria | 24911 |
| 669 | Ga0495586_0094291 | 3300046535 | Bacteria | 1656 |
| 670 | Ga0495587_0026074 | 3300046536 | Unclassified | 3567 |
| 671 | Ga0495587_0059363 | 3300046536 | Bacteria | 2245 |
| 672 | Ga0495587_0064738 | 3300046536 | Bacteria | 2136 |
| 673 | Ga0495598_0005511 | 3300046537 | Bacteria | 2810 |
| 674 | Ga0495609_0136275 | 3300046538 | Bacteria | 1049 |
| 675 | Ga0495645_0040362 | 3300046543 | Bacteria | 3405 |
| 676 | Ga0495645_0211969 | 3300046543 | Bacteria | 1307 |
| 677 | Ga0495622_0012185 | 3300046557 | Bacteria | 3977 |
| 678 | Ga0495622_0113256 | 3300046557 | Bacteria | 1241 |
| 679 | Ga0495633_0065431 | 3300046558 | Bacteria | 1699 |
| 680 | Ga0495667_0097976 | 3300046559 | Bacteria | 1898 |
| 681 | Ga0495656_0022409 | 3300046615 | Bacteria | 2473 |
| 682 | Ga0495668_0300790 | 3300046616 | Bacteria | 879 |
| 683 | Ga0495634_0000809 | 3300046642 | Bacteria | 30408 |
| 684 | Ga0495634_0083804 | 3300046642 | Bacteria | 2080 |
| 685 | Ga0495611_0044990 | 3300046648 | Bacteria | 1976 |
| 686 | Ga0495611_0058782 | 3300046648 | Bacteria | 1744 |
| 687 | Ga0495625_0002724 | 3300046660 | Bacteria | 18731 |
| 688 | Ga0495625_0218136 | 3300046660 | Bacteria | 1251 |
| 689 | Ga0495635_0040840 | 3300046663 | Unclassified | 3205 |
| 690 | Ga0495635_0051422 | 3300046663 | Bacteria | 2839 |
| 691 | Ga0495635_0077632 | 3300046663 | Bacteria | 2274 |
| 692 | Ga0495588_0178366 | 3300046674 | Bacteria | 1123 |
| 693 | Ga0495657_0012692 | 3300046675 | Bacteria | 6246 |
| 694 | Ga0495657_0041190 | 3300046675 | Bacteria | 3163 |
| 695 | Ga0495599_0012963 | 3300046678 | Bacteria | 5146 |
| 696 | Ga0495623_0050801 | 3300046679 | Bacteria | 2625 |
| 697 | Ga0495646_0035399 | 3300046680 | Bacteria | 3097 |
| 698 | Ga0495613_0041868 | 3300046689 | Unclassified | 3390 |
| 699 | Ga0495613_0116726 | 3300046689 | Bacteria | 1919 |
| 700 | Ga0495649_0025331 | 3300046694 | Bacteria | 3304 |
| 701 | Ga0495600_0009237 | 3300046809 | Bacteria | 6083 |
| 702 | Ga0495600_0009700 | 3300046809 | Bacteria | 5949 |
| 703 | Ga0495600_0145471 | 3300046809 | Bacteria | 1536 |
| 704 | Ga0495581_0061716 | 3300047315 | Bacteria | 2166 |
| 705 | Ga0495604_0002141 | 3300047317 | Bacteria | 15889 |
| 706 | Ga0495604_0019923 | 3300047317 | Bacteria | 5364 |
| 707 | Ga0495604_0032091 | 3300047317 | Unclassified | 4164 |
| 708 | Ga0495636_0014340 | 3300047318 | Bacteria | 3150 |
| 709 | Ga0495674_0066042 | 3300047319 | Bacteria | 3140 |
| 710 | Ga0495674_0350530 | 3300047319 | Bacteria | 1198 |
| 711 | Ga0495672_0111907 | 3300047320 | Bacteria | 1464 |
| 712 | Ga0495676_0024811 | 3300047321 | Bacteria | 5182 |
| 713 | Ga0495680_0000573 | 3300047322 | Bacteria | 41141 |
| 714 | Ga0495680_0001080 | 3300047322 | Bacteria | 30231 |
| 715 | Ga0495680_0027624 | 3300047322 | Bacteria | 4659 |
| 716 | Ga0495680_0215015 | 3300047322 | Bacteria | 1374 |
| 717 | Ga0495687_002149 | 3300047443 | Bacteria | 16450 |
| 718 | Ga0495687_010566 | 3300047443 | Bacteria | 5054 |
| 719 | Ga0495675_0042893 | 3300047444 | Bacteria | 2882 |
| 720 | Ga0495675_0133697 | 3300047444 | Bacteria | 1541 |
| 721 | Ga0495684_0034397 | 3300047471 | Bacteria | 3888 |
| 722 | Ga0495684_0051066 | 3300047471 | Bacteria | 3156 |
| 723 | Ga0495684_0075441 | 3300047471 | Bacteria | 2562 |
| 724 | Ga0495686_0090972 | 3300047472 | Bacteria | 1852 |
| 725 | Ga0495602_0068174 | 3300048088 | Bacteria | 3056 |
| 726 | Ga0495602_0107284 | 3300048088 | Bacteria | 2277 |
| 727 | Ga0495602_0323865 | 3300048088 | Bacteria | 1120 |
| 728 | Ga0495614_0032295 | 3300048089 | Bacteria | 2253 |
| 729 | Ga0495626_0090385 | 3300048091 | Bacteria | 1347 |
| 730 | Ga0496102_0030482 | 3300048905 | Bacteria | 4828 |
| 731 | Ga0496103_0035888 | 3300048906 | Bacteria | 3035 |
| 732 | Ga0496103_0244433 | 3300048906 | Bacteria | 1155 |
| 733 | Ga0496104_0056959 | 3300048907 | Bacteria | 3698 |
| 734 | Ga0496104_0069858 | 3300048907 | Bacteria | 3338 |
| 735 | Ga0496104_0197631 | 3300048907 | Bacteria | 1923 |
| 736 | Ga0496104_0305410 | 3300048907 | Bacteria | 1503 |
| 737 | Ga0496104_0811354 | 3300048907 | Bacteria | 842 |
| 738 | Ga0496105_0006073 | 3300048908 | Bacteria | 9241 |
| 739 | Ga0496105_0011341 | 3300048908 | Bacteria | 7039 |
| 740 | Ga0496105_0087290 | 3300048908 | Bacteria | 2577 |
| 741 | Ga0496106_0001404 | 3300048909 | Bacteria | 18059 |
| 742 | Ga0496107_0038761 | 3300048910 | Bacteria | 3417 |
| 743 | Ga0496107_0192181 | 3300048910 | Bacteria | 1517 |
| 744 | Ga0496107_0278034 | 3300048910 | Bacteria | 1246 |
| 745 | Ga0496108_0108415 | 3300048911 | Bacteria | 2372 |
| 746 | Ga0496108_0148025 | 3300048911 | Bacteria | 2025 |
| 747 | Ga0496108_0699835 | 3300048911 | Bacteria | 879 |
| 748 | Ga0496109_0068715 | 3300048912 | Bacteria | 3247 |
| 749 | Ga0496109_0073155 | 3300048912 | Bacteria | 3149 |
| 750 | Ga0496109_0149085 | 3300048912 | Bacteria | 2189 |
| 751 | Ga0496110_0021410 | 3300048913 | Bacteria | 5474 |
| 752 | Ga0496110_0070703 | 3300048913 | Bacteria | 3093 |
| 753 | Ga0496110_0110320 | 3300048913 | Bacteria | 2472 |
| 754 | Ga0496111_0158048 | 3300048914 | Bacteria | 1682 |
| 755 | Ga0496112_0012206 | 3300048915 | Bacteria | 7885 |
| 756 | Ga0496112_0055686 | 3300048915 | Bacteria | 3890 |
| 757 | Ga0496112_0124135 | 3300048915 | Bacteria | 2552 |
| 758 | Ga0496112_0149786 | 3300048915 | Bacteria | 2300 |
| 759 | Ga0496112_0216012 | 3300048915 | Bacteria | 1874 |
| 760 | Ga0496112_0217534 | 3300048915 | Bacteria | 1867 |
| 761 | Ga0496113_0022393 | 3300048916 | Bacteria | 4469 |
| 762 | Ga0496113_0046768 | 3300048916 | Bacteria | 3213 |
| 763 | Ga0496114_0144878 | 3300048917 | Bacteria | 2059 |
| 764 | Ga0496115_0012154 | 3300048918 | Bacteria | 6474 |
| 765 | Ga0496115_0113952 | 3300048918 | Bacteria | 2222 |
| 766 | Ga0496116_0062415 | 3300048919 | Bacteria | 2406 |
| 767 | Ga0496116_0109841 | 3300048919 | Bacteria | 1624 |
| 768 | Ga0496116_0187960 | 3300048919 | Bacteria | 1097 |
| 769 | Ga0496117_0000277 | 3300048920 | Bacteria | 95538 |
| 770 | Ga0496117_0002266 | 3300048920 | Bacteria | 24847 |
| 771 | Ga0496117_0024305 | 3300048920 | Bacteria | 4797 |
| 772 | Ga0496117_0062668 | 3300048920 | Bacteria | 2547 |
| 773 | Ga0496118_0003433 | 3300048921 | Bacteria | 19953 |
| 774 | Ga0496118_0004387 | 3300048921 | Bacteria | 16773 |
| 775 | Ga0496118_0059074 | 3300048921 | Bacteria | 2859 |
| 776 | Ga0496118_0082241 | 3300048921 | Bacteria | 2257 |
| 777 | Ga0496118_0151894 | 3300048921 | Bacteria | 1448 |
| 778 | Ga0496119_0006742 | 3300048922 | Bacteria | 10543 |
| 779 | Ga0496120_0002184 | 3300048923 | Bacteria | 20708 |
| 780 | Ga0496120_0015798 | 3300048923 | Bacteria | 4962 |
| 781 | Ga0496120_0023914 | 3300048923 | Bacteria | 3817 |
| 782 | Ga0496121_0008110 | 3300048924 | Bacteria | 12491 |
| 783 | Ga0496121_0011953 | 3300048924 | Bacteria | 9551 |
| 784 | Ga0496121_0030834 | 3300048924 | Bacteria | 4916 |
| 785 | Ga0496121_0039649 | 3300048924 | Bacteria | 4145 |
| 786 | Ga0496121_0138623 | 3300048924 | Bacteria | 1808 |
| 787 | Ga0496121_0178998 | 3300048924 | Bacteria | 1532 |
| 788 | Ga0496122_0000193 | 3300048925 | Bacteria | 139724 |
| 789 | Ga0496122_0000565 | 3300048925 | Bacteria | 75875 |
| 790 | Ga0496123_0000154 | 3300048926 | Bacteria | 139724 |
| 791 | Ga0496123_0000247 | 3300048926 | Bacteria | 109186 |
| 792 | Ga0496123_0140567 | 3300048926 | Bacteria | 1321 |
| 793 | Ga0496124_0000236 | 3300048927 | Bacteria | 107751 |
| 794 | Ga0496124_0001021 | 3300048927 | Bacteria | 44387 |
| 795 | Ga0496124_0001147 | 3300048927 | Bacteria | 41534 |
| 796 | Ga0496124_0016756 | 3300048927 | Bacteria | 6949 |
| 797 | Ga0496124_0034562 | 3300048927 | Bacteria | 4434 |
| 798 | Ga0496124_0075314 | 3300048927 | Bacteria | 2788 |
| 799 | Ga0496124_0099656 | 3300048927 | Bacteria | 2356 |
| 800 | Ga0496124_0172527 | 3300048927 | Bacteria | 1673 |
| 801 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 802 | Ga0496125_0000161 | 3300048928 | Bacteria | 150707 |
| 803 | Ga0496125_0015436 | 3300048928 | Bacteria | 7389 |
| 804 | Ga0496125_0075584 | 3300048928 | Bacteria | 2606 |
| 805 | Ga0496125_0102752 | 3300048928 | Bacteria | 2099 |
| 806 | Ga0496125_0110972 | 3300048928 | Bacteria | 1986 |
| 807 | Ga0496125_0240530 | 3300048928 | Bacteria | 1150 |
| 808 | Ga0496126_0014738 | 3300048929 | Bacteria | 7888 |
| 809 | Ga0496126_0033724 | 3300048929 | Bacteria | 4815 |
| 810 | Ga0496126_0036043 | 3300048929 | Bacteria | 4630 |
| 811 | Ga0496126_0060024 | 3300048929 | Bacteria | 3422 |
| 812 | Ga0496126_0106984 | 3300048929 | Bacteria | 2440 |
| 813 | Ga0496126_0130319 | 3300048929 | Bacteria | 2174 |
| 814 | Ga0496126_0298274 | 3300048929 | Bacteria | 1330 |
| 815 | Ga0496126_0315954 | 3300048929 | Bacteria | 1285 |
| 816 | Ga0496126_0386751 | 3300048929 | Bacteria | 1137 |
| 817 | Ga0501033_0262240 | 3300049570 | Bacteria | 1223 |
| 818 | Ga0501033_0355522 | 3300049570 | Bacteria | 1026 |
| 819 | Ga0501034_0303738 | 3300049571 | Bacteria | 1532 |
| 820 | Ga0501034_0418777 | 3300049571 | Bacteria | 1261 |
| 821 | Ga0501034_0452686 | 3300049571 | Bacteria | 1201 |
| 822 | Ga0501036_0083720 | 3300049572 | Bacteria | 2697 |
| 823 | Ga0501037_0048371 | 3300049573 | Bacteria | 3117 |
| 824 | Ga0501037_0311707 | 3300049573 | Bacteria | 1091 |
| 825 | Ga0501038_0371239 | 3300049574 | Bacteria | 1111 |
| 826 | Ga0501039_0051288 | 3300049575 | Bacteria | 3193 |
| 827 | Ga0501041_0089233 | 3300049577 | Bacteria | 1903 |
| 828 | Ga0501046_0062816 | 3300049580 | Bacteria | 2901 |
| 829 | Ga0501046_0185408 | 3300049580 | Bacteria | 1554 |
| 830 | Ga0501047_0049231 | 3300049581 | Bacteria | 4069 |
| 831 | Ga0501048_0159261 | 3300049582 | Bacteria | 1597 |
| 832 | Ga0501069_0007682 | 3300049585 | Bacteria | 5658 |
| 833 | Ga0501070_0047575 | 3300049586 | Bacteria | 3564 |
| 834 | Ga0501071_0170851 | 3300049587 | Bacteria | 1627 |
| 835 | Ga0501073_0009876 | 3300049589 | Bacteria | 7023 |
| 836 | Ga0501073_0019033 | 3300049589 | Bacteria | 4962 |
| 837 | Ga0501073_0038802 | 3300049589 | Bacteria | 3377 |
| 838 | Ga0501074_0032192 | 3300049590 | Bacteria | 3799 |
| 839 | Ga0501075_0021797 | 3300049591 | Bacteria | 4673 |
| 840 | Ga0501075_0250349 | 3300049591 | Bacteria | 1350 |
| 841 | Ga0501076_0000181 | 3300049592 | Bacteria | 37445 |
| 842 | Ga0501076_0220047 | 3300049592 | Bacteria | 1552 |
| 843 | Ga0501077_0139560 | 3300049593 | Bacteria | 1537 |
| 844 | Ga0501077_0252125 | 3300049593 | Bacteria | 1122 |
| 845 | Ga0501079_0125914 | 3300049741 | Bacteria | 1993 |
| 846 | Ga0501080_0045179 | 3300049742 | Bacteria | 4100 |
| 847 | Ga0501283_004969 | 3300049779 | Bacteria | 1812 |
| 848 | Ga0501044_0369152 | 3300049823 | Bacteria | 1352 |
| 849 | nmdc:mga03683_5518_c1 | 3300050489 | Bacteria | 4276 |
| 850 | nmdc:mga03683_75217_c1 | 3300050489 | Bacteria | 1450 |
| 851 | nmdc:mga03n38_18736_c1 | 3300050490 | Bacteria | 2737 |
| 852 | nmdc:mga00v17_23153_c1 | 3300050491 | Bacteria | 3591 |
| 853 | nmdc:mga00v17_44461_c1 | 3300050491 | Bacteria | 2678 |
| 854 | nmdc:mga00v17_5869_c1 | 3300050491 | Bacteria | 6486 |
| 855 | nmdc:mga00v17_59654_c1 | 3300050491 | Bacteria | 2342 |
| 856 | nmdc:mga0yw44_128062_c1 | 3300050492 | Bacteria | 1641 |
| 857 | nmdc:mga0yw44_134939_c1 | 3300050492 | Bacteria | 1601 |
| 858 | nmdc:mga0yw44_1376_c1 | 3300050492 | Bacteria | 9645 |
| 859 | nmdc:mga0yw44_14033_c1 | 3300050492 | Bacteria | 4240 |
| 860 | nmdc:mga0yw44_1469_c1 | 3300050492 | Bacteria | 9383 |
| 861 | nmdc:mga0yw44_16455_c1 | 3300050492 | Bacteria | 3995 |
| 862 | nmdc:mga0yw44_243628_c1 | 3300050492 | Bacteria | 1195 |
| 863 | nmdc:mga0yw44_58912_c1 | 3300050492 | Bacteria | 2348 |
| 864 | nmdc:mga0yw44_8393_c1 | 3300050492 | Bacteria | 5144 |
| 865 | nmdc:mga0yw44_84243_c1 | 3300050492 | Bacteria | 1998 |
| 866 | nmdc:mga0yw44_9233_c1 | 3300050492 | Bacteria | 4967 |
| 867 | nmdc:mga0k408_5011_c1 | 3300050493 | Bacteria | 7014 |
| 868 | nmdc:mga0k408_61175_c1 | 3300050493 | Bacteria | 2189 |
| 869 | nmdc:mga06z11_123_c1 | 3300050494 | Bacteria | 31898 |
| 870 | nmdc:mga06z11_12549_c1 | 3300050494 | Bacteria | 3689 |
| 871 | nmdc:mga04h51_21042_c1 | 3300050495 | Bacteria | 1958 |
| 872 | nmdc:mga07m45_27724_c1 | 3300050496 | Bacteria | 3123 |
| 873 | nmdc:mga07m45_56175_c1 | 3300050496 | Bacteria | 2225 |
| 874 | nmdc:mga07m45_5693_c1 | 3300050496 | Bacteria | 6230 |
| 875 | nmdc:mga07m45_63177_c1 | 3300050496 | Bacteria | 2100 |
| 876 | nmdc:mga05p37_37093_c1 | 3300050507 | Bacteria | 5979 |
| 877 | nmdc:mga05p37_697300_c1 | 3300050507 | Bacteria | 1128 |
| 878 | nmdc:mga05p37_76186_c1 | 3300050507 | Bacteria | 4130 |
| 879 | nmdc:mga05p37_786_c1 | 3300050507 | Bacteria | 35281 |
| 880 | nmdc:mga05p37_838165_c1 | 3300050507 | Bacteria | 1000 |
| 881 | nmdc:mga09592_252008_c1 | 3300050508 | Bacteria | 1530 |
| 882 | nmdc:mga0qj67_128197_c1 | 3300050509 | Bacteria | 2053 |
| 883 | nmdc:mga0qj67_43293_c1 | 3300050509 | Bacteria | 3545 |
| 884 | nmdc:mga0qj67_76633_c1 | 3300050509 | Bacteria | 2675 |
| 885 | nmdc:mga06r32_418635_c1 | 3300050510 | Bacteria | 1321 |
| 886 | nmdc:mga08y16_108804_c1 | 3300050511 | Bacteria | 2886 |
| 887 | nmdc:mga08y16_295955_c1 | 3300050511 | Bacteria | 1668 |
| 888 | nmdc:mga08y16_37614_c1 | 3300050511 | Bacteria | 5081 |
| 889 | nmdc:mga08y16_83801_c1 | 3300050511 | Bacteria | 3323 |
| 890 | nmdc:mga0n895_310876_c1 | 3300050512 | Bacteria | 1597 |
| 891 | nmdc:mga0rr50_61556_c1 | 3300050513 | Bacteria | 2828 |
| 892 | nmdc:mga0a205_84573_c1 | 3300050515 | Bacteria | 3064 |
| 893 | nmdc:mga0sz30_24814_c1 | 3300050516 | Bacteria | 2449 |
