F492632

General Info

Members Datasets Scaffolds Average Seq Length
1290 465 1252 318

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0313049|Ga0501047_0313049_159_1328
Length 389
Sequence MRALGLGGGVRRSRKQLYCRKSLNRIQVEIRKAWQGFLNFCRPSFVDSTEPFGHFPGPFGFYCQDPFRKVAMHAYLDFEKPIAELEGKIVELRQLAANDPTMEIDSDVARLQSKADALVRDTYAKLTPWQKVQVARHQNRPHFSDYVNHLIDEFTPLAGDRLYGEDAAVIAGLGRFRGRAVAVVGQEKGNDTKSRLKHNFGMAMPEGYRKAQRLFDMADRFGLPVLSLVDTSGAYPGVSAEERGQSEAIARSTQAGLELRVPFVCTIIGDGMSGGAIAIAAANRVYMLEHSIYSVISPEGCASILWRNADKAQDAATALKITAQDLLDLKIIDGIVSEPVGGAHRAPQEAIMNAGEQIAKALAELSSLSGDELRRQRREKFLAMGRNLV

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
5 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
6 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
7 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
8 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
9 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
10 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
11 2818991467 Bosea vestrisii 3192 Isolate Unclassified
12 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
13 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
14 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
15 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
16 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
17 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
18 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
19 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
20 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
21 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
22 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
23 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
24 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
25 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
26 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
27 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
28 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
29 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
30 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
31 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
32 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
33 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
162 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
163 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
280 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
283 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
286 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
287 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
293 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
294 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
295 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
296 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
297 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
298 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
374 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
378 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
424 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
425 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
428 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
435 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
436 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
437 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
438 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
439 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
440 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
441 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
442 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
443 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
444 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
445 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
446 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
447 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
448 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
449 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
450 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
451 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
452 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
453 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
454 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
455 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
460 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
461 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
462 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
463 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
464 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
465 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0.23
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 6.51
Nodule 0.16
Rhizoplane 3.41
Rhizosphere 85.04
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000201 3300001904 Bacteria 10736
2 JGI24741J21665_1001549 3300001915 Bacteria 6501
3 JGI24739J22299_10018850 3300001989 Bacteria 2475
4 JGI24738J21930_10013641 3300002075 Bacteria 1753
5 JGI25150J39212_1000340 3300002774 Bacteria 23053
6 JGI25406J46586_10002125 3300003203 Bacteria 9358
7 JGI25406J46586_10004558 3300003203 Bacteria 6449
8 rootH2_10006377 3300003320 Bacteria 60685
9 rootH2_10013646 3300003320 Bacteria 13171
10 JGI25407J50210_10033264 3300003373 Bacteria 1331
11 Ga0055526_1002614 3300003771 Bacteria 12040
12 Ga0055524_1000205 3300003775 Bacteria 64186
13 Ga0055524_1009309 3300003775 Bacteria 4010
14 Ga0055530_10039828 3300003791 Bacteria 1158
15 Ga0065165_1003151 3300005262 Bacteria 12160
16 Ga0065712_10088759 3300005290 Bacteria 2503
17 Ga0070658_10000379 3300005327 Bacteria 38762
18 Ga0070658_10000629 3300005327 Bacteria 30443
19 Ga0070658_10001363 3300005327 Bacteria 20879
20 Ga0070658_10001797 3300005327 Bacteria 18034
21 Ga0070658_10004427 3300005327 Bacteria 11443
22 Ga0070658_10004769 3300005327 Bacteria 11028
23 Ga0070658_10263739 3300005327 Bacteria 1463
24 Ga0070683_100018947 3300005329 Bacteria 6106
25 Ga0070683_100190337 3300005329 Bacteria 1948
26 Ga0070690_100000750 3300005330 Bacteria 16607
27 Ga0070670_100042476 3300005331 Bacteria 3908
28 Ga0068869_100069402 3300005334 Bacteria 2605
29 Ga0068869_100086347 3300005334 Bacteria 2352
30 Ga0070666_10090471 3300005335 Bacteria 2102
31 Ga0070680_100000533 3300005336 Bacteria 25986
32 Ga0070680_100001991 3300005336 Bacteria 15033
33 Ga0070680_100011194 3300005336 Bacteria 6939
34 Ga0070680_100012364 3300005336 Bacteria 6629
35 Ga0070680_100025656 3300005336 Bacteria 4712
36 Ga0070680_100134645 3300005336 Bacteria 2069
37 Ga0070680_100217605 3300005336 Bacteria 1612
38 Ga0070682_100075508 3300005337 Bacteria 2167
39 Ga0068868_100013002 3300005338 Bacteria 6091
40 Ga0070660_100000085 3300005339 Bacteria 56233
41 Ga0070660_100003873 3300005339 Bacteria 10334
42 Ga0070660_100006908 3300005339 Bacteria 7873
43 Ga0070660_100010943 3300005339 Bacteria 6424
44 Ga0070660_100017238 3300005339 Bacteria 5262
45 Ga0070660_100041942 3300005339 Bacteria 3490
46 Ga0070660_100072550 3300005339 Bacteria 2691
47 Ga0070660_100152121 3300005339 Bacteria 1861
48 Ga0070691_10000436 3300005341 Bacteria 15410
49 Ga0070661_100008874 3300005344 Bacteria 6961
50 Ga0070661_100036493 3300005344 Bacteria 3573
51 Ga0070661_100059067 3300005344 Bacteria 2811
52 Ga0070661_100067263 3300005344 Bacteria 2633
53 Ga0070661_100416099 3300005344 Bacteria 1065
54 Ga0070692_10000996 3300005345 Bacteria 9712
55 Ga0070692_10121551 3300005345 Bacteria 1457
56 Ga0070668_100004964 3300005347 Bacteria 9852
57 Ga0070668_100041725 3300005347 Bacteria 3516
58 Ga0070668_100051129 3300005347 Bacteria 3183
59 Ga0070669_100014161 3300005353 Bacteria 5675
60 Ga0070669_100046987 3300005353 Bacteria 3148
61 Ga0070671_100019489 3300005355 Bacteria 5522
62 Ga0070671_100140493 3300005355 Bacteria 2038
63 Ga0070671_100167661 3300005355 Bacteria 1857
64 Ga0070688_100020935 3300005365 Bacteria 3812
65 Ga0070659_100034927 3300005366 Bacteria 3913
66 Ga0070659_100050154 3300005366 Bacteria 3282
67 Ga0070659_100052987 3300005366 Bacteria 3192
68 Ga0070659_100082226 3300005366 Bacteria 2573
69 Ga0070667_100000128 3300005367 Bacteria 95780
70 Ga0070667_100101349 3300005367 Bacteria 2487
71 Ga0070667_100176654 3300005367 Bacteria 1887
72 Ga0070667_100452247 3300005367 Bacteria 1174
73 Ga0070709_10022286 3300005434 Bacteria 3703
74 Ga0070709_10045104 3300005434 Bacteria 2734
75 Ga0070709_10050465 3300005434 Bacteria 2607
76 Ga0070709_10073352 3300005434 Bacteria 2215
77 Ga0070709_10213562 3300005434 Bacteria 1372
78 Ga0070714_100001555 3300005435 Bacteria 16718
79 Ga0070714_100092568 3300005435 Bacteria 2650
80 Ga0070714_100143734 3300005435 Bacteria 2144
81 Ga0070714_100159661 3300005435 Bacteria 2039
82 Ga0070714_100175048 3300005435 Bacteria 1950
83 Ga0070714_100287153 3300005435 Bacteria 1530
84 Ga0070714_100407097 3300005435 Bacteria 1287
85 Ga0070713_100000046 3300005436 Bacteria 77263
86 Ga0070713_100035064 3300005436 Bacteria 4037
87 Ga0070713_100066889 3300005436 Bacteria 3023
88 Ga0070713_100105035 3300005436 Bacteria 2453
89 Ga0070713_100278926 3300005436 Bacteria 1533
90 Ga0070710_10155478 3300005437 Bacteria 1414
91 Ga0070710_10181264 3300005437 Bacteria 1319
92 Ga0070710_10182275 3300005437 Bacteria 1315
93 Ga0070711_100033505 3300005439 Bacteria 3420
94 Ga0070711_100106035 3300005439 Bacteria 2054
95 Ga0070711_100115903 3300005439 Bacteria 1973
96 Ga0070711_100248073 3300005439 Bacteria 1395
97 Ga0070705_100000255 3300005440 Bacteria 31677
98 Ga0070700_100000791 3300005441 Bacteria 15529
99 Ga0070708_100146096 3300005445 Bacteria 2196
100 Ga0070663_100002086 3300005455 Bacteria 11179
101 Ga0070663_100015553 3300005455 Bacteria 4917
102 Ga0070663_100020448 3300005455 Bacteria 4384
103 Ga0070663_100218586 3300005455 Bacteria 1495
104 Ga0070678_100022241 3300005456 Bacteria 4197
105 Ga0070662_100012251 3300005457 Bacteria 5679
106 Ga0070662_100182915 3300005457 Bacteria 1653
107 Ga0070681_10000001 3300005458 Bacteria 946857
108 Ga0070681_10013587 3300005458 Bacteria 8101
109 Ga0070681_10016380 3300005458 Bacteria 7400
110 Ga0070681_10033804 3300005458 Bacteria 5133
111 Ga0070681_10039831 3300005458 Bacteria 4710
112 Ga0070681_10099789 3300005458 Bacteria 2849
113 Ga0070681_10145238 3300005458 Bacteria 2301
114 Ga0070681_10292648 3300005458 Bacteria 1538
115 Ga0070706_100137911 3300005467 Bacteria 2276
116 Ga0070707_100061943 3300005468 Bacteria 3589
117 Ga0070698_100209583 3300005471 Bacteria 1884
118 Ga0070698_100225709 3300005471 Bacteria 1806
119 Ga0070699_100001711 3300005518 Bacteria 20006
120 Ga0070699_100022541 3300005518 Bacteria 5428
121 Ga0070699_100054126 3300005518 Bacteria 3474
122 Ga0070679_100008607 3300005530 Bacteria 9619
123 Ga0070679_100049485 3300005530 Bacteria 4186
124 Ga0070679_100150468 3300005530 Bacteria 2304
125 Ga0070679_100218911 3300005530 Bacteria 1865
126 Ga0070679_100244695 3300005530 Bacteria 1750
127 Ga0070679_100341713 3300005530 Bacteria 1445
128 Ga0070679_100449157 3300005530 Bacteria 1234
129 Ga0070684_100068767 3300005535 Bacteria 3113
130 Ga0070684_100276095 3300005535 Bacteria 1539
131 Ga0070697_100003111 3300005536 Bacteria 12747
132 Ga0070697_100112469 3300005536 Bacteria 2271
133 Ga0070697_100342900 3300005536 Bacteria 1289
134 Ga0068853_100032596 3300005539 Bacteria 4415
135 Ga0068853_100034820 3300005539 Bacteria 4276
136 Ga0068853_100226575 3300005539 Bacteria 1709
137 Ga0068853_100227876 3300005539 Bacteria 1704
138 Ga0070695_100000220 3300005545 Bacteria 27875
139 Ga0070695_100037083 3300005545 Bacteria 3071
140 Ga0070695_100112590 3300005545 Bacteria 1849
141 Ga0070696_100000497 3300005546 Bacteria 24787
142 Ga0070696_100085113 3300005546 Bacteria 2244
143 Ga0070693_100039630 3300005547 Bacteria 2640
144 Ga0070665_100000044 3300005548 Bacteria 276702
145 Ga0070665_100008964 3300005548 Bacteria 10136
146 Ga0070665_100049422 3300005548 Bacteria 4219
147 Ga0070704_100008113 3300005549 Bacteria 6278
148 Ga0070704_100030739 3300005549 Bacteria 3602
149 Ga0068855_100000022 3300005563 Bacteria 190807
150 Ga0068855_100000300 3300005563 Bacteria 61687
151 Ga0068855_100005454 3300005563 Bacteria 15509
152 Ga0068855_100011392 3300005563 Bacteria 10739
153 Ga0068855_100013133 3300005563 Bacteria 9989
154 Ga0068855_100071882 3300005563 Bacteria 4021
155 Ga0068855_100076637 3300005563 Bacteria 3880
156 Ga0068855_100106140 3300005563 Bacteria 3229
157 Ga0068855_100212238 3300005563 Bacteria 2174
158 Ga0068855_100503035 3300005563 Bacteria 1316
159 Ga0068855_100533468 3300005563 Bacteria 1272
160 Ga0068855_100808508 3300005563 Bacteria 996
161 Ga0070664_100016737 3300005564 Bacteria 6015
162 Ga0070664_100031720 3300005564 Bacteria 4418
163 Ga0070664_100070065 3300005564 Bacteria 3002
164 Ga0070664_100200308 3300005564 Bacteria 1782
165 Ga0068857_100000031 3300005577 Bacteria 75513
166 Ga0068857_100047135 3300005577 Bacteria 3826
167 Ga0068857_100092376 3300005577 Bacteria 2710
168 Ga0068857_100103343 3300005577 Bacteria 2558
169 Ga0068854_100040816 3300005578 Bacteria 3276
170 Ga0068854_100063265 3300005578 Bacteria 2685
171 Ga0068854_100146336 3300005578 Bacteria 1818
172 Ga0068856_100000379 3300005614 Bacteria 48620
173 Ga0068856_100001105 3300005614 Bacteria 28524
174 Ga0068856_100005014 3300005614 Bacteria 13112
175 Ga0068856_100038634 3300005614 Bacteria 4686
176 Ga0068856_100039824 3300005614 Bacteria 4614
177 Ga0068856_100062239 3300005614 Bacteria 3686
178 Ga0068856_100135736 3300005614 Bacteria 2465
179 Ga0068856_100382471 3300005614 Bacteria 1427
180 Ga0068852_100013898 3300005616 Bacteria 6174
181 Ga0068852_100017797 3300005616 Bacteria 5585
182 Ga0068852_100044561 3300005616 Bacteria 3768
183 Ga0068852_100094589 3300005616 Bacteria 2681
184 Ga0068852_100422311 3300005616 Bacteria 1315
185 Ga0068859_100000221 3300005617 Bacteria 56589
186 Ga0068859_100102251 3300005617 Bacteria 2923
187 Ga0068864_100000324 3300005618 Bacteria 42149
188 Ga0068851_10111336 3300005834 Bacteria 1462
189 Ga0068863_100000988 3300005841 Bacteria 28552
190 Ga0068858_100000038 3300005842 Bacteria 137131
191 Ga0068858_100302282 3300005842 Bacteria 1527
192 Ga0068858_100357961 3300005842 Bacteria 1399
193 Ga0068858_100532904 3300005842 Bacteria 1136
194 Ga0068860_100012362 3300005843 Bacteria 8410
195 Ga0068860_100038050 3300005843 Bacteria 4603
196 Ga0068860_100048226 3300005843 Bacteria 4059
197 Ga0068860_100121793 3300005843 Bacteria 2498
198 Ga0068862_100000435 3300005844 Bacteria 45439
199 Ga0068862_100011492 3300005844 Bacteria 7309
200 Ga0068862_100323761 3300005844 Bacteria 1424
201 Ga0081455_10000149 3300005937 Bacteria 83756
202 Ga0081455_10000211 3300005937 Bacteria 74488
203 Ga0081455_10000736 3300005937 Bacteria 42524
204 Ga0081455_10002000 3300005937 Bacteria 24347
205 Ga0081538_10006504 3300005981 Bacteria 10278
206 Ga0081538_10012501 3300005981 Bacteria 6801
207 Ga0081540_1001053 3300005983 Bacteria 24603
208 Ga0081540_1001559 3300005983 Bacteria 19626
209 Ga0081539_10000618 3300005985 Bacteria 71969
210 Ga0081539_10000954 3300005985 Bacteria 54181
211 Ga0081539_10006940 3300005985 Bacteria 10532
212 Ga0081539_10010399 3300005985 Bacteria 7565
213 Ga0081539_10036460 3300005985 Bacteria 2943
214 Ga0070717_10024484 3300006028 Bacteria 4794
215 Ga0070717_10117189 3300006028 Bacteria 2278
216 Ga0070717_10266506 3300006028 Bacteria 1516
217 Ga0075365_10031254 3300006038 Bacteria 3415
218 Ga0075365_10056117 3300006038 Bacteria 2617
219 Ga0075365_10068296 3300006038 Bacteria 2388
220 Ga0075365_10099284 3300006038 Bacteria 1992
221 Ga0075365_10262520 3300006038 Bacteria 1214
222 Ga0075368_10025070 3300006042 Bacteria 2288
223 Ga0075368_10075290 3300006042 Bacteria 1368
224 Ga0075363_100031931 3300006048 Bacteria 2732
225 Ga0075364_10030585 3300006051 Bacteria 3457
226 Ga0075364_10033207 3300006051 Bacteria 3321
227 Ga0075364_10133005 3300006051 Bacteria 1670
228 Ga0075364_10163234 3300006051 Bacteria 1504
229 Ga0070716_100112601 3300006173 Bacteria 1689
230 Ga0070712_100000218 3300006175 Bacteria 32344
231 Ga0070712_100003438 3300006175 Bacteria 9743
232 Ga0070712_100005245 3300006175 Bacteria 8018
233 Ga0070712_100018646 3300006175 Bacteria 4511
234 Ga0070712_100048413 3300006175 Bacteria 2946
235 Ga0070712_100096860 3300006175 Bacteria 2173
236 Ga0075367_10030349 3300006178 Bacteria 3099
237 Ga0075367_10079105 3300006178 Bacteria 1986
238 Ga0075369_10027277 3300006186 Bacteria 2387
239 Ga0075366_10010922 3300006195 Bacteria 5110
240 Ga0075366_10026437 3300006195 Bacteria 3399
241 Ga0075366_10046671 3300006195 Bacteria 2567
242 Ga0075428_100000606 3300006844 Bacteria 36554
243 Ga0075428_100060712 3300006844 Bacteria 4140
244 Ga0075428_100068529 3300006844 Bacteria 3881
245 Ga0075428_100109364 3300006844 Bacteria 3012
246 Ga0075430_100051888 3300006846 Bacteria 3454
247 Ga0075430_100057443 3300006846 Bacteria 3273
248 Ga0075430_100084206 3300006846 Bacteria 2663
249 Ga0075430_100182139 3300006846 Bacteria 1747
250 Ga0075430_100251388 3300006846 Bacteria 1465
251 Ga0075431_100000032 3300006847 Bacteria 72293
252 Ga0075431_100006971 3300006847 Bacteria 11238
253 Ga0075431_100028286 3300006847 Bacteria 5757
254 Ga0075431_100136702 3300006847 Bacteria 2527
255 Ga0075433_10067598 3300006852 Bacteria 3137
256 Ga0075433_10125346 3300006852 Bacteria 2281
257 Ga0075433_10315850 3300006852 Bacteria 1382
258 Ga0075434_100105187 3300006871 Bacteria 2832
259 Ga0075429_100031410 3300006880 Bacteria 4615
260 Ga0075429_100045311 3300006880 Bacteria 3826
261 Ga0075436_100001529 3300006914 Bacteria 15800
262 Ga0097620_100000221 3300006931 Bacteria 56589
263 Ga0097620_100102244 3300006931 Bacteria 2923
264 Ga0075435_100219157 3300007076 Bacteria 1616
265 Ga0099794_10028110 3300007265 Bacteria 2613
266 Ga0099795_10014147 3300007788 Bacteria 2466
267 Ga0105250_10006178 3300009092 Bacteria 5262
268 Ga0105240_10000430 3300009093 Bacteria 77531
269 Ga0105240_10002169 3300009093 Bacteria 32009
270 Ga0105240_10033000 3300009093 Bacteria 6694
271 Ga0105240_10051735 3300009093 Bacteria 5167
272 Ga0105240_10070930 3300009093 Bacteria 4309
273 Ga0105240_10076343 3300009093 Bacteria 4131
274 Ga0105240_10185191 3300009093 Bacteria 2453
275 Ga0105240_10388079 3300009093 Bacteria 1575
276 Ga0105240_10651770 3300009093 Bacteria 1154
277 Ga0105240_10728330 3300009093 Bacteria 1080
278 Ga0111539_10001089 3300009094 Bacteria 35899
279 Ga0111539_10003408 3300009094 Bacteria 20944
280 Ga0111539_10020065 3300009094 Bacteria 8234
281 Ga0111539_10251657 3300009094 Bacteria 2057
282 Ga0111539_10462833 3300009094 Bacteria 1477
283 Ga0111539_10600315 3300009094 Bacteria 1282
284 Ga0105245_10000484 3300009098 Bacteria 36479
285 Ga0105247_10038214 3300009101 Bacteria 2929
286 Ga0114129_10000062 3300009147 Bacteria 96507
287 Ga0114129_10001060 3300009147 Bacteria 36097
288 Ga0114129_10244180 3300009147 Bacteria 2413
289 Ga0114129_10589531 3300009147 Bacteria 1441
290 Ga0105243_10246979 3300009148 Bacteria 1591
291 Ga0105243_10275585 3300009148 Bacteria 1513
292 Ga0105241_10013670 3300009174 Bacteria 5948
293 Ga0105241_10073900 3300009174 Bacteria 2654
294 Ga0105241_10114489 3300009174 Bacteria 2163
295 Ga0105241_10228088 3300009174 Bacteria 1569
296 Ga0105248_10000005 3300009177 Bacteria 673111
297 Ga0105248_10001342 3300009177 Bacteria 27431
298 Ga0105248_10505355 3300009177 Bacteria 1363
299 Ga0105237_10001309 3300009545 Bacteria 33107
300 Ga0105237_10202392 3300009545 Bacteria 1986
301 Ga0105238_10004028 3300009551 Bacteria 14580
302 Ga0105238_10017014 3300009551 Bacteria 7381
303 Ga0105238_10033305 3300009551 Bacteria 5244
304 Ga0105249_10017541 3300009553 Bacteria 6357
305 Ga0099796_10027095 3300010159 Bacteria 1827
306 Ga0105239_10002559 3300010375 Bacteria 23073
307 Ga0105239_10004314 3300010375 Bacteria 17052
308 Ga0105239_10008789 3300010375 Bacteria 11430
309 Ga0157373_10001315 3300013100 Bacteria 19009
310 Ga0157373_10014370 3300013100 Bacteria 5803
311 Ga0157373_10064155 3300013100 Bacteria 2600
312 Ga0157371_10006249 3300013102 Bacteria 9871
313 Ga0157371_10014275 3300013102 Bacteria 6002
314 Ga0157370_10007564 3300013104 Bacteria 11801
315 Ga0157370_10039763 3300013104 Bacteria 4544
316 Ga0157370_10053908 3300013104 Bacteria 3834
317 Ga0157370_10117220 3300013104 Bacteria 2487
318 Ga0157370_10117302 3300013104 Bacteria 2486
319 Ga0157370_10156819 3300013104 Bacteria 2118
320 Ga0157370_10180436 3300013104 Bacteria 1962
321 Ga0157370_10348261 3300013104 Bacteria 1365
322 Ga0157370_10469073 3300013104 Bacteria 1157
323 Ga0157369_10000756 3300013105 Bacteria 41660
324 Ga0157369_10000881 3300013105 Bacteria 38268
325 Ga0157369_10018172 3300013105 Bacteria 7886
326 Ga0157369_10023244 3300013105 Bacteria 6907
327 Ga0157369_10083966 3300013105 Bacteria 3405
328 Ga0157369_10274749 3300013105 Bacteria 1755
329 Ga0157369_10619993 3300013105 Bacteria 1116
330 Ga0157374_10024477 3300013296 Bacteria 5414
331 Ga0157374_10131397 3300013296 Bacteria 2423
332 Ga0157374_10332038 3300013296 Bacteria 1508
333 Ga0157378_10087458 3300013297 Bacteria 2827
334 Ga0157372_10004048 3300013307 Bacteria 15708
335 Ga0157372_10016212 3300013307 Bacteria 7994
336 Ga0163163_10000489 3300014325 Bacteria 35830
337 Ga0163163_10253252 3300014325 Bacteria 1811
338 Ga0163163_10596353 3300014325 Bacteria 1168
339 Ga0157379_10002131 3300014968 Bacteria 16408
340 Ga0157379_10011138 3300014968 Bacteria 7839
341 Ga0157379_10063465 3300014968 Bacteria 3302
342 Ga0157379_10092288 3300014968 Bacteria 2716
343 Ga0157379_10299331 3300014968 Bacteria 1466
344 Ga0157379_10473095 3300014968 Bacteria 1159
345 Ga0163161_10230658 3300017792 Bacteria 1437
346 Ga0206354_11027225 3300020081 Bacteria 1350
347 Ga0206353_11504462 3300020082 Bacteria 1254
348 Ga0213873_10056291 3300021358 Bacteria 1054
349 Ga0213872_10060633 3300021361 Bacteria 1711
350 Ga0213872_10088358 3300021361 Bacteria 1388
351 Ga0213874_10001553 3300021377 Bacteria 4786
352 Ga0213876_10001206 3300021384 Bacteria 16300
353 Ga0213876_10154312 3300021384 Bacteria 1221
354 Ga0213875_10000674 3300021388 Bacteria 26801
355 Ga0213875_10004650 3300021388 Bacteria 7481
356 Ga0213875_10004811 3300021388 Bacteria 7340
357 Ga0213875_10007532 3300021388 Bacteria 5612
358 Ga0213875_10020458 3300021388 Bacteria 3175
359 Ga0213871_10005226 3300021441 Bacteria 2662
360 Ga0213871_10018486 3300021441 Bacteria 1706
361 Ga0224572_1003951 3300024225 Bacteria 2543
362 Ga0224572_1012161 3300024225 Bacteria 1632
363 Ga0228598_1009795 3300024227 Bacteria 1915
364 Ga0209147_103646 3300025229 Bacteria 2882
365 Ga0209565_1000054 3300025263 Bacteria 206016
366 Ga0209673_1017066 3300025273 Bacteria 2687
367 Ga0209675_1002435 3300025291 Bacteria 9572
368 Ga0209025_1036751 3300025294 Bacteria 2187
369 Ga0209564_1000177 3300025295 Bacteria 152313
370 Ga0209564_1001852 3300025295 Bacteria 19200
371 Ga0209256_1000032 3300025299 Bacteria 395041
372 Ga0209256_1000547 3300025299 Bacteria 53996
373 Ga0207656_10098138 3300025321 Bacteria 1339
374 Ga0207696_1008107 3300025711 Bacteria 4053
375 Ga0207710_10065182 3300025900 Bacteria 1660
376 Ga0207680_10000466 3300025903 Bacteria 19090
377 Ga0207647_10003785 3300025904 Bacteria 11307
378 Ga0207647_10004237 3300025904 Bacteria 10629
379 Ga0207647_10018861 3300025904 Bacteria 4651
380 Ga0207647_10037669 3300025904 Bacteria 3064
381 Ga0207699_10000310 3300025906 Bacteria 26065
382 Ga0207699_10039135 3300025906 Bacteria 2722
383 Ga0207699_10077590 3300025906 Bacteria 2050
384 Ga0207699_10175871 3300025906 Bacteria 1435
385 Ga0207705_10000003 3300025909 Bacteria 709270
386 Ga0207705_10000061 3300025909 Bacteria 150179
387 Ga0207705_10000522 3300025909 Bacteria 32721
388 Ga0207705_10000704 3300025909 Bacteria 27609
389 Ga0207705_10004521 3300025909 Bacteria 10510
390 Ga0207705_10018789 3300025909 Bacteria 4944
391 Ga0207705_10034746 3300025909 Bacteria 3605
392 Ga0207705_10062918 3300025909 Bacteria 2680
393 Ga0207705_10260852 3300025909 Bacteria 1323
394 Ga0207705_10288154 3300025909 Bacteria 1258
395 Ga0207705_10341801 3300025909 Bacteria 1152
396 Ga0207684_10075405 3300025910 Bacteria 2866
397 Ga0207684_10088784 3300025910 Bacteria 2634
398 Ga0207684_10097405 3300025910 Bacteria 2511
399 Ga0207684_10430784 3300025910 Bacteria 1133
400 Ga0207654_10174227 3300025911 Bacteria 1399
401 Ga0207654_10206847 3300025911 Bacteria 1295
402 Ga0207707_10000011 3300025912 Bacteria 282857
403 Ga0207707_10003695 3300025912 Bacteria 13568
404 Ga0207707_10005561 3300025912 Bacteria 11025
405 Ga0207707_10024159 3300025912 Bacteria 5317
406 Ga0207707_10320517 3300025912 Bacteria 1338
407 Ga0207695_10000018 3300025913 Bacteria 766611
408 Ga0207695_10006765 3300025913 Bacteria 14782
409 Ga0207695_10006975 3300025913 Bacteria 14503
410 Ga0207695_10012037 3300025913 Bacteria 10405
411 Ga0207695_10016569 3300025913 Bacteria 8618
412 Ga0207695_10053216 3300025913 Bacteria 4235
413 Ga0207695_10101865 3300025913 Bacteria 2865
414 Ga0207695_10139030 3300025913 Bacteria 2379
415 Ga0207695_10149130 3300025913 Bacteria 2279
416 Ga0207695_10262908 3300025913 Bacteria 1623
417 Ga0207671_10100361 3300025914 Bacteria 2191
418 Ga0207671_10151241 3300025914 Bacteria 1793
419 Ga0207671_10359018 3300025914 Bacteria 1156
420 Ga0207693_10000663 3300025915 Bacteria 30928
421 Ga0207693_10001492 3300025915 Bacteria 20643
422 Ga0207693_10010617 3300025915 Bacteria 7472
423 Ga0207693_10016004 3300025915 Bacteria 6003
424 Ga0207693_10018927 3300025915 Bacteria 5481
425 Ga0207693_10019783 3300025915 Bacteria 5352
426 Ga0207693_10146564 3300025915 Bacteria 1856
427 Ga0207663_10025072 3300025916 Bacteria 3442
428 Ga0207660_10000737 3300025917 Bacteria 21749
429 Ga0207660_10002355 3300025917 Bacteria 12445
430 Ga0207660_10005544 3300025917 Bacteria 8197
431 Ga0207660_10051470 3300025917 Bacteria 2928
432 Ga0207660_10070703 3300025917 Bacteria 2537
433 Ga0207660_10104875 3300025917 Bacteria 2117
434 Ga0207660_10155309 3300025917 Bacteria 1761
435 Ga0207660_10178237 3300025917 Bacteria 1649
436 Ga0207657_10000101 3300025919 Bacteria 82962
437 Ga0207657_10000631 3300025919 Bacteria 37345
438 Ga0207657_10001405 3300025919 Bacteria 25680
439 Ga0207657_10001922 3300025919 Bacteria 22436
440 Ga0207657_10007725 3300025919 Bacteria 10982
441 Ga0207657_10012424 3300025919 Bacteria 8412
442 Ga0207657_10034343 3300025919 Bacteria 4562
443 Ga0207657_10050184 3300025919 Bacteria 3632
444 Ga0207657_10143431 3300025919 Bacteria 1950
445 Ga0207657_10188959 3300025919 Bacteria 1663
446 Ga0207657_10238560 3300025919 Bacteria 1452
447 Ga0207657_10292141 3300025919 Bacteria 1292
448 Ga0207657_10409508 3300025919 Bacteria 1066
449 Ga0207649_10000494 3300025920 Bacteria 28001
450 Ga0207649_10001179 3300025920 Bacteria 15748
451 Ga0207649_10004815 3300025920 Bacteria 7299
452 Ga0207649_10049357 3300025920 Bacteria 2599
453 Ga0207649_10090808 3300025920 Bacteria 1999
454 Ga0207652_10000089 3300025921 Bacteria 99680
455 Ga0207652_10000334 3300025921 Bacteria 48952
456 Ga0207652_10062747 3300025921 Bacteria 3212
457 Ga0207652_10132412 3300025921 Bacteria 2225
458 Ga0207652_10294109 3300025921 Bacteria 1466
459 Ga0207652_10374399 3300025921 Bacteria 1285
460 Ga0207652_10401522 3300025921 Bacteria 1237
461 Ga0207646_10022399 3300025922 Bacteria 5821
462 Ga0207694_10000005 3300025924 Bacteria 823704
463 Ga0207694_10024662 3300025924 Bacteria 4568
464 Ga0207650_10074789 3300025925 Bacteria 2555
465 Ga0207687_10032337 3300025927 Bacteria 3543
466 Ga0207700_10000017 3300025928 Bacteria 195983
467 Ga0207700_10175549 3300025928 Bacteria 1790
468 Ga0207664_10030301 3300025929 Bacteria 4131
469 Ga0207664_10034053 3300025929 Bacteria 3920
470 Ga0207664_10056751 3300025929 Bacteria 3111
471 Ga0207664_10067798 3300025929 Bacteria 2864
472 Ga0207664_10139268 3300025929 Bacteria 2051
473 Ga0207664_10160393 3300025929 Bacteria 1918
474 Ga0207664_10538999 3300025929 Bacteria 1046
475 Ga0207644_10105586 3300025931 Bacteria 2122
476 Ga0207690_10021392 3300025932 Bacteria 4011
477 Ga0207690_10034093 3300025932 Bacteria 3278
478 Ga0207690_10039976 3300025932 Bacteria 3063
479 Ga0207690_10043002 3300025932 Bacteria 2971
480 Ga0207690_10054649 3300025932 Bacteria 2686
481 Ga0207690_10184130 3300025932 Bacteria 1575
482 Ga0207690_10268363 3300025932 Bacteria 1325
483 Ga0207706_10009699 3300025933 Bacteria 8836
484 Ga0207706_10019485 3300025933 Bacteria 6104
485 Ga0207706_10190413 3300025933 Bacteria 1801
486 Ga0207665_10059848 3300025939 Bacteria 2579
487 Ga0207711_10000002 3300025941 Bacteria 1228676
488 Ga0207711_10000042 3300025941 Bacteria 158782
489 Ga0207711_10015104 3300025941 Bacteria 6413
490 Ga0207711_10047034 3300025941 Bacteria 3688
491 Ga0207689_10102631 3300025942 Bacteria 2350
492 Ga0207689_10134030 3300025942 Bacteria 2039
493 Ga0207661_10023150 3300025944 Bacteria 4690
494 Ga0207661_10090760 3300025944 Bacteria 2544
495 Ga0207661_10216926 3300025944 Bacteria 1689
496 Ga0207679_10113338 3300025945 Bacteria 2145
497 Ga0207679_10153289 3300025945 Bacteria 1878
498 Ga0207667_10000061 3300025949 Bacteria 190818
499 Ga0207667_10000187 3300025949 Bacteria 90766
500 Ga0207667_10005445 3300025949 Bacteria 15518
501 Ga0207667_10009340 3300025949 Bacteria 11566
502 Ga0207667_10013895 3300025949 Bacteria 9197
503 Ga0207667_10031158 3300025949 Bacteria 5760
504 Ga0207667_10078431 3300025949 Bacteria 3423
505 Ga0207667_10534911 3300025949 Bacteria 1186
506 Ga0207651_10045319 3300025960 Bacteria 2949
507 Ga0207712_10005400 3300025961 Bacteria 8069
508 Ga0207668_10003197 3300025972 Bacteria 9597
509 Ga0207668_10033479 3300025972 Bacteria 3404
510 Ga0207668_10110453 3300025972 Bacteria 2062
511 Ga0207640_10002139 3300025981 Bacteria 10614
512 Ga0207640_10005375 3300025981 Bacteria 6984
513 Ga0207640_10055031 3300025981 Bacteria 2604
514 Ga0207658_10004787 3300025986 Bacteria 9364
515 Ga0207658_10027427 3300025986 Bacteria 4002
516 Ga0207658_10043127 3300025986 Bacteria 3277
517 Ga0207703_10000440 3300026035 Bacteria 43772
518 Ga0207703_10001009 3300026035 Bacteria 27028
519 Ga0207703_10244799 3300026035 Bacteria 1614
520 Ga0207703_10344945 3300026035 Bacteria 1370
521 Ga0207639_10004301 3300026041 Bacteria 9593
522 Ga0207639_10029891 3300026041 Bacteria 3993
523 Ga0207639_10032439 3300026041 Bacteria 3845
524 Ga0207639_10106886 3300026041 Bacteria 2272
525 Ga0207639_10261874 3300026041 Bacteria 1513
526 Ga0207678_10003050 3300026067 Bacteria 15155