| 894 | nmdc:mga0sz30_278_c1 | 3300050516 | Bacteria | 19605 |
| 895 | nmdc:mga0sz30_68390_c1 | 3300050516 | Bacteria | 1526 |
| 896 | Ga0495601_0027755 | 3300053077 | Unclassified | 3502 |
| 897 | Ga0495601_0033668 | 3300053077 | Bacteria | 3193 |
| 898 | Ga0495601_0254896 | 3300053077 | Bacteria | 1146 |
| 899 | Ga0495619_0015343 | 3300053085 | Bacteria | 4847 |
| 900 | Ga0495619_0099557 | 3300053085 | Bacteria | 1977 |
| 901 | Ga0500643_000163 | 3300053087 | Bacteria | 66676 |
| 902 | Ga0500583_0000375 | 3300053092 | Bacteria | 14688 |
| 903 | Ga0500583_0097375 | 3300053092 | Bacteria | 1437 |
| 904 | Ga0500651_0066570 | 3300053093 | Bacteria | 2244 |
| 905 | Ga0500566_0000224 | 3300053094 | Bacteria | 30350 |
| 906 | Ga0500566_0132919 | 3300053094 | Bacteria | 1329 |
| 907 | Ga0500566_0164054 | 3300053094 | Bacteria | 1155 |
| 908 | Ga0500640_018898 | 3300053095 | Bacteria | 2946 |
| 909 | Ga0500555_007778 | 3300053103 | Bacteria | 3049 |
| 910 | Ga0500556_0003912 | 3300053104 | Bacteria | 4304 |
| 911 | Ga0500556_0059304 | 3300053104 | Bacteria | 1405 |
| 912 | Ga0500556_0084171 | 3300053104 | Bacteria | 1206 |
| 913 | Ga0500557_000051 | 3300053105 | Bacteria | 51214 |
| 914 | Ga0500569_013543 | 3300053109 | Bacteria | 1999 |
| 915 | Ga0500569_029359 | 3300053109 | Bacteria | 1532 |
| 916 | Ga0500569_082566 | 3300053109 | Bacteria | 1030 |
| 917 | Ga0500572_001212 | 3300053111 | Bacteria | 7330 |
| 918 | Ga0500594_0071004 | 3300053118 | Bacteria | 1024 |
| 919 | Ga0500595_012448 | 3300053119 | Bacteria | 3291 |
| 920 | Ga0500595_012813 | 3300053119 | Bacteria | 3229 |
| 921 | Ga0500595_021746 | 3300053119 | Bacteria | 2285 |
| 922 | Ga0500608_041925 | 3300053122 | Bacteria | 2196 |
| 923 | Ga0500642_0000117 | 3300053130 | Bacteria | 36211 |
| 924 | Ga0500559_0000250 | 3300053136 | Bacteria | 42675 |
| 925 | Ga0500559_0031178 | 3300053136 | Bacteria | 2286 |
| 926 | Ga0500559_0072589 | 3300053136 | Bacteria | 1551 |
| 927 | Ga0500561_0000084 | 3300053137 | Bacteria | 18691 |
| 928 | Ga0500573_0133858 | 3300053140 | Bacteria | 1370 |
| 929 | Ga0500588_0097512 | 3300053146 | Bacteria | 1009 |
| 930 | Ga0500590_056258 | 3300053148 | Bacteria | 1988 |
| 931 | Ga0500616_0019339 | 3300053153 | Bacteria | 3841 |
| 932 | Ga0500616_0031035 | 3300053153 | Bacteria | 2931 |
| 933 | Ga0500616_0034643 | 3300053153 | Bacteria | 2749 |
| 934 | Ga0500622_0009036 | 3300053156 | Bacteria | 5536 |
| 935 | Ga0500622_0014416 | 3300053156 | Bacteria | 4244 |
| 936 | Ga0500622_0104616 | 3300053156 | Bacteria | 1389 |
| 937 | Ga0500627_0033852 | 3300053158 | Bacteria | 2162 |
| 938 | Ga0500627_0181309 | 3300053158 | Bacteria | 947 |
| 939 | Ga0500634_0124250 | 3300053161 | Bacteria | 1250 |
| 940 | Ga0500638_133022 | 3300053162 | Bacteria | 1125 |
| 941 | Ga0500636_0000330 | 3300053177 | Bacteria | 26259 |
| 942 | Ga0500636_0031687 | 3300053177 | Bacteria | 3128 |
| 943 | Ga0500636_0038369 | 3300053177 | Bacteria | 2833 |
| 944 | Ga0500636_0084416 | 3300053177 | Bacteria | 1826 |
| 945 | Ga0500649_027676 | 3300053722 | Bacteria | 2357 |
| 946 | Ga0500625_036574 | 3300053729 | Bacteria | 2322 |
| 947 | Ga0500552_005773 | 3300053733 | Bacteria | 1362 |
| 948 | Ga0500596_001865 | 3300053735 | Bacteria | 4235 |
| 949 | Ga0500599_000188 | 3300053736 | Bacteria | 5714 |
| 950 | Ga0500601_000943 | 3300053737 | Bacteria | 3431 |
| 951 | Ga0501084_0412639 | 3300054114 | Bacteria | 1141 |
| 952 | Ga0501082_0082206 | 3300060353 | Bacteria | 2779 |
| 953 | Ga0530510_0021188 | 3300061734 | Bacteria | 4623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_61556_c1 | nmdc:mga0rr50_61556_c1_2069_2803 | 237 |
| 2 | 3300049590 | Ga0501074_0032192 | Ga0501074_0032192_12_788 | 258 |
| 3 | 3300005328 | Ga0070676_10230841 | Ga0070676_102308412 | 265 |
| 4 | 3300005543 | Ga0070672_100514159 | Ga0070672_1005141592 | 265 |
| 5 | 3300005546 | Ga0070696_100302296 | Ga0070696_1003022961 | 265 |
| 6 | 3300005615 | Ga0070702_100122904 | Ga0070702_1001229041 | 265 |
| 7 | 3300006847 | Ga0075431_100351630 | Ga0075431_1003516302 | 265 |
| 8 | 3300006880 | Ga0075429_100162557 | Ga0075429_1001625572 | 265 |
| 9 | 3300009147 | Ga0114129_10538960 | Ga0114129_105389602 | 265 |
| 10 | 3300009148 | Ga0105243_10725442 | Ga0105243_107254421 | 265 |
| 11 | 3300025907 | Ga0207645_10070694 | Ga0207645_100706942 | 265 |
| 12 | 3300025908 | Ga0207643_10069191 | Ga0207643_100691912 | 265 |
| 13 | 3300025936 | Ga0207670_10041017 | Ga0207670_100410173 | 265 |
| 14 | 3300025940 | Ga0207691_10148321 | Ga0207691_101483212 | 265 |
| 15 | 3300025960 | Ga0207651_10251636 | Ga0207651_102516362 | 265 |
| 16 | 3300026075 | Ga0207708_10107400 | Ga0207708_101074002 | 265 |
| 17 | 3300026118 | Ga0207675_100271945 | Ga0207675_1002719452 | 265 |
| 18 | 3300050507 | nmdc:mga05p37_697300_c1 | nmdc:mga05p37_697300_c1_147_1013 | 265 |
| 19 | 3300050509 | nmdc:mga0qj67_76633_c1 | nmdc:mga0qj67_76633_c1_1453_2319 | 265 |
| 20 | 3300048920 | Ga0496117_0062668 | Ga0496117_0062668_35_835 | 266 |
| 21 | 3300049570 | Ga0501033_0355522 | Ga0501033_0355522_52_903 | 268 |
| 22 | 3300050507 | nmdc:mga05p37_838165_c1 | nmdc:mga05p37_838165_c1_132_986 | 268 |
| 23 | 3300054114 | Ga0501084_0412639 | Ga0501084_0412639_58_909 | 268 |
| 24 | 3300037471 | Ga0395905_0386613 | Ga0395905_0386613_14_823 | 269 |
| 25 | 3300046461 | Ga0495641_0101056 | Ga0495641_0101056_468_1277 | 269 |
| 26 | 3300046616 | Ga0495668_0300790 | Ga0495668_0300790_44_853 | 269 |
| 27 | 3300047319 | Ga0495674_0350530 | Ga0495674_0350530_373_1182 | 269 |
| 28 | 3300048907 | Ga0496104_0811354 | Ga0496104_0811354_20_829 | 269 |
| 29 | 3300048915 | Ga0496112_0149786 | Ga0496112_0149786_33_842 | 269 |
| 30 | iso_pu_bacteria | 2917699015 | 2917701832 | 269 |
| 31 | 3300025939 | Ga0207665_10244428 | Ga0207665_102444282 | 270 |
| 32 | 3300046515 | Ga0495620_0066338 | Ga0495620_0066338_14_835 | 273 |
| 33 | 3300048911 | Ga0496108_0699835 | Ga0496108_0699835_39_860 | 273 |
| 34 | 3300048929 | Ga0496126_0106984 | Ga0496126_0106984_1308_2129 | 273 |
| 35 | 3300003320 | rootH2_10003773 | rootH2_100037737 | 280 |
| 36 | 3300003322 | rootL2_10003291 | rootL2_100032914 | 280 |
| 37 | 3300005937 | Ga0081455_10030982 | Ga0081455_100309823 | 281 |
| 38 | 3300005983 | Ga0081540_1006462 | Ga0081540_10064626 | 281 |
| 39 | 3300006846 | Ga0075430_100014044 | Ga0075430_1000140444 | 281 |
| 40 | 3300025940 | Ga0207691_10204300 | Ga0207691_102043002 | 281 |
| 41 | 3300032002 | Ga0307416_100461414 | Ga0307416_1004614142 | 281 |
| 42 | 3300036401 | Ga0373937_0449555 | Ga0373937_0449555_18_863 | 281 |
| 43 | 3300041404 | Ga0439436_0051973 | Ga0439436_0051973_299_1144 | 281 |
| 44 | 3300042015 | Ga0439462_0029823 | Ga0439462_0029823_320_1180 | 281 |
| 45 | 3300042435 | Ga0439434_0000009 | Ga0439434_0000009_17113_17973 | 281 |
| 46 | 3300042436 | Ga0439435_0000008 | Ga0439435_0000008_2722_3582 | 281 |
| 47 | 3300044694 | Ga0466963_0281247 | Ga0466963_0281247_26_871 | 281 |
| 48 | 3300048091 | Ga0495626_0090385 | Ga0495626_0090385_29_874 | 281 |
| 49 | 3300049577 | Ga0501041_0089233 | Ga0501041_0089233_484_1362 | 281 |
| 50 | 3300050509 | nmdc:mga0qj67_43293_c1 | nmdc:mga0qj67_43293_c1_247_1128 | 281 |
| 51 | 3300053146 | Ga0500588_0097512 | Ga0500588_0097512_43_888 | 281 |
| 52 | 3300053148 | Ga0500590_056258 | Ga0500590_056258_30_875 | 281 |
| 53 | 3300053161 | Ga0500634_0124250 | Ga0500634_0124250_21_866 | 281 |
| 54 | 3300005336 | Ga0070680_100177673 | Ga0070680_1001776731 | 282 |
| 55 | 3300005440 | Ga0070705_100072833 | Ga0070705_1000728332 | 282 |
| 56 | 3300005546 | Ga0070696_100074707 | Ga0070696_1000747072 | 282 |
| 57 | 3300005549 | Ga0070704_100002950 | Ga0070704_1000029508 | 282 |
| 58 | 3300005844 | Ga0068862_100005845 | Ga0068862_1000058452 | 282 |
| 59 | 3300006846 | Ga0075430_100016966 | Ga0075430_1000169665 | 282 |
| 60 | 3300006847 | Ga0075431_100408676 | Ga0075431_1004086762 | 282 |
| 61 | 3300009094 | Ga0111539_10170741 | Ga0111539_101707412 | 282 |
| 62 | 3300025938 | Ga0207704_10577748 | Ga0207704_105777481 | 282 |
| 63 | 3300026075 | Ga0207708_10000242 | Ga0207708_1000024252 | 282 |
| 64 | 3300027462 | Ga0210000_1006512 | Ga0210000_10065122 | 282 |
| 65 | 3300027543 | Ga0209999_1014530 | Ga0209999_10145302 | 282 |
| 66 | 3300035724 | Ga0373933_0185399 | Ga0373933_0185399_49_912 | 282 |
| 67 | 3300042436 | Ga0439435_0020317 | Ga0439435_0020317_732_1613 | 282 |
| 68 | 3300049572 | Ga0501036_0083720 | Ga0501036_0083720_1088_1969 | 282 |
| 69 | 3300049573 | Ga0501037_0311707 | Ga0501037_0311707_166_1047 | 282 |
| 70 | 3300049574 | Ga0501038_0371239 | Ga0501038_0371239_146_1027 | 282 |
| 71 | 3300049575 | Ga0501039_0051288 | Ga0501039_0051288_740_1621 | 282 |
| 72 | 3300049580 | Ga0501046_0185408 | Ga0501046_0185408_493_1374 | 282 |
| 73 | 3300049582 | Ga0501048_0159261 | Ga0501048_0159261_426_1307 | 282 |
| 74 | 3300049591 | Ga0501075_0021797 | Ga0501075_0021797_2447_3328 | 282 |
| 75 | 3300049592 | Ga0501076_0000181 | Ga0501076_0000181_1161_2042 | 282 |
| 76 | 3300049592 | Ga0501076_0220047 | Ga0501076_0220047_15_896 | 282 |
| 77 | 3300049741 | Ga0501079_0125914 | Ga0501079_0125914_778_1659 | 282 |
| 78 | 3300049779 | Ga0501283_004969 | Ga0501283_004969_133_999 | 282 |
| 79 | 3300050510 | nmdc:mga06r32_418635_c1 | nmdc:mga06r32_418635_c1_255_1127 | 282 |
| 80 | 3300050511 | nmdc:mga08y16_37614_c1 | nmdc:mga08y16_37614_c1_3758_4624 | 282 |
| 81 | 3300060353 | Ga0501082_0082206 | Ga0501082_0082206_1131_2012 | 282 |
| 82 | 3300061734 | Ga0530510_0021188 | Ga0530510_0021188_2420_3301 | 282 |
| 83 | 3300005364 | Ga0070673_100117539 | Ga0070673_1001175391 | 285 |
| 84 | 3300005536 | Ga0070697_100005598 | Ga0070697_1000055988 | 285 |
| 85 | 3300005549 | Ga0070704_100157057 | Ga0070704_1001570572 | 285 |
| 86 | 3300006852 | Ga0075433_10062737 | Ga0075433_100627374 | 285 |
| 87 | 3300009094 | Ga0111539_10019063 | Ga0111539_100190632 | 285 |
| 88 | 3300027671 | Ga0209588_1057082 | Ga0209588_10570822 | 285 |
| 89 | 3300046454 | Ga0495592_0000332 | Ga0495592_0000332_20828_21703 | 285 |
| 90 | 3300046463 | Ga0495653_0267069 | Ga0495653_0267069_70_945 | 285 |
| 91 | 3300046476 | Ga0495662_0009913 | Ga0495662_0009913_617_1492 | 285 |
| 92 | 3300046511 | Ga0495608_0003907 | Ga0495608_0003907_2879_3754 | 285 |
| 93 | 3300046514 | Ga0495618_0046804 | Ga0495618_0046804_1387_2262 | 285 |
| 94 | 3300046516 | Ga0495628_0089696 | Ga0495628_0089696_614_1489 | 285 |
| 95 | 3300046517 | Ga0495630_0022706 | Ga0495630_0022706_2695_3570 | 285 |
| 96 | 3300046526 | Ga0495666_0015279 | Ga0495666_0015279_2139_3014 | 285 |
| 97 | 3300046529 | Ga0495652_0075289 | Ga0495652_0075289_645_1520 | 285 |
| 98 | 3300046533 | Ga0495640_0050283 | Ga0495640_0050283_344_1219 | 285 |
| 99 | 3300046535 | Ga0495586_0000443 | Ga0495586_0000443_3119_3994 | 285 |
| 100 | 3300046536 | Ga0495587_0026074 | Ga0495587_0026074_1899_2774 | 285 |
| 101 | 3300046642 | Ga0495634_0000809 | Ga0495634_0000809_20911_21786 | 285 |
| 102 | 3300046663 | Ga0495635_0040840 | Ga0495635_0040840_210_1085 | 285 |
| 103 | 3300046678 | Ga0495599_0012963 | Ga0495599_0012963_518_1393 | 285 |
| 104 | 3300046689 | Ga0495613_0041868 | Ga0495613_0041868_1333_2208 | 285 |
| 105 | 3300046809 | Ga0495600_0009237 | Ga0495600_0009237_4495_5370 | 285 |
| 106 | 3300047317 | Ga0495604_0032091 | Ga0495604_0032091_2121_2996 | 285 |
| 107 | 3300047318 | Ga0495636_0014340 | Ga0495636_0014340_482_1357 | 285 |
| 108 | 3300047322 | Ga0495680_0001080 | Ga0495680_0001080_8489_9364 | 285 |
| 109 | 3300047471 | Ga0495684_0034397 | Ga0495684_0034397_2631_3506 | 285 |
| 110 | 3300049571 | Ga0501034_0303738 | Ga0501034_0303738_643_1521 | 285 |
| 111 | 3300049593 | Ga0501077_0252125 | Ga0501077_0252125_135_1010 | 285 |
| 112 | 3300049823 | Ga0501044_0369152 | Ga0501044_0369152_196_1074 | 285 |
| 113 | 3300050515 | nmdc:mga0a205_84573_c1 | nmdc:mga0a205_84573_c1_1810_2685 | 285 |
| 114 | 3300053077 | Ga0495601_0027755 | Ga0495601_0027755_494_1369 | 285 |
| 115 | 3300005347 | Ga0070668_100067604 | Ga0070668_1000676043 | 286 |
| 116 | 3300005353 | Ga0070669_100009057 | Ga0070669_1000090575 | 286 |
| 117 | 3300005441 | Ga0070700_100002099 | Ga0070700_1000020995 | 286 |
| 118 | 3300005458 | Ga0070681_10348024 | Ga0070681_103480241 | 286 |
| 119 | 3300005459 | Ga0068867_100000183 | Ga0068867_10000018336 | 286 |
| 120 | 3300006881 | Ga0068865_100057377 | Ga0068865_1000573774 | 286 |
| 121 | 3300009094 | Ga0111539_10046861 | Ga0111539_100468615 | 286 |
| 122 | 3300009553 | Ga0105249_10042784 | Ga0105249_100427841 | 286 |
| 123 | 3300025923 | Ga0207681_10006311 | Ga0207681_100063118 | 286 |
| 124 | 3300025938 | Ga0207704_10015461 | Ga0207704_100154612 | 286 |
| 125 | 3300025961 | Ga0207712_10045112 | Ga0207712_100451124 | 286 |
| 126 | 3300026089 | Ga0207648_10000526 | Ga0207648_1000052651 | 286 |
| 127 | 3300026118 | Ga0207675_100014392 | Ga0207675_1000143921 | 286 |
| 128 | 3300027907 | Ga0207428_10011801 | Ga0207428_100118019 | 286 |
| 129 | 3300044712 | Ga0453684_0232302 | Ga0453684_0232302_1189_2070 | 286 |
| 130 | 3300050511 | nmdc:mga08y16_108804_c1 | nmdc:mga08y16_108804_c1_1706_2584 | 286 |
| 131 | 3300021388 | Ga0213875_10074731 | Ga0213875_100747312 | 287 |
| 132 | 3300037853 | Ga0436364_0081523 | Ga0436364_0081523_388_1293 | 287 |
| 133 | iso_pu_bacteria | 2841966195 | 2841969334 | 291 |
| 134 | iso_pu_bacteria | 2877676314 | 2877676373 | 291 |
| 135 | iso_pu_bacteria | 2513237088 | 2513594941 | 292 |
| 136 | iso_pu_bacteria | 2896384573 | 2896391511 | 292 |
| 137 | iso_pu_bacteria | 2507262055 | 2507504932 | 293 |