527 Ga0207678_10005069 3300026067 Bacteria 11810
528 Ga0207678_10050319 3300026067 Bacteria 3600
529 Ga0207678_10254549 3300026067 Bacteria 1504
530 Ga0207708_10000384 3300026075 Bacteria 34526
531 Ga0207702_10000035 3300026078 Bacteria 158744
532 Ga0207702_10000182 3300026078 Bacteria 75732
533 Ga0207702_10000875 3300026078 Bacteria 31344
534 Ga0207702_10045038 3300026078 Bacteria 3711
535 Ga0207702_10294177 3300026078 Bacteria 1539
536 Ga0207702_10330786 3300026078 Bacteria 1453
537 Ga0207702_10451192 3300026078 Bacteria 1248
538 Ga0207641_10000415 3300026088 Bacteria 49760
539 Ga0207676_10002042 3300026095 Bacteria 14668
540 Ga0207676_10155364 3300026095 Bacteria 1976
541 Ga0207674_10000003 3300026116 Bacteria 241674
542 Ga0207674_10015341 3300026116 Bacteria 8420
543 Ga0207674_10034758 3300026116 Bacteria 5266
544 Ga0207674_10055630 3300026116 Bacteria 4022
545 Ga0207675_100387745 3300026118 Bacteria 1375
546 Ga0207675_100619089 3300026118 Bacteria 1087
547 Ga0207683_10028724 3300026121 Bacteria 4811
548 Ga0207698_10002033 3300026142 Bacteria 11927
549 Ga0207698_10049620 3300026142 Bacteria 3196
550 Ga0207698_10069627 3300026142 Bacteria 2783
551 Ga0209813_10006106 3300027866 Bacteria 2962
552 Ga0207428_10000203 3300027907 Bacteria 82534
553 Ga0207428_10007154 3300027907 Bacteria 10211
554 Ga0268266_10000002 3300028379 Bacteria 3059047
555 Ga0268266_10009292 3300028379 Bacteria 8673
556 Ga0268266_10070415 3300028379 Bacteria 3031
557 Ga0268266_10106600 3300028379 Bacteria 2477
558 Ga0268265_10000793 3300028380 Bacteria 30088
559 Ga0268265_10003811 3300028380 Bacteria 10685
560 Ga0268265_10066985 3300028380 Bacteria 2778
561 Ga0268265_10443854 3300028380 Bacteria 1210
562 Ga0268265_10464241 3300028380 Bacteria 1185
563 Ga0268264_10002765 3300028381 Bacteria 15302
564 Ga0268264_10023310 3300028381 Bacteria 5050
565 Ga0268264_10040033 3300028381 Bacteria 3872
566 Ga0265334_10000953 3300028573 Bacteria 14401
567 Ga0265334_10002804 3300028573 Bacteria 8035
568 Ga0265338_10005581 3300028800 Bacteria 16367
569 Ga0265338_10019894 3300028800 Bacteria 7092
570 Ga0265338_10020732 3300028800 Bacteria 6896
571 Ga0265338_10050438 3300028800 Bacteria 3762
572 Ga0265330_10025130 3300031235 Bacteria 2700
573 Ga0265330_10053156 3300031235 Bacteria 1773
574 Ga0265330_10086903 3300031235 Bacteria 1344
575 Ga0265332_10071114 3300031238 Bacteria 1481
576 Ga0265328_10000046 3300031239 Bacteria 81288
577 Ga0265325_10000567 3300031241 Bacteria 26847
578 Ga0265325_10005899 3300031241 Bacteria 7508
579 Ga0265325_10044214 3300031241 Bacteria 2321
580 Ga0265340_10000428 3300031247 Bacteria 22576
581 Ga0265340_10000540 3300031247 Bacteria 20903
582 Ga0265340_10006101 3300031247 Bacteria 6645
583 Ga0265340_10006948 3300031247 Bacteria 6178
584 Ga0265340_10014313 3300031247 Bacteria 4148
585 Ga0265340_10036841 3300031247 Bacteria 2423
586 Ga0265339_10003873 3300031249 Bacteria 10385
587 Ga0265339_10006509 3300031249 Bacteria 7656
588 Ga0265339_10123637 3300031249 Bacteria 1328
589 Ga0265331_10000054 3300031250 Bacteria 180181
590 Ga0265331_10004958 3300031250 Bacteria 8175
591 Ga0265331_10013768 3300031250 Bacteria 4337
592 Ga0265331_10016457 3300031250 Bacteria 3881
593 Ga0265327_10000179 3300031251 Bacteria 135005
594 Ga0265316_10000099 3300031344 Bacteria 95020
595 Ga0265316_10017095 3300031344 Bacteria 6278
596 Ga0265316_10084400 3300031344 Bacteria 2432
597 Ga0265316_10114507 3300031344 Bacteria 2040
598 Ga0265316_10217742 3300031344 Bacteria 1410
599 Ga0265316_10392352 3300031344 Bacteria 1000
600 Ga0307408_100189182 3300031548 Bacteria 1657
601 Ga0307408_100221489 3300031548 Bacteria 1544
602 Ga0265313_10000216 3300031595 Bacteria 62003
603 Ga0265313_10011560 3300031595 Bacteria 5475
604 Ga0265313_10028965 3300031595 Bacteria 2871
605 Ga0316579_10115829 3300031691 Bacteria 1286
606 Ga0265314_10000160 3300031711 Bacteria 102289
607 Ga0265314_10019986 3300031711 Bacteria 5178
608 Ga0265314_10023980 3300031711 Bacteria 4636
609 Ga0265314_10048739 3300031711 Bacteria 2970
610 Ga0265314_10091869 3300031711 Bacteria 1974
611 Ga0265314_10093099 3300031711 Bacteria 1957
612 Ga0265314_10115196 3300031711 Bacteria 1701
613 Ga0265314_10165398 3300031711 Bacteria 1341
614 Ga0265342_10000139 3300031712 Bacteria 81785
615 Ga0265342_10001957 3300031712 Bacteria 18419
616 Ga0265342_10004338 3300031712 Bacteria 11220
617 Ga0265342_10022508 3300031712 Bacteria 4004
618 Ga0265342_10086638 3300031712 Bacteria 1801
619 Ga0265342_10101609 3300031712 Bacteria 1637
620 Ga0316578_10125608 3300031728 Bacteria 1542
621 Ga0307516_10033704 3300031730 Bacteria 5153
622 Ga0307405_10042115 3300031731 Bacteria 2777
623 Ga0307413_10006025 3300031824 Bacteria 5489
624 Ga0307413_10047640 3300031824 Bacteria 2557
625 Ga0307410_10017956 3300031852 Bacteria 4262
626 Ga0307410_10044829 3300031852 Bacteria 2940
627 Ga0307407_10016181 3300031903 Bacteria 3707
628 Ga0307407_10020660 3300031903 Bacteria 3378
629 Ga0307412_10020774 3300031911 Bacteria 4001
630 Ga0307409_100010082 3300031995 Bacteria 5847
631 Ga0307409_100052374 3300031995 Bacteria 3129
632 Ga0307416_100023757 3300032002 Bacteria 4457
633 Ga0307416_100044905 3300032002 Bacteria 3474
634 Ga0307414_10004083 3300032004 Bacteria 7874
635 Ga0307414_10208203 3300032004 Bacteria 1596
636 Ga0307411_10007821 3300032005 Bacteria 5487
637 Ga0307411_10010197 3300032005 Bacteria 4995
638 Ga0307411_10020382 3300032005 Bacteria 3855
639 Ga0307411_10036072 3300032005 Bacteria 3094
640 Ga0307415_100000374 3300032126 Bacteria 19118
641 Ga0307415_100007417 3300032126 Bacteria 5998
642 Ga0316596_1043264 3300033541 Bacteria 1186
643 Ga0373926_0014359 3300035083 Bacteria 2693
644 Ga0373923_0005873 3300035111 Bacteria 4194
645 Ga0373936_0074704 3300035113 Bacteria 1403
646 Ga0373945_0011777 3300035116 Bacteria 2896
647 Ga0373945_0033883 3300035116 Bacteria 1818
648 Ga0373953_0001424 3300035117 Bacteria 6914
649 Ga0373954_0002291 3300035118 Bacteria 7971
650 Ga0373954_0008633 3300035118 Bacteria 4481
651 Ga0373954_0032949 3300035118 Bacteria 2397
652 Ga0373956_0003222 3300035119 Bacteria 6590
653 Ga0373956_0027878 3300035119 Bacteria 2455
654 Ga0373956_0035196 3300035119 Bacteria 2208
655 Ga0373957_0006598 3300035120 Bacteria 3666
656 Ga0373957_0016614 3300035120 Bacteria 2550
657 Ga0373957_0090602 3300035120 Bacteria 1215
658 Ga0373943_0001584 3300035170 Bacteria 10306
659 Ga0373943_0061477 3300035170 Bacteria 1878
660 Ga0373946_0002328 3300035171 Bacteria 6719
661 Ga0373955_0000338 3300035172 Bacteria 19607
662 Ga0373955_0036945 3300035172 Bacteria 2595
663 Ga0373955_0160865 3300035172 Bacteria 1325
664 Ga0373924_0005579 3300035410 Bacteria 4463
665 Ga0373924_0030474 3300035410 Bacteria 2163
666 Ga0373931_0043536 3300035691 Bacteria 2365
667 Ga0373931_0117728 3300035691 Bacteria 1515
668 Ga0373935_0000281 3300035692 Bacteria 25102
669 Ga0373935_0024213 3300035692 Bacteria 3735
670 Ga0373935_0026454 3300035692 Bacteria 3581
671 Ga0373935_0040406 3300035692 Bacteria 2928
672 Ga0373935_0093528 3300035692 Bacteria 1972
673 Ga0373935_0097538 3300035692 Bacteria 1934
674 Ga0373935_0126777 3300035692 Bacteria 1711
675 Ga0373935_0152662 3300035692 Bacteria 1568
676 Ga0373927_0022573 3300035695 Bacteria 4122
677 Ga0373927_0060294 3300035695 Bacteria 2455
678 Ga0373927_0086861 3300035695 Bacteria 2030
679 Ga0373927_0086944 3300035695 Bacteria 2029
680 Ga0373927_0099209 3300035695 Bacteria 1894
681 Ga0373927_0147041 3300035695 Bacteria 1543
682 Ga0373927_0177722 3300035695 Bacteria 1396
683 Ga0373933_0012856 3300035724 Bacteria 4629
684 Ga0373933_0017737 3300035724 Bacteria 3994
685 Ga0373933_0039569 3300035724 Bacteria 2774
686 Ga0373933_0076526 3300035724 Bacteria 2044
687 Ga0373933_0125479 3300035724 Bacteria 1610
688 Ga0373933_0130999 3300035724 Bacteria 1577
689 Ga0373947_0003801 3300035725 Bacteria 8902
690 Ga0373947_0008856 3300035725 Bacteria 5790
691 Ga0373947_0032588 3300035725 Bacteria 3072
692 Ga0373947_0035434 3300035725 Bacteria 2955
693 Ga0373947_0182087 3300035725 Bacteria 1368
694 Ga0373947_0200265 3300035725 Bacteria 1306
695 Ga0373947_0259854 3300035725 Bacteria 1150
696 Ga0373937_0000005 3300036401 Bacteria 199965
697 Ga0373937_0003891 3300036401 Bacteria 12634
698 Ga0373937_0006693 3300036401 Bacteria 9944
699 Ga0373937_0014147 3300036401 Bacteria 7038
700 Ga0373937_0020900 3300036401 Bacteria 5871
701 Ga0373937_0025615 3300036401 Bacteria 5327
702 Ga0373937_0048456 3300036401 Bacteria 3890
703 Ga0373937_0073318 3300036401 Bacteria 3158
704 Ga0373937_0091428 3300036401 Bacteria 2820
705 Ga0373937_0103858 3300036401 Bacteria 2639
706 Ga0373937_0110420 3300036401 Bacteria 2557
707 Ga0373937_0178582 3300036401 Bacteria 1993
708 Ga0373937_0335086 3300036401 Bacteria 1432
709 Ga0316582_0082434 3300036647 Bacteria 2102
710 Ga0316582_0110442 3300036647 Bacteria 1829
711 Ga0373925_0000007 3300037068 Bacteria 257023
712 Ga0373925_0006090 3300037068 Bacteria 8920
713 Ga0373925_0006256 3300037068 Bacteria 8779
714 Ga0373925_0007976 3300037068 Bacteria 7710
715 Ga0373925_0053155 3300037068 Bacteria 3027
716 Ga0373925_0311510 3300037068 Bacteria 1272
717 Ga0395899_0000112 3300037312 Bacteria 138389
718 Ga0395899_0015917 3300037312 Bacteria 5735
719 Ga0395899_0020389 3300037312 Bacteria 5026
720 Ga0395899_0029465 3300037312 Bacteria 4128
721 Ga0395899_0045807 3300037312 Bacteria 3259
722 Ga0395899_0103687 3300037312 Bacteria 2051
723 Ga0395899_0128167 3300037312 Bacteria 1814
724 Ga0395900_0000126 3300037418 Bacteria 127586
725 Ga0395900_0001168 3300037418 Bacteria 32771
726 Ga0395900_0004045 3300037418 Bacteria 15646
727 Ga0395900_0004704 3300037418 Bacteria 14390
728 Ga0395900_0005035 3300037418 Bacteria 13871
729 Ga0395900_0015042 3300037418 Bacteria 7887
730 Ga0395900_0026720 3300037418 Bacteria 5909
731 Ga0395900_0091877 3300037418 Bacteria 3118
732 Ga0395900_0110853 3300037418 Bacteria 2819
733 Ga0395900_0131334 3300037418 Bacteria 2566
734 Ga0395900_0135244 3300037418 Bacteria 2525
735 Ga0395900_0186006 3300037418 Bacteria 2108
736 Ga0395900_0204397 3300037418 Bacteria 1997
737 Ga0395900_0411048 3300037418 Bacteria 1315
738 Ga0395898_0012308 3300037466 Bacteria 8847
739 Ga0395898_0015527 3300037466 Bacteria 7809
740 Ga0395898_0021159 3300037466 Bacteria 6598
741 Ga0395898_0057536 3300037466 Bacteria 3788
742 Ga0395898_0067814 3300037466 Bacteria 3453
743 Ga0395898_0071691 3300037466 Bacteria 3347
744 Ga0395898_0129509 3300037466 Bacteria 2417
745 Ga0395898_0165391 3300037466 Bacteria 2116
746 Ga0395898_0182532 3300037466 Bacteria 2005
747 Ga0395898_0299275 3300037466 Bacteria 1535
748 Ga0395898_0303673 3300037466 Bacteria 1522
749 Ga0395898_0626186 3300037466 Bacteria 1018
750 Ga0395905_0000490 3300037471 Bacteria 54512
751 Ga0395905_0001952 3300037471 Bacteria 23608
752 Ga0395905_0002564 3300037471 Bacteria 20014
753 Ga0395905_0030798 3300037471 Bacteria 5053
754 Ga0395905_0038530 3300037471 Bacteria 4486
755 Ga0395905_0044910 3300037471 Bacteria 4145
756 Ga0395905_0094841 3300037471 Bacteria 2799
757 Ga0395905_0113726 3300037471 Bacteria 2543
758 Ga0395905_0257928 3300037471 Bacteria 1628
759 Ga0436364_0315170 3300037853 Bacteria 2953
760 Ga0436364_0981594 3300037853 Bacteria 21203
761 Ga0436364_1094905 3300037853 Bacteria 8704
762 Ga0436364_1123333 3300037853 Bacteria 3003
763 Ga0436364_1183619 3300037853 Bacteria 29970
764 Ga0436364_1316620 3300037853 Bacteria 1871
765 Ga0395901_0000249 3300038443 Bacteria 66993
766 Ga0395901_0028554 3300038443 Bacteria 5737
767 Ga0395901_0032611 3300038443 Bacteria 5372
768 Ga0395901_0033897 3300038443 Bacteria 5272
769 Ga0395901_0062128 3300038443 Bacteria 3887
770 Ga0395901_0064971 3300038443 Bacteria 3798
771 Ga0395901_0239538 3300038443 Bacteria 1892
772 Ga0400488_42668 3300038741 Bacteria 3342
773 Ga0400486_23075 3300038742 Bacteria 3644
774 Ga0436365_0385120 3300039437 Bacteria 1533
775 Ga0436365_0388612 3300039437 Bacteria 1233
776 Ga0436365_0452497 3300039437 Bacteria 2345
777 Ga0436365_0710251 3300039437 Bacteria 5854
778 Ga0436365_0821816 3300039437 Bacteria 1072
779 Ga0436365_1432912 3300039437 Bacteria 91459
780 Ga0436365_1747331 3300039437 Bacteria 2372
781 Ga0436360_0189891 3300039438 Bacteria 1629
782 Ga0436360_0321394 3300039438 Bacteria 2413
783 Ga0436360_0776057 3300039438 Bacteria 1545
784 Ga0436360_0865765 3300039438 Bacteria 1680
785 Ga0436360_1119660 3300039438 Bacteria 1635
786 Ga0436360_1203410 3300039438 Bacteria 10729
787 Ga0436360_1333994 3300039438 Bacteria 3408
788 Ga0436361_0007600 3300039447 Bacteria 4929
789 Ga0436361_0124441 3300039447 Bacteria 1656
790 Ga0436361_0198498 3300039447 Bacteria 5615
791 Ga0436361_0216543 3300039447 Bacteria 1302
792 Ga0436361_0833088 3300039447 Bacteria 2174
793 Ga0436363_0036075 3300039450 Bacteria 20430
794 Ga0436363_0055727 3300039450 Bacteria 5665
795 Ga0436363_0792304 3300039450 Bacteria 2245
796 Ga0436363_1377919 3300039450 Bacteria 1387
797 Ga0436362_0692635 3300039453 Bacteria 1601
798 Ga0436362_0958195 3300039453 Bacteria 7517
799 Ga0439441_006052 3300042001 Bacteria 1904
800 Ga0439464_0000604 3300042439 Bacteria 7574
801 Ga0466965_0107407 3300044683 Bacteria 1432
802 Ga0466966_0000001 3300044684 Bacteria 410376
803 Ga0466966_0007678 3300044684 Bacteria 7146
804 Ga0466961_0001957 3300044693 Bacteria 12837
805 Ga0466961_0021341 3300044693 Bacteria 4169
806 Ga0466963_0060957 3300044694 Bacteria 2520
807 Ga0466963_0066699 3300044694 Bacteria 2415
808 Ga0466963_0088879 3300044694 Bacteria 2101
809 Ga0466963_0098529 3300044694 Bacteria 1998
810 Ga0466964_0045424 3300044706 Bacteria 1787
811 Ga0466971_0049154 3300044719 Bacteria 1897
812 Ga0466968_0033418 3300044735 Bacteria 2143
813 Ga0466970_0015793 3300044765 Bacteria 3887
814 Ga0466970_0018885 3300044765 Bacteria 3570
815 Ga0466970_0041527 3300044765 Bacteria 2444
816 Ga0466957_0001548 3300044842 Bacteria 12099
817 Ga0466957_0013787 3300044842 Bacteria 4696
818 Ga0466957_0131477 3300044842 Bacteria 1604
819 Ga0466959_0059278 3300045049 Bacteria 2787
820 Ga0466959_0086949 3300045049 Bacteria 2248
821 Ga0466959_0425139 3300045049 Bacteria 901
822 Ga0466958_0017411 3300045836 Bacteria 4153
823 Ga0466958_0063706 3300045836 Bacteria 2248
824 Ga0466958_0096927 3300045836 Bacteria 1830
825 Ga0466958_0116963 3300045836 Bacteria 1667
826 Ga0466967_0104109 3300045976 Bacteria 2598
827 Ga0466967_0174449 3300045976 Bacteria 2025
828 Ga0466967_0215765 3300045976 Bacteria 1821
829 Ga0466967_0300392 3300045976 Bacteria 1544
830 Ga0466967_0459947 3300045976 Bacteria 1244
831 Ga0466967_0586481 3300045976 Bacteria 1099
832 Ga0495627_000353 3300046453 Bacteria 43133
833 Ga0495627_000615 3300046453 Bacteria 28285
834 Ga0495592_0000241 3300046454 Bacteria 46812
835 Ga0495603_0130304 3300046455 Bacteria 1465
836 Ga0495629_0015097 3300046459 Bacteria 5552
837 Ga0495638_0088182 3300046460 Bacteria 1873
838 Ga0495651_0000555 3300046462 Bacteria 28819
839 Ga0495651_0020950 3300046462 Bacteria 5076
840 Ga0495651_0071936 3300046462 Bacteria 2628
841 Ga0495653_0000103 3300046463 Bacteria 69772
842 Ga0495580_0023628 3300046472 Bacteria 4510
843 Ga0495582_0106757 3300046473 Bacteria 1571
844 Ga0495639_0087870 3300046475 Bacteria 1455
845 Ga0495662_0012843 3300046476 Bacteria 4082
846 Ga0495664_0000003 3300046477 Bacteria 551602
847 Ga0495664_0005148 3300046477 Bacteria 7173
848 Ga0495594_0159278 3300046499 Bacteria 1283
849 Ga0495607_0013505 3300046501 Bacteria 5350
850 Ga0495583_0004819 3300046506 Bacteria 9455
851 Ga0495606_0068911 3300046507 Bacteria 2237
852 Ga0495608_0000131 3300046511 Bacteria 53612
853 Ga0495608_0002138 3300046511 Bacteria 14259
854 Ga0495608_0043182 3300046511 Bacteria 3013
855 Ga0495610_0000186 3300046512 Bacteria 69408
856 Ga0495610_0047236 3300046512 Bacteria 2119
857 Ga0495618_0000019 3300046514 Bacteria 136770
858 Ga0495628_0000080 3300046516 Bacteria 75108
859 Ga0495628_0052855 3300046516 Bacteria 3208
860 Ga0495628_0129636 3300046516 Bacteria 1930
861 Ga0495630_0000989 3300046517 Bacteria 19766
862 Ga0495630_0027488 3300046517 Bacteria 4222
863 Ga0495632_0129557 3300046519 Bacteria 1175
864 Ga0495637_0018683 3300046520 Bacteria 3212
865 Ga0495637_0045769 3300046520 Bacteria 1854
866 Ga0495637_0080112 3300046520 Bacteria 1303
867 Ga0495643_0001215 3300046522 Bacteria 24923
868 Ga0495643_0004105 3300046522 Bacteria 10360
869 Ga0495648_0043810 3300046524 Bacteria 2801
870 Ga0495652_0000006 3300046529 Bacteria 459709
871 Ga0495652_0256481 3300046529 Bacteria 1293
872 Ga0495640_0000002 3300046533 Bacteria 646434
873 Ga0495640_0027742 3300046533 Bacteria 4081
874 Ga0495640_0056264 3300046533 Bacteria 2688
875 Ga0495640_0170358 3300046533 Bacteria 1391
876 Ga0495587_0000001 3300046536 Bacteria 724132
877 Ga0495587_0071295 3300046536 Bacteria 2021
878 Ga0495645_0000009 3300046543 Bacteria 239632
879 Ga0495645_0001435 3300046543 Bacteria 16064
880 Ga0495645_0115662 3300046543 Bacteria 1894
881 Ga0495633_0002461 3300046558 Bacteria 13068
882 Ga0495667_0000021 3300046559 Bacteria 180625
883 Ga0495667_0029141 3300046559 Bacteria 3715
884 Ga0495667_0251498 3300046559 Bacteria 1125
885 Ga0495668_0000258 3300046616 Bacteria 75022
886 Ga0495668_0018062 3300046616 Bacteria 4082
887 Ga0495668_0119050 3300046616 Bacteria 1444
888 Ga0495634_0000396 3300046642 Bacteria 42784
889 Ga0495634_0017941 3300046642 Bacteria 5044
890 Ga0495634_0182947 3300046642 Bacteria 1311
891 Ga0495634_0198400 3300046642 Bacteria 1248
892 Ga0495611_0004123 3300046648 Bacteria 6330
893 Ga0495625_0076122 3300046660 Bacteria 2347
894 Ga0495625_0089169 3300046660 Bacteria 2135
895 Ga0495635_0000001 3300046663 Bacteria 704901
896 Ga0495635_0040769 3300046663 Bacteria 3208
897 Ga0495657_0000088 3300046675 Bacteria 81307
898 Ga0495657_0066311 3300046675 Bacteria 2372
899 Ga0495599_0000025 3300046678 Bacteria 120337
900 Ga0495623_0000018 3300046679 Bacteria 107338
901 Ga0495623_0040784 3300046679 Bacteria 2963
902 Ga0495623_0170245 3300046679 Bacteria 1273
903 Ga0495646_0000003 3300046680 Bacteria 287773
904 Ga0495658_0000497 3300046683 Bacteria 21583
905 Ga0495669_0000096 3300046684 Bacteria 56184
906 Ga0495624_0046274 3300046690 Bacteria 2767
907 Ga0495624_0163952 3300046690 Bacteria 1357
908 Ga0495600_0000042 3300046809 Bacteria 74873
909 Ga0495581_0008078 3300047315 Bacteria 6092
910 Ga0495604_0000008 3300047317 Bacteria 341160
911 Ga0495674_0000028 3300047319 Bacteria 124722
912 Ga0495674_0043205 3300047319 Bacteria 4013
913 Ga0495674_0076822 3300047319 Bacteria 2872
914 Ga0495674_0192162 3300047319 Bacteria 1696
915 Ga0495674_0350370 3300047319 Bacteria 1199
916 Ga0495680_0001113 3300047322 Bacteria 29690
917 Ga0495687_000378 3300047443 Bacteria 55453
918 Ga0495675_0000691 3300047444 Bacteria 21173
919 Ga0495675_0018021 3300047444 Bacteria 4477
920 Ga0495677_0002781 3300047445 Bacteria 6826
921 Ga0495681_0000110 3300047470 Bacteria 70960
922 Ga0495684_0000002 3300047471 Bacteria 341216
923 Ga0495684_0074731 3300047471 Bacteria 2575
924 Ga0495686_0029419 3300047472 Bacteria 3574
925 Ga0495686_0066427 3300047472 Bacteria 2228
926 Ga0495593_0005631 3300047673 Bacteria 7394
927 Ga0495602_0000022 3300048088 Bacteria 163672
928 Ga0495602_0001350 3300048088 Bacteria 24223
929 Ga0495602_0023164 3300048088 Bacteria 6058
930 Ga0495615_0022915 3300048090 Bacteria 1426
931 Ga0496101_0091665 3300048904 Bacteria 2262
932 Ga0496101_0164931 3300048904 Bacteria 1701
933 Ga0496101_0283930 3300048904 Bacteria 1294
934 Ga0496102_0008864 3300048905 Bacteria 8634
935 Ga0496102_0023431 3300048905 Bacteria 5484
936 Ga0496102_0059494 3300048905 Bacteria 3494
937 Ga0496103_0002167 3300048906 Bacteria 12476
938 Ga0496103_0039827 3300048906 Bacteria 2888
939 Ga0496104_0000040 3300048907 Bacteria 162886
940 Ga0496104_0000316 3300048907 Bacteria 43064
941 Ga0496104_0002075 3300048907 Bacteria 17406
942 Ga0496104_0035963 3300048907 Bacteria 4626
943 Ga0496104_0096964 3300048907 Bacteria 2821
944 Ga0496104_0165598 3300048907 Bacteria 2120
945 Ga0496104_0403309 3300048907 Bacteria 1279
946 Ga0496105_0000060 3300048908 Bacteria 86019
947 Ga0496105_0026202 3300048908 Bacteria 4753
948 Ga0496105_0036677 3300048908 Bacteria 4039
949 Ga0496106_0000674 3300048909 Bacteria 24467
950 Ga0496107_0002521 3300048910 Bacteria 11914
951 Ga0496107_0111587 3300048910 Bacteria 2010
952 Ga0496108_0005349 3300048911 Bacteria 10379
953 Ga0496108_0021285 3300048911 Bacteria 5330
954 Ga0496108_0108637 3300048911 Bacteria 2370
955 Ga0496109_0070289 3300048912 Bacteria 3212
956 Ga0496109_0076001 3300048912 Bacteria 3089
957 Ga0496110_0002032 3300048913 Bacteria 15081
958 Ga0496111_0030447 3300048914 Bacteria 3837
959 Ga0496111_0042787 3300048914 Bacteria 3253
960 Ga0496111_0084443 3300048914 Bacteria 2321
961 Ga0496111_0139830 3300048914 Bacteria 1794
962 Ga0496112_0004086 3300048915 Bacteria 12259
963 Ga0496112_0027234 3300048915 Bacteria 5512
964 Ga0496112_0317958 3300048915 Bacteria 1501
965 Ga0496112_0339454 3300048915 Bacteria 1446
966 Ga0496112_0432041 3300048915 Bacteria 1255
967 Ga0496113_0004024 3300048916 Bacteria 8946
968 Ga0496113_0040657 3300048916 Bacteria 3427
969 Ga0496113_0246116 3300048916 Bacteria 1427
970 Ga0496115_0028629 3300048918 Bacteria 4368
971 Ga0496115_0060528 3300048918 Bacteria 3051
972 Ga0496115_0096158 3300048918 Bacteria 2425
973 Ga0496119_0002688 3300048922 Bacteria 19208
974 Ga0496121_0147076 3300048924 Bacteria 1739
975 Ga0496123_0129844 3300048926 Bacteria 1398
976 Ga0496124_0232116 3300048927 Bacteria 1379
977 Ga0496125_0009891 3300048928 Bacteria 9701
978 Ga0496125_0292461 3300048928 Bacteria 1002
979 Ga0496126_0002680 3300048929 Bacteria 23522
980 Ga0496126_0091139 3300048929 Bacteria 2681
981 Ga0496126_0091998 3300048929 Bacteria 2666
982 Ga0496126_0195334 3300048929 Bacteria 1712
983 Ga0495678_015954 3300049459 Bacteria 3447
984 Ga0495682_0005841 3300049460 Bacteria 5055
985 Ga0501031_0014292 3300049568 Bacteria 5163
986 Ga0501031_0022369 3300049568 Bacteria 4121
987 Ga0501031_0060240 3300049568 Bacteria 2474
988 Ga0501032_0011626 3300049569 Bacteria 6312
989 Ga0501032_0026639 3300049569 Bacteria 3974
990 Ga0501032_0181853 3300049569 Bacteria 1376
991 Ga0501033_0000385 3300049570 Bacteria 42475
992 Ga0501033_0003573 3300049570 Bacteria 12720
993 Ga0501033_0010904 3300049570 Bacteria 6967
994 Ga0501033_0089119 3300049570 Bacteria 2257
995 Ga0501033_0095068 3300049570 Bacteria 2178
996 Ga0501033_0120461 3300049570 Bacteria 1905
997 Ga0501033_0165665 3300049570 Bacteria 1589
998 Ga0501034_0001717 3300049571 Bacteria 28196
999 Ga0501034_0005576 3300049571 Bacteria 13711
1000 Ga0501034_0006988 3300049571 Bacteria 12053
1001 Ga0501034_0009108 3300049571 Bacteria 10426
1002 Ga0501034_0009494 3300049571 Bacteria 10183
1003 Ga0501034_0054483 3300049571 Bacteria 4026
1004 Ga0501034_0061063 3300049571 Bacteria 3786
1005 Ga0501034_0072766 3300049571 Bacteria 3446
1006 Ga0501034_0142028 3300049571 Bacteria 2380
1007 Ga0501034_0193315 3300049571 Bacteria 1996
1008 Ga0501034_0199574 3300049571 Bacteria 1959
1009 Ga0501034_0237408 3300049571 Bacteria 1770
1010 Ga0501034_0313760 3300049571 Bacteria 1502
1011 Ga0501036_0005785 3300049572 Bacteria 10021
1012 Ga0501036_0123265 3300049572 Bacteria 2189
1013 Ga0501036_0177235 3300049572 Bacteria 1795
1014 Ga0501037_0000049 3300049573 Bacteria 113246
1015 Ga0501037_0002948 3300049573 Bacteria 12337
1016 Ga0501037_0008002 3300049573 Bacteria 7747
1017 Ga0501037_0124211 3300049573 Bacteria 1854
1018 Ga0501037_0263761 3300049573 Bacteria 1203
1019 Ga0501037_0316101 3300049573 Bacteria 1082
1020 Ga0501037_0350299 3300049573 Bacteria 1019
1021 Ga0501038_0000010 3300049574 Bacteria 182652
1022 Ga0501038_0000843 3300049574 Bacteria 27250
1023 Ga0501038_0028450 3300049574 Bacteria 4966
1024 Ga0501038_0052840 3300049574 Bacteria 3501
1025 Ga0501038_0089951 3300049574 Bacteria 2574
1026 Ga0501038_0143461 3300049574 Bacteria 1952
1027 Ga0501038_0194151 3300049574 Bacteria 1632
1028 Ga0501039_0006533 3300049575 Bacteria 8854
1029 Ga0501043_0000006 3300049579 Bacteria 234413
1030 Ga0501043_0010724 3300049579 Bacteria 7178
1031 Ga0501043_0049522 3300049579 Bacteria 3303
1032 Ga0501046_0000035 3300049580 Bacteria 161495
1033 Ga0501046_0003200 3300049580 Bacteria 15070
1034 Ga0501046_0012717 3300049580 Bacteria 7157
1035 Ga0501047_0006810 3300049581 Bacteria 10739
1036 Ga0501047_0010868 3300049581 Bacteria 8605
1037 Ga0501047_0013059 3300049581 Bacteria 7867
1038 Ga0501047_0092119 3300049581 Bacteria 2909
1039 Ga0501047_0167775 3300049581 Bacteria 2065
1040 Ga0501047_0313049 3300049581 Bacteria 1410
1041 Ga0501047_0505445 3300049581 Bacteria 1035
1042 Ga0501048_0003240 3300049582 Bacteria 12399
1043 Ga0501048_0098135 3300049582 Bacteria 2067
1044 Ga0501067_0003372 3300049583 Bacteria 8781
1045 Ga0501067_0015846 3300049583 Bacteria 4169
1046 Ga0501067_0055584 3300049583 Bacteria 2193
1047 Ga0501067_0063225 3300049583 Bacteria 2049
1048 Ga0501068_0001776 3300049584 Bacteria 11468
1049 Ga0501068_0010765 3300049584 Bacteria 5143
1050 Ga0501068_0032115 3300049584 Bacteria 3121
1051 Ga0501068_0072378 3300049584 Bacteria 2105
1052 Ga0501069_0000141 3300049585 Bacteria 31844
1053 Ga0501069_0006219 3300049585 Bacteria 6237
1054 Ga0501069_0031823 3300049585 Bacteria 2903
1055 Ga0501069_0103639 3300049585 Bacteria 1616
1056 Ga0501070_0000024 3300049586 Bacteria 159781
1057 Ga0501070_0000081 3300049586 Bacteria 81543
1058 Ga0501070_0000254 3300049586 Bacteria 50216
1059 Ga0501070_0003223 3300049586 Bacteria 14190
1060 Ga0501070_0008662 3300049586 Bacteria 8600
1061 Ga0501070_0012129 3300049586 Bacteria 7275
1062 Ga0501070_0023248 3300049586 Bacteria 5191
1063 Ga0501070_0025471 3300049586 Bacteria 4961
1064 Ga0501070_0030575 3300049586 Bacteria 4513
1065 Ga0501070_0058101 3300049586 Bacteria 3206
1066 Ga0501070_0063974 3300049586 Bacteria 3047
1067 Ga0501070_0065460 3300049586 Bacteria 3009
1068 Ga0501070_0128281 3300049586 Bacteria 2096
1069 Ga0501070_0163411 3300049586 Bacteria 1835
1070 Ga0501070_0361742 3300049586 Bacteria 1177
1071 Ga0501071_0018083 3300049587 Bacteria 4874
1072 Ga0501071_0067976 3300049587 Bacteria 2592
1073 Ga0501071_0081436 3300049587 Bacteria 2369
1074 Ga0501072_0010755 3300049588 Bacteria 6973
1075 Ga0501072_0122482 3300049588 Bacteria 2072
1076 Ga0501072_0135142 3300049588 Bacteria 1966
1077 Ga0501073_0015833 3300049589 Bacteria 5464
1078 Ga0501073_0019692 3300049589 Bacteria 4870
1079 Ga0501073_0024481 3300049589 Bacteria 4335
1080 Ga0501073_0029021 3300049589 Bacteria 3953
1081 Ga0501073_0046862 3300049589 Bacteria 3039
1082 Ga0501073_0051648 3300049589 Bacteria 2879
1083 Ga0501073_0083510 3300049589 Bacteria 2222
1084 Ga0501073_0111541 3300049589 Bacteria 1897
1085 Ga0501073_0234866 3300049589 Bacteria 1266
1086 Ga0501073_0368523 3300049589 Bacteria 992
1087 Ga0501074_0000011 3300049590 Bacteria 93181
1088 Ga0501074_0003356 3300049590 Bacteria 11346
1089 Ga0501074_0018814 3300049590 Bacteria 5017
1090 Ga0501074_0071243 3300049590 Bacteria 2499
1091 Ga0501074_0107374 3300049590 Bacteria 1999
1092 Ga0501074_0146591 3300049590 Bacteria 1688
1093 Ga0501075_0097733 3300049591 Bacteria 2228
1094 Ga0501076_0004022 3300049592 Bacteria 10391
1095 Ga0501076_0032561 3300049592 Bacteria 4069
1096 Ga0501077_0001770 3300049593 Bacteria 13042
1097 Ga0501257_006979 3300049686 Bacteria 2516
1098 Ga0501079_0033484 3300049741 Bacteria 3953
1099 Ga0501079_0046635 3300049741 Bacteria 3344
1100 Ga0501079_0138816 3300049741 Bacteria 1893
1101 Ga0501079_0188434 3300049741 Bacteria 1610
1102 Ga0501079_0338998 3300049741 Bacteria 1178
1103 Ga0501080_0001944 3300049742 Bacteria 17847
1104 Ga0501080_0002670 3300049742 Bacteria 15612
1105 Ga0501080_0002884 3300049742 Bacteria 15122
1106 Ga0501080_0011105 3300049742 Bacteria 8241
1107 Ga0501080_0019967 3300049742 Bacteria 6202
1108 Ga0501080_0026141 3300049742 Bacteria 5423
1109 Ga0501080_0043428 3300049742 Bacteria 4186
1110 Ga0501080_0068934 3300049742 Bacteria 3290
1111 Ga0501080_0095249 3300049742 Bacteria 2764
1112 Ga0501080_0158149 3300049742 Bacteria 2093
1113 Ga0501080_0186438 3300049742 Bacteria 1907
1114 Ga0501080_0349284 3300049742 Bacteria 1336
1115 Ga0501081_0007060 3300049743 Bacteria 7302
1116 Ga0501081_0048889 3300049743 Bacteria 2911
1117 Ga0501083_0000338 3300049744 Bacteria 29749
1118 Ga0501083_0010892 3300049744 Bacteria 6397
1119 Ga0501035_0000068 3300049822 Bacteria 128392
1120 Ga0501035_0000371 3300049822 Bacteria 51668
1121 Ga0501035_0000695 3300049822 Bacteria 36638
1122 Ga0501035_0004271 3300049822 Bacteria 13564
1123 Ga0501035_0009698 3300049822 Bacteria 8957
1124 Ga0501035_0029527 3300049822 Bacteria 5000
1125 Ga0501035_0057030 3300049822 Bacteria 3483
1126 Ga0501035_0095699 3300049822 Bacteria 2610
1127 Ga0501035_0099572 3300049822 Bacteria 2551
1128 Ga0501035_0147032 3300049822 Bacteria 2046
1129 Ga0501035_0147823 3300049822 Bacteria 2040
1130 Ga0501035_0207155 3300049822 Bacteria 1679
1131 Ga0501035_0431924 3300049822 Bacteria 1092
1132 Ga0501044_0000082 3300049823 Bacteria 115127
1133 Ga0501044_0002209 3300049823 Bacteria 22334
1134 Ga0501044_0013515 3300049823 Bacteria 8828
1135 Ga0501044_0019534 3300049823 Bacteria 7246
1136 Ga0501044_0020418 3300049823 Bacteria 7074
1137 Ga0501044_0026362 3300049823 Bacteria 6153
1138 Ga0501044_0033513 3300049823 Bacteria 5397
1139 Ga0501044_0042427 3300049823 Bacteria 4732
1140 Ga0501044_0059040 3300049823 Bacteria 3932
1141 Ga0501044_0081092 3300049823 Bacteria 3285
1142 Ga0501044_0087370 3300049823 Bacteria 3149
1143 Ga0501044_0114874 3300049823 Bacteria 2697
1144 Ga0501044_0125060 3300049823 Bacteria 2569
1145 Ga0501044_0193349 3300049823 Bacteria 1996
1146 Ga0501044_0247551 3300049823 Bacteria 1725
1147 Ga0501044_0435360 3300049823 Bacteria 1220
1148 Ga0501045_0371486 3300049824 Bacteria 1064
1149 nmdc:mga03n38_238014_c1 3300050490 Bacteria 957
1150 nmdc:mga03n38_54946_c1 3300050490 Bacteria 1792
1151 nmdc:mga03n38_595_c1 3300050490 Bacteria 9212
1152 nmdc:mga03n38_73454_c1 3300050490 Bacteria 1588
1153 nmdc:mga00v17_148556_c1 3300050491 Bacteria 1505
1154 nmdc:mga00v17_5162_c1 3300050491 Bacteria 6868
1155 nmdc:mga0yw44_207906_c1 3300050492 Bacteria 1294
1156 nmdc:mga0yw44_2703_c1 3300050492 Bacteria 7651
1157 nmdc:mga0yw44_50038_c1 3300050492 Bacteria 2525
1158 nmdc:mga0k408_88267_c1 3300050493 Bacteria 1821
1159 nmdc:mga06z11_123_c1 3300050494 Bacteria 31898
1160 nmdc:mga06z11_40694_c1 3300050494 Bacteria 2321
1161 nmdc:mga06z11_65058_c1 3300050494 Bacteria 1913
1162 nmdc:mga06z11_87811_c1 3300050494 Bacteria 1683
1163 nmdc:mga04h51_46045_c1 3300050495 Bacteria 1445
1164 nmdc:mga05p37_197560_c1 3300050507 Bacteria 2438