| 138 | iso_pu_bacteria | 2508501009 | 2508546280 | 293 |
| 139 | iso_pu_bacteria | 2508501042 | 2508695212 | 293 |
| 140 | iso_pu_bacteria | 2508501050 | 2508730778 | 293 |
| 141 | iso_pu_bacteria | 2508501122 | 2509112049 | 293 |
| 142 | iso_pu_bacteria | 2509276019 | 2509380192 | 293 |
| 143 | iso_pu_bacteria | 2509276033 | 2509443217 | 293 |
| 144 | iso_pu_bacteria | 2511231028 | 2511398509 | 293 |
| 145 | iso_pu_bacteria | 2512047086 | 2512532041 | 293 |
| 146 | iso_pu_bacteria | 2513237084 | 2513574141 | 293 |
| 147 | iso_pu_bacteria | 2513237095 | 2513647876 | 293 |
| 148 | iso_pu_bacteria | 2513237102 | 2513699680 | 293 |
| 149 | iso_pu_bacteria | 2513237104 | 2513718761 | 293 |
| 150 | iso_pu_bacteria | 2513237139 | 2513873823 | 293 |
| 151 | iso_pu_bacteria | 2513237159 | 2514000129 | 293 |
| 152 | iso_pu_bacteria | 2515154112 | 2515625775 | 293 |
| 153 | iso_pu_bacteria | 2516143018 | 2516207217 | 293 |
| 154 | iso_pu_bacteria | 2517093001 | 2517102297 | 293 |
| 155 | iso_pu_bacteria | 2519899620 | 2520381637 | 293 |
| 156 | iso_pu_bacteria | 2524023205 | 2524435817 | 293 |
| 157 | iso_pu_bacteria | 2528768022 | 2528851963 | 293 |
| 158 | iso_pu_bacteria | 2554235003 | 2554249696 | 293 |
| 159 | iso_pu_bacteria | 2558860100 | 2558861674 | 293 |
| 160 | iso_pu_bacteria | 2558860242 | 2559297984 | 293 |
| 161 | iso_pu_bacteria | 2582581867 | 2585404866 | 293 |
| 162 | iso_pu_bacteria | 2615840624 | 2616292497 | 293 |
| 163 | iso_pu_bacteria | 2617270735 | 2617351794 | 293 |
| 164 | iso_pu_bacteria | 2617270741 | 2617374031 | 293 |
| 165 | iso_pu_bacteria | 2643221693 | 2644520033 | 293 |
| 166 | iso_pu_bacteria | 2657244999 | 2657686585 | 293 |
| 167 | iso_pu_bacteria | 2667528174 | 2671113086 | 293 |
| 168 | iso_pu_bacteria | 2718217882 | 2719181145 | 293 |
| 169 | iso_pu_bacteria | 2718217927 | 2719385396 | 293 |
| 170 | iso_pu_bacteria | 2718217997 | 2719667014 | 293 |
| 171 | iso_pu_bacteria | 2718218009 | 2719731894 | 293 |
| 172 | iso_pu_bacteria | 2718218199 | 2720493434 | 293 |
| 173 | iso_pu_bacteria | 2718218363 | 2721147239 | 293 |
| 174 | iso_pu_bacteria | 2718218365 | 2721158772 | 293 |
| 175 | iso_pu_bacteria | 2718218366 | 2721164157 | 293 |
| 176 | iso_pu_bacteria | 2718218423 | 2721399145 | 293 |
| 177 | iso_pu_bacteria | 2721755514 | 2722840327 | 293 |
| 178 | iso_pu_bacteria | 2721755809 | 2724037958 | 293 |
| 179 | iso_pu_bacteria | 2721755810 | 2724044650 | 293 |
| 180 | iso_pu_bacteria | 2728369365 | 2730164382 | 293 |
| 181 | iso_pu_bacteria | 2728369397 | 2730298404 | 293 |
| 182 | iso_pu_bacteria | 2744054633 | 2745079114 | 293 |
| 183 | iso_pu_bacteria | 2751185821 | 2753459336 | 293 |
| 184 | iso_pu_bacteria | 2791355082 | 2792581958 | 293 |
| 185 | iso_pu_bacteria | 2791355091 | 2792624055 | 293 |
| 186 | iso_pu_bacteria | 2791355092 | 2792629442 | 293 |
| 187 | iso_pu_bacteria | 2791355094 | 2792641272 | 293 |
| 188 | iso_pu_bacteria | 2791355196 | 2793063025 | 293 |
| 189 | iso_pu_bacteria | 2791355256 | 2793297137 | 293 |
| 190 | iso_pu_bacteria | 2791355259 | 2793312213 | 293 |
| 191 | iso_pu_bacteria | 2791355260 | 2793322057 | 293 |
| 192 | iso_pu_bacteria | 2791355262 | 2793337329 | 293 |
| 193 | iso_pu_bacteria | 2791355264 | 2793349114 | 293 |
| 194 | iso_pu_bacteria | 2791355265 | 2793352239 | 293 |
| 195 | iso_pu_bacteria | 2802429268 | 2804755442 | 293 |
| 196 | iso_pu_bacteria | 2802429603 | 2805915906 | 293 |
| 197 | iso_pu_bacteria | 2802429605 | 2805927568 | 293 |
| 198 | iso_pu_bacteria | 2802429606 | 2805936042 | 293 |
| 199 | iso_pu_bacteria | 2802429633 | 2806049030 | 293 |
| 200 | iso_pu_bacteria | 2802429636 | 2806065810 | 293 |
| 201 | iso_pu_bacteria | 2802429637 | 2806077298 | 293 |
| 202 | iso_pu_bacteria | 2808606387 | 2808990126 | 293 |
| 203 | iso_pu_bacteria | 2816332527 | 2818237367 | 293 |
| 204 | iso_pu_bacteria | 2818991448 | 2819611799 | 293 |
| 205 | iso_pu_bacteria | 2824600985 | 2824602661 | 293 |
| 206 | iso_pu_bacteria | 2824609381 | 2824617072 | 293 |
| 207 | iso_pu_bacteria | 2824617872 | 2824621022 | 293 |
| 208 | iso_pu_bacteria | 2824626560 | 2824630029 | 293 |
| 209 | iso_pu_bacteria | 2824635225 | 2824642240 | 293 |
| 210 | iso_pu_bacteria | 2824644064 | 2824651034 | 293 |
| 211 | iso_pu_bacteria | 2824653114 | 2824661076 | 293 |
| 212 | iso_pu_bacteria | 2824661429 | 2824669597 | 293 |
| 213 | iso_pu_bacteria | 2824671348 | 2824679204 | 293 |
| 214 | iso_pu_bacteria | 2824679649 | 2824687355 | 293 |
| 215 | iso_pu_bacteria | 2824687955 | 2824695799 | 293 |
| 216 | iso_pu_bacteria | 2824696289 | 2824703357 | 293 |
| 217 | iso_pu_bacteria | 2824704595 | 2824714102 | 293 |
| 218 | iso_pu_bacteria | 2824714736 | 2824723051 | 293 |
| 219 | iso_pu_bacteria | 2824723954 | 2824732230 | 293 |
| 220 | iso_pu_bacteria | 2824732956 | 2824737598 | 293 |
| 221 | iso_pu_bacteria | 2824746037 | 2824752743 | 293 |
| 222 | iso_pu_bacteria | 2824753945 | 2824760555 | 293 |
| 223 | iso_pu_bacteria | 2824763712 | 2824771019 | 293 |
| 224 | iso_pu_bacteria | 2824773399 | 2824774849 | 293 |
| 225 | iso_pu_bacteria | 2835312727 | 2835314199 | 293 |
| 226 | iso_pu_bacteria | 2838022645 | 2838027905 | 293 |
| 227 | iso_pu_bacteria | 2838029111 | 2838031607 | 293 |
| 228 | iso_pu_bacteria | 2838042994 | 2838043396 | 293 |
| 229 | iso_pu_bacteria | 2838074704 | 2838081135 | 293 |
| 230 | iso_pu_bacteria | 2838122688 | 2838124210 | 293 |
| 231 | iso_pu_bacteria | 2838668709 | 2838670009 | 293 |
| 232 | iso_pu_bacteria | 2838680041 | 2838682256 | 293 |
| 233 | iso_pu_bacteria | 2838694306 | 2838696827 | 293 |
| 234 | iso_pu_bacteria | 2838701080 | 2838702381 | 293 |
| 235 | iso_pu_bacteria | 2838707686 | 2838709932 | 293 |
| 236 | iso_pu_bacteria | 2838714209 | 2838718723 | 293 |
| 237 | iso_pu_bacteria | 2838719591 | 2838723721 | 293 |
| 238 | iso_pu_bacteria | 2840764183 | 2840765234 | 293 |
| 239 | iso_pu_bacteria | 2841864319 | 2841868060 | 293 |
| 240 | iso_pu_bacteria | 2841941048 | 2841944556 | 293 |
| 241 | iso_pu_bacteria | 2841949485 | 2841951694 | 293 |
| 242 | iso_pu_bacteria | 2841957949 | 2841964836 | 293 |
| 243 | iso_pu_bacteria | 2841974524 | 2841980269 | 293 |
| 244 | iso_pu_bacteria | 2841983080 | 2841985519 | 293 |
| 245 | iso_pu_bacteria | 2842038055 | 2842043791 | 293 |
| 246 | iso_pu_bacteria | 2842045827 | 2842052219 | 293 |
| 247 | iso_pu_bacteria | 2842077413 | 2842078106 | 293 |
| 248 | iso_pu_bacteria | 2842118031 | 2842119385 | 293 |
| 249 | iso_pu_bacteria | 2842146304 | 2842147074 | 293 |
| 250 | iso_pu_bacteria | 2842170452 | 2842174680 | 293 |
| 251 | iso_pu_bacteria | 2842187318 | 2842191162 | 293 |
| 252 | iso_pu_bacteria | 2842192696 | 2842197071 | 293 |
| 253 | iso_pu_bacteria | 2842198810 | 2842203780 | 293 |
| 254 | iso_pu_bacteria | 2842205361 | 2842206471 | 293 |
| 255 | iso_pu_bacteria | 2842211629 | 2842215765 | 293 |
| 256 | iso_pu_bacteria | 2842224351 | 2842228486 | 293 |
| 257 | iso_pu_bacteria | 2842237096 | 2842239345 | 293 |
| 258 | iso_pu_bacteria | 2842250916 | 2842252139 | 293 |
| 259 | iso_pu_bacteria | 2842278818 | 2842279928 | 293 |
| 260 | iso_pu_bacteria | 2842285085 | 2842287557 | 293 |
| 261 | iso_pu_bacteria | 2842291075 | 2842291769 | 293 |
| 262 | iso_pu_bacteria | 2842317721 | 2842318320 | 293 |
| 263 | iso_pu_bacteria | 2842341865 | 2842345122 | 293 |
| 264 | iso_pu_bacteria | 2842363717 | 2842369969 | 293 |
| 265 | iso_pu_bacteria | 2842370503 | 2842372822 | 293 |
| 266 | iso_pu_bacteria | 2842377471 | 2842378165 | 293 |
| 267 | iso_pu_bacteria | 2842384541 | 2842385894 | 293 |
| 268 | iso_pu_bacteria | 2842395702 | 2842398405 | 293 |
| 269 | iso_pu_bacteria | 2842402390 | 2842404914 | 293 |
| 270 | iso_pu_bacteria | 2842409023 | 2842411496 | 293 |
| 271 | iso_pu_bacteria | 2842415677 | 2842418053 | 293 |
| 272 | iso_pu_bacteria | 2842475841 | 2842478339 | 293 |
| 273 | iso_pu_bacteria | 2842489311 | 2842492699 | 293 |
| 274 | iso_pu_bacteria | 2842495871 | 2842500706 | 293 |
| 275 | iso_pu_bacteria | 2842502639 | 2842505715 | 293 |
| 276 | iso_pu_bacteria | 2842521101 | 2842523683 | 293 |
| 277 | iso_pu_bacteria | 2844315083 | 2844321910 | 293 |
| 278 | iso_pu_bacteria | 2847939898 | 2847941847 | 293 |
| 279 | iso_pu_bacteria | 2848992105 | 2848996749 | 293 |
| 280 | iso_pu_bacteria | 2850079185 | 2850085583 | 293 |
| 281 | iso_pu_bacteria | 2855872281 | 2855876044 | 293 |
| 282 | iso_pu_bacteria | 2856349417 | 2856353667 | 293 |
| 283 | iso_pu_bacteria | 2857509624 | 2857511655 | 293 |
| 284 | iso_pu_bacteria | 2871488783 | 2871492264 | 293 |
| 285 | iso_pu_bacteria | 2871495908 | 2871496218 | 293 |
| 286 | iso_pu_bacteria | 2874123672 | 2874126913 | 293 |
| 287 | iso_pu_bacteria | 2874590934 | 2874596929 | 293 |
| 288 | iso_pu_bacteria | 2874620515 | 2874624503 | 293 |
| 289 | iso_pu_bacteria | 2874628541 | 2874629133 | 293 |
| 290 | iso_pu_bacteria | 2874645413 | 2874648733 | 293 |
| 291 | iso_pu_bacteria | 2876761206 | 2876769188 | 293 |
| 292 | iso_pu_bacteria | 2876771140 | 2876777393 | 293 |
| 293 | iso_pu_bacteria | 2876818435 | 2876825475 | 293 |
| 294 | iso_pu_bacteria | 2878753008 | 2878759722 | 293 |
| 295 | iso_pu_bacteria | 2878760144 | 2878760447 | 293 |
| 296 | iso_pu_bacteria | 2878767105 | 2878767410 | 293 |
| 297 | iso_pu_bacteria | 2879074833 | 2879077724 | 293 |
| 298 | iso_pu_bacteria | 2879099564 | 2879107315 | 293 |
| 299 | iso_pu_bacteria | 2879127579 | 2879131397 | 293 |
| 300 | iso_pu_bacteria | 2879142872 | 2879144357 | 293 |
| 301 | iso_pu_bacteria | 2881147464 | 2881150374 | 293 |
| 302 | iso_pu_bacteria | 2881155292 | 2881158185 | 293 |
| 303 | iso_pu_bacteria | 2881161766 | 2881167281 | 293 |
| 304 | iso_pu_bacteria | 2881665667 | 2881665782 | 293 |
| 305 | iso_pu_bacteria | 2881845957 | 2881849285 | 293 |
| 306 | iso_pu_bacteria | 2881853255 | 2881856049 | 293 |
| 307 | iso_pu_bacteria | 2881861095 | 2881865571 | 293 |
| 308 | iso_pu_bacteria | 2882456835 | 2882462711 | 293 |
| 309 | iso_pu_bacteria | 2882912400 | 2882918770 | 293 |
| 310 | iso_pu_bacteria | 2885305155 | 2885308924 | 293 |
| 311 | iso_pu_bacteria | 2885312484 | 2885312822 | 293 |
| 312 | iso_pu_bacteria | 2885334103 | 2885336303 | 293 |
| 313 | iso_pu_bacteria | 2885342637 | 2885344860 | 293 |
| 314 | iso_pu_bacteria | 2885350715 | 2885354568 | 293 |
| 315 | iso_pu_bacteria | 2885366525 | 2885371315 | 293 |
| 316 | iso_pu_bacteria | 2888343758 | 2888346764 | 293 |
| 317 | iso_pu_bacteria | 2888378607 | 2888379876 | 293 |
| 318 | iso_pu_bacteria | 2888419890 | 2888420684 | 293 |
| 319 | iso_pu_bacteria | 2891373044 | 2891374326 | 293 |
| 320 | iso_pu_bacteria | 2899792073 | 2899793198 | 293 |
| 321 | iso_pu_bacteria | 2899845264 | 2899846044 | 293 |
| 322 | iso_pu_bacteria | 2903492973 | 2903497005 | 293 |
| 323 | iso_pu_bacteria | 2903540706 | 2903541012 | 293 |
| 324 | iso_pu_bacteria | 2903727486 | 2903727542 | 293 |
| 325 | iso_pu_bacteria | 2904666416 | 2904672158 | 293 |
| 326 | iso_pu_bacteria | 2904711408 | 2904718160 | 293 |
| 327 | iso_pu_bacteria | 2906602504 | 2906602968 | 293 |
| 328 | iso_pu_bacteria | 2908775508 | 2908776508 | 293 |
| 329 | iso_pu_bacteria | 2913295892 | 2913296824 | 293 |
| 330 | iso_pu_bacteria | 2919408235 | 2919412873 | 293 |
| 331 | iso_pu_bacteria | 2920760137 | 2920766693 | 293 |
| 332 | iso_pu_bacteria | 2920822456 | 2920827920 | 293 |
| 333 | iso_pu_bacteria | 2922368715 | 2922378585 | 293 |
| 334 | iso_pu_bacteria | 2922393267 | 2922396660 | 293 |
| 335 | iso_pu_bacteria | 2923556063 | 2923561818 | 293 |
| 336 | iso_pu_bacteria | 2924784321 | 2924785280 | 293 |
| 337 | iso_pu_bacteria | 2926760298 | 2926765369 | 293 |
| 338 | iso_pu_bacteria | 2929615660 | 2929623805 | 293 |
| 339 | iso_pu_bacteria | 2929624759 | 2929629036 | 293 |
| 340 | iso_pu_bacteria | 2932784394 | 2932786437 | 293 |
| 341 | iso_pu_bacteria | 2932794094 | 2932794602 | 293 |
| 342 | iso_pu_bacteria | 2932801729 | 2932806883 | 293 |
| 343 | iso_pu_bacteria | 2932809354 | 2932812489 | 293 |
| 344 | iso_pu_bacteria | 2932818245 | 2932822851 | 293 |
| 345 | iso_pu_bacteria | 2932828146 | 2932829674 | 293 |
| 346 | iso_pu_bacteria | 2933577622 | 2933585674 | 293 |
| 347 | iso_pu_bacteria | 2935608549 | 2935615465 | 293 |
| 348 | iso_pu_bacteria | 2935616580 | 2935618193 | 293 |
| 349 | iso_pu_bacteria | 2935638405 | 2935641410 | 293 |
| 350 | iso_pu_bacteria | 2935648319 | 2935652902 | 293 |
| 351 | iso_pu_bacteria | 2935656913 | 2935661485 | 293 |
| 352 | iso_pu_bacteria | 2935665750 | 2935669532 | 293 |
| 353 | iso_pu_bacteria | 2935675223 | 2935677870 | 293 |
| 354 | iso_pu_bacteria | 2935684952 | 2935689681 | 293 |
| 355 | iso_pu_bacteria | 2935694250 | 2935698219 | 293 |
| 356 | iso_pu_bacteria | 2935703347 | 2935707357 | 293 |
| 357 | iso_pu_bacteria | 2935713505 | 2935717201 | 293 |
| 358 | iso_pu_bacteria | 2935722832 | 2935729965 | 293 |
| 359 | iso_pu_bacteria | 2935732158 | 2935738616 | 293 |
| 360 | iso_pu_bacteria | 2935741537 | 2935749136 | 293 |
| 361 | iso_pu_bacteria | 2935750917 | 2935757035 | 293 |
| 362 | iso_pu_bacteria | 2935760218 | 2935764354 | 293 |
| 363 | iso_pu_bacteria | 2935769743 | 2935772691 | 293 |
| 364 | iso_pu_bacteria | 2935777560 | 2935778173 | 293 |
| 365 | iso_pu_bacteria | 2935785616 | 2935787400 | 293 |
| 366 | iso_pu_bacteria | 2935793552 | 2935795812 | 293 |
| 367 | iso_pu_bacteria | 2935801545 | 2935804264 | 293 |
| 368 | iso_pu_bacteria | 2935810662 | 2935815347 | 293 |
| 369 | iso_pu_bacteria | 2935819856 | 2935825157 | 293 |
| 370 | iso_pu_bacteria | 2935827899 | 2935831141 | 293 |
| 371 | iso_pu_bacteria | 2935837841 | 2935841750 | 293 |