1165 nmdc:mga05p37_2001_c1 3300050507 Bacteria 23793
1166 nmdc:mga05p37_216337_c1 3300050507 Bacteria 2314
1167 nmdc:mga05p37_564_c1 3300050507 Bacteria 40786
1168 nmdc:mga05p37_94737_c1 3300050507 Bacteria 3678
1169 nmdc:mga09592_20905_c1 3300050508 Bacteria 5390
1170 nmdc:mga09592_287282_c1 3300050508 Bacteria 1426
1171 nmdc:mga09592_430002_c1 3300050508 Bacteria 1140
1172 nmdc:mga09592_47868_c1 3300050508 Bacteria 3604
1173 nmdc:mga0qj67_21757_c1 3300050509 Bacteria 4920
1174 nmdc:mga0qj67_3413_c1 3300050509 Bacteria 11462
1175 nmdc:mga0qj67_46501_c1 3300050509 Bacteria 3426
1176 nmdc:mga06r32_150255_c1 3300050510 Bacteria 2307
1177 nmdc:mga06r32_191_c1 3300050510 Bacteria 49056
1178 nmdc:mga06r32_335094_c1 3300050510 Bacteria 1498
1179 nmdc:mga06r32_4147_c1 3300050510 Bacteria 12977
1180 nmdc:mga08y16_272171_c1 3300050511 Bacteria 1748
1181 nmdc:mga08y16_67805_c1 3300050511 Bacteria 3722
1182 nmdc:mga08y16_82_c1 3300050511 Bacteria 81080
1183 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
1184 nmdc:mga0n895_110202_c1 3300050512 Bacteria 2768
1185 nmdc:mga0n895_22520_c1 3300050512 Bacteria 5909
1186 nmdc:mga0n895_97197_c1 3300050512 Bacteria 2950
1187 nmdc:mga0rr50_34672_c1 3300050513 Bacteria 3616
1188 nmdc:mga0rr50_81139_c1 3300050513 Bacteria 2502
1189 nmdc:mga08x19_129089_c1 3300050514 Bacteria 1699
1190 nmdc:mga08x19_94_c1 3300050514 Bacteria 79727
1191 nmdc:mga0a205_74953_c1 3300050515 Bacteria 3269
1192 nmdc:mga0sz30_357_c1 3300050516 Bacteria 17392
1193 Ga0495601_0000001 3300053077 Bacteria 549454
1194 Ga0495601_0000911 3300053077 Bacteria 16102
1195 Ga0495601_0046582 3300053077 Bacteria 2730
1196 Ga0495601_0287949 3300053077 Bacteria 1071
1197 Ga0495612_0000003 3300053078 Bacteria 303629
1198 Ga0495612_0000639 3300053078 Bacteria 14049
1199 Ga0500610_0000197 3300053079 Bacteria 18347
1200 Ga0495595_0000093 3300053084 Bacteria 42083
1201 Ga0495619_0000004 3300053085 Bacteria 500068
1202 Ga0495619_0050091 3300053085 Bacteria 2756
1203 Ga0495619_0230697 3300053085 Bacteria 1282
1204 Ga0500578_0118312 3300053086 Bacteria 1667
1205 Ga0500647_0030771 3300053091 Bacteria 2551
1206 Ga0500651_0006181 3300053093 Bacteria 6880
1207 Ga0500566_0166802 3300053094 Bacteria 1142
1208 Ga0500641_0000277 3300053096 Bacteria 19051
1209 Ga0500641_0020633 3300053096 Bacteria 2502
1210 Ga0500562_000173 3300053108 Bacteria 17722
1211 Ga0500595_013327 3300053119 Bacteria 3152
1212 Ga0500595_021227 3300053119 Bacteria 2321
1213 Ga0500597_002095 3300053120 Bacteria 5399
1214 Ga0500618_004151 3300053125 Bacteria 4733
1215 Ga0500642_0009494 3300053130 Bacteria 3380
1216 Ga0500652_000056 3300053131 Bacteria 51871
1217 Ga0500655_000024 3300053133 Bacteria 43300
1218 Ga0500655_010896 3300053133 Bacteria 1644
1219 Ga0500658_0050268 3300053134 Bacteria 1701
1220 Ga0500658_0056297 3300053134 Bacteria 1622
1221 Ga0500561_0040921 3300053137 Bacteria 1223
1222 Ga0500573_0000046 3300053140 Bacteria 98723
1223 Ga0500590_000243 3300053148 Bacteria 16712
1224 Ga0500604_0002073 3300053151 Bacteria 5523
1225 Ga0500616_0003666 3300053153 Bacteria 11519
1226 Ga0500616_0062964 3300053153 Bacteria 1914
1227 Ga0500619_005042 3300053154 Bacteria 2904
1228 Ga0500622_0011869 3300053156 Bacteria 4735
1229 Ga0500624_000001 3300053157 Bacteria 284974
1230 Ga0500627_0046749 3300053158 Bacteria 1876
1231 Ga0500636_0010157 3300053177 Bacteria 5489
1232 Ga0500636_0060093 3300053177 Bacteria 2219
1233 Ga0500637_0000010 3300053178 Bacteria 81649
1234 Ga0500570_000188 3300053724 Bacteria 19563
1235 Ga0500645_000008 3300053730 Bacteria 212254
1236 Ga0500552_003131 3300053733 Bacteria 1656
1237 Ga0501084_0000363 3300054114 Bacteria 34695
1238 Ga0501084_0006757 3300054114 Bacteria 9429
1239 Ga0501084_0028335 3300054114 Bacteria 4681
1240 Ga0501084_0071402 3300054114 Bacteria 2907
1241 Ga0501084_0075852 3300054114 Bacteria 2817
1242 Ga0501084_0127741 3300054114 Bacteria 2140
1243 Ga0501082_0002420 3300060353 Bacteria 16378
1244 Ga0501082_0012588 3300060353 Bacteria 7270
1245 Ga0501082_0016405 3300060353 Bacteria 6376
1246 Ga0501082_0071723 3300060353 Bacteria 2983
1247 Ga0501082_0087693 3300060353 Bacteria 2685
1248 Ga0501082_0137163 3300060353 Bacteria 2123
1249 Ga0501082_0289568 3300060353 Bacteria 1426
1250 Ga0466962_0000607 3300061719 Bacteria 15864
1251 Ga0466962_0014485 3300061719 Bacteria 3801
1252 Ga0466962_0074237 3300061719 Bacteria 1625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0350299 Ga0501037_0350299_21_791 252
2 3300020082 Ga0206353_11504462 Ga0206353_115044622 271
3 3300035119 Ga0373956_0035196 Ga0373956_0035196_1364_2197 275
4 3300006847 Ga0075431_100136702 Ga0075431_1001367022 276
5 3300009147 Ga0114129_10589531 Ga0114129_105895312 276
6 3300050510 nmdc:mga06r32_150255_c1 nmdc:mga06r32_150255_c1_1281_2249 276
7 iso_pu_bacteria 2909399089 2909403067 281
8 3300013296 Ga0157374_10024477 Ga0157374_100244777 284
9 3300045049 Ga0466959_0425139 Ga0466959_0425139_14_868 284
10 3300050490 nmdc:mga03n38_238014_c1 nmdc:mga03n38_238014_c1_11_874 284
11 3300061719 Ga0466962_0000607 Ga0466962_0000607_19_873 284
12 3300006846 Ga0075430_100084206 Ga0075430_1000842062 290
13 3300006847 Ga0075431_100006971 Ga0075431_1000069712 290
14 3300050508 nmdc:mga09592_287282_c1 nmdc:mga09592_287282_c1_394_1347 290
15 3300050509 nmdc:mga0qj67_3413_c1 nmdc:mga0qj67_3413_c1_697_1650 290
16 3300050510 nmdc:mga06r32_4147_c1 nmdc:mga06r32_4147_c1_10841_11794 290
17 3300032005 Ga0307411_10007821 Ga0307411_100078214 295
18 3300037418 Ga0395900_0110853 Ga0395900_0110853_1567_2616 295
19 3300037466 Ga0395898_0299275 Ga0395898_0299275_179_1228 295
20 3300037471 Ga0395905_0038530 Ga0395905_0038530_764_1813 295
21 3300037312 Ga0395899_0045807 Ga0395899_0045807_2332_3222 296
22 3300037471 Ga0395905_0000490 Ga0395905_0000490_16038_17084 296
23 3300006844 Ga0075428_100109364 Ga0075428_1001093642 300
24 3300005844 Ga0068862_100011492 Ga0068862_1000114925 301
25 3300006846 Ga0075430_100182139 Ga0075430_1001821391 301
26 3300009094 Ga0111539_10462833 Ga0111539_104628331 301
27 3300028380 Ga0268265_10003811 Ga0268265_100038116 301
28 3300049573 Ga0501037_0316101 Ga0501037_0316101_49_1029 301
29 3300053153 Ga0500616_0003666 Ga0500616_0003666_1232_2200 301
30 3300060353 Ga0501082_0289568 Ga0501082_0289568_293_1273 301
31 3300039438 Ga0436360_0865765 Ga0436360_0865765_540_1496 302
32 3300047472 Ga0495686_0029419 Ga0495686_0029419_789_1736 302
33 3300045976 Ga0466967_0215765 Ga0466967_0215765_147_1142 303
34 3300005563 Ga0068855_100808508 Ga0068855_1008085081 306
35 3300037471 Ga0395905_0044910 Ga0395905_0044910_1051_2082 307
36 iso_pu_bacteria 2524023250 2524609436 307
37 3300031852 Ga0307410_10017956 Ga0307410_100179563 308
38 3300032005 Ga0307411_10010197 Ga0307411_100101975 308
39 3300049589 Ga0501073_0111541 Ga0501073_0111541_679_1635 308
40 3300049742 Ga0501080_0043428 Ga0501080_0043428_2721_3677 308
41 iso_pu_bacteria 2643221550 2643771757 308
42 iso_pu_bacteria 2643221623 2644130850 308
43 iso_pu_bacteria 2842775625 2842778881 308
44 iso_pu_bacteria 2883577096 2883581621 308
45 iso_pu_bacteria 2894772417 2894773497 308
46 iso_pu_bacteria 2929199973 2929204729 308
47 iso_pu_bacteria 2937843397 2937845187 308
48 iso_pu_bacteria 2996336353 2996341328 308
49 iso_pu_bacteria 641228493 641336132 308
50 iso_pu_bacteria 643348555 643389932 308
51 iso_pu_bacteria 8002285264 8002290230 308
52 iso_pu_bacteria 8055909800 8055913475 308
53 iso_pu_bacteria 2523231067 2523467723 309
54 iso_pu_bacteria 2582581305 2585260459 309
55 iso_pu_bacteria 2671180139 2671692524 309
56 iso_pu_bacteria 2738543031 2739349174 309
57 iso_pu_bacteria 2839993093 2839997936 309
58 iso_pu_bacteria 2840764183 2840765569 309
59 iso_pu_bacteria 2894652903 2894654142 309
60 iso_pu_bacteria 2904578770 2904580407 309
61 iso_pu_bacteria 2919119836 2919119918 309
62 3300003320 rootH2_10006377 rootH2_1000637740 310
63 3300021377 Ga0213874_10001553 Ga0213874_100015533 310
64 3300031711 Ga0265314_10165398 Ga0265314_101653981 310
65 3300049580 Ga0501046_0000035 Ga0501046_0000035_47428_48459 310
66 3300049823 Ga0501044_0247551 Ga0501044_0247551_118_1065 310
67 iso_pu_bacteria 2885429604 2885429969 310
68 iso_pu_bacteria 2928027323 2928027665 310
69 iso_pu_bacteria 2984555340 2984558041 310
70 iso_pu_bacteria 2984564862 2984567591 310
71 iso_pu_bacteria 2993356040 2993358644 310
72 3300005437 Ga0070710_10181264 Ga0070710_101812641 311
73 3300005457 Ga0070662_100182915 Ga0070662_1001829152 311
74 3300005458 Ga0070681_10099789 Ga0070681_100997892 311
75 3300005458 Ga0070681_10145238 Ga0070681_101452382 311
76 3300005578 Ga0068854_100063265 Ga0068854_1000632653 311
77 3300005937 Ga0081455_10000149 Ga0081455_100001497 311
78 3300014968 Ga0157379_10473095 Ga0157379_104730951 311
79 3300024225 Ga0224572_1003951 Ga0224572_10039513 311
80 3300024225 Ga0224572_1012161 Ga0224572_10121612 311
81 3300024227 Ga0228598_1009795 Ga0228598_10097951 311
82 3300026041 Ga0207639_10029891 Ga0207639_100298912 311
83 3300031548 Ga0307408_100189182 Ga0307408_1001891822 311
84 3300031731 Ga0307405_10042115 Ga0307405_100421152 311
85 3300031911 Ga0307412_10020774 Ga0307412_100207742 311
86 3300031995 Ga0307409_100052374 Ga0307409_1000523743 311
87 3300032002 Ga0307416_100044905 Ga0307416_1000449052 311
88 3300036401 Ga0373937_0073318 Ga0373937_0073318_354_1310 311
89 3300037312 Ga0395899_0015917 Ga0395899_0015917_406_1380 311
90 3300037418 Ga0395900_0004045 Ga0395900_0004045_7709_8683 311
91 3300037418 Ga0395900_0015042 Ga0395900_0015042_6428_7402 311
92 3300037466 Ga0395898_0012308 Ga0395898_0012308_6267_7241 311
93 3300037466 Ga0395898_0057536 Ga0395898_0057536_1568_2542 311
94 3300049568 Ga0501031_0060240 Ga0501031_0060240_1360_2307 311
95 3300049571 Ga0501034_0006988 Ga0501034_0006988_1585_2532 311
96 3300049571 Ga0501034_0199574 Ga0501034_0199574_24_971 311
97 3300049574 Ga0501038_0000010 Ga0501038_0000010_174761_175708 311
98 3300049686 Ga0501257_006979 Ga0501257_006979_789_1742 311
99 3300049823 Ga0501044_0193349 Ga0501044_0193349_905_1852 311
100 3300053108 Ga0500562_000173 Ga0500562_000173_8500_9456 311
101 iso_pu_bacteria 2841911363 2841914659 311
102 3300003203 JGI25406J46586_10002125 JGI25406J46586_1000212512 312
103 3300003203 JGI25406J46586_10004558 JGI25406J46586_100045584 312
104 3300005327 Ga0070658_10001363 Ga0070658_1000136320 312
105 3300005334 Ga0068869_100086347 Ga0068869_1000863471 312
106 3300005336 Ga0070680_100012364 Ga0070680_1000123647 312
107 3300005336 Ga0070680_100217605 Ga0070680_1002176052 312
108 3300005353 Ga0070669_100014161 Ga0070669_1000141617 312
109 3300005355 Ga0070671_100019489 Ga0070671_1000194892 312
110 3300005355 Ga0070671_100140493 Ga0070671_1001404932 312
111 3300005367 Ga0070667_100452247 Ga0070667_1004522471 312
112 3300005434 Ga0070709_10045104 Ga0070709_100451044 312
113 3300005434 Ga0070709_10073352 Ga0070709_100733523 312
114 3300005434 Ga0070709_10213562 Ga0070709_102135622 312
115 3300005435 Ga0070714_100001555 Ga0070714_10000155514 312
116 3300005436 Ga0070713_100066889 Ga0070713_1000668892 312
117 3300005436 Ga0070713_100105035 Ga0070713_1001050353 312
118 3300005436 Ga0070713_100278926 Ga0070713_1002789262 312
119 3300005439 Ga0070711_100033505 Ga0070711_1000335055 312
120 3300005439 Ga0070711_100106035 Ga0070711_1001060351 312
121 3300005439 Ga0070711_100115903 Ga0070711_1001159032 312
122 3300005440 Ga0070705_100000255 Ga0070705_10000025529 312
123 3300005441 Ga0070700_100000791 Ga0070700_10000079112 312
124 3300005445 Ga0070708_100146096 Ga0070708_1001460962 312
125 3300005456 Ga0070678_100022241 Ga0070678_1000222412 312
126 3300005458 Ga0070681_10013587 Ga0070681_100135872 312
127 3300005458 Ga0070681_10033804 Ga0070681_100338046 312
128 3300005458 Ga0070681_10292648 Ga0070681_102926482 312
129 3300005467 Ga0070706_100137911 Ga0070706_1001379112 312
130 3300005468 Ga0070707_100061943 Ga0070707_1000619432 312
131 3300005471 Ga0070698_100209583 Ga0070698_1002095832 312
132 3300005518 Ga0070699_100001711 Ga0070699_10000171119 312
133 3300005518 Ga0070699_100022541 Ga0070699_1000225415 312
134 3300005530 Ga0070679_100008607 Ga0070679_1000086073 312
135 3300005530 Ga0070679_100049485 Ga0070679_1000494851 312
136 3300005535 Ga0070684_100068767 Ga0070684_1000687672 312
137 3300005536 Ga0070697_100003111 Ga0070697_1000031112 312
138 3300005536 Ga0070697_100112469 Ga0070697_1001124692 312
139 3300005545 Ga0070695_100000220 Ga0070695_10000022012 312
140 3300005545 Ga0070695_100112590 Ga0070695_1001125902 312
141 3300005546 Ga0070696_100000497 Ga0070696_10000049715 312
142 3300005546 Ga0070696_100085113 Ga0070696_1000851131 312
143 3300005547 Ga0070693_100039630 Ga0070693_1000396301 312
144 3300005548 Ga0070665_100008964 Ga0070665_10000896412 312
145 3300005548 Ga0070665_100049422 Ga0070665_1000494225 312
146 3300005549 Ga0070704_100008113 Ga0070704_1000081135 312
147 3300005563 Ga0068855_100533468 Ga0068855_1005334682 312
148 3300005577 Ga0068857_100047135 Ga0068857_1000471353 312
149 3300005577 Ga0068857_100092376 Ga0068857_1000923762 312
150 3300005614 Ga0068856_100382471 Ga0068856_1003824712 312
151 3300005617 Ga0068859_100102251 Ga0068859_1001022513 312
152 3300005842 Ga0068858_100302282 Ga0068858_1003022821 312
153 3300005842 Ga0068858_100357961 Ga0068858_1003579612 312
154 3300005843 Ga0068860_100121793 Ga0068860_1001217931 312
155 3300005844 Ga0068862_100000435 Ga0068862_10000043522 312
156 3300005937 Ga0081455_10000211 Ga0081455_1000021112 312
157 3300005937 Ga0081455_10002000 Ga0081455_1000200012 312
158 3300005981 Ga0081538_10006504 Ga0081538_100065046 312
159 3300005985 Ga0081539_10000618 Ga0081539_1000061863 312
160 3300005985 Ga0081539_10000954 Ga0081539_1000095414 312
161 3300005985 Ga0081539_10006940 Ga0081539_100069409 312
162 3300005985 Ga0081539_10010399 Ga0081539_100103994 312
163 3300006028 Ga0070717_10117189 Ga0070717_101171893 312
164 3300006038 Ga0075365_10031254 Ga0075365_100312542 312
165 3300006038 Ga0075365_10099284 Ga0075365_100992841 312
166 3300006048 Ga0075363_100031931 Ga0075363_1000319313 312
167 3300006051 Ga0075364_10030585 Ga0075364_100305853 312
168 3300006051 Ga0075364_10163234 Ga0075364_101632342 312
169 3300006175 Ga0070712_100003438 Ga0070712_10000343815 312
170 3300006175 Ga0070712_100018646 Ga0070712_1000186462 312
171 3300006175 Ga0070712_100048413 Ga0070712_1000484133 312
172 3300006175 Ga0070712_100096860 Ga0070712_1000968602 312
173 3300006178 Ga0075367_10030349 Ga0075367_100303494 312
174 3300006195 Ga0075366_10010922 Ga0075366_100109226 312
175 3300006195 Ga0075366_10026437 Ga0075366_100264371 312
176 3300006931 Ga0097620_100102244 Ga0097620_1001022441 312
177 3300007788 Ga0099795_10014147 Ga0099795_100141472 312
178 3300009093 Ga0105240_10076343 Ga0105240_100763433 312
179 3300009093 Ga0105240_10388079 Ga0105240_103880791 312
180 3300009094 Ga0111539_10003408 Ga0111539_1000340824 312
181 3300009094 Ga0111539_10600315 Ga0111539_106003151 312
182 3300009148 Ga0105243_10246979 Ga0105243_102469791 312
183 3300013104 Ga0157370_10117220 Ga0157370_101172201 312
184 3300013104 Ga0157370_10117302 Ga0157370_101173022 312
185 3300013104 Ga0157370_10156819 Ga0157370_101568192 312
186 3300013104 Ga0157370_10469073 Ga0157370_104690731 312
187 3300013105 Ga0157369_10023244 Ga0157369_100232444 312