| 372 | iso_pu_bacteria | 2935847175 | 2935852991 | 293 |
| 373 | iso_pu_bacteria | 2935855204 | 2935856308 | 293 |
| 374 | iso_pu_bacteria | 2935864058 | 2935866360 | 293 |
| 375 | iso_pu_bacteria | 2935873716 | 2935874667 | 293 |
| 376 | iso_pu_bacteria | 2935883170 | 2935890298 | 293 |
| 377 | iso_pu_bacteria | 2935894831 | 2935897317 | 293 |
| 378 | iso_pu_bacteria | 2935908558 | 2935910271 | 293 |
| 379 | iso_pu_bacteria | 2935916978 | 2935918443 | 293 |
| 380 | iso_pu_bacteria | 2935926038 | 2935927818 | 293 |
| 381 | iso_pu_bacteria | 2935934488 | 2935936310 | 293 |
| 382 | iso_pu_bacteria | 2935942939 | 2935944137 | 293 |
| 383 | iso_pu_bacteria | 2935951376 | 2935952574 | 293 |
| 384 | iso_pu_bacteria | 2935967501 | 2935969414 | 293 |
| 385 | iso_pu_bacteria | 2935975950 | 2935977818 | 293 |
| 386 | iso_pu_bacteria | 2935984226 | 2935984873 | 293 |
| 387 | iso_pu_bacteria | 2935992306 | 2935994126 | 293 |
| 388 | iso_pu_bacteria | 2936002035 | 2936004863 | 293 |
| 389 | iso_pu_bacteria | 2936011229 | 2936015786 | 293 |
| 390 | iso_pu_bacteria | 2936019824 | 2936024420 | 293 |
| 391 | iso_pu_bacteria | 2936028420 | 2936031693 | 293 |
| 392 | iso_pu_bacteria | 2936037263 | 2936045002 | 293 |
| 393 | iso_pu_bacteria | 2936046547 | 2936051515 | 293 |
| 394 | iso_pu_bacteria | 2936055302 | 2936056044 | 293 |
| 395 | iso_pu_bacteria | 2936367885 | 2936372749 | 293 |
| 396 | iso_pu_bacteria | 2936375103 | 2936376622 | 293 |
| 397 | iso_pu_bacteria | 2937994558 | 2937994865 | 293 |
| 398 | iso_pu_bacteria | 2940556831 | 2940562949 | 293 |
| 399 | iso_pu_bacteria | 2941531003 | 2941532427 | 293 |
| 400 | iso_pu_bacteria | 2941538514 | 2941543823 | 293 |
| 401 | iso_pu_bacteria | 2958165035 | 2958165345 | 293 |
| 402 | iso_pu_bacteria | 2961127735 | 2961135182 | 293 |
| 403 | iso_pu_bacteria | 2961163497 | 2961163803 | 293 |
| 404 | iso_pu_bacteria | 2961170736 | 2961173662 | 293 |
| 405 | iso_pu_bacteria | 2965018300 | 2965018608 | 293 |
| 406 | iso_pu_bacteria | 2968003550 | 2968005743 | 293 |
| 407 | iso_pu_bacteria | 2968171901 | 2968172209 | 293 |
| 408 | iso_pu_bacteria | 2970503327 | 2970506254 | 293 |
| 409 | iso_pu_bacteria | 2970524798 | 2970528546 | 293 |
| 410 | iso_pu_bacteria | 2970554993 | 2970555299 | 293 |
| 411 | iso_pu_bacteria | 2977821940 | 2977828243 | 293 |
| 412 | iso_pu_bacteria | 2979089926 | 2979095379 | 293 |
| 413 | iso_pu_bacteria | 2979095461 | 2979097633 | 293 |
| 414 | iso_pu_bacteria | 2979808191 | 2979810976 | 293 |
| 415 | iso_pu_bacteria | 2987659509 | 2987659815 | 293 |
| 416 | iso_pu_bacteria | 3004188549 | 3004188862 | 293 |
| 417 | iso_pu_bacteria | 3005445848 | 3005450438 | 293 |
| 418 | iso_pu_bacteria | 3005483717 | 3005487365 | 293 |
| 419 | iso_pu_bacteria | 3005587118 | 3005589523 | 293 |
| 420 | iso_pu_bacteria | 3005594810 | 3005602247 | 293 |
| 421 | iso_pu_bacteria | 3005710791 | 3005718012 | 293 |
| 422 | iso_pu_bacteria | 3005718088 | 3005725033 | 293 |
| 423 | iso_pu_bacteria | 643348564 | 643597628 | 293 |
| 424 | iso_pu_bacteria | 643692032 | 643822456 | 293 |
| 425 | iso_pu_bacteria | 650716007 | 650741325 | 293 |
| 426 | iso_pu_bacteria | 8004374579 | 8004381223 | 293 |
| 427 | iso_pu_bacteria | 8005275841 | 8005280164 | 293 |
| 428 | iso_pu_bacteria | 8005289223 | 8005294749 | 293 |
| 429 | iso_pu_bacteria | 8005301065 | 8005302519 | 293 |
| 430 | iso_pu_bacteria | 8005376324 | 8005379168 | 293 |
| 431 | iso_pu_bacteria | 8005395548 | 8005398098 | 293 |
| 432 | iso_pu_bacteria | 8005484373 | 8005486365 | 293 |
| 433 | iso_pu_bacteria | 8005645114 | 8005647492 | 293 |
| 434 | iso_pu_bacteria | 8005688590 | 8005694532 | 293 |
| 435 | iso_pu_bacteria | 8005695170 | 8005700971 | 293 |
| 436 | iso_pu_bacteria | 8006926726 | 8006932733 | 293 |
| 437 | iso_pu_bacteria | 8006984368 | 8006992392 | 293 |
| 438 | iso_pu_bacteria | 8016511872 | 8016518526 | 293 |
| 439 | iso_pu_bacteria | 8016539877 | 8016544790 | 293 |
| 440 | iso_pu_bacteria | 8016548790 | 8016557294 | 293 |
| 441 | iso_pu_bacteria | 8016557553 | 8016565642 | 293 |
| 442 | iso_pu_bacteria | 8016566248 | 8016569848 | 293 |
| 443 | iso_pu_bacteria | 8016575299 | 8016582443 | 293 |
| 444 | iso_pu_bacteria | 8016595262 | 8016603251 | 293 |
| 445 | iso_pu_bacteria | 8016603502 | 8016606178 | 293 |
| 446 | iso_pu_bacteria | 8017057580 | 8017058136 | 293 |
| 447 | iso_pu_bacteria | 8018127388 | 8018129875 | 293 |
| 448 | iso_pu_bacteria | 8018176218 | 8018178364 | 293 |
| 449 | iso_pu_bacteria | 8019530166 | 8019531412 | 293 |
| 450 | iso_pu_bacteria | 8019538911 | 8019540116 | 293 |
| 451 | iso_pu_bacteria | 8019547302 | 8019550537 | 293 |
| 452 | iso_pu_bacteria | 8019576017 | 8019577593 | 293 |
| 453 | iso_pu_bacteria | 8019586578 | 8019595687 | 293 |
| 454 | iso_pu_bacteria | 8019597564 | 8019606073 | 293 |
| 455 | iso_pu_bacteria | 8019608314 | 8019612456 | 293 |
| 456 | iso_pu_bacteria | 8019619141 | 8019622655 | 293 |
| 457 | iso_pu_bacteria | 8019629233 | 8019630455 | 293 |
| 458 | iso_pu_bacteria | 8019638758 | 8019640153 | 293 |
| 459 | iso_pu_bacteria | 8019648815 | 8019652786 | 293 |
| 460 | iso_pu_bacteria | 8019659431 | 8019667285 | 293 |
| 461 | iso_pu_bacteria | 8019678201 | 8019678924 | 293 |
| 462 | iso_pu_bacteria | 8019687851 | 8019696607 | 293 |
| 463 | iso_pu_bacteria | 8023680758 | 8023684820 | 293 |
| 464 | iso_pu_bacteria | 8024501048 | 8024505163 | 293 |
| 465 | iso_pu_bacteria | 8049293176 | 8049294766 | 293 |
| 466 | iso_pu_bacteria | 8055742211 | 8055751096 | 293 |
| 467 | iso_pu_bacteria | 8056382006 | 8056387604 | 293 |
| 468 | iso_pu_bacteria | 8056967851 | 8056971001 | 293 |
| 469 | iso_pu_bacteria | 8057529695 | 8057535703 | 293 |
| 470 | 3300005341 | Ga0070691_10005506 | Ga0070691_100055066 | 294 |
| 471 | 3300005545 | Ga0070695_100032449 | Ga0070695_1000324492 | 294 |
| 472 | 3300014325 | Ga0163163_10022458 | Ga0163163_100224582 | 294 |
| 473 | 3300014968 | Ga0157379_10302728 | Ga0157379_103027281 | 294 |
| 474 | 3300025933 | Ga0207706_10016538 | Ga0207706_100165382 | 294 |
| 475 | 3300025941 | Ga0207711_10213603 | Ga0207711_102136032 | 294 |
| 476 | 3300028800 | Ga0265338_10035197 | Ga0265338_100351975 | 294 |
| 477 | 3300005328 | Ga0070676_10190605 | Ga0070676_101906052 | 295 |
| 478 | 3300005329 | Ga0070683_100086993 | Ga0070683_1000869932 | 295 |
| 479 | 3300005331 | Ga0070670_100014283 | Ga0070670_1000142836 | 295 |
| 480 | 3300005347 | Ga0070668_100012180 | Ga0070668_1000121802 | 295 |
| 481 | 3300005347 | Ga0070668_100088506 | Ga0070668_1000885062 | 295 |
| 482 | 3300005353 | Ga0070669_100016819 | Ga0070669_1000168194 | 295 |
| 483 | 3300005354 | Ga0070675_100055476 | Ga0070675_1000554762 | 295 |
| 484 | 3300005355 | Ga0070671_100112725 | Ga0070671_1001127253 | 295 |
| 485 | 3300005364 | Ga0070673_100019247 | Ga0070673_1000192472 | 295 |
| 486 | 3300005367 | Ga0070667_100135029 | Ga0070667_1001350292 | 295 |
| 487 | 3300005457 | Ga0070662_100074005 | Ga0070662_1000740052 | 295 |
| 488 | 3300005543 | Ga0070672_100026539 | Ga0070672_1000265391 | 295 |
| 489 | 3300005548 | Ga0070665_100264287 | Ga0070665_1002642873 | 295 |
| 490 | 3300005564 | Ga0070664_100100002 | Ga0070664_1001000022 | 295 |
| 491 | 3300005618 | Ga0068864_100001387 | Ga0068864_1000013876 | 295 |
| 492 | 3300005618 | Ga0068864_100092506 | Ga0068864_1000925062 | 295 |
| 493 | 3300005719 | Ga0068861_100008698 | Ga0068861_1000086984 | 295 |
| 494 | 3300005841 | Ga0068863_100003575 | Ga0068863_10000357512 | 295 |
| 495 | 3300005843 | Ga0068860_100100480 | Ga0068860_1001004803 | 295 |
| 496 | 3300005844 | Ga0068862_100077601 | Ga0068862_1000776013 | 295 |
| 497 | 3300006042 | Ga0075368_10016228 | Ga0075368_100162281 | 295 |
| 498 | 3300006042 | Ga0075368_10111814 | Ga0075368_101118142 | 295 |
| 499 | 3300006048 | Ga0075363_100010972 | Ga0075363_1000109724 | 295 |
| 500 | 3300006051 | Ga0075364_10001365 | Ga0075364_1000136513 | 295 |
| 501 | 3300006178 | Ga0075367_10000941 | Ga0075367_100009415 | 295 |
| 502 | 3300006237 | Ga0097621_100101508 | Ga0097621_1001015082 | 295 |
| 503 | 3300013308 | Ga0157375_10025670 | Ga0157375_100256702 | 295 |
| 504 | 3300014326 | Ga0157380_10043207 | Ga0157380_100432073 | 295 |
| 505 | 3300025925 | Ga0207650_10013219 | Ga0207650_100132195 | 295 |
| 506 | 3300025926 | Ga0207659_10003329 | Ga0207659_100033299 | 295 |
| 507 | 3300025940 | Ga0207691_10000087 | Ga0207691_1000008750 | 295 |
| 508 | 3300025972 | Ga0207668_10007626 | Ga0207668_100076265 | 295 |
| 509 | 3300025972 | Ga0207668_10063662 | Ga0207668_100636623 | 295 |
| 510 | 3300026088 | Ga0207641_10004243 | Ga0207641_1000424312 | 295 |
| 511 | 3300026095 | Ga0207676_10134075 | Ga0207676_101340752 | 295 |
| 512 | 3300026095 | Ga0207676_10188791 | Ga0207676_101887913 | 295 |
| 513 | 3300026118 | Ga0207675_100023306 | Ga0207675_1000233063 | 295 |
| 514 | 3300028380 | Ga0268265_10009040 | Ga0268265_100090402 | 295 |
| 515 | 3300028381 | Ga0268264_10177202 | Ga0268264_101772022 | 295 |
| 516 | 3300028794 | Ga0307515_10062665 | Ga0307515_100626653 | 295 |
| 517 | 3300028794 | Ga0307515_10286493 | Ga0307515_102864931 | 295 |
| 518 | 3300044719 | Ga0466971_0037246 | Ga0466971_0037246_252_1175 | 295 |
| 519 | 3300046660 | Ga0495625_0002724 | Ga0495625_0002724_5284_6171 | 295 |
| 520 | 3300049570 | Ga0501033_0262240 | Ga0501033_0262240_53_943 | 295 |
| 521 | 3300049585 | Ga0501069_0007682 | Ga0501069_0007682_3011_3955 | 295 |
| 522 | 3300049589 | Ga0501073_0019033 | Ga0501073_0019033_3540_4430 | 295 |
| 523 | 3300050491 | nmdc:mga00v17_5869_c1 | nmdc:mga00v17_5869_c1_2783_3670 | 295 |
| 524 | 3300050492 | nmdc:mga0yw44_1469_c1 | nmdc:mga0yw44_1469_c1_3340_4227 | 295 |
| 525 | 3300050494 | nmdc:mga06z11_123_c1 | nmdc:mga06z11_123_c1_16510_17397 | 295 |
| 526 | 3300050507 | nmdc:mga05p37_786_c1 | nmdc:mga05p37_786_c1_4208_5143 | 295 |
| 527 | 3300053092 | Ga0500583_0000375 | Ga0500583_0000375_5686_6573 | 295 |
| 528 | 3300003320 | rootH2_10038800 | rootH2_1003880015 | 296 |
| 529 | 3300005364 | Ga0070673_100313669 | Ga0070673_1003136692 | 296 |
| 530 | 3300005366 | Ga0070659_100036188 | Ga0070659_1000361883 | 296 |
| 531 | 3300005458 | Ga0070681_10037922 | Ga0070681_100379223 | 296 |
| 532 | 3300005536 | Ga0070697_100093937 | Ga0070697_1000939373 | 296 |
| 533 | 3300005617 | Ga0068859_100013871 | Ga0068859_1000138716 | 296 |
| 534 | 3300005981 | Ga0081538_10005050 | Ga0081538_1000505011 | 296 |
| 535 | 3300005983 | Ga0081540_1000287 | Ga0081540_100028730 | 296 |
| 536 | 3300005983 | Ga0081540_1017035 | Ga0081540_10170356 | 296 |
| 537 | 3300006038 | Ga0075365_10067396 | Ga0075365_100673962 | 296 |
| 538 | 3300006038 | Ga0075365_10088963 | Ga0075365_100889632 | 296 |
| 539 | 3300006051 | Ga0075364_10028066 | Ga0075364_100280662 | 296 |
| 540 | 3300006163 | Ga0070715_10002633 | Ga0070715_100026336 | 296 |
| 541 | 3300006163 | Ga0070715_10005023 | Ga0070715_100050232 | 296 |
| 542 | 3300006173 | Ga0070716_100192214 | Ga0070716_1001922141 | 296 |
| 543 | 3300006175 | Ga0070712_100002895 | Ga0070712_1000028953 | 296 |
| 544 | 3300006844 | Ga0075428_100013745 | Ga0075428_1000137456 | 296 |
| 545 | 3300006844 | Ga0075428_100024178 | Ga0075428_1000241789 | 296 |
| 546 | 3300006846 | Ga0075430_100046100 | Ga0075430_1000461003 | 296 |
| 547 | 3300006852 | Ga0075433_10001822 | Ga0075433_100018224 | 296 |
| 548 | 3300006881 | Ga0068865_100148238 | Ga0068865_1001482382 | 296 |
| 549 | 3300006931 | Ga0097620_100013871 | Ga0097620_1000138716 | 296 |
| 550 | 3300007265 | Ga0099794_10020399 | Ga0099794_100203993 | 296 |
| 551 | 3300009093 | Ga0105240_10000052 | Ga0105240_10000052100 | 296 |
| 552 | 3300009094 | Ga0111539_10064023 | Ga0111539_100640233 | 296 |
| 553 | 3300009094 | Ga0111539_10104075 | Ga0111539_101040753 | 296 |
| 554 | 3300009098 | Ga0105245_10055768 | Ga0105245_100557682 | 296 |
| 555 | 3300009147 | Ga0114129_10793909 | Ga0114129_107939091 | 296 |
| 556 | 3300013296 | Ga0157374_10015447 | Ga0157374_100154478 | 296 |
| 557 | 3300013297 | Ga0157378_10001817 | Ga0157378_1000181714 | 296 |
| 558 | 3300025913 | Ga0207695_10000122 | Ga0207695_10000122118 | 296 |
| 559 | 3300025927 | Ga0207687_10115510 | Ga0207687_101155102 | 296 |
| 560 | 3300027907 | Ga0207428_10217992 | Ga0207428_102179922 | 296 |
| 561 | 3300028800 | Ga0265338_10012635 | Ga0265338_100126356 | 296 |
| 562 | 3300031238 | Ga0265332_10007225 | Ga0265332_100072252 | 296 |
| 563 | 3300033544 | Ga0316215_1000671 | Ga0316215_10006712 | 296 |
| 564 | 3300035170 | Ga0373943_0076738 | Ga0373943_0076738_63_1004 | 296 |
| 565 | 3300035695 | Ga0373927_0058978 | Ga0373927_0058978_439_1380 | 296 |
| 566 | 3300035724 | Ga0373933_0063953 | Ga0373933_0063953_289_1203 | 296 |
| 567 | 3300037068 | Ga0373925_0019685 | Ga0373925_0019685_2516_3457 | 296 |
| 568 | 3300039437 | Ga0436365_0957587 | Ga0436365_0957587_222_1163 | 296 |
| 569 | 3300039447 | Ga0436361_0395780 | Ga0436361_0395780_225_1115 | 296 |
| 570 | 3300039450 | Ga0436363_1520079 | Ga0436363_1520079_246_1187 | 296 |
| 571 | 3300041498 | Ga0451841_1398578 | Ga0451841_1398578_185_1075 | 296 |
| 572 | 3300041509 | Ga0451843_1054068 | Ga0451843_1054068_28_945 | 296 |
| 573 | 3300041509 | Ga0451843_1533294 | Ga0451843_1533294_24_929 | 296 |
| 574 | 3300041512 | Ga0451853_0114604 | Ga0451853_0114604_385_1275 | 296 |
| 575 | 3300046462 | Ga0495651_0000620 | Ga0495651_0000620_3052_3969 | 296 |
| 576 | 3300046648 | Ga0495611_0058782 | Ga0495611_0058782_28_918 | 296 |
| 577 | 3300047320 | Ga0495672_0111907 | Ga0495672_0111907_31_939 | 296 |
| 578 | 3300047322 | Ga0495680_0000573 | Ga0495680_0000573_13778_14695 | 296 |
| 579 | 3300048088 | Ga0495602_0323865 | Ga0495602_0323865_38_952 | 296 |
| 580 | 3300048915 | Ga0496112_0055686 | Ga0496112_0055686_1155_2132 | 296 |
| 581 | 3300048915 | Ga0496112_0217534 | Ga0496112_0217534_89_1009 | 296 |
| 582 | 3300048917 | Ga0496114_0144878 | Ga0496114_0144878_367_1344 | 296 |
| 583 | 3300048918 | Ga0496115_0113952 | Ga0496115_0113952_580_1503 | 296 |
| 584 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_130387_131277 | 296 |
| 585 | 3300048929 | Ga0496126_0033724 | Ga0496126_0033724_1017_1943 | 296 |
| 586 | 3300048929 | Ga0496126_0036043 | Ga0496126_0036043_2714_3604 | 296 |
| 587 | 3300049571 | Ga0501034_0418777 | Ga0501034_0418777_197_1093 | 296 |
| 588 | 3300049587 | Ga0501071_0170851 | Ga0501071_0170851_414_1334 | 296 |
| 589 | 3300049591 | Ga0501075_0250349 | Ga0501075_0250349_277_1212 | 296 |
| 590 | 3300049593 | Ga0501077_0139560 | Ga0501077_0139560_213_1262 | 296 |
| 591 | 3300050492 | nmdc:mga0yw44_16455_c1 | nmdc:mga0yw44_16455_c1_2666_3601 | 296 |
| 592 | 3300050492 | nmdc:mga0yw44_84243_c1 | nmdc:mga0yw44_84243_c1_949_1884 | 296 |
| 593 | 3300050511 | nmdc:mga08y16_83801_c1 | nmdc:mga08y16_83801_c1_1055_1969 | 296 |
| 594 | 3300002704 | JGI25155J39150_1000112 | JGI25155J39150_100011222 | 297 |
| 595 | 3300002705 | JGI25156J39149_1000197 | JGI25156J39149_100019729 | 297 |
| 596 | 3300002738 | JGI25154J39366_1000492 | JGI25154J39366_10004922 | 297 |
| 597 | 3300002738 | JGI25154J39366_1001559 | JGI25154J39366_10015597 | 297 |
| 598 | 3300002741 | JGI25157J39369_1000239 | JGI25157J39369_100023929 | 297 |
| 599 | 3300002773 | JGI25152J39213_1023134 | JGI25152J39213_10231341 | 297 |
| 600 | 3300002774 | JGI25150J39212_1013973 | JGI25150J39212_10139732 | 297 |
| 601 | 3300002987 | JGI25159J45721_1007982 | JGI25159J45721_10079821 | 297 |
| 602 | 3300003187 | JGI25151J46595_10001139 | JGI25151J46595_1000113910 | 297 |
| 603 | 3300003187 | JGI25151J46595_10002242 | JGI25151J46595_100022429 | 297 |
| 604 | 3300003187 | JGI25151J46595_10007087 | JGI25151J46595_100070879 | 297 |
| 605 | 3300003187 | JGI25151J46595_10022426 | JGI25151J46595_100224263 | 297 |
| 606 | 3300003187 | JGI25151J46595_10023263 | JGI25151J46595_100232632 | 297 |
| 607 | 3300003203 | JGI25406J46586_10010495 | JGI25406J46586_100104953 | 297 |
| 608 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_1000018135 | 297 |
| 609 | 3300003215 | JGI25153J46596_10000445 | JGI25153J46596_1000044511 | 297 |
| 610 | 3300003215 | JGI25153J46596_10000538 | JGI25153J46596_1000053810 | 297 |
| 611 | 3300003215 | JGI25153J46596_10001836 | JGI25153J46596_100018366 | 297 |
| 612 | 3300003215 | JGI25153J46596_10001953 | JGI25153J46596_100019537 | 297 |
| 613 | 3300003215 | JGI25153J46596_10002991 | JGI25153J46596_100029913 | 297 |
| 614 | 3300003354 | JGI25160J50197_1001189 | JGI25160J50197_10011898 | 297 |
| 615 | 3300003659 | JGI25404J52841_10004891 | JGI25404J52841_100048911 | 297 |
| 616 | 3300003659 | JGI25404J52841_10008719 | JGI25404J52841_100087192 | 297 |
| 617 | 3300003771 | Ga0055526_1000294 | Ga0055526_10002946 | 297 |
| 618 | 3300003771 | Ga0055526_1003052 | Ga0055526_10030529 | 297 |
| 619 | 3300003771 | Ga0055526_1004955 | Ga0055526_100495510 | 297 |
| 620 | 3300003771 | Ga0055526_1007171 | Ga0055526_10071712 | 297 |
| 621 | 3300003775 | Ga0055524_1000329 | Ga0055524_100032939 | 297 |
| 622 | 3300003775 | Ga0055524_1005364 | Ga0055524_10053641 | 297 |
| 623 | 3300003781 | Ga0055536_1002017 | Ga0055536_10020174 | 297 |
| 624 | 3300003781 | Ga0055536_1015902 | Ga0055536_10159023 | 297 |
| 625 | 3300003790 | Ga0055528_1005515 | Ga0055528_10055157 | 297 |
| 626 | 3300003790 | Ga0055528_1005551 | Ga0055528_10055512 | 297 |
| 627 | 3300003791 | Ga0055530_10010995 | Ga0055530_100109953 | 297 |
| 628 | 3300003792 | Ga0055540_1016013 | Ga0055540_10160131 | 297 |
| 629 | 3300003794 | Ga0055531_10000729 | Ga0055531_1000072911 | 297 |
| 630 | 3300004625 | Ga0055543_1002209 | Ga0055543_10022094 | 297 |
| 631 | 3300005262 | Ga0065165_1001097 | Ga0065165_100109710 | 297 |
| 632 | 3300005262 | Ga0065165_1002055 | Ga0065165_100205511 | 297 |
| 633 | 3300005262 | Ga0065165_1002735 | Ga0065165_10027353 | 297 |
| 634 | 3300005262 | Ga0065165_1005168 | Ga0065165_10051686 | 297 |
| 635 | 3300005327 | Ga0070658_10361909 | Ga0070658_103619091 | 297 |
| 636 | 3300005333 | Ga0070677_10000277 | Ga0070677_1000027715 | 297 |
| 637 | 3300005334 | Ga0068869_100019363 | Ga0068869_1000193632 | 297 |
| 638 | 3300005334 | Ga0068869_100034767 | Ga0068869_1000347674 | 297 |
| 639 | 3300005338 | Ga0068868_100040441 | Ga0068868_1000404415 | 297 |
| 640 | 3300005338 | Ga0068868_100227193 | Ga0068868_1002271932 | 297 |
| 641 | 3300005338 | Ga0068868_100309955 | Ga0068868_1003099552 | 297 |
| 642 | 3300005347 | Ga0070668_100002093 | Ga0070668_10000209311 | 297 |
| 643 | 3300005347 | Ga0070668_100038940 | Ga0070668_1000389404 | 297 |
| 644 | 3300005347 | Ga0070668_100458226 | Ga0070668_1004582261 | 297 |
| 645 | 3300005354 | Ga0070675_100000224 | Ga0070675_10000022435 | 297 |
| 646 | 3300005355 | Ga0070671_100001015 | Ga0070671_10000101517 | 297 |
| 647 | 3300005355 | Ga0070671_100034845 | Ga0070671_1000348452 | 297 |
| 648 | 3300005356 | Ga0070674_100000094 | Ga0070674_1000000941 | 297 |
| 649 | 3300005364 | Ga0070673_100000132 | Ga0070673_1000001324 | 297 |
| 650 | 3300005367 | Ga0070667_100002751 | Ga0070667_1000027511 | 297 |
| 651 | 3300005434 | Ga0070709_10001902 | Ga0070709_100019023 | 297 |
| 652 | 3300005434 | Ga0070709_10012965 | Ga0070709_100129654 | 297 |
| 653 | 3300005435 | Ga0070714_100033431 | Ga0070714_1000334314 | 297 |
| 654 | 3300005435 | Ga0070714_100063866 | Ga0070714_1000638661 | 297 |
| 655 | 3300005435 | Ga0070714_100108307 | Ga0070714_1001083072 | 297 |
| 656 | 3300005436 | Ga0070713_100158950 | Ga0070713_1001589502 | 297 |
| 657 | 3300005436 | Ga0070713_100191331 | Ga0070713_1001913312 | 297 |
| 658 | 3300005437 | Ga0070710_10007353 | Ga0070710_100073534 | 297 |
| 659 | 3300005437 | Ga0070710_10019031 | Ga0070710_100190313 | 297 |
| 660 | 3300005437 | Ga0070710_10020006 | Ga0070710_100200063 | 297 |
| 661 | 3300005437 | Ga0070710_10105297 | Ga0070710_101052972 | 297 |
| 662 | 3300005439 | Ga0070711_100003318 | Ga0070711_1000033186 | 297 |
| 663 | 3300005439 | Ga0070711_100035905 | Ga0070711_1000359052 | 297 |
| 664 | 3300005439 | Ga0070711_100103701 | Ga0070711_1001037012 | 297 |
| 665 | 3300005444 | Ga0070694_100178884 | Ga0070694_1001788841 | 297 |
| 666 | 3300005455 | Ga0070663_100025078 | Ga0070663_1000250783 | 297 |
| 667 | 3300005455 | Ga0070663_100245350 | Ga0070663_1002453502 | 297 |
| 668 | 3300005456 | Ga0070678_100000658 | Ga0070678_1000006584 | 297 |
| 669 | 3300005456 | Ga0070678_100015205 | Ga0070678_1000152054 | 297 |
| 670 | 3300005456 | Ga0070678_100113954 | Ga0070678_1001139542 | 297 |
| 671 | 3300005458 | Ga0070681_10085431 | Ga0070681_100854314 | 297 |
| 672 | 3300005459 | Ga0068867_100059626 | Ga0068867_1000596262 | 297 |
| 673 | 3300005518 | Ga0070699_100404947 | Ga0070699_1004049472 | 297 |
| 674 | 3300005530 | Ga0070679_100078285 | Ga0070679_1000782851 | 297 |
| 675 | 3300005535 | Ga0070684_100003721 | Ga0070684_1000037214 | 297 |
| 676 | 3300005539 | Ga0068853_100134956 | Ga0068853_1001349561 | 297 |
| 677 | 3300005548 | Ga0070665_100001793 | Ga0070665_10000179311 | 297 |
| 678 | 3300005548 | Ga0070665_100101470 | Ga0070665_1001014702 | 297 |
| 679 | 3300005563 | Ga0068855_100431984 | Ga0068855_1004319842 | 297 |
| 680 | 3300005577 | Ga0068857_100210607 | Ga0068857_1002106072 | 297 |
| 681 | 3300005578 | Ga0068854_100284263 | Ga0068854_1002842631 | 297 |
| 682 | 3300005614 | Ga0068856_100033647 | Ga0068856_1000336475 | 297 |
| 683 | 3300005614 | Ga0068856_100058870 | Ga0068856_1000588702 | 297 |
| 684 | 3300005615 | Ga0070702_100054816 | Ga0070702_1000548162 | 297 |
| 685 | 3300005616 | Ga0068852_100001003 | Ga0068852_10000100317 | 297 |
| 686 | 3300005616 | Ga0068852_100302172 | Ga0068852_1003021721 | 297 |
| 687 | 3300005617 | Ga0068859_100232140 | Ga0068859_1002321402 | 297 |
| 688 | 3300005617 | Ga0068859_100260537 | Ga0068859_1002605371 | 297 |
| 689 | 3300005618 | Ga0068864_100012763 | Ga0068864_1000127634 | 297 |
| 690 | 3300005618 | Ga0068864_100196195 | Ga0068864_1001961952 | 297 |
| 691 | 3300005718 | Ga0068866_10102620 | Ga0068866_101026202 | 297 |
| 692 | 3300005719 | Ga0068861_100067100 | Ga0068861_1000671003 | 297 |
| 693 | 3300005840 | Ga0068870_10070933 | Ga0068870_100709333 | 297 |
| 694 | 3300005841 | Ga0068863_100028496 | Ga0068863_1000284963 | 297 |
| 695 | 3300005841 | Ga0068863_100116394 | Ga0068863_1001163943 | 297 |
| 696 | 3300005842 | Ga0068858_100016761 | Ga0068858_1000167616 | 297 |
| 697 | 3300005842 | Ga0068858_100116179 | Ga0068858_1001161792 | 297 |
| 698 | 3300005842 | Ga0068858_100250114 | Ga0068858_1002501142 | 297 |
| 699 | 3300005843 | Ga0068860_100011049 | Ga0068860_1000110494 | 297 |
| 700 | 3300005843 | Ga0068860_100011142 | Ga0068860_1000111422 | 297 |
| 701 | 3300005843 | Ga0068860_100179659 | Ga0068860_1001796592 | 297 |
| 702 | 3300005844 | Ga0068862_100035365 | Ga0068862_1000353654 | 297 |
| 703 | 3300005937 | Ga0081455_10014700 | Ga0081455_100147006 | 297 |
| 704 | 3300005937 | Ga0081455_10033538 | Ga0081455_100335383 | 297 |
| 705 | 3300005937 | Ga0081455_10090038 | Ga0081455_100900382 | 297 |
| 706 | 3300005937 | Ga0081455_10131260 | Ga0081455_101312602 | 297 |
| 707 | 3300005983 | Ga0081540_1019445 | Ga0081540_10194453 | 297 |
| 708 | 3300005983 | Ga0081540_1022824 | Ga0081540_10228243 | 297 |
| 709 | 3300005983 | Ga0081540_1022968 | Ga0081540_10229683 | 297 |
| 710 | 3300005983 | Ga0081540_1037387 | Ga0081540_10373872 | 297 |
| 711 | 3300005983 | Ga0081540_1041655 | Ga0081540_10416552 | 297 |
| 712 | 3300005985 | Ga0081539_10002840 | Ga0081539_100028403 | 297 |
| 713 | 3300005985 | Ga0081539_10160343 | Ga0081539_101603431 | 297 |
| 714 | 3300006028 | Ga0070717_10077764 | Ga0070717_100777642 | 297 |
| 715 | 3300006038 | Ga0075365_10004444 | Ga0075365_100044449 | 297 |
| 716 | 3300006038 | Ga0075365_10031780 | Ga0075365_100317804 | 297 |
| 717 | 3300006038 | Ga0075365_10098570 | Ga0075365_100985702 | 297 |
| 718 | 3300006038 | Ga0075365_10114483 | Ga0075365_101144832 | 297 |
| 719 | 3300006038 | Ga0075365_10198549 | Ga0075365_101985492 | 297 |
| 720 | 3300006042 | Ga0075368_10004886 | Ga0075368_100048863 | 297 |
| 721 | 3300006048 | Ga0075363_100015751 | Ga0075363_1000157513 | 297 |
| 722 | 3300006051 | Ga0075364_10007672 | Ga0075364_100076723 | 297 |
| 723 | 3300006173 | Ga0070716_100046680 | Ga0070716_1000466802 | 297 |
| 724 | 3300006175 | Ga0070712_100015634 | Ga0070712_1000156343 | 297 |
| 725 | 3300006177 | Ga0075362_10012412 | Ga0075362_100124122 | 297 |
| 726 | 3300006177 | Ga0075362_10061449 | Ga0075362_100614492 | 297 |
| 727 | 3300006178 | Ga0075367_10007827 | Ga0075367_100078274 | 297 |
| 728 | 3300006178 | Ga0075367_10063112 | Ga0075367_100631121 | 297 |
| 729 | 3300006186 | Ga0075369_10012242 | Ga0075369_100122422 | 297 |
| 730 | 3300006186 | Ga0075369_10025703 | Ga0075369_100257033 | 297 |
| 731 | 3300006186 | Ga0075369_10062278 | Ga0075369_100622782 | 297 |
| 732 | 3300006186 | Ga0075369_10071521 | Ga0075369_100715212 | 297 |
| 733 | 3300006186 | Ga0075369_10099870 | Ga0075369_100998701 | 297 |
| 734 | 3300006195 | Ga0075366_10001108 | Ga0075366_1000110814 | 297 |
| 735 | 3300006195 | Ga0075366_10012683 | Ga0075366_100126834 | 297 |
| 736 | 3300006195 | Ga0075366_10092393 | Ga0075366_100923932 | 297 |
| 737 | 3300006195 | Ga0075366_10152563 | Ga0075366_101525632 | 297 |
| 738 | 3300006237 | Ga0097621_100016114 | Ga0097621_1000161146 | 297 |
| 739 | 3300006237 | Ga0097621_100604493 | Ga0097621_1006044931 | 297 |
| 740 | 3300006353 | Ga0075370_10015332 | Ga0075370_100153321 | 297 |
| 741 | 3300006353 | Ga0075370_10073167 | Ga0075370_100731671 | 297 |
| 742 | 3300006353 | Ga0075370_10102129 | Ga0075370_101021291 | 297 |
| 743 | 3300006358 | Ga0068871_100002062 | Ga0068871_1000020625 | 297 |
| 744 | 3300006844 | Ga0075428_100214898 | Ga0075428_1002148983 | 297 |
| 745 | 3300006871 | Ga0075434_100176014 | Ga0075434_1001760142 | 297 |
| 746 | 3300006871 | Ga0075434_100260298 | Ga0075434_1002602982 | 297 |
| 747 | 3300006880 | Ga0075429_100291968 | Ga0075429_1002919682 | 297 |
| 748 | 3300006931 | Ga0097620_100232137 | Ga0097620_1002321372 | 297 |
| 749 | 3300006931 | Ga0097620_100260548 | Ga0097620_1002605481 | 297 |
| 750 | 3300006942 | Ga0099824_1022087 | Ga0099824_10220875 | 297 |
| 751 | 3300007265 | Ga0099794_10015436 | Ga0099794_100154362 | 297 |
| 752 | 3300007788 | Ga0099795_10031309 | Ga0099795_100313092 | 297 |
| 753 | 3300009092 | Ga0105250_10084800 | Ga0105250_100848002 | 297 |
| 754 | 3300009093 | Ga0105240_10060989 | Ga0105240_100609893 | 297 |
| 755 | 3300009093 | Ga0105240_10110542 | Ga0105240_101105422 | 297 |
| 756 | 3300009094 | Ga0111539_10277782 | Ga0111539_102777822 | 297 |
| 757 | 3300009098 | Ga0105245_10107778 | Ga0105245_101077782 | 297 |
| 758 | 3300009098 | Ga0105245_10233051 | Ga0105245_102330512 | 297 |
| 759 | 3300009098 | Ga0105245_10379769 | Ga0105245_103797692 | 297 |
| 760 | 3300009098 | Ga0105245_10620932 | Ga0105245_106209322 | 297 |
| 761 | 3300009098 | Ga0105245_10647798 | Ga0105245_106477981 | 297 |
| 762 | 3300009101 | Ga0105247_10016792 | Ga0105247_100167924 | 297 |
| 763 | 3300009147 | Ga0114129_10037785 | Ga0114129_100377857 | 297 |
| 764 | 3300009147 | Ga0114129_10047181 | Ga0114129_100471816 | 297 |
| 765 | 3300009174 | Ga0105241_10233679 | Ga0105241_102336791 | 297 |