188 3300013105 Ga0157369_10083966 Ga0157369_100839663 312
189 3300013296 Ga0157374_10332038 Ga0157374_103320382 312
190 3300020081 Ga0206354_11027225 Ga0206354_110272252 312
191 3300021358 Ga0213873_10056291 Ga0213873_100562911 312
192 3300021361 Ga0213872_10088358 Ga0213872_100883581 312
193 3300021388 Ga0213875_10000674 Ga0213875_1000067421 312
194 3300021388 Ga0213875_10004650 Ga0213875_100046504 312
195 3300021388 Ga0213875_10004811 Ga0213875_100048117 312
196 3300021388 Ga0213875_10007532 Ga0213875_100075322 312
197 3300021388 Ga0213875_10020458 Ga0213875_100204585 312
198 3300021441 Ga0213871_10005226 Ga0213871_100052263 312
199 3300021441 Ga0213871_10018486 Ga0213871_100184862 312
200 3300025906 Ga0207699_10039135 Ga0207699_100391353 312
201 3300025906 Ga0207699_10077590 Ga0207699_100775903 312
202 3300025909 Ga0207705_10288154 Ga0207705_102881542 312
203 3300025910 Ga0207684_10075405 Ga0207684_100754052 312
204 3300025910 Ga0207684_10088784 Ga0207684_100887842 312
205 3300025910 Ga0207684_10097405 Ga0207684_100974052 312
206 3300025910 Ga0207684_10430784 Ga0207684_104307841 312
207 3300025911 Ga0207654_10174227 Ga0207654_101742272 312
208 3300025912 Ga0207707_10003695 Ga0207707_100036953 312
209 3300025912 Ga0207707_10005561 Ga0207707_1000556113 312
210 3300025912 Ga0207707_10320517 Ga0207707_103205172 312
211 3300025913 Ga0207695_10149130 Ga0207695_101491303 312
212 3300025913 Ga0207695_10262908 Ga0207695_102629081 312
213 3300025914 Ga0207671_10359018 Ga0207671_103590182 312
214 3300025915 Ga0207693_10001492 Ga0207693_100014924 312
215 3300025915 Ga0207693_10016004 Ga0207693_100160044 312
216 3300025915 Ga0207693_10018927 Ga0207693_100189276 312
217 3300025915 Ga0207693_10019783 Ga0207693_100197835 312
218 3300025915 Ga0207693_10146564 Ga0207693_101465642 312
219 3300025916 Ga0207663_10025072 Ga0207663_100250722 312
220 3300025917 Ga0207660_10051470 Ga0207660_100514703 312
221 3300025917 Ga0207660_10178237 Ga0207660_101782372 312
222 3300025919 Ga0207657_10050184 Ga0207657_100501842 312
223 3300025921 Ga0207652_10062747 Ga0207652_100627472 312
224 3300025922 Ga0207646_10022399 Ga0207646_100223994 312
225 3300025928 Ga0207700_10175549 Ga0207700_101755492 312
226 3300025929 Ga0207664_10034053 Ga0207664_100340532 312
227 3300025931 Ga0207644_10105586 Ga0207644_101055862 312
228 3300025942 Ga0207689_10102631 Ga0207689_101026312 312
229 3300025944 Ga0207661_10090760 Ga0207661_100907602 312
230 3300025944 Ga0207661_10216926 Ga0207661_102169262 312
231 3300025945 Ga0207679_10153289 Ga0207679_101532892 312
232 3300025961 Ga0207712_10005400 Ga0207712_100054004 312
233 3300026035 Ga0207703_10244799 Ga0207703_102447992 312
234 3300026035 Ga0207703_10344945 Ga0207703_103449452 312
235 3300026075 Ga0207708_10000384 Ga0207708_1000038417 312
236 3300026078 Ga0207702_10330786 Ga0207702_103307862 312
237 3300026078 Ga0207702_10451192 Ga0207702_104511922 312
238 3300026095 Ga0207676_10155364 Ga0207676_101553641 312
239 3300026116 Ga0207674_10015341 Ga0207674_100153416 312
240 3300026116 Ga0207674_10055630 Ga0207674_100556302 312
241 3300026118 Ga0207675_100619089 Ga0207675_1006190891 312
242 3300026121 Ga0207683_10028724 Ga0207683_100287245 312
243 3300027907 Ga0207428_10000203 Ga0207428_1000020346 312
244 3300028379 Ga0268266_10009292 Ga0268266_100092922 312
245 3300028379 Ga0268266_10106600 Ga0268266_101066002 312
246 3300028380 Ga0268265_10000793 Ga0268265_1000079316 312
247 3300028381 Ga0268264_10002765 Ga0268264_100027651 312
248 3300028573 Ga0265334_10002804 Ga0265334_100028047 312
249 3300028800 Ga0265338_10020732 Ga0265338_100207326 312
250 3300031247 Ga0265340_10014313 Ga0265340_100143133 312
251 3300031712 Ga0265342_10086638 Ga0265342_100866382 312
252 3300032004 Ga0307414_10208203 Ga0307414_102082032 312
253 3300035083 Ga0373926_0014359 Ga0373926_0014359_1278_2234 312
254 3300035118 Ga0373954_0008633 Ga0373954_0008633_2878_3834 312
255 3300035119 Ga0373956_0003222 Ga0373956_0003222_4885_5841 312
256 3300035120 Ga0373957_0090602 Ga0373957_0090602_236_1192 312
257 3300035172 Ga0373955_0036945 Ga0373955_0036945_304_1260 312
258 3300035172 Ga0373955_0160865 Ga0373955_0160865_225_1181 312
259 3300035410 Ga0373924_0030474 Ga0373924_0030474_703_1659 312
260 3300035691 Ga0373931_0043536 Ga0373931_0043536_913_1866 312
261 3300035691 Ga0373931_0117728 Ga0373931_0117728_416_1372 312
262 3300035692 Ga0373935_0093528 Ga0373935_0093528_648_1604 312
263 3300035692 Ga0373935_0097538 Ga0373935_0097538_44_997 312
264 3300035692 Ga0373935_0126777 Ga0373935_0126777_251_1204 312
265 3300035692 Ga0373935_0152662 Ga0373935_0152662_131_1087 312
266 3300035695 Ga0373927_0147041 Ga0373927_0147041_309_1265 312
267 3300035695 Ga0373927_0177722 Ga0373927_0177722_251_1204 312
268 3300035724 Ga0373933_0017737 Ga0373933_0017737_755_1711 312
269 3300035724 Ga0373933_0039569 Ga0373933_0039569_1679_2635 312
270 3300035724 Ga0373933_0125479 Ga0373933_0125479_497_1450 312
271 3300035725 Ga0373947_0182087 Ga0373947_0182087_353_1324 312
272 3300035725 Ga0373947_0200265 Ga0373947_0200265_50_1006 312
273 3300036401 Ga0373937_0003891 Ga0373937_0003891_1844_2800 312
274 3300036401 Ga0373937_0006693 Ga0373937_0006693_3036_3992 312
275 3300036401 Ga0373937_0014147 Ga0373937_0014147_1225_2181 312
276 3300036401 Ga0373937_0020900 Ga0373937_0020900_4139_5092 312
277 3300036401 Ga0373937_0091428 Ga0373937_0091428_1165_2121 312
278 3300036401 Ga0373937_0103858 Ga0373937_0103858_1062_2018 312
279 3300036401 Ga0373937_0335086 Ga0373937_0335086_248_1201 312
280 3300037068 Ga0373925_0006090 Ga0373925_0006090_3805_4761 312
281 3300037068 Ga0373925_0053155 Ga0373925_0053155_364_1320 312
282 3300037312 Ga0395899_0103687 Ga0395899_0103687_925_1878 312
283 3300037418 Ga0395900_0004704 Ga0395900_0004704_9061_10014 312
284 3300037418 Ga0395900_0026720 Ga0395900_0026720_2345_3298 312
285 3300037418 Ga0395900_0135244 Ga0395900_0135244_281_1234 312
286 3300037466 Ga0395898_0015527 Ga0395898_0015527_6484_7437 312
287 3300037471 Ga0395905_0030798 Ga0395905_0030798_499_1452 312
288 3300037853 Ga0436364_0315170 Ga0436364_0315170_1385_2341 312
289 3300037853 Ga0436364_0981594 Ga0436364_0981594_6405_7361 312
290 3300037853 Ga0436364_1094905 Ga0436364_1094905_7665_8660 312
291 3300037853 Ga0436364_1123333 Ga0436364_1123333_965_1921 312
292 3300037853 Ga0436364_1183619 Ga0436364_1183619_8274_9230 312
293 3300037853 Ga0436364_1316620 Ga0436364_1316620_26_1000 312
294 3300038443 Ga0395901_0033897 Ga0395901_0033897_3731_4684 312
295 3300038443 Ga0395901_0062128 Ga0395901_0062128_2650_3603 312
296 3300039437 Ga0436365_0385120 Ga0436365_0385120_507_1463 312
297 3300039437 Ga0436365_0452497 Ga0436365_0452497_1012_1965 312
298 3300039437 Ga0436365_0821816 Ga0436365_0821816_77_1030 312
299 3300039437 Ga0436365_1747331 Ga0436365_1747331_79_1032 312
300 3300039438 Ga0436360_0189891 Ga0436360_0189891_142_1098 312
301 3300039438 Ga0436360_0321394 Ga0436360_0321394_336_1292 312
302 3300039438 Ga0436360_0776057 Ga0436360_0776057_224_1180 312
303 3300039438 Ga0436360_1119660 Ga0436360_1119660_191_1147 312
304 3300039438 Ga0436360_1203410 Ga0436360_1203410_9618_10571 312
305 3300039438 Ga0436360_1333994 Ga0436360_1333994_1589_2545 312
306 3300039447 Ga0436361_0007600 Ga0436361_0007600_1131_2084 312
307 3300039447 Ga0436361_0216543 Ga0436361_0216543_42_998 312
308 3300039450 Ga0436363_0055727 Ga0436363_0055727_306_1262 312
309 3300039450 Ga0436363_0792304 Ga0436363_0792304_889_1845 312
310 3300039450 Ga0436363_1377919 Ga0436363_1377919_186_1142 312
311 3300039453 Ga0436362_0692635 Ga0436362_0692635_167_1123 312
312 3300039453 Ga0436362_0958195 Ga0436362_0958195_2747_3703 312
313 3300042001 Ga0439441_006052 Ga0439441_006052_505_1458 312
314 3300044694 Ga0466963_0088879 Ga0466963_0088879_325_1278 312
315 3300044842 Ga0466957_0131477 Ga0466957_0131477_587_1540 312
316 3300045976 Ga0466967_0104109 Ga0466967_0104109_503_1531 312
317 3300045976 Ga0466967_0174449 Ga0466967_0174449_341_1291 312
318 3300046462 Ga0495651_0020950 Ga0495651_0020950_544_1500 312
319 3300046462 Ga0495651_0071936 Ga0495651_0071936_1305_2261 312
320 3300046477 Ga0495664_0005148 Ga0495664_0005148_4262_5218 312
321 3300046511 Ga0495608_0002138 Ga0495608_0002138_7032_7988 312
322 3300046511 Ga0495608_0043182 Ga0495608_0043182_497_1453 312
323 3300046516 Ga0495628_0052855 Ga0495628_0052855_1392_2348 312
324 3300046516 Ga0495628_0129636 Ga0495628_0129636_659_1615 312
325 3300046529 Ga0495652_0256481 Ga0495652_0256481_282_1238 312
326 3300046533 Ga0495640_0056264 Ga0495640_0056264_1381_2337 312
327 3300046533 Ga0495640_0170358 Ga0495640_0170358_244_1200 312
328 3300046536 Ga0495587_0071295 Ga0495587_0071295_13_969 312
329 3300046543 Ga0495645_0001435 Ga0495645_0001435_10659_11615 312
330 3300046559 Ga0495667_0029141 Ga0495667_0029141_1197_2153 312
331 3300046663 Ga0495635_0040769 Ga0495635_0040769_1942_2898 312
332 3300046679 Ga0495623_0040784 Ga0495623_0040784_542_1498 312
333 3300046679 Ga0495623_0170245 Ga0495623_0170245_70_1026 312
334 3300047319 Ga0495674_0043205 Ga0495674_0043205_1810_2766 312
335 3300047319 Ga0495674_0076822 Ga0495674_0076822_790_1746 312
336 3300047444 Ga0495675_0018021 Ga0495675_0018021_2644_3600 312
337 3300047471 Ga0495684_0074731 Ga0495684_0074731_17_973 312
338 3300047472 Ga0495686_0066427 Ga0495686_0066427_370_1320 312
339 3300048088 Ga0495602_0001350 Ga0495602_0001350_8835_9791 312
340 3300048904 Ga0496101_0283930 Ga0496101_0283930_49_1020 312
341 3300048905 Ga0496102_0008864 Ga0496102_0008864_5263_6234 312
342 3300048906 Ga0496103_0002167 Ga0496103_0002167_4297_5268 312
343 3300048907 Ga0496104_0165598 Ga0496104_0165598_676_1647 312
344 3300048909 Ga0496106_0000674 Ga0496106_0000674_2195_3166 312
345 3300048910 Ga0496107_0002521 Ga0496107_0002521_5491_6462 312
346 3300048911 Ga0496108_0108637 Ga0496108_0108637_1189_2160 312
347 3300048915 Ga0496112_0339454 Ga0496112_0339454_345_1298 312
348 3300048915 Ga0496112_0432041 Ga0496112_0432041_65_1021 312
349 3300048916 Ga0496113_0246116 Ga0496113_0246116_376_1347 312
350 3300048918 Ga0496115_0096158 Ga0496115_0096158_937_1887 312
351 3300048927 Ga0496124_0232116 Ga0496124_0232116_37_987 312
352 3300048928 Ga0496125_0009891 Ga0496125_0009891_4791_5741 312
353 3300048929 Ga0496126_0091139 Ga0496126_0091139_1624_2577 312
354 3300049568 Ga0501031_0014292 Ga0501031_0014292_1041_1985 312
355 3300049569 Ga0501032_0011626 Ga0501032_0011626_993_1937 312
356 3300049570 Ga0501033_0000385 Ga0501033_0000385_34391_35335 312
357 3300049570 Ga0501033_0003573 Ga0501033_0003573_6765_7709 312
358 3300049570 Ga0501033_0095068 Ga0501033_0095068_658_1602 312
359 3300049570 Ga0501033_0165665 Ga0501033_0165665_445_1389 312
360 3300049571 Ga0501034_0001717 Ga0501034_0001717_19438_20391 312
361 3300049571 Ga0501034_0009108 Ga0501034_0009108_6542_7495 312
362 3300049571 Ga0501034_0054483 Ga0501034_0054483_254_1213 312
363 3300049571 Ga0501034_0193315 Ga0501034_0193315_144_1088 312
364 3300049571 Ga0501034_0237408 Ga0501034_0237408_767_1720 312
365 3300049572 Ga0501036_0177235 Ga0501036_0177235_450_1394 312
366 3300049573 Ga0501037_0000049 Ga0501037_0000049_103157_104101 312
367 3300049573 Ga0501037_0008002 Ga0501037_0008002_1947_2903 312
368 3300049573 Ga0501037_0124211 Ga0501037_0124211_121_1065 312
369 3300049574 Ga0501038_0194151 Ga0501038_0194151_280_1224 312
370 3300049579 Ga0501043_0000006 Ga0501043_0000006_130198_131142 312
371 3300049579 Ga0501043_0049522 Ga0501043_0049522_2111_3055 312
372 3300049581 Ga0501047_0013059 Ga0501047_0013059_4392_5351 312
373 3300049581 Ga0501047_0092119 Ga0501047_0092119_544_1488 312
374 3300049581 Ga0501047_0505445 Ga0501047_0505445_61_1014 312
375 3300049582 Ga0501048_0098135 Ga0501048_0098135_348_1307 312
376 3300049584 Ga0501068_0010765 Ga0501068_0010765_1767_2711 312
377 3300049585 Ga0501069_0000141 Ga0501069_0000141_20061_21005 312
378 3300049586 Ga0501070_0000081 Ga0501070_0000081_30040_30984 312
379 3300049586 Ga0501070_0000254 Ga0501070_0000254_26680_27624 312
380 3300049586 Ga0501070_0012129 Ga0501070_0012129_1017_1970 312
381 3300049586 Ga0501070_0023248 Ga0501070_0023248_3119_4063 312
382 3300049586 Ga0501070_0128281 Ga0501070_0128281_753_1697 312
383 3300049586 Ga0501070_0361742 Ga0501070_0361742_70_1029 312
384 3300049587 Ga0501071_0067976 Ga0501071_0067976_1212_2156 312
385 3300049587 Ga0501071_0081436 Ga0501071_0081436_1167_2126 312
386 3300049588 Ga0501072_0122482 Ga0501072_0122482_972_1928 312
387 3300049588 Ga0501072_0135142 Ga0501072_0135142_44_1003 312
388 3300049589 Ga0501073_0015833 Ga0501073_0015833_1905_2849 312
389 3300049589 Ga0501073_0024481 Ga0501073_0024481_2225_3169 312
390 3300049589 Ga0501073_0368523 Ga0501073_0368523_29_973 312
391 3300049590 Ga0501074_0000011 Ga0501074_0000011_48455_49399 312
392 3300049590 Ga0501074_0018814 Ga0501074_0018814_799_1743 312
393 3300049592 Ga0501076_0032561 Ga0501076_0032561_728_1687 312
394 3300049741 Ga0501079_0046635 Ga0501079_0046635_954_1913 312
395 3300049742 Ga0501080_0001944 Ga0501080_0001944_9915_10859 312
396 3300049742 Ga0501080_0002670 Ga0501080_0002670_8120_9064 312
397 3300049742 Ga0501080_0095249 Ga0501080_0095249_1795_2739 312
398 3300049743 Ga0501081_0048889 Ga0501081_0048889_282_1241 312
399 3300049744 Ga0501083_0000338 Ga0501083_0000338_8893_9837 312
400 3300049822 Ga0501035_0000068 Ga0501035_0000068_21041_21985 312
401 3300049822 Ga0501035_0000695 Ga0501035_0000695_28480_29424 312
402 3300049822 Ga0501035_0004271 Ga0501035_0004271_2206_3150 312
403 3300049822 Ga0501035_0095699 Ga0501035_0095699_1075_2031 312
404 3300049822 Ga0501035_0099572 Ga0501035_0099572_187_1131 312
405 3300049822 Ga0501035_0147032 Ga0501035_0147032_1038_1982 312
406 3300049823 Ga0501044_0000082 Ga0501044_0000082_103284_104228 312
407 3300049823 Ga0501044_0013515 Ga0501044_0013515_3761_4714 312
408 3300049823 Ga0501044_0019534 Ga0501044_0019534_1053_1997 312
409 3300049823 Ga0501044_0033513 Ga0501044_0033513_2815_3759 312
410 3300049823 Ga0501044_0042427 Ga0501044_0042427_3774_4718 312
411 3300049823 Ga0501044_0059040 Ga0501044_0059040_2362_3318 312
412 3300049823 Ga0501044_0081092 Ga0501044_0081092_214_1173 312
413 3300049823 Ga0501044_0125060 Ga0501044_0125060_1322_2266 312
414 3300049824 Ga0501045_0371486 Ga0501045_0371486_28_987 312
415 3300050490 nmdc:mga03n38_54946_c1 nmdc:mga03n38_54946_c1_816_1769 312
416 3300050491 nmdc:mga00v17_148556_c1 nmdc:mga00v17_148556_c1_44_997 312
417 3300050492 nmdc:mga0yw44_50038_c1 nmdc:mga0yw44_50038_c1_1539_2489 312
418 3300050493 nmdc:mga0k408_88267_c1 nmdc:mga0k408_88267_c1_161_1114 312
419 3300050494 nmdc:mga06z11_40694_c1 nmdc:mga06z11_40694_c1_1038_1991 312
420 3300050494 nmdc:mga06z11_65058_c1 nmdc:mga06z11_65058_c1_527_1480 312
421 3300050511 nmdc:mga08y16_82_c1 nmdc:mga08y16_82_c1_69383_70342 312
422 3300050516 nmdc:mga0sz30_357_c1 nmdc:mga0sz30_357_c1_2080_3033 312
423 3300053077 Ga0495601_0000911 Ga0495601_0000911_11017_11973 312
424 3300053077 Ga0495601_0046582 Ga0495601_0046582_1127_2083 312
425 3300053078 Ga0495612_0000639 Ga0495612_0000639_9409_10365 312
426 3300053096 Ga0500641_0000277 Ga0500641_0000277_11938_12891 312
427 3300053151 Ga0500604_0002073 Ga0500604_0002073_2449_3408 312
428 3300053158 Ga0500627_0046749 Ga0500627_0046749_348_1298 312