| 766 | 3300009177 | Ga0105248_10143155 | Ga0105248_101431553 | 297 |
| 767 | 3300009177 | Ga0105248_10166735 | Ga0105248_101667352 | 297 |
| 768 | 3300009177 | Ga0105248_10530893 | Ga0105248_105308932 | 297 |
| 769 | 3300009545 | Ga0105237_10011301 | Ga0105237_100113014 | 297 |
| 770 | 3300009545 | Ga0105237_10014185 | Ga0105237_100141856 | 297 |
| 771 | 3300009545 | Ga0105237_10020492 | Ga0105237_100204926 | 297 |
| 772 | 3300009545 | Ga0105237_10034201 | Ga0105237_100342012 | 297 |
| 773 | 3300009545 | Ga0105237_10130618 | Ga0105237_101306182 | 297 |
| 774 | 3300009545 | Ga0105237_10465549 | Ga0105237_104655491 | 297 |
| 775 | 3300009551 | Ga0105238_10156933 | Ga0105238_101569332 | 297 |
| 776 | 3300009551 | Ga0105238_10192322 | Ga0105238_101923222 | 297 |
| 777 | 3300009551 | Ga0105238_10401500 | Ga0105238_104015002 | 297 |
| 778 | 3300009553 | Ga0105249_10164237 | Ga0105249_101642372 | 297 |
| 779 | 3300009765 | Ga0123341_1000004 | Ga0123341_100000464 | 297 |
| 780 | 3300009765 | Ga0123341_1000928 | Ga0123341_10009285 | 297 |
| 781 | 3300009766 | Ga0123342_1012789 | Ga0123342_10127897 | 297 |
| 782 | 3300010375 | Ga0105239_10022996 | Ga0105239_100229962 | 297 |
| 783 | 3300010375 | Ga0105239_10080181 | Ga0105239_100801814 | 297 |
| 784 | 3300010375 | Ga0105239_10085808 | Ga0105239_100858083 | 297 |
| 785 | 3300010375 | Ga0105239_10111798 | Ga0105239_101117982 | 297 |
| 786 | 3300010375 | Ga0105239_10335359 | Ga0105239_103353592 | 297 |
| 787 | 3300011119 | Ga0105246_10071539 | Ga0105246_100715392 | 297 |
| 788 | 3300011119 | Ga0105246_10071630 | Ga0105246_100716302 | 297 |
| 789 | 3300011119 | Ga0105246_10111269 | Ga0105246_101112693 | 297 |
| 790 | 3300011119 | Ga0105246_10253810 | Ga0105246_102538101 | 297 |
| 791 | 3300013100 | Ga0157373_10002385 | Ga0157373_100023855 | 297 |
| 792 | 3300013102 | Ga0157371_10001149 | Ga0157371_100011493 | 297 |
| 793 | 3300013104 | Ga0157370_10003466 | Ga0157370_100034666 | 297 |
| 794 | 3300013105 | Ga0157369_10101634 | Ga0157369_101016343 | 297 |
| 795 | 3300013249 | Ga0171463_1005 | Ga0171463_1005129 | 297 |
| 796 | 3300013250 | Ga0171462_1036 | Ga0171462_103620 | 297 |
| 797 | 3300013296 | Ga0157374_10177414 | Ga0157374_101774142 | 297 |
| 798 | 3300013297 | Ga0157378_10080000 | Ga0157378_100800003 | 297 |
| 799 | 3300013306 | Ga0163162_10208117 | Ga0163162_102081172 | 297 |
| 800 | 3300013306 | Ga0163162_10357376 | Ga0163162_103573762 | 297 |
| 801 | 3300013306 | Ga0163162_10465892 | Ga0163162_104658922 | 297 |
| 802 | 3300013308 | Ga0157375_10001014 | Ga0157375_1000101423 | 297 |
| 803 | 3300013308 | Ga0157375_10148137 | Ga0157375_101481372 | 297 |
| 804 | 3300013308 | Ga0157375_10169634 | Ga0157375_101696342 | 297 |
| 805 | 3300014325 | Ga0163163_10195174 | Ga0163163_101951742 | 297 |
| 806 | 3300014745 | Ga0157377_10260516 | Ga0157377_102605162 | 297 |
| 807 | 3300014968 | Ga0157379_10155023 | Ga0157379_101550232 | 297 |
| 808 | 3300015690 | Ga0183363_1022 | Ga0183363_102235 | 297 |
| 809 | 3300021320 | Ga0214544_1000003 | Ga0214544_100000337 | 297 |
| 810 | 3300021320 | Ga0214544_1000130 | Ga0214544_100013083 | 297 |
| 811 | 3300021321 | Ga0214542_1000003 | Ga0214542_100000327 | 297 |
| 812 | 3300021321 | Ga0214542_1000014 | Ga0214542_100001495 | 297 |
| 813 | 3300021324 | Ga0214545_1000004 | Ga0214545_100000440 | 297 |
| 814 | 3300021327 | Ga0214543_1000007 | Ga0214543_1000007376 | 297 |
| 815 | 3300021327 | Ga0214543_1000146 | Ga0214543_100014695 | 297 |
| 816 | 3300021327 | Ga0214543_1012039 | Ga0214543_101203911 | 297 |
| 817 | 3300021384 | Ga0213876_10001150 | Ga0213876_1000115012 | 297 |
| 818 | 3300021388 | Ga0213875_10061127 | Ga0213875_100611272 | 297 |
| 819 | 3300025206 | Ga0209435_100089 | Ga0209435_10008928 | 297 |
| 820 | 3300025233 | Ga0209437_100022 | Ga0209437_100022197 | 297 |
| 821 | 3300025245 | Ga0207425_1006786 | Ga0207425_10067863 | 297 |
| 822 | 3300025245 | Ga0207425_1007610 | Ga0207425_10076103 | 297 |
| 823 | 3300025245 | Ga0207425_1023781 | Ga0207425_10237811 | 297 |
| 824 | 3300025246 | Ga0209646_1000293 | Ga0209646_100029328 | 297 |
| 825 | 3300025250 | Ga0209026_1000364 | Ga0209026_100036428 | 297 |
| 826 | 3300025253 | Ga0209677_106350 | Ga0209677_1063502 | 297 |
| 827 | 3300025254 | Ga0209148_1004847 | Ga0209148_10048473 | 297 |
| 828 | 3300025256 | Ga0209759_1000508 | Ga0209759_100050828 | 297 |
| 829 | 3300025258 | Ga0209129_1000249 | Ga0209129_100024933 | 297 |
| 830 | 3300025258 | Ga0209129_1008239 | Ga0209129_10082393 | 297 |
| 831 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031197 | 297 |
| 832 | 3300025261 | Ga0209233_1005792 | Ga0209233_10057923 | 297 |
| 833 | 3300025263 | Ga0209565_1020364 | Ga0209565_10203641 | 297 |
| 834 | 3300025272 | Ga0209455_1002341 | Ga0209455_10023413 | 297 |
| 835 | 3300025272 | Ga0209455_1004862 | Ga0209455_10048622 | 297 |
| 836 | 3300025273 | Ga0209673_1000846 | Ga0209673_100084640 | 297 |
| 837 | 3300025273 | Ga0209673_1001554 | Ga0209673_100155413 | 297 |
| 838 | 3300025273 | Ga0209673_1011769 | Ga0209673_10117692 | 297 |
| 839 | 3300025284 | Ga0209130_1001589 | Ga0209130_100158915 | 297 |
| 840 | 3300025291 | Ga0209675_1001292 | Ga0209675_10012927 | 297 |
| 841 | 3300025291 | Ga0209675_1009170 | Ga0209675_10091704 | 297 |
| 842 | 3300025292 | Ga0209676_1002007 | Ga0209676_100200716 | 297 |
| 843 | 3300025292 | Ga0209676_1006744 | Ga0209676_10067443 | 297 |
| 844 | 3300025292 | Ga0209676_1013963 | Ga0209676_10139632 | 297 |
| 845 | 3300025294 | Ga0209025_1000121 | Ga0209025_100012178 | 297 |
| 846 | 3300025294 | Ga0209025_1001108 | Ga0209025_100110837 | 297 |
| 847 | 3300025294 | Ga0209025_1001350 | Ga0209025_100135033 | 297 |
| 848 | 3300025294 | Ga0209025_1002685 | Ga0209025_100268515 | 297 |
| 849 | 3300025294 | Ga0209025_1006909 | Ga0209025_10069098 | 297 |
| 850 | 3300025295 | Ga0209564_1000015 | Ga0209564_100001565 | 297 |
| 851 | 3300025295 | Ga0209564_1000341 | Ga0209564_100034146 | 297 |
| 852 | 3300025295 | Ga0209564_1002099 | Ga0209564_10020997 | 297 |
| 853 | 3300025295 | Ga0209564_1002240 | Ga0209564_10022407 | 297 |
| 854 | 3300025295 | Ga0209564_1004061 | Ga0209564_10040617 | 297 |
| 855 | 3300025295 | Ga0209564_1051806 | Ga0209564_10518061 | 297 |
| 856 | 3300025297 | Ga0209758_1000015 | Ga0209758_100001584 | 297 |
| 857 | 3300025297 | Ga0209758_1000335 | Ga0209758_100033510 | 297 |
| 858 | 3300025297 | Ga0209758_1000445 | Ga0209758_10004455 | 297 |
| 859 | 3300025297 | Ga0209758_1002632 | Ga0209758_100263210 | 297 |
| 860 | 3300025297 | Ga0209758_1002782 | Ga0209758_100278218 | 297 |
| 861 | 3300025297 | Ga0209758_1009164 | Ga0209758_10091643 | 297 |
| 862 | 3300025297 | Ga0209758_1039146 | Ga0209758_10391462 | 297 |
| 863 | 3300025297 | Ga0209758_1040308 | Ga0209758_10403082 | 297 |
| 864 | 3300025298 | Ga0209050_1002265 | Ga0209050_10022659 | 297 |
| 865 | 3300025298 | Ga0209050_1013214 | Ga0209050_10132142 | 297 |
| 866 | 3300025299 | Ga0209256_1000176 | Ga0209256_1000176119 | 297 |
| 867 | 3300025299 | Ga0209256_1000205 | Ga0209256_100020565 | 297 |
| 868 | 3300025299 | Ga0209256_1000403 | Ga0209256_100040366 | 297 |
| 869 | 3300025299 | Ga0209256_1000534 | Ga0209256_100053456 | 297 |
| 870 | 3300025302 | Ga0207426_1000201 | Ga0207426_100020187 | 297 |
| 871 | 3300025302 | Ga0207426_1007422 | Ga0207426_10074222 | 297 |
| 872 | 3300025303 | Ga0209051_1007468 | Ga0209051_10074684 | 297 |
| 873 | 3300025303 | Ga0209051_1008435 | Ga0209051_10084352 | 297 |
| 874 | 3300025304 | Ga0209257_1000599 | Ga0209257_100059922 | 297 |
| 875 | 3300025304 | Ga0209257_1001779 | Ga0209257_10017794 | 297 |
| 876 | 3300025304 | Ga0209257_1008569 | Ga0209257_10085695 | 297 |
| 877 | 3300025315 | Ga0207697_10006269 | Ga0207697_100062694 | 297 |
| 878 | 3300025893 | Ga0207682_10000084 | Ga0207682_100000849 | 297 |
| 879 | 3300025898 | Ga0207692_10000985 | Ga0207692_100009855 | 297 |
| 880 | 3300025899 | Ga0207642_10060513 | Ga0207642_100605132 | 297 |
| 881 | 3300025900 | Ga0207710_10014600 | Ga0207710_100146003 | 297 |
| 882 | 3300025901 | Ga0207688_10120688 | Ga0207688_101206881 | 297 |
| 883 | 3300025904 | Ga0207647_10023900 | Ga0207647_100239002 | 297 |
| 884 | 3300025904 | Ga0207647_10164332 | Ga0207647_101643322 | 297 |
| 885 | 3300025905 | Ga0207685_10010851 | Ga0207685_100108512 | 297 |
| 886 | 3300025906 | Ga0207699_10008567 | Ga0207699_100085674 | 297 |
| 887 | 3300025906 | Ga0207699_10145192 | Ga0207699_101451922 | 297 |
| 888 | 3300025907 | Ga0207645_10000663 | Ga0207645_1000066315 | 297 |
| 889 | 3300025907 | Ga0207645_10018670 | Ga0207645_100186704 | 297 |
| 890 | 3300025908 | Ga0207643_10222293 | Ga0207643_102222931 | 297 |
| 891 | 3300025911 | Ga0207654_10018655 | Ga0207654_100186552 | 297 |
| 892 | 3300025913 | Ga0207695_10000065 | Ga0207695_10000065258 | 297 |
| 893 | 3300025913 | Ga0207695_10251590 | Ga0207695_102515902 | 297 |
| 894 | 3300025914 | Ga0207671_10018466 | Ga0207671_100184663 | 297 |
| 895 | 3300025914 | Ga0207671_10025951 | Ga0207671_100259512 | 297 |
| 896 | 3300025914 | Ga0207671_10353055 | Ga0207671_103530551 | 297 |
| 897 | 3300025915 | Ga0207693_10029022 | Ga0207693_100290225 | 297 |
| 898 | 3300025915 | Ga0207693_10042330 | Ga0207693_100423302 | 297 |
| 899 | 3300025916 | Ga0207663_10112064 | Ga0207663_101120642 | 297 |
| 900 | 3300025916 | Ga0207663_10194828 | Ga0207663_101948282 | 297 |
| 901 | 3300025921 | Ga0207652_10016276 | Ga0207652_100162762 | 297 |
| 902 | 3300025923 | Ga0207681_10259235 | Ga0207681_102592352 | 297 |
| 903 | 3300025924 | Ga0207694_10262412 | Ga0207694_102624121 | 297 |
| 904 | 3300025925 | Ga0207650_10069612 | Ga0207650_100696123 | 297 |
| 905 | 3300025925 | Ga0207650_10079425 | Ga0207650_100794253 | 297 |
| 906 | 3300025927 | Ga0207687_10029665 | Ga0207687_100296653 | 297 |
| 907 | 3300025927 | Ga0207687_10034122 | Ga0207687_100341224 | 297 |
| 908 | 3300025928 | Ga0207700_10000320 | Ga0207700_1000032017 | 297 |
| 909 | 3300025928 | Ga0207700_10031277 | Ga0207700_100312772 | 297 |
| 910 | 3300025928 | Ga0207700_10249639 | Ga0207700_102496392 | 297 |
| 911 | 3300025929 | Ga0207664_10016641 | Ga0207664_100166412 | 297 |
| 912 | 3300025929 | Ga0207664_10129290 | Ga0207664_101292902 | 297 |
| 913 | 3300025931 | Ga0207644_10004187 | Ga0207644_100041872 | 297 |
| 914 | 3300025932 | Ga0207690_10121767 | Ga0207690_101217672 | 297 |
| 915 | 3300025933 | Ga0207706_10099488 | Ga0207706_100994882 | 297 |
| 916 | 3300025935 | Ga0207709_10068782 | Ga0207709_100687821 | 297 |
| 917 | 3300025935 | Ga0207709_10117239 | Ga0207709_101172392 | 297 |
| 918 | 3300025938 | Ga0207704_10047997 | Ga0207704_100479973 | 297 |
| 919 | 3300025938 | Ga0207704_10143993 | Ga0207704_101439932 | 297 |
| 920 | 3300025938 | Ga0207704_10203711 | Ga0207704_102037111 | 297 |
| 921 | 3300025939 | Ga0207665_10018294 | Ga0207665_100182944 | 297 |
| 922 | 3300025939 | Ga0207665_10029914 | Ga0207665_100299144 | 297 |
| 923 | 3300025940 | Ga0207691_10000018 | Ga0207691_1000001885 | 297 |
| 924 | 3300025941 | Ga0207711_10032525 | Ga0207711_100325254 | 297 |
| 925 | 3300025942 | Ga0207689_10040619 | Ga0207689_100406194 | 297 |
| 926 | 3300025944 | Ga0207661_10000633 | Ga0207661_1000063312 | 297 |
| 927 | 3300025949 | Ga0207667_10045957 | Ga0207667_100459573 | 297 |
| 928 | 3300025972 | Ga0207668_10000899 | Ga0207668_100008999 | 297 |
| 929 | 3300025972 | Ga0207668_10031173 | Ga0207668_100311733 | 297 |
| 930 | 3300025972 | Ga0207668_10279070 | Ga0207668_102790701 | 297 |
| 931 | 3300025981 | Ga0207640_10144707 | Ga0207640_101447071 | 297 |
| 932 | 3300025981 | Ga0207640_10162833 | Ga0207640_101628332 | 297 |
| 933 | 3300025981 | Ga0207640_10165198 | Ga0207640_101651982 | 297 |
| 934 | 3300025986 | Ga0207658_10013727 | Ga0207658_100137273 | 297 |
| 935 | 3300025986 | Ga0207658_10637251 | Ga0207658_106372511 | 297 |
| 936 | 3300026035 | Ga0207703_10092104 | Ga0207703_100921043 | 297 |
| 937 | 3300026041 | Ga0207639_10078615 | Ga0207639_100786152 | 297 |
| 938 | 3300026041 | Ga0207639_10218291 | Ga0207639_102182912 | 297 |
| 939 | 3300026067 | Ga0207678_10036869 | Ga0207678_100368693 | 297 |
| 940 | 3300026067 | Ga0207678_10225011 | Ga0207678_102250112 | 297 |
| 941 | 3300026078 | Ga0207702_10007536 | Ga0207702_100075367 | 297 |
| 942 | 3300026078 | Ga0207702_10107345 | Ga0207702_101073452 | 297 |
| 943 | 3300026078 | Ga0207702_10156910 | Ga0207702_101569101 | 297 |
| 944 | 3300026088 | Ga0207641_10150138 | Ga0207641_101501382 | 297 |
| 945 | 3300026088 | Ga0207641_10298338 | Ga0207641_102983382 | 297 |
| 946 | 3300026089 | Ga0207648_10215753 | Ga0207648_102157532 | 297 |
| 947 | 3300026095 | Ga0207676_10244249 | Ga0207676_102442491 | 297 |
| 948 | 3300026116 | Ga0207674_10014693 | Ga0207674_100146933 | 297 |
| 949 | 3300026116 | Ga0207674_10195908 | Ga0207674_101959082 | 297 |
| 950 | 3300026118 | Ga0207675_100053073 | Ga0207675_1000530733 | 297 |
| 951 | 3300026118 | Ga0207675_100228366 | Ga0207675_1002283663 | 297 |
| 952 | 3300026118 | Ga0207675_100408817 | Ga0207675_1004088172 | 297 |
| 953 | 3300026121 | Ga0207683_10000020 | Ga0207683_1000002030 | 297 |
| 954 | 3300026121 | Ga0207683_10057745 | Ga0207683_100577452 | 297 |
| 955 | 3300026121 | Ga0207683_10123371 | Ga0207683_101233713 | 297 |
| 956 | 3300026121 | Ga0207683_10164091 | Ga0207683_101640913 | 297 |
| 957 | 3300026142 | Ga0207698_10046918 | Ga0207698_100469183 | 297 |
| 958 | 3300026142 | Ga0207698_10133811 | Ga0207698_101338111 | 297 |
| 959 | 3300026142 | Ga0207698_10197657 | Ga0207698_101976572 | 297 |
| 960 | 3300027296 | Ga0209389_1000051 | Ga0209389_100005166 | 297 |
| 961 | 3300027357 | Ga0209589_1000012 | Ga0209589_1000012141 | 297 |
| 962 | 3300027357 | Ga0209589_1000013 | Ga0209589_100001365 | 297 |
| 963 | 3300027361 | Ga0209489_100013 | Ga0209489_100013142 | 297 |
| 964 | 3300027866 | Ga0209813_10003733 | Ga0209813_100037332 | 297 |
| 965 | 3300027866 | Ga0209813_10004512 | Ga0209813_100045123 | 297 |
| 966 | 3300028379 | Ga0268266_10003057 | Ga0268266_1000305714 | 297 |
| 967 | 3300028379 | Ga0268266_10003873 | Ga0268266_100038736 | 297 |
| 968 | 3300028379 | Ga0268266_10161514 | Ga0268266_101615142 | 297 |
| 969 | 3300028380 | Ga0268265_10039034 | Ga0268265_100390344 | 297 |
| 970 | 3300028381 | Ga0268264_10000050 | Ga0268264_10000050203 | 297 |
| 971 | 3300028573 | Ga0265334_10009976 | Ga0265334_100099762 | 297 |
| 972 | 3300028577 | Ga0265318_10028345 | Ga0265318_100283451 | 297 |
| 973 | 3300028653 | Ga0265323_10000915 | Ga0265323_100009153 | 297 |
| 974 | 3300028666 | Ga0265336_10000355 | Ga0265336_1000035510 | 297 |
| 975 | 3300028786 | Ga0307517_10000008 | Ga0307517_10000008134 | 297 |
| 976 | 3300028786 | Ga0307517_10106896 | Ga0307517_101068963 | 297 |
| 977 | 3300028794 | Ga0307515_10157752 | Ga0307515_101577522 | 297 |
| 978 | 3300028800 | Ga0265338_10000256 | Ga0265338_1000025676 | 297 |
| 979 | 3300029957 | Ga0265324_10007574 | Ga0265324_100075742 | 297 |
| 980 | 3300030521 | Ga0307511_10074184 | Ga0307511_100741842 | 297 |
| 981 | 3300031247 | Ga0265340_10029663 | Ga0265340_100296632 | 297 |
| 982 | 3300031249 | Ga0265339_10001455 | Ga0265339_100014552 | 297 |
| 983 | 3300031456 | Ga0307513_10024502 | Ga0307513_100245028 | 297 |
| 984 | 3300031456 | Ga0307513_10106247 | Ga0307513_101062473 | 297 |
| 985 | 3300031507 | Ga0307509_10025858 | Ga0307509_100258584 | 297 |
| 986 | 3300031507 | Ga0307509_10037192 | Ga0307509_100371923 | 297 |
| 987 | 3300031507 | Ga0307509_10085801 | Ga0307509_100858013 | 297 |
| 988 | 3300031616 | Ga0307508_10000199 | Ga0307508_1000019936 | 297 |
| 989 | 3300031616 | Ga0307508_10025882 | Ga0307508_100258825 | 297 |
| 990 | 3300031616 | Ga0307508_10191074 | Ga0307508_101910742 | 297 |
| 991 | 3300031730 | Ga0307516_10014367 | Ga0307516_100143672 | 297 |
| 992 | 3300031730 | Ga0307516_10042849 | Ga0307516_100428493 | 297 |
| 993 | 3300031730 | Ga0307516_10104092 | Ga0307516_101040922 | 297 |
| 994 | 3300031730 | Ga0307516_10105246 | Ga0307516_101052462 | 297 |
| 995 | 3300031901 | Ga0307406_10283481 | Ga0307406_102834812 | 297 |
| 996 | 3300032005 | Ga0307411_10158656 | Ga0307411_101586562 | 297 |
| 997 | 3300033179 | Ga0307507_10139984 | Ga0307507_101399842 | 297 |
| 998 | 3300033180 | Ga0307510_10010134 | Ga0307510_100101347 | 297 |
| 999 | 3300033180 | Ga0307510_10011942 | Ga0307510_100119422 | 297 |
| 1000 | 3300033180 | Ga0307510_10038357 | Ga0307510_100383573 | 297 |
| 1001 | 3300033180 | Ga0307510_10104473 | Ga0307510_101044734 | 297 |
| 1002 | 3300033180 | Ga0307510_10232981 | Ga0307510_102329812 | 297 |
| 1003 | 3300035119 | Ga0373956_0034348 | Ga0373956_0034348_499_1392 | 297 |
| 1004 | 3300035120 | Ga0373957_0074036 | Ga0373957_0074036_410_1303 | 297 |
| 1005 | 3300035692 | Ga0373935_0189638 | Ga0373935_0189638_471_1364 | 297 |
| 1006 | 3300035695 | Ga0373927_0008680 | Ga0373927_0008680_233_1126 | 297 |
| 1007 | 3300035695 | Ga0373927_0019914 | Ga0373927_0019914_2791_3684 | 297 |
| 1008 | 3300035695 | Ga0373927_0093128 | Ga0373927_0093128_769_1701 | 297 |
| 1009 | 3300037068 | Ga0373925_0012149 | Ga0373925_0012149_261_1154 | 297 |
| 1010 | 3300037068 | Ga0373925_0322689 | Ga0373925_0322689_68_961 | 297 |
| 1011 | 3300037418 | Ga0395900_0380205 | Ga0395900_0380205_127_1020 | 297 |
| 1012 | 3300037471 | Ga0395905_0030027 | Ga0395905_0030027_1800_2693 | 297 |
| 1013 | 3300037471 | Ga0395905_0038103 | Ga0395905_0038103_2641_3534 | 297 |
| 1014 | 3300037853 | Ga0436364_1308571 | Ga0436364_1308571_2258_3193 | 297 |
| 1015 | 3300037853 | Ga0436364_1377077 | Ga0436364_1377077_502_1395 | 297 |
| 1016 | 3300038443 | Ga0395901_0182403 | Ga0395901_0182403_1241_2134 | 297 |
| 1017 | 3300039437 | Ga0436365_0468054 | Ga0436365_0468054_2289_3182 | 297 |
| 1018 | 3300039437 | Ga0436365_0508557 | Ga0436365_0508557_531_1469 | 297 |
| 1019 | 3300039437 | Ga0436365_0553610 | Ga0436365_0553610_1386_2279 | 297 |
| 1020 | 3300039437 | Ga0436365_1117592 | Ga0436365_1117592_661_1554 | 297 |
| 1021 | 3300039437 | Ga0436365_1191157 | Ga0436365_1191157_38_931 | 297 |
| 1022 | 3300039438 | Ga0436360_0310240 | Ga0436360_0310240_647_1576 | 297 |
| 1023 | 3300039447 | Ga0436361_0085496 | Ga0436361_0085496_847_1740 | 297 |
| 1024 | 3300039450 | Ga0436363_0876054 | Ga0436363_0876054_228_1121 | 297 |
| 1025 | 3300039450 | Ga0436363_1243528 | Ga0436363_1243528_1180_2073 | 297 |
| 1026 | 3300039453 | Ga0436362_0666995 | Ga0436362_0666995_2087_2980 | 297 |
| 1027 | 3300041411 | Ga0439466_0030058 | Ga0439466_0030058_177_1070 | 297 |
| 1028 | 3300041413 | Ga0439465_0000416 | Ga0439465_0000416_2521_3414 | 297 |
| 1029 | 3300041496 | Ga0451839_1153228 | Ga0451839_1153228_506_1399 | 297 |
| 1030 | 3300041507 | Ga0451851_1104365 | Ga0451851_1104365_701_1594 | 297 |
| 1031 | 3300041512 | Ga0451853_1561911 | Ga0451853_1561911_7859_8752 | 297 |
| 1032 | 3300042007 | Ga0439449_0060430 | Ga0439449_0060430_194_1087 | 297 |
| 1033 | 3300042015 | Ga0439462_0034116 | Ga0439462_0034116_123_1016 | 297 |
| 1034 | 3300044656 | Ga0466969_0067369 | Ga0466969_0067369_750_1643 | 297 |
| 1035 | 3300044658 | Ga0466972_0000059 | Ga0466972_0000059_20275_21168 | 297 |
| 1036 | 3300044658 | Ga0466972_0032827 | Ga0466972_0032827_997_1890 | 297 |
| 1037 | 3300044658 | Ga0466972_0120294 | Ga0466972_0120294_96_989 | 297 |
| 1038 | 3300044683 | Ga0466965_0086877 | Ga0466965_0086877_26_919 | 297 |
| 1039 | 3300044684 | Ga0466966_0004126 | Ga0466966_0004126_7133_8026 | 297 |
| 1040 | 3300044693 | Ga0466961_0000019 | Ga0466961_0000019_55118_56011 | 297 |
| 1041 | 3300044706 | Ga0466964_0081393 | Ga0466964_0081393_154_1047 | 297 |
| 1042 | 3300044765 | Ga0466970_0113948 | Ga0466970_0113948_518_1411 | 297 |
| 1043 | 3300044842 | Ga0466957_0021158 | Ga0466957_0021158_2496_3389 | 297 |
| 1044 | 3300044901 | Ga0466960_0044563 | Ga0466960_0044563_776_1669 | 297 |
| 1045 | 3300044901 | Ga0466960_0194016 | Ga0466960_0194016_167_1060 | 297 |
| 1046 | 3300045049 | Ga0466959_0008440 | Ga0466959_0008440_2653_3546 | 297 |
| 1047 | 3300046452 | Ga0495617_020512 | Ga0495617_020512_1260_2153 | 297 |
| 1048 | 3300046454 | Ga0495592_0011643 | Ga0495592_0011643_294_1187 | 297 |
| 1049 | 3300046454 | Ga0495592_0036556 | Ga0495592_0036556_2598_3491 | 297 |
| 1050 | 3300046455 | Ga0495603_0005987 | Ga0495603_0005987_3375_4268 | 297 |
| 1051 | 3300046459 | Ga0495629_0005134 | Ga0495629_0005134_7646_8539 | 297 |
| 1052 | 3300046459 | Ga0495629_0067398 | Ga0495629_0067398_160_1053 | 297 |
| 1053 | 3300046461 | Ga0495641_0046899 | Ga0495641_0046899_731_1624 | 297 |
| 1054 | 3300046462 | Ga0495651_0044564 | Ga0495651_0044564_390_1283 | 297 |
| 1055 | 3300046462 | Ga0495651_0050445 | Ga0495651_0050445_33_926 | 297 |
| 1056 | 3300046462 | Ga0495651_0073110 | Ga0495651_0073110_1475_2368 | 297 |
| 1057 | 3300046463 | Ga0495653_0055671 | Ga0495653_0055671_1822_2715 | 297 |
| 1058 | 3300046473 | Ga0495582_0073037 | Ga0495582_0073037_886_1779 | 297 |
| 1059 | 3300046473 | Ga0495582_0084329 | Ga0495582_0084329_323_1216 | 297 |
| 1060 | 3300046476 | Ga0495662_0055337 | Ga0495662_0055337_252_1145 | 297 |
| 1061 | 3300046477 | Ga0495664_0020161 | Ga0495664_0020161_2797_3690 | 297 |
| 1062 | 3300046477 | Ga0495664_0104039 | Ga0495664_0104039_516_1409 | 297 |
| 1063 | 3300046491 | Ga0495584_0148627 | Ga0495584_0148627_161_1054 | 297 |
| 1064 | 3300046500 | Ga0495596_0110807 | Ga0495596_0110807_122_1015 | 297 |
| 1065 | 3300046506 | Ga0495583_0005356 | Ga0495583_0005356_21_914 | 297 |
| 1066 | 3300046507 | Ga0495606_0076479 | Ga0495606_0076479_287_1180 | 297 |
| 1067 | 3300046511 | Ga0495608_0050502 | Ga0495608_0050502_1204_2097 | 297 |
| 1068 | 3300046512 | Ga0495610_0085517 | Ga0495610_0085517_17_910 | 297 |
| 1069 | 3300046513 | Ga0495616_0062178 | Ga0495616_0062178_170_1063 | 297 |
| 1070 | 3300046513 | Ga0495616_0084295 | Ga0495616_0084295_133_1026 | 297 |
| 1071 | 3300046514 | Ga0495618_0019213 | Ga0495618_0019213_145_1038 | 297 |
| 1072 | 3300046515 | Ga0495620_0024339 | Ga0495620_0024339_14_907 | 297 |
| 1073 | 3300046516 | Ga0495628_0113209 | Ga0495628_0113209_1097_1990 | 297 |
| 1074 | 3300046516 | Ga0495628_0245187 | Ga0495628_0245187_132_1025 | 297 |
| 1075 | 3300046522 | Ga0495643_0010133 | Ga0495643_0010133_900_1793 | 297 |
| 1076 | 3300046522 | Ga0495643_0167823 | Ga0495643_0167823_135_1028 | 297 |
| 1077 | 3300046524 | Ga0495648_0001886 | Ga0495648_0001886_237_1130 | 297 |
| 1078 | 3300046524 | Ga0495648_0005722 | Ga0495648_0005722_4726_5619 | 297 |
| 1079 | 3300046524 | Ga0495648_0051065 | Ga0495648_0051065_1416_2309 | 297 |
| 1080 | 3300046524 | Ga0495648_0146645 | Ga0495648_0146645_40_933 | 297 |
| 1081 | 3300046529 | Ga0495652_0067434 | Ga0495652_0067434_122_1015 | 297 |
| 1082 | 3300046529 | Ga0495652_0203825 | Ga0495652_0203825_201_1094 | 297 |
| 1083 | 3300046533 | Ga0495640_0032096 | Ga0495640_0032096_205_1098 | 297 |
| 1084 | 3300046533 | Ga0495640_0036214 | Ga0495640_0036214_2515_3408 | 297 |
| 1085 | 3300046535 | Ga0495586_0094291 | Ga0495586_0094291_338_1231 | 297 |
| 1086 | 3300046536 | Ga0495587_0059363 | Ga0495587_0059363_501_1394 | 297 |
| 1087 | 3300046536 | Ga0495587_0064738 | Ga0495587_0064738_1051_1944 | 297 |
| 1088 | 3300046537 | Ga0495598_0005511 | Ga0495598_0005511_1631_2524 | 297 |
| 1089 | 3300046538 | Ga0495609_0136275 | Ga0495609_0136275_112_1005 | 297 |
| 1090 | 3300046543 | Ga0495645_0040362 | Ga0495645_0040362_39_932 | 297 |
| 1091 | 3300046543 | Ga0495645_0211969 | Ga0495645_0211969_354_1247 | 297 |
| 1092 | 3300046557 | Ga0495622_0012185 | Ga0495622_0012185_864_1757 | 297 |
| 1093 | 3300046557 | Ga0495622_0113256 | Ga0495622_0113256_294_1187 | 297 |
| 1094 | 3300046558 | Ga0495633_0065431 | Ga0495633_0065431_742_1635 | 297 |
| 1095 | 3300046559 | Ga0495667_0097976 | Ga0495667_0097976_612_1505 | 297 |
| 1096 | 3300046615 | Ga0495656_0022409 | Ga0495656_0022409_895_1788 | 297 |
| 1097 | 3300046642 | Ga0495634_0083804 | Ga0495634_0083804_728_1621 | 297 |
| 1098 | 3300046648 | Ga0495611_0044990 | Ga0495611_0044990_543_1436 | 297 |
| 1099 | 3300046660 | Ga0495625_0218136 | Ga0495625_0218136_170_1087 | 297 |
| 1100 | 3300046663 | Ga0495635_0051422 | Ga0495635_0051422_1377_2270 | 297 |
| 1101 | 3300046663 | Ga0495635_0077632 | Ga0495635_0077632_395_1288 | 297 |
| 1102 | 3300046674 | Ga0495588_0178366 | Ga0495588_0178366_213_1106 | 297 |
| 1103 | 3300046675 | Ga0495657_0012692 | Ga0495657_0012692_3628_4521 | 297 |
| 1104 | 3300046675 | Ga0495657_0041190 | Ga0495657_0041190_476_1369 | 297 |
| 1105 | 3300046679 | Ga0495623_0050801 | Ga0495623_0050801_1591_2484 | 297 |
| 1106 | 3300046680 | Ga0495646_0035399 | Ga0495646_0035399_284_1177 | 297 |
| 1107 | 3300046689 | Ga0495613_0116726 | Ga0495613_0116726_28_921 | 297 |
| 1108 | 3300046694 | Ga0495649_0025331 | Ga0495649_0025331_163_1056 | 297 |
| 1109 | 3300046809 | Ga0495600_0009700 | Ga0495600_0009700_1445_2338 | 297 |
| 1110 | 3300046809 | Ga0495600_0145471 | Ga0495600_0145471_308_1201 | 297 |
| 1111 | 3300047315 | Ga0495581_0061716 | Ga0495581_0061716_821_1714 | 297 |
| 1112 | 3300047317 | Ga0495604_0002141 | Ga0495604_0002141_7309_8202 | 297 |
| 1113 | 3300047317 | Ga0495604_0019923 | Ga0495604_0019923_208_1101 | 297 |
| 1114 | 3300047319 | Ga0495674_0066042 | Ga0495674_0066042_1392_2285 | 297 |
| 1115 | 3300047321 | Ga0495676_0024811 | Ga0495676_0024811_240_1133 | 297 |
| 1116 | 3300047322 | Ga0495680_0027624 | Ga0495680_0027624_672_1565 | 297 |
| 1117 | 3300047322 | Ga0495680_0215015 | Ga0495680_0215015_422_1315 | 297 |
| 1118 | 3300047443 | Ga0495687_002149 | Ga0495687_002149_8428_9321 | 297 |
| 1119 | 3300047443 | Ga0495687_010566 | Ga0495687_010566_896_1789 | 297 |
| 1120 | 3300047444 | Ga0495675_0042893 | Ga0495675_0042893_1239_2132 | 297 |
| 1121 | 3300047444 | Ga0495675_0133697 | Ga0495675_0133697_56_949 | 297 |
| 1122 | 3300047471 | Ga0495684_0051066 | Ga0495684_0051066_35_928 | 297 |
| 1123 | 3300047471 | Ga0495684_0075441 | Ga0495684_0075441_354_1247 | 297 |
| 1124 | 3300047472 | Ga0495686_0090972 | Ga0495686_0090972_468_1361 | 297 |
| 1125 | 3300048088 | Ga0495602_0068174 | Ga0495602_0068174_95_988 | 297 |
| 1126 | 3300048088 | Ga0495602_0107284 | Ga0495602_0107284_1109_2002 | 297 |
| 1127 | 3300048089 | Ga0495614_0032295 | Ga0495614_0032295_660_1553 | 297 |
| 1128 | 3300048905 | Ga0496102_0030482 | Ga0496102_0030482_2544_3437 | 297 |
| 1129 | 3300048906 | Ga0496103_0035888 | Ga0496103_0035888_1901_2794 | 297 |
| 1130 | 3300048906 | Ga0496103_0244433 | Ga0496103_0244433_15_908 | 297 |
| 1131 | 3300048907 | Ga0496104_0056959 | Ga0496104_0056959_1116_2009 | 297 |
| 1132 | 3300048907 | Ga0496104_0069858 | Ga0496104_0069858_1700_2593 | 297 |
| 1133 | 3300048907 | Ga0496104_0197631 | Ga0496104_0197631_50_943 | 297 |
| 1134 | 3300048907 | Ga0496104_0305410 | Ga0496104_0305410_408_1301 | 297 |
| 1135 | 3300048908 | Ga0496105_0006073 | Ga0496105_0006073_937_1830 | 297 |
| 1136 | 3300048908 | Ga0496105_0011341 | Ga0496105_0011341_3815_4708 | 297 |
| 1137 | 3300048908 | Ga0496105_0087290 | Ga0496105_0087290_1157_2050 | 297 |
| 1138 | 3300048909 | Ga0496106_0001404 | Ga0496106_0001404_484_1377 | 297 |
| 1139 | 3300048910 | Ga0496107_0038761 | Ga0496107_0038761_916_1809 | 297 |
| 1140 | 3300048910 | Ga0496107_0192181 | Ga0496107_0192181_467_1360 | 297 |