429 3300053733 Ga0500552_003131 Ga0500552_003131_41_994 312
430 3300054114 Ga0501084_0071402 Ga0501084_0071402_1136_2095 312
431 3300060353 Ga0501082_0087693 Ga0501082_0087693_1584_2528 312
432 3300060353 Ga0501082_0137163 Ga0501082_0137163_285_1229 312
433 iso_pu_bacteria 2738543032 2739355110 312
434 iso_pu_bacteria 2889306138 2889306724 312
435 iso_pu_bacteria 2902405164 2902409627 312
436 3300001904 JGI24736J21556_1000201 JGI24736J21556_100020112 313
437 3300001915 JGI24741J21665_1001549 JGI24741J21665_10015492 313
438 3300001989 JGI24739J22299_10018850 JGI24739J22299_100188502 313
439 3300002075 JGI24738J21930_10013641 JGI24738J21930_100136412 313
440 3300002774 JGI25150J39212_1000340 JGI25150J39212_100034012 313
441 3300003320 rootH2_10013646 rootH2_100136467 313
442 3300003373 JGI25407J50210_10033264 JGI25407J50210_100332641 313
443 3300003771 Ga0055526_1002614 Ga0055526_100261410 313
444 3300003775 Ga0055524_1000205 Ga0055524_100020530 313
445 3300003775 Ga0055524_1009309 Ga0055524_10093092 313
446 3300003791 Ga0055530_10039828 Ga0055530_100398281 313
447 3300005262 Ga0065165_1003151 Ga0065165_10031513 313
448 3300005290 Ga0065712_10088759 Ga0065712_100887592 313
449 3300005327 Ga0070658_10000379 Ga0070658_1000037933 313
450 3300005327 Ga0070658_10000629 Ga0070658_1000062911 313
451 3300005327 Ga0070658_10001797 Ga0070658_1000179714 313
452 3300005327 Ga0070658_10004427 Ga0070658_100044275 313
453 3300005327 Ga0070658_10004769 Ga0070658_100047696 313
454 3300005327 Ga0070658_10263739 Ga0070658_102637391 313
455 3300005329 Ga0070683_100018947 Ga0070683_1000189477 313
456 3300005329 Ga0070683_100190337 Ga0070683_1001903372 313
457 3300005330 Ga0070690_100000750 Ga0070690_10000075010 313
458 3300005331 Ga0070670_100042476 Ga0070670_1000424761 313
459 3300005334 Ga0068869_100069402 Ga0068869_1000694022 313
460 3300005335 Ga0070666_10090471 Ga0070666_100904712 313
461 3300005336 Ga0070680_100000533 Ga0070680_10000053332 313
462 3300005336 Ga0070680_100001991 Ga0070680_1000019914 313
463 3300005336 Ga0070680_100011194 Ga0070680_1000111942 313
464 3300005336 Ga0070680_100025656 Ga0070680_1000256564 313
465 3300005336 Ga0070680_100134645 Ga0070680_1001346451 313
466 3300005337 Ga0070682_100075508 Ga0070682_1000755081 313
467 3300005338 Ga0068868_100013002 Ga0068868_1000130023 313
468 3300005339 Ga0070660_100000085 Ga0070660_10000008510 313
469 3300005339 Ga0070660_100003873 Ga0070660_1000038736 313
470 3300005339 Ga0070660_100006908 Ga0070660_1000069082 313
471 3300005339 Ga0070660_100010943 Ga0070660_1000109433 313
472 3300005339 Ga0070660_100017238 Ga0070660_1000172385 313
473 3300005339 Ga0070660_100041942 Ga0070660_1000419422 313
474 3300005339 Ga0070660_100072550 Ga0070660_1000725502 313
475 3300005339 Ga0070660_100152121 Ga0070660_1001521211 313
476 3300005341 Ga0070691_10000436 Ga0070691_100004364 313
477 3300005344 Ga0070661_100008874 Ga0070661_1000088747 313
478 3300005344 Ga0070661_100036493 Ga0070661_1000364935 313
479 3300005344 Ga0070661_100059067 Ga0070661_1000590672 313
480 3300005344 Ga0070661_100067263 Ga0070661_1000672632 313
481 3300005344 Ga0070661_100416099 Ga0070661_1004160991 313
482 3300005345 Ga0070692_10000996 Ga0070692_100009962 313
483 3300005345 Ga0070692_10121551 Ga0070692_101215512 313
484 3300005347 Ga0070668_100004964 Ga0070668_1000049642 313
485 3300005347 Ga0070668_100041725 Ga0070668_1000417252 313
486 3300005347 Ga0070668_100051129 Ga0070668_1000511293 313
487 3300005353 Ga0070669_100046987 Ga0070669_1000469872 313
488 3300005355 Ga0070671_100167661 Ga0070671_1001676612 313
489 3300005365 Ga0070688_100020935 Ga0070688_1000209353 313
490 3300005366 Ga0070659_100034927 Ga0070659_1000349273 313
491 3300005366 Ga0070659_100050154 Ga0070659_1000501542 313
492 3300005366 Ga0070659_100052987 Ga0070659_1000529872 313
493 3300005366 Ga0070659_100082226 Ga0070659_1000822262 313
494 3300005367 Ga0070667_100000128 Ga0070667_10000012814 313
495 3300005367 Ga0070667_100101349 Ga0070667_1001013492 313
496 3300005367 Ga0070667_100176654 Ga0070667_1001766542 313
497 3300005434 Ga0070709_10022286 Ga0070709_100222862 313
498 3300005434 Ga0070709_10050465 Ga0070709_100504653 313
499 3300005435 Ga0070714_100092568 Ga0070714_1000925682 313
500 3300005435 Ga0070714_100143734 Ga0070714_1001437342 313
501 3300005435 Ga0070714_100159661 Ga0070714_1001596612 313
502 3300005435 Ga0070714_100175048 Ga0070714_1001750481 313
503 3300005435 Ga0070714_100287153 Ga0070714_1002871532 313
504 3300005435 Ga0070714_100407097 Ga0070714_1004070972 313
505 3300005436 Ga0070713_100000046 Ga0070713_10000004636 313
506 3300005436 Ga0070713_100035064 Ga0070713_1000350641 313
507 3300005437 Ga0070710_10155478 Ga0070710_101554782 313
508 3300005437 Ga0070710_10182275 Ga0070710_101822751 313
509 3300005439 Ga0070711_100248073 Ga0070711_1002480732 313
510 3300005455 Ga0070663_100002086 Ga0070663_1000020867 313
511 3300005455 Ga0070663_100015553 Ga0070663_1000155537 313
512 3300005455 Ga0070663_100020448 Ga0070663_1000204482 313
513 3300005455 Ga0070663_100218586 Ga0070663_1002185862 313
514 3300005457 Ga0070662_100012251 Ga0070662_1000122512 313
515 3300005458 Ga0070681_10000001 Ga0070681_10000001171 313
516 3300005458 Ga0070681_10016380 Ga0070681_100163806 313
517 3300005458 Ga0070681_10039831 Ga0070681_100398314 313
518 3300005471 Ga0070698_100225709 Ga0070698_1002257092 313
519 3300005518 Ga0070699_100054126 Ga0070699_1000541262 313
520 3300005530 Ga0070679_100150468 Ga0070679_1001504682 313
521 3300005530 Ga0070679_100218911 Ga0070679_1002189112 313
522 3300005530 Ga0070679_100244695 Ga0070679_1002446951 313
523 3300005530 Ga0070679_100341713 Ga0070679_1003417132 313
524 3300005530 Ga0070679_100449157 Ga0070679_1004491572 313
525 3300005535 Ga0070684_100276095 Ga0070684_1002760952 313
526 3300005536 Ga0070697_100342900 Ga0070697_1003429001 313
527 3300005539 Ga0068853_100032596 Ga0068853_1000325962 313
528 3300005539 Ga0068853_100034820 Ga0068853_1000348204 313
529 3300005539 Ga0068853_100226575 Ga0068853_1002265751 313
530 3300005539 Ga0068853_100227876 Ga0068853_1002278762 313
531 3300005545 Ga0070695_100037083 Ga0070695_1000370831 313
532 3300005548 Ga0070665_100000044 Ga0070665_10000004477 313
533 3300005549 Ga0070704_100030739 Ga0070704_1000307392 313
534 3300005563 Ga0068855_100000022 Ga0068855_10000002266 313
535 3300005563 Ga0068855_100000300 Ga0068855_10000030048 313
536 3300005563 Ga0068855_100005454 Ga0068855_10000545410 313
537 3300005563 Ga0068855_100011392 Ga0068855_1000113928 313
538 3300005563 Ga0068855_100013133 Ga0068855_1000131335 313
539 3300005563 Ga0068855_100071882 Ga0068855_1000718824 313
540 3300005563 Ga0068855_100076637 Ga0068855_1000766374 313
541 3300005563 Ga0068855_100106140 Ga0068855_1001061402 313
542 3300005563 Ga0068855_100212238 Ga0068855_1002122383 313
543 3300005563 Ga0068855_100503035 Ga0068855_1005030352 313
544 3300005564 Ga0070664_100016737 Ga0070664_1000167377 313
545 3300005564 Ga0070664_100031720 Ga0070664_1000317204 313
546 3300005564 Ga0070664_100070065 Ga0070664_1000700653 313
547 3300005564 Ga0070664_100200308 Ga0070664_1002003082 313
548 3300005577 Ga0068857_100000031 Ga0068857_10000003130 313
549 3300005577 Ga0068857_100103343 Ga0068857_1001033432 313
550 3300005578 Ga0068854_100040816 Ga0068854_1000408163 313
551 3300005578 Ga0068854_100146336 Ga0068854_1001463362 313
552 3300005614 Ga0068856_100000379 Ga0068856_10000037938 313
553 3300005614 Ga0068856_100001105 Ga0068856_10000110520 313
554 3300005614 Ga0068856_100005014 Ga0068856_1000050143 313
555 3300005614 Ga0068856_100038634 Ga0068856_1000386342 313
556 3300005614 Ga0068856_100039824 Ga0068856_1000398244 313
557 3300005614 Ga0068856_100062239 Ga0068856_1000622392 313
558 3300005614 Ga0068856_100135736 Ga0068856_1001357362 313
559 3300005616 Ga0068852_100013898 Ga0068852_1000138984 313
560 3300005616 Ga0068852_100017797 Ga0068852_1000177975 313
561 3300005616 Ga0068852_100044561 Ga0068852_1000445613 313
562 3300005616 Ga0068852_100094589 Ga0068852_1000945891 313
563 3300005616 Ga0068852_100422311 Ga0068852_1004223111 313
564 3300005617 Ga0068859_100000221 Ga0068859_10000022124 313
565 3300005618 Ga0068864_100000324 Ga0068864_10000032419 313
566 3300005834 Ga0068851_10111336 Ga0068851_101113361 313
567 3300005841 Ga0068863_100000988 Ga0068863_10000098827 313
568 3300005842 Ga0068858_100000038 Ga0068858_10000003862 313
569 3300005842 Ga0068858_100532904 Ga0068858_1005329042 313
570 3300005843 Ga0068860_100012362 Ga0068860_1000123628 313
571 3300005843 Ga0068860_100038050 Ga0068860_1000380503 313
572 3300005843 Ga0068860_100048226 Ga0068860_1000482264 313
573 3300005844 Ga0068862_100323761 Ga0068862_1003237612 313
574 3300005937 Ga0081455_10000736 Ga0081455_1000073633 313
575 3300005981 Ga0081538_10012501 Ga0081538_100125015 313
576 3300005983 Ga0081540_1001053 Ga0081540_100105311 313
577 3300005983 Ga0081540_1001559 Ga0081540_10015593 313
578 3300005985 Ga0081539_10036460 Ga0081539_100364602 313
579 3300006028 Ga0070717_10024484 Ga0070717_100244845 313
580 3300006028 Ga0070717_10266506 Ga0070717_102665062 313
581 3300006038 Ga0075365_10056117 Ga0075365_100561172 313
582 3300006038 Ga0075365_10068296 Ga0075365_100682963 313
583 3300006038 Ga0075365_10262520 Ga0075365_102625201 313
584 3300006042 Ga0075368_10025070 Ga0075368_100250701 313
585 3300006042 Ga0075368_10075290 Ga0075368_100752901 313
586 3300006051 Ga0075364_10033207 Ga0075364_100332072 313
587 3300006051 Ga0075364_10133005 Ga0075364_101330051 313
588 3300006173 Ga0070716_100112601 Ga0070716_1001126011 313
589 3300006175 Ga0070712_100000218 Ga0070712_10000021823 313
590 3300006175 Ga0070712_100005245 Ga0070712_1000052453 313
591 3300006178 Ga0075367_10079105 Ga0075367_100791052 313
592 3300006186 Ga0075369_10027277 Ga0075369_100272772 313
593 3300006195 Ga0075366_10046671 Ga0075366_100466712 313
594 3300006844 Ga0075428_100000606 Ga0075428_10000060615 313
595 3300006844 Ga0075428_100060712 Ga0075428_1000607124 313
596 3300006844 Ga0075428_100068529 Ga0075428_1000685291 313
597 3300006846 Ga0075430_100051888 Ga0075430_1000518884 313
598 3300006846 Ga0075430_100057443 Ga0075430_1000574433 313
599 3300006846 Ga0075430_100251388 Ga0075430_1002513882 313
600 3300006847 Ga0075431_100000032 Ga0075431_10000003239 313
601 3300006847 Ga0075431_100028286 Ga0075431_1000282865 313
602 3300006852 Ga0075433_10067598 Ga0075433_100675982 313
603 3300006852 Ga0075433_10125346 Ga0075433_101253462 313
604 3300006852 Ga0075433_10315850 Ga0075433_103158502 313
605 3300006871 Ga0075434_100105187 Ga0075434_1001051872 313
606 3300006880 Ga0075429_100031410 Ga0075429_1000314104 313
607 3300006880 Ga0075429_100045311 Ga0075429_1000453111 313
608 3300006914 Ga0075436_100001529 Ga0075436_10000152912 313
609 3300006931 Ga0097620_100000221 Ga0097620_10000022124 313
610 3300007076 Ga0075435_100219157 Ga0075435_1002191572 313
611 3300007265 Ga0099794_10028110 Ga0099794_100281102 313
612 3300009092 Ga0105250_10006178 Ga0105250_100061785 313
613 3300009093 Ga0105240_10000430 Ga0105240_1000043072 313
614 3300009093 Ga0105240_10002169 Ga0105240_1000216927 313
615 3300009093 Ga0105240_10033000 Ga0105240_100330007 313
616 3300009093 Ga0105240_10051735 Ga0105240_100517354 313
617 3300009093 Ga0105240_10070930 Ga0105240_100709302 313
618 3300009093 Ga0105240_10185191 Ga0105240_101851912 313
619 3300009093 Ga0105240_10651770 Ga0105240_106517702 313
620 3300009093 Ga0105240_10728330 Ga0105240_107283301 313
621 3300009094 Ga0111539_10001089 Ga0111539_1000108916 313
622 3300009094 Ga0111539_10020065 Ga0111539_100200658 313
623 3300009094 Ga0111539_10251657 Ga0111539_102516572 313
624 3300009098 Ga0105245_10000484 Ga0105245_1000048425 313
625 3300009101 Ga0105247_10038214 Ga0105247_100382141 313
626 3300009147 Ga0114129_10000062 Ga0114129_1000006238 313
627 3300009147 Ga0114129_10001060 Ga0114129_1000106016 313
628 3300009147 Ga0114129_10244180 Ga0114129_102441802 313
629 3300009148 Ga0105243_10275585 Ga0105243_102755852 313
630 3300009174 Ga0105241_10013670 Ga0105241_100136701 313
631 3300009174 Ga0105241_10073900 Ga0105241_100739002 313
632 3300009174 Ga0105241_10114489 Ga0105241_101144891 313
633 3300009174 Ga0105241_10228088 Ga0105241_102280882 313
634 3300009177 Ga0105248_10000005 Ga0105248_10000005274 313
635 3300009177 Ga0105248_10001342 Ga0105248_1000134211 313
636 3300009177 Ga0105248_10505355 Ga0105248_105053552 313
637 3300009545 Ga0105237_10001309 Ga0105237_1000130924 313
638 3300009545 Ga0105237_10202392 Ga0105237_102023922 313
639 3300009551 Ga0105238_10004028 Ga0105238_1000402814 313
640 3300009551 Ga0105238_10017014 Ga0105238_100170145 313
641 3300009551 Ga0105238_10033305 Ga0105238_100333055 313
642 3300009553 Ga0105249_10017541 Ga0105249_100175416 313
643 3300010159 Ga0099796_10027095 Ga0099796_100270952 313
644 3300010375 Ga0105239_10002559 Ga0105239_1000255920 313
645 3300010375 Ga0105239_10004314 Ga0105239_1000431410 313
646 3300010375 Ga0105239_10008789 Ga0105239_1000878910 313
647 3300013100 Ga0157373_10001315 Ga0157373_100013157 313
648 3300013100 Ga0157373_10014370 Ga0157373_100143703 313
649 3300013100 Ga0157373_10064155 Ga0157373_100641552 313
650 3300013102 Ga0157371_10006249 Ga0157371_100062499 313
651 3300013102 Ga0157371_10014275 Ga0157371_100142753 313
652 3300013104 Ga0157370_10007564 Ga0157370_100075648 313
653 3300013104 Ga0157370_10039763 Ga0157370_100397633 313
654 3300013104 Ga0157370_10053908 Ga0157370_100539082 313
655 3300013104 Ga0157370_10180436 Ga0157370_101804362 313
656 3300013104 Ga0157370_10348261 Ga0157370_103482612 313
657 3300013105 Ga0157369_10000756 Ga0157369_1000075624 313
658 3300013105 Ga0157369_10000881 Ga0157369_1000088130 313
659 3300013105 Ga0157369_10018172 Ga0157369_100181727 313
660 3300013105 Ga0157369_10274749 Ga0157369_102747492 313
661 3300013105 Ga0157369_10619993 Ga0157369_106199932 313
662 3300013296 Ga0157374_10131397 Ga0157374_101313972 313
663 3300013297 Ga0157378_10087458 Ga0157378_100874582 313
664 3300013307 Ga0157372_10004048 Ga0157372_1000404817 313
665 3300013307 Ga0157372_10016212 Ga0157372_1001621211 313
666 3300014325 Ga0163163_10000489 Ga0163163_100004899 313
667 3300014325 Ga0163163_10253252 Ga0163163_102532521 313
668 3300014325 Ga0163163_10596353 Ga0163163_105963531 313
669 3300014968 Ga0157379_10002131 Ga0157379_100021317 313
670 3300014968 Ga0157379_10011138 Ga0157379_100111384 313
671 3300014968 Ga0157379_10063465 Ga0157379_100634651 313
672 3300014968 Ga0157379_10092288 Ga0157379_100922882 313
673 3300014968 Ga0157379_10299331 Ga0157379_102993312 313
674 3300017792 Ga0163161_10230658 Ga0163161_102306581 313
675 3300021361 Ga0213872_10060633 Ga0213872_100606331 313
676 3300021384 Ga0213876_10001206 Ga0213876_1000120613 313
677 3300021384 Ga0213876_10154312 Ga0213876_101543121 313
678 3300025229 Ga0209147_103646 Ga0209147_1036463 313
679 3300025263 Ga0209565_1000054 Ga0209565_1000054151 313
680 3300025273 Ga0209673_1017066 Ga0209673_10170663 313
681 3300025291 Ga0209675_1002435 Ga0209675_10024358 313
682 3300025294 Ga0209025_1036751 Ga0209025_10367512 313
683 3300025295 Ga0209564_1000177 Ga0209564_1000177110 313
684 3300025295 Ga0209564_1001852 Ga0209564_100185210 313
685 3300025299 Ga0209256_1000032 Ga0209256_1000032296 313
686 3300025299 Ga0209256_1000547 Ga0209256_100054715 313
687 3300025321 Ga0207656_10098138 Ga0207656_100981381 313
688 3300025711 Ga0207696_1008107 Ga0207696_10081073 313
689 3300025900 Ga0207710_10065182 Ga0207710_100651821 313
690 3300025903 Ga0207680_10000466 Ga0207680_100004665 313
691 3300025904 Ga0207647_10003785 Ga0207647_100037857 313
692 3300025904 Ga0207647_10004237 Ga0207647_100042374 313
693 3300025904 Ga0207647_10018861 Ga0207647_100188612 313
694 3300025904 Ga0207647_10037669 Ga0207647_100376692 313
695 3300025906 Ga0207699_10000310 Ga0207699_100003105 313
696 3300025906 Ga0207699_10175871 Ga0207699_101758711 313
697 3300025909 Ga0207705_10000003 Ga0207705_10000003504 313
698 3300025909 Ga0207705_10000061 Ga0207705_1000006111 313
699 3300025909 Ga0207705_10000522 Ga0207705_1000052231 313
700 3300025909 Ga0207705_10000704 Ga0207705_1000070417 313
701 3300025909 Ga0207705_10004521 Ga0207705_100045215 313
702 3300025909 Ga0207705_10018789 Ga0207705_100187893 313
703 3300025909 Ga0207705_10034746 Ga0207705_100347462 313
704 3300025909 Ga0207705_10062918 Ga0207705_100629181 313
705 3300025909 Ga0207705_10260852 Ga0207705_102608522 313
706 3300025909 Ga0207705_10341801 Ga0207705_103418012 313
707 3300025911 Ga0207654_10206847 Ga0207654_102068472 313
708 3300025912 Ga0207707_10000011 Ga0207707_10000011288 313
709 3300025912 Ga0207707_10024159 Ga0207707_100241595 313
710 3300025913 Ga0207695_10000018 Ga0207695_10000018565 313
711 3300025913 Ga0207695_10006765 Ga0207695_100067654 313
712 3300025913 Ga0207695_10006975 Ga0207695_1000697515 313
713 3300025913 Ga0207695_10012037 Ga0207695_100120379 313
714 3300025913 Ga0207695_10016569 Ga0207695_100165693 313
715 3300025913 Ga0207695_10053216 Ga0207695_100532164 313
716 3300025913 Ga0207695_10101865 Ga0207695_101018652 313
717 3300025913 Ga0207695_10139030 Ga0207695_101390302 313
718 3300025914 Ga0207671_10100361 Ga0207671_101003612 313
719 3300025914 Ga0207671_10151241 Ga0207671_101512412 313
720 3300025915 Ga0207693_10000663 Ga0207693_100006638 313
721 3300025915 Ga0207693_10010617 Ga0207693_100106173 313
722 3300025917 Ga0207660_10000737 Ga0207660_1000073719 313
723 3300025917 Ga0207660_10002355 Ga0207660_100023557 313
724 3300025917 Ga0207660_10005544 Ga0207660_1000554412 313
725 3300025917 Ga0207660_10070703 Ga0207660_100707032 313
726 3300025917 Ga0207660_10104875 Ga0207660_101048752 313
727 3300025917 Ga0207660_10155309 Ga0207660_101553091 313
728 3300025919 Ga0207657_10000101 Ga0207657_1000010177 313
729 3300025919 Ga0207657_10000631 Ga0207657_100006319 313
730 3300025919 Ga0207657_10001405 Ga0207657_1000140518 313
731 3300025919 Ga0207657_10001922 Ga0207657_1000192222 313
732 3300025919 Ga0207657_10007725 Ga0207657_100077257 313
733 3300025919 Ga0207657_10012424 Ga0207657_100124244 313
734 3300025919 Ga0207657_10034343 Ga0207657_100343432 313
735 3300025919 Ga0207657_10143431 Ga0207657_101434312 313
736 3300025919 Ga0207657_10188959 Ga0207657_101889592 313
737 3300025919 Ga0207657_10238560 Ga0207657_102385601 313
738 3300025919 Ga0207657_10292141 Ga0207657_102921411 313
739 3300025919 Ga0207657_10409508 Ga0207657_104095081 313
740 3300025920 Ga0207649_10000494 Ga0207649_1000049424 313
741 3300025920 Ga0207649_10001179 Ga0207649_1000117916 313
742 3300025920 Ga0207649_10004815 Ga0207649_100048152 313
743 3300025920 Ga0207649_10049357 Ga0207649_100493574 313
744 3300025920 Ga0207649_10090808 Ga0207649_100908081 313
745 3300025921 Ga0207652_10000089 Ga0207652_1000008922 313
746 3300025921 Ga0207652_10000334 Ga0207652_1000033431 313
747 3300025921 Ga0207652_10132412 Ga0207652_101324122 313
748 3300025921 Ga0207652_10294109 Ga0207652_102941092 313
749 3300025921 Ga0207652_10374399 Ga0207652_103743992 313
750 3300025921 Ga0207652_10401522 Ga0207652_104015221 313
751 3300025924 Ga0207694_10000005 Ga0207694_1000000520 313
752 3300025924 Ga0207694_10024662 Ga0207694_100246622 313
753 3300025925 Ga0207650_10074789 Ga0207650_100747892 313
754 3300025927 Ga0207687_10032337 Ga0207687_100323372 313
755 3300025928 Ga0207700_10000017 Ga0207700_10000017191 313
756 3300025929 Ga0207664_10030301 Ga0207664_100303015 313
757 3300025929 Ga0207664_10056751 Ga0207664_100567512 313
758 3300025929 Ga0207664_10067798 Ga0207664_100677982 313
759 3300025929 Ga0207664_10139268 Ga0207664_101392682 313
760 3300025929 Ga0207664_10160393 Ga0207664_101603932 313
761 3300025929 Ga0207664_10538999 Ga0207664_105389991 313
762 3300025932 Ga0207690_10021392 Ga0207690_100213924 313
763 3300025932 Ga0207690_10034093 Ga0207690_100340933 313
764 3300025932 Ga0207690_10039976 Ga0207690_100399763 313
765 3300025932 Ga0207690_10043002 Ga0207690_100430023 313
766 3300025932 Ga0207690_10054649 Ga0207690_100546492 313
767 3300025932 Ga0207690_10184130 Ga0207690_101841302 313
768 3300025932 Ga0207690_10268363 Ga0207690_102683632 313
769 3300025933 Ga0207706_10009699 Ga0207706_100096993 313
770 3300025933 Ga0207706_10019485 Ga0207706_100194855 313
771 3300025933 Ga0207706_10190413 Ga0207706_101904132 313
772 3300025939 Ga0207665_10059848 Ga0207665_100598482 313
773 3300025941 Ga0207711_10000002 Ga0207711_10000002274 313
774 3300025941 Ga0207711_10000042 Ga0207711_10000042112 313
775 3300025941 Ga0207711_10015104 Ga0207711_100151045 313
776 3300025941 Ga0207711_10047034 Ga0207711_100470344 313
777 3300025942 Ga0207689_10134030 Ga0207689_101340302 313
778 3300025944 Ga0207661_10023150 Ga0207661_100231505 313
779 3300025945 Ga0207679_10113338 Ga0207679_101133382 313
780 3300025949 Ga0207667_10000061 Ga0207667_1000006165 313
781 3300025949 Ga0207667_10000187 Ga0207667_1000018755 313
782 3300025949 Ga0207667_10005445 Ga0207667_1000544510 313
783 3300025949 Ga0207667_10009340 Ga0207667_1000934014 313
784 3300025949 Ga0207667_10013895 Ga0207667_100138952 313
785 3300025949 Ga0207667_10031158 Ga0207667_100311585 313
786 3300025949 Ga0207667_10078431 Ga0207667_100784312 313
787 3300025949 Ga0207667_10534911 Ga0207667_105349111 313
788 3300025960 Ga0207651_10045319 Ga0207651_100453193 313
789 3300025972 Ga0207668_10003197 Ga0207668_100031972 313
790 3300025972 Ga0207668_10033479 Ga0207668_100334792 313
791 3300025972 Ga0207668_10110453 Ga0207668_101104532 313
792 3300025981 Ga0207640_10002139 Ga0207640_1000213914 313
793 3300025981 Ga0207640_10005375 Ga0207640_100053757 313
794 3300025981 Ga0207640_10055031 Ga0207640_100550312 313
795 3300025986 Ga0207658_10004787 Ga0207658_100047876 313
796 3300025986 Ga0207658_10027427 Ga0207658_100274273 313
797 3300025986 Ga0207658_10043127 Ga0207658_100431274 313
798 3300026035 Ga0207703_10000440 Ga0207703_1000044019 313
799 3300026035 Ga0207703_10001009 Ga0207703_1000100926 313
800 3300026041 Ga0207639_10004301 Ga0207639_100043013 313
801 3300026041 Ga0207639_10032439 Ga0207639_100324393 313
802 3300026041 Ga0207639_10106886 Ga0207639_101068861 313
803 3300026041 Ga0207639_10261874 Ga0207639_102618742 313
804 3300026067 Ga0207678_10003050 Ga0207678_100030503 313
805 3300026067 Ga0207678_10005069 Ga0207678_100050698 313
806 3300026067 Ga0207678_10050319 Ga0207678_100503192 313
807 3300026067 Ga0207678_10254549 Ga0207678_102545492 313
808 3300026078 Ga0207702_10000035 Ga0207702_1000003565 313
809 3300026078 Ga0207702_10000182 Ga0207702_1000018259 313
810 3300026078 Ga0207702_10000875 Ga0207702_1000087512 313
811 3300026078 Ga0207702_10045038 Ga0207702_100450383 313
812 3300026078 Ga0207702_10294177 Ga0207702_102941771 313
813 3300026088 Ga0207641_10000415 Ga0207641_100004154 313
814 3300026095 Ga0207676_10002042 Ga0207676_1000204212 313
815 3300026116 Ga0207674_10000003 Ga0207674_10000003134 313
816 3300026116 Ga0207674_10034758 Ga0207674_100347584 313
817 3300026118 Ga0207675_100387745 Ga0207675_1003877451 313
818 3300026142 Ga0207698_10002033 Ga0207698_100020333 313
819 3300026142 Ga0207698_10049620 Ga0207698_100496203 313
820 3300026142 Ga0207698_10069627 Ga0207698_100696272 313
821 3300027866 Ga0209813_10006106 Ga0209813_100061063 313
822 3300027907 Ga0207428_10007154 Ga0207428_100071546 313
823 3300028379 Ga0268266_10000002 Ga0268266_100000021968 313
824 3300028379 Ga0268266_10070415 Ga0268266_100704151 313
825 3300028380 Ga0268265_10066985 Ga0268265_100669853 313
826 3300028380 Ga0268265_10443854 Ga0268265_104438541 313
827 3300028380 Ga0268265_10464241 Ga0268265_104642411 313
828 3300028381 Ga0268264_10023310 Ga0268264_100233104 313
829 3300028381 Ga0268264_10040033 Ga0268264_100400334 313
830 3300028573 Ga0265334_10000953 Ga0265334_100009539 313
831 3300028800 Ga0265338_10005581 Ga0265338_100055818 313
832 3300028800 Ga0265338_10019894 Ga0265338_100198948 313
833 3300028800 Ga0265338_10050438 Ga0265338_100504383 313
834 3300031235 Ga0265330_10025130 Ga0265330_100251302 313
835 3300031235 Ga0265330_10053156 Ga0265330_100531561 313
836 3300031235 Ga0265330_10086903 Ga0265330_100869031 313
837 3300031238 Ga0265332_10071114 Ga0265332_100711142 313
838 3300031239 Ga0265328_10000046 Ga0265328_1000004639 313
839 3300031241 Ga0265325_10000567 Ga0265325_1000056713 313
840 3300031241 Ga0265325_10005899 Ga0265325_100058991 313
841 3300031241 Ga0265325_10044214 Ga0265325_100442141 313
842 3300031247 Ga0265340_10000428 Ga0265340_100004287 313
843 3300031247 Ga0265340_10000540 Ga0265340_1000054015 313
844 3300031247 Ga0265340_10006101 Ga0265340_100061015 313
845 3300031247 Ga0265340_10006948 Ga0265340_100069485 313
846 3300031247 Ga0265340_10036841 Ga0265340_100368411 313
847 3300031249 Ga0265339_10003873 Ga0265339_100038736 313
848 3300031249 Ga0265339_10006509 Ga0265339_100065092 313
849 3300031249 Ga0265339_10123637 Ga0265339_101236372 313
850 3300031250 Ga0265331_10000054 Ga0265331_10000054135 313
851 3300031250 Ga0265331_10004958 Ga0265331_100049587 313
852 3300031250 Ga0265331_10013768 Ga0265331_100137684 313
853 3300031250 Ga0265331_10016457 Ga0265331_100164572 313
854 3300031251 Ga0265327_10000179 Ga0265327_1000017957 313
855 3300031344 Ga0265316_10000099 Ga0265316_1000009938 313
856 3300031344 Ga0265316_10017095 Ga0265316_100170955 313
857 3300031344 Ga0265316_10084400 Ga0265316_100844002 313
858 3300031344 Ga0265316_10114507 Ga0265316_101145072 313
859 3300031344 Ga0265316_10217742 Ga0265316_102177421 313
860 3300031344 Ga0265316_10392352 Ga0265316_103923521 313
861 3300031548 Ga0307408_100221489 Ga0307408_1002214892 313
862 3300031595 Ga0265313_10000216 Ga0265313_1000021657 313
863 3300031595 Ga0265313_10011560 Ga0265313_100115606 313
864 3300031595 Ga0265313_10028965 Ga0265313_100289652 313
865 3300031691 Ga0316579_10115829 Ga0316579_101158291 313
866 3300031711 Ga0265314_10000160 Ga0265314_1000016025 313
867 3300031711 Ga0265314_10019986 Ga0265314_100199864 313
868 3300031711 Ga0265314_10023980 Ga0265314_100239804 313
869 3300031711 Ga0265314_10048739 Ga0265314_100487392 313
870 3300031711 Ga0265314_10091869 Ga0265314_100918693 313
871 3300031711 Ga0265314_10093099 Ga0265314_100930992 313
872 3300031711 Ga0265314_10115196 Ga0265314_101151962 313
873 3300031712 Ga0265342_10000139 Ga0265342_1000013940 313
874 3300031712 Ga0265342_10001957 Ga0265342_1000195719 313
875 3300031712 Ga0265342_10004338 Ga0265342_100043389 313
876 3300031712 Ga0265342_10022508 Ga0265342_100225082 313
877 3300031712 Ga0265342_10101609 Ga0265342_101016091 313
878 3300031728 Ga0316578_10125608 Ga0316578_101256082 313
879 3300031730 Ga0307516_10033704 Ga0307516_100337045 313
880 3300031824 Ga0307413_10006025 Ga0307413_100060253 313
881 3300031824 Ga0307413_10047640 Ga0307413_100476402 313
882 3300031852 Ga0307410_10044829 Ga0307410_100448293 313
883 3300031903 Ga0307407_10016181 Ga0307407_100161812 313
884 3300031903 Ga0307407_10020660 Ga0307407_100206602 313
885 3300031995 Ga0307409_100010082 Ga0307409_1000100823 313
886 3300032002 Ga0307416_100023757 Ga0307416_1000237573 313
887 3300032004 Ga0307414_10004083 Ga0307414_100040835 313
888 3300032005 Ga0307411_10020382 Ga0307411_100203824 313
889 3300032005 Ga0307411_10036072 Ga0307411_100360723 313
890 3300032126 Ga0307415_100000374 Ga0307415_10000037412 313
891 3300032126 Ga0307415_100007417 Ga0307415_1000074176 313
892 3300033541 Ga0316596_1043264 Ga0316596_10432641 313
893 3300035111 Ga0373923_0005873 Ga0373923_0005873_2556_3512 313
894 3300035113 Ga0373936_0074704 Ga0373936_0074704_419_1375 313
895 3300035116 Ga0373945_0011777 Ga0373945_0011777_1459_2415 313
896 3300035116 Ga0373945_0033883 Ga0373945_0033883_430_1386 313
897 3300035117 Ga0373953_0001424 Ga0373953_0001424_2745_3701 313
898 3300035118 Ga0373954_0002291 Ga0373954_0002291_3792_4748 313
899 3300035118 Ga0373954_0032949 Ga0373954_0032949_1164_2105 313
900 3300035119 Ga0373956_0027878 Ga0373956_0027878_901_1842 313
901 3300035120 Ga0373957_0006598 Ga0373957_0006598_1783_2739 313
902 3300035120 Ga0373957_0016614 Ga0373957_0016614_1089_2030 313
903 3300035170 Ga0373943_0001584 Ga0373943_0001584_4506_5462 313
904 3300035170 Ga0373943_0061477 Ga0373943_0061477_812_1771 313
905 3300035171 Ga0373946_0002328 Ga0373946_0002328_2521_3477 313
906 3300035172 Ga0373955_0000338 Ga0373955_0000338_6904_7860 313
907 3300035410 Ga0373924_0005579 Ga0373924_0005579_2109_3065 313
908 3300035692 Ga0373935_0000281 Ga0373935_0000281_23315_24271 313
909 3300035692 Ga0373935_0024213 Ga0373935_0024213_1551_2507 313
910 3300035692 Ga0373935_0026454 Ga0373935_0026454_2580_3536 313
911 3300035692 Ga0373935_0040406 Ga0373935_0040406_1076_2032 313
912 3300035695 Ga0373927_0022573 Ga0373927_0022573_201_1157 313
913 3300035695 Ga0373927_0060294 Ga0373927_0060294_421_1377 313
914 3300035695 Ga0373927_0086861 Ga0373927_0086861_192_1151 313
915 3300035695 Ga0373927_0086944 Ga0373927_0086944_393_1349 313
916 3300035695 Ga0373927_0099209 Ga0373927_0099209_387_1343 313
917 3300035724 Ga0373933_0012856 Ga0373933_0012856_1203_2159 313
918 3300035724 Ga0373933_0076526 Ga0373933_0076526_996_1937 313
919 3300035724 Ga0373933_0130999 Ga0373933_0130999_332_1294 313
920 3300035725 Ga0373947_0003801 Ga0373947_0003801_5240_6196 313
921 3300035725 Ga0373947_0008856 Ga0373947_0008856_4320_5276 313
922 3300035725 Ga0373947_0032588 Ga0373947_0032588_1532_2488 313
923 3300035725 Ga0373947_0035434 Ga0373947_0035434_76_1032 313
924 3300035725 Ga0373947_0259854 Ga0373947_0259854_35_994 313
925 3300036401 Ga0373937_0000005 Ga0373937_0000005_82403_83359 313
926 3300036401 Ga0373937_0025615 Ga0373937_0025615_1281_2243 313
927 3300036401 Ga0373937_0048456 Ga0373937_0048456_2392_3354 313
928 3300036401 Ga0373937_0110420 Ga0373937_0110420_89_1030 313
929 3300036401 Ga0373937_0178582 Ga0373937_0178582_817_1776 313
930 3300036647 Ga0316582_0082434 Ga0316582_0082434_828_1781 313
931 3300036647 Ga0316582_0110442 Ga0316582_0110442_555_1508 313
932 3300037068 Ga0373925_0000007 Ga0373925_0000007_116834_117790 313
933 3300037068 Ga0373925_0006256 Ga0373925_0006256_4781_5737 313
934 3300037068 Ga0373925_0007976 Ga0373925_0007976_2676_3632 313
935 3300037068 Ga0373925_0311510 Ga0373925_0311510_14_970 313
936 3300037312 Ga0395899_0000112 Ga0395899_0000112_135138_136079 313
937 3300037312 Ga0395899_0020389 Ga0395899_0020389_2207_3148 313
938 3300037312 Ga0395899_0029465 Ga0395899_0029465_2985_3926 313
939 3300037312 Ga0395899_0128167 Ga0395899_0128167_278_1249 313
940 3300037418 Ga0395900_0000126 Ga0395900_0000126_50825_51766 313
941 3300037418 Ga0395900_0001168 Ga0395900_0001168_5389_6333 313
942 3300037418 Ga0395900_0005035 Ga0395900_0005035_5466_