| 1141 | 3300048910 | Ga0496107_0278034 | Ga0496107_0278034_56_949 | 297 |
| 1142 | 3300048911 | Ga0496108_0108415 | Ga0496108_0108415_1342_2235 | 297 |
| 1143 | 3300048911 | Ga0496108_0148025 | Ga0496108_0148025_887_1780 | 297 |
| 1144 | 3300048912 | Ga0496109_0068715 | Ga0496109_0068715_825_1718 | 297 |
| 1145 | 3300048912 | Ga0496109_0073155 | Ga0496109_0073155_1040_1933 | 297 |
| 1146 | 3300048912 | Ga0496109_0149085 | Ga0496109_0149085_717_1610 | 297 |
| 1147 | 3300048913 | Ga0496110_0021410 | Ga0496110_0021410_3980_4873 | 297 |
| 1148 | 3300048913 | Ga0496110_0070703 | Ga0496110_0070703_1404_2297 | 297 |
| 1149 | 3300048913 | Ga0496110_0110320 | Ga0496110_0110320_577_1470 | 297 |
| 1150 | 3300048914 | Ga0496111_0158048 | Ga0496111_0158048_353_1246 | 297 |
| 1151 | 3300048915 | Ga0496112_0012206 | Ga0496112_0012206_5674_6567 | 297 |
| 1152 | 3300048915 | Ga0496112_0124135 | Ga0496112_0124135_925_1818 | 297 |
| 1153 | 3300048915 | Ga0496112_0216012 | Ga0496112_0216012_406_1299 | 297 |
| 1154 | 3300048916 | Ga0496113_0022393 | Ga0496113_0022393_238_1131 | 297 |
| 1155 | 3300048916 | Ga0496113_0046768 | Ga0496113_0046768_1897_2790 | 297 |
| 1156 | 3300048918 | Ga0496115_0012154 | Ga0496115_0012154_1557_2450 | 297 |
| 1157 | 3300048919 | Ga0496116_0062415 | Ga0496116_0062415_783_1676 | 297 |
| 1158 | 3300048919 | Ga0496116_0109841 | Ga0496116_0109841_178_1071 | 297 |
| 1159 | 3300048919 | Ga0496116_0187960 | Ga0496116_0187960_79_972 | 297 |
| 1160 | 3300048920 | Ga0496117_0000277 | Ga0496117_0000277_79200_80093 | 297 |
| 1161 | 3300048920 | Ga0496117_0002266 | Ga0496117_0002266_19212_20105 | 297 |
| 1162 | 3300048920 | Ga0496117_0024305 | Ga0496117_0024305_3787_4680 | 297 |
| 1163 | 3300048921 | Ga0496118_0003433 | Ga0496118_0003433_10717_11610 | 297 |
| 1164 | 3300048921 | Ga0496118_0004387 | Ga0496118_0004387_13479_14372 | 297 |
| 1165 | 3300048921 | Ga0496118_0059074 | Ga0496118_0059074_1945_2838 | 297 |
| 1166 | 3300048921 | Ga0496118_0082241 | Ga0496118_0082241_269_1162 | 297 |
| 1167 | 3300048921 | Ga0496118_0151894 | Ga0496118_0151894_68_961 | 297 |
| 1168 | 3300048922 | Ga0496119_0006742 | Ga0496119_0006742_8553_9446 | 297 |
| 1169 | 3300048923 | Ga0496120_0002184 | Ga0496120_0002184_14526_15419 | 297 |
| 1170 | 3300048923 | Ga0496120_0015798 | Ga0496120_0015798_1833_2726 | 297 |
| 1171 | 3300048923 | Ga0496120_0023914 | Ga0496120_0023914_2804_3697 | 297 |
| 1172 | 3300048924 | Ga0496121_0008110 | Ga0496121_0008110_5830_6723 | 297 |
| 1173 | 3300048924 | Ga0496121_0011953 | Ga0496121_0011953_229_1146 | 297 |
| 1174 | 3300048924 | Ga0496121_0030834 | Ga0496121_0030834_2376_3269 | 297 |
| 1175 | 3300048924 | Ga0496121_0039649 | Ga0496121_0039649_1133_2026 | 297 |
| 1176 | 3300048924 | Ga0496121_0138623 | Ga0496121_0138623_636_1529 | 297 |
| 1177 | 3300048924 | Ga0496121_0178998 | Ga0496121_0178998_352_1245 | 297 |
| 1178 | 3300048925 | Ga0496122_0000193 | Ga0496122_0000193_12059_12952 | 297 |
| 1179 | 3300048925 | Ga0496122_0000565 | Ga0496122_0000565_11241_12134 | 297 |
| 1180 | 3300048926 | Ga0496123_0000154 | Ga0496123_0000154_12059_12952 | 297 |
| 1181 | 3300048926 | Ga0496123_0000247 | Ga0496123_0000247_96078_96971 | 297 |
| 1182 | 3300048926 | Ga0496123_0140567 | Ga0496123_0140567_194_1087 | 297 |
| 1183 | 3300048927 | Ga0496124_0000236 | Ga0496124_0000236_56947_57840 | 297 |
| 1184 | 3300048927 | Ga0496124_0001021 | Ga0496124_0001021_27343_28236 | 297 |
| 1185 | 3300048927 | Ga0496124_0001147 | Ga0496124_0001147_1681_2574 | 297 |
| 1186 | 3300048927 | Ga0496124_0016756 | Ga0496124_0016756_5560_6453 | 297 |
| 1187 | 3300048927 | Ga0496124_0034562 | Ga0496124_0034562_1991_2884 | 297 |
| 1188 | 3300048927 | Ga0496124_0075314 | Ga0496124_0075314_1728_2621 | 297 |
| 1189 | 3300048927 | Ga0496124_0099656 | Ga0496124_0099656_1293_2186 | 297 |
| 1190 | 3300048927 | Ga0496124_0172527 | Ga0496124_0172527_122_1018 | 297 |
| 1191 | 3300048928 | Ga0496125_0000161 | Ga0496125_0000161_130207_131100 | 297 |
| 1192 | 3300048928 | Ga0496125_0015436 | Ga0496125_0015436_6247_7140 | 297 |
| 1193 | 3300048928 | Ga0496125_0075584 | Ga0496125_0075584_1680_2573 | 297 |
| 1194 | 3300048928 | Ga0496125_0102752 | Ga0496125_0102752_1152_2045 | 297 |
| 1195 | 3300048928 | Ga0496125_0110972 | Ga0496125_0110972_449_1342 | 297 |
| 1196 | 3300048928 | Ga0496125_0240530 | Ga0496125_0240530_110_1003 | 297 |
| 1197 | 3300048929 | Ga0496126_0014738 | Ga0496126_0014738_480_1373 | 297 |
| 1198 | 3300048929 | Ga0496126_0060024 | Ga0496126_0060024_1725_2618 | 297 |
| 1199 | 3300048929 | Ga0496126_0130319 | Ga0496126_0130319_424_1317 | 297 |
| 1200 | 3300048929 | Ga0496126_0298274 | Ga0496126_0298274_316_1209 | 297 |
| 1201 | 3300048929 | Ga0496126_0315954 | Ga0496126_0315954_379_1272 | 297 |
| 1202 | 3300048929 | Ga0496126_0386751 | Ga0496126_0386751_122_1015 | 297 |
| 1203 | 3300049571 | Ga0501034_0452686 | Ga0501034_0452686_232_1125 | 297 |
| 1204 | 3300049573 | Ga0501037_0048371 | Ga0501037_0048371_1220_2113 | 297 |
| 1205 | 3300049580 | Ga0501046_0062816 | Ga0501046_0062816_867_1760 | 297 |
| 1206 | 3300049581 | Ga0501047_0049231 | Ga0501047_0049231_178_1071 | 297 |
| 1207 | 3300049586 | Ga0501070_0047575 | Ga0501070_0047575_2484_3377 | 297 |
| 1208 | 3300049589 | Ga0501073_0009876 | Ga0501073_0009876_2818_3750 | 297 |
| 1209 | 3300049589 | Ga0501073_0038802 | Ga0501073_0038802_2312_3205 | 297 |
| 1210 | 3300049742 | Ga0501080_0045179 | Ga0501080_0045179_1253_2146 | 297 |
| 1211 | 3300050489 | nmdc:mga03683_5518_c1 | nmdc:mga03683_5518_c1_708_1601 | 297 |
| 1212 | 3300050489 | nmdc:mga03683_75217_c1 | nmdc:mga03683_75217_c1_362_1255 | 297 |
| 1213 | 3300050490 | nmdc:mga03n38_18736_c1 | nmdc:mga03n38_18736_c1_1402_2295 | 297 |
| 1214 | 3300050491 | nmdc:mga00v17_23153_c1 | nmdc:mga00v17_23153_c1_744_1637 | 297 |
| 1215 | 3300050491 | nmdc:mga00v17_44461_c1 | nmdc:mga00v17_44461_c1_743_1636 | 297 |
| 1216 | 3300050491 | nmdc:mga00v17_59654_c1 | nmdc:mga00v17_59654_c1_1088_1981 | 297 |
| 1217 | 3300050492 | nmdc:mga0yw44_128062_c1 | nmdc:mga0yw44_128062_c1_531_1424 | 297 |
| 1218 | 3300050492 | nmdc:mga0yw44_134939_c1 | nmdc:mga0yw44_134939_c1_298_1191 | 297 |
| 1219 | 3300050492 | nmdc:mga0yw44_1376_c1 | nmdc:mga0yw44_1376_c1_900_1793 | 297 |
| 1220 | 3300050492 | nmdc:mga0yw44_14033_c1 | nmdc:mga0yw44_14033_c1_3230_4123 | 297 |
| 1221 | 3300050492 | nmdc:mga0yw44_243628_c1 | nmdc:mga0yw44_243628_c1_261_1154 | 297 |
| 1222 | 3300050492 | nmdc:mga0yw44_58912_c1 | nmdc:mga0yw44_58912_c1_892_1785 | 297 |
| 1223 | 3300050492 | nmdc:mga0yw44_8393_c1 | nmdc:mga0yw44_8393_c1_3244_4137 | 297 |
| 1224 | 3300050492 | nmdc:mga0yw44_9233_c1 | nmdc:mga0yw44_9233_c1_1528_2421 | 297 |
| 1225 | 3300050493 | nmdc:mga0k408_5011_c1 | nmdc:mga0k408_5011_c1_4303_5196 | 297 |
| 1226 | 3300050493 | nmdc:mga0k408_61175_c1 | nmdc:mga0k408_61175_c1_374_1267 | 297 |
| 1227 | 3300050494 | nmdc:mga06z11_12549_c1 | nmdc:mga06z11_12549_c1_2147_3040 | 297 |
| 1228 | 3300050495 | nmdc:mga04h51_21042_c1 | nmdc:mga04h51_21042_c1_501_1394 | 297 |
| 1229 | 3300050496 | nmdc:mga07m45_27724_c1 | nmdc:mga07m45_27724_c1_102_995 | 297 |
| 1230 | 3300050496 | nmdc:mga07m45_56175_c1 | nmdc:mga07m45_56175_c1_109_1002 | 297 |
| 1231 | 3300050496 | nmdc:mga07m45_5693_c1 | nmdc:mga07m45_5693_c1_3594_4487 | 297 |
| 1232 | 3300050496 | nmdc:mga07m45_63177_c1 | nmdc:mga07m45_63177_c1_956_1849 | 297 |
| 1233 | 3300050507 | nmdc:mga05p37_37093_c1 | nmdc:mga05p37_37093_c1_1346_2239 | 297 |
| 1234 | 3300050507 | nmdc:mga05p37_76186_c1 | nmdc:mga05p37_76186_c1_1759_2652 | 297 |
| 1235 | 3300050508 | nmdc:mga09592_252008_c1 | nmdc:mga09592_252008_c1_170_1063 | 297 |
| 1236 | 3300050509 | nmdc:mga0qj67_128197_c1 | nmdc:mga0qj67_128197_c1_862_1758 | 297 |
| 1237 | 3300050511 | nmdc:mga08y16_295955_c1 | nmdc:mga08y16_295955_c1_154_1047 | 297 |
| 1238 | 3300050512 | nmdc:mga0n895_310876_c1 | nmdc:mga0n895_310876_c1_555_1448 | 297 |
| 1239 | 3300050516 | nmdc:mga0sz30_24814_c1 | nmdc:mga0sz30_24814_c1_366_1259 | 297 |
| 1240 | 3300050516 | nmdc:mga0sz30_278_c1 | nmdc:mga0sz30_278_c1_2466_3359 | 297 |
| 1241 | 3300050516 | nmdc:mga0sz30_68390_c1 | nmdc:mga0sz30_68390_c1_249_1142 | 297 |
| 1242 | 3300053077 | Ga0495601_0033668 | Ga0495601_0033668_1948_2841 | 297 |
| 1243 | 3300053077 | Ga0495601_0254896 | Ga0495601_0254896_220_1113 | 297 |
| 1244 | 3300053085 | Ga0495619_0015343 | Ga0495619_0015343_1202_2095 | 297 |
| 1245 | 3300053085 | Ga0495619_0099557 | Ga0495619_0099557_1048_1941 | 297 |
| 1246 | 3300053087 | Ga0500643_000163 | Ga0500643_000163_41817_42710 | 297 |
| 1247 | 3300053092 | Ga0500583_0097375 | Ga0500583_0097375_134_1027 | 297 |
| 1248 | 3300053093 | Ga0500651_0066570 | Ga0500651_0066570_550_1443 | 297 |
| 1249 | 3300053094 | Ga0500566_0000224 | Ga0500566_0000224_8214_9107 | 297 |
| 1250 | 3300053094 | Ga0500566_0132919 | Ga0500566_0132919_118_1011 | 297 |
| 1251 | 3300053094 | Ga0500566_0164054 | Ga0500566_0164054_109_1002 | 297 |
| 1252 | 3300053095 | Ga0500640_018898 | Ga0500640_018898_423_1316 | 297 |
| 1253 | 3300053103 | Ga0500555_007778 | Ga0500555_007778_1462_2355 | 297 |
| 1254 | 3300053104 | Ga0500556_0003912 | Ga0500556_0003912_1480_2373 | 297 |
| 1255 | 3300053104 | Ga0500556_0059304 | Ga0500556_0059304_441_1334 | 297 |
| 1256 | 3300053104 | Ga0500556_0084171 | Ga0500556_0084171_229_1122 | 297 |
| 1257 | 3300053105 | Ga0500557_000051 | Ga0500557_000051_28510_29403 | 297 |
| 1258 | 3300053109 | Ga0500569_013543 | Ga0500569_013543_1058_1951 | 297 |
| 1259 | 3300053109 | Ga0500569_029359 | Ga0500569_029359_485_1378 | 297 |
| 1260 | 3300053109 | Ga0500569_082566 | Ga0500569_082566_60_953 | 297 |
| 1261 | 3300053111 | Ga0500572_001212 | Ga0500572_001212_6406_7299 | 297 |
| 1262 | 3300053118 | Ga0500594_0071004 | Ga0500594_0071004_26_943 | 297 |
| 1263 | 3300053119 | Ga0500595_012448 | Ga0500595_012448_914_1807 | 297 |
| 1264 | 3300053119 | Ga0500595_012813 | Ga0500595_012813_2246_3139 | 297 |
| 1265 | 3300053119 | Ga0500595_021746 | Ga0500595_021746_1379_2272 | 297 |
| 1266 | 3300053122 | Ga0500608_041925 | Ga0500608_041925_211_1128 | 297 |
| 1267 | 3300053130 | Ga0500642_0000117 | Ga0500642_0000117_26953_27846 | 297 |
| 1268 | 3300053136 | Ga0500559_0000250 | Ga0500559_0000250_32659_33552 | 297 |
| 1269 | 3300053136 | Ga0500559_0031178 | Ga0500559_0031178_491_1384 | 297 |
| 1270 | 3300053136 | Ga0500559_0072589 | Ga0500559_0072589_46_939 | 297 |
| 1271 | 3300053137 | Ga0500561_0000084 | Ga0500561_0000084_16347_17240 | 297 |
| 1272 | 3300053140 | Ga0500573_0133858 | Ga0500573_0133858_271_1164 | 297 |
| 1273 | 3300053153 | Ga0500616_0019339 | Ga0500616_0019339_20_913 | 297 |
| 1274 | 3300053153 | Ga0500616_0031035 | Ga0500616_0031035_1658_2551 | 297 |
| 1275 | 3300053153 | Ga0500616_0034643 | Ga0500616_0034643_1061_1978 | 297 |
| 1276 | 3300053156 | Ga0500622_0009036 | Ga0500622_0009036_1777_2670 | 297 |
| 1277 | 3300053156 | Ga0500622_0014416 | Ga0500622_0014416_1302_2222 | 297 |
| 1278 | 3300053156 | Ga0500622_0104616 | Ga0500622_0104616_278_1171 | 297 |
| 1279 | 3300053158 | Ga0500627_0033852 | Ga0500627_0033852_148_1041 | 297 |
| 1280 | 3300053158 | Ga0500627_0181309 | Ga0500627_0181309_44_937 | 297 |
| 1281 | 3300053162 | Ga0500638_133022 | Ga0500638_133022_13_906 | 297 |
| 1282 | 3300053177 | Ga0500636_0000330 | Ga0500636_0000330_16055_16954 | 297 |
| 1283 | 3300053177 | Ga0500636_0031687 | Ga0500636_0031687_495_1412 | 297 |
| 1284 | 3300053177 | Ga0500636_0038369 | Ga0500636_0038369_867_1760 | 297 |
| 1285 | 3300053177 | Ga0500636_0084416 | Ga0500636_0084416_890_1783 | 297 |
| 1286 | 3300053722 | Ga0500649_027676 | Ga0500649_027676_367_1260 | 297 |
| 1287 | 3300053729 | Ga0500625_036574 | Ga0500625_036574_1280_2173 | 297 |
| 1288 | 3300053733 | Ga0500552_005773 | Ga0500552_005773_341_1234 | 297 |
| 1289 | 3300053735 | Ga0500596_001865 | Ga0500596_001865_904_1797 | 297 |
| 1290 | 3300053736 | Ga0500599_000188 | Ga0500599_000188_4008_4901 | 297 |
| 1291 | 3300053737 | Ga0500601_000943 | Ga0500601_000943_1059_1952 | 297 |
| 1292 | iso_pu_bacteria | 2643221605 | 2644041060 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tmx-assembly1.cif.gz_B | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.9197 | 6 | 287 |
| 1tmx-assembly1.cif.gz_A | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.9168 | 6 | 287 |
| 1tmx-assembly1.cif.gz_B | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.8891 | 6 | 287 |
| 3n9t-assembly1.cif.gz_A-2 | cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4 | 0.886 | 6 | 287 |
| 1tmx-assembly1.cif.gz_A | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.8808 | 6 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tmxA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.9168 | 6 | 287 | 2.60.130.10 |
| af_P86029_1_299_2.60.130.10 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.9097 | 7 | 286 | 2.60.130.10 |
| af_Q59Z18_7_293_2.60.130.10 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8963 | 1 | 284 | 2.60.130.10 |
| 3hhyA02 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8917 | 97 | 287 | 2.60.130.10 |
| 3n9tA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.886 | 6 | 287 | 2.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E8VIE8-F1-model_v4 | Catechol 1,2-dioxygenase | 0.9888 | 1 | 297 |
GO:0008199
GO:0009712 GO:0018576 |
| AF-A0A7W5KI92-F1-model_v4 | deleted | 0.9886 | 33 | 297 |
|
| AF-A5VH88-F1-model_v4 | deleted | 0.9838 | 2 | 297 |
|
| AF-A0A7W5KI92-F1-model_v4 | deleted | 0.9813 | 33 | 297 |
|
| AF-A5VH88-F1-model_v4 | deleted | 0.9805 | 2 | 297 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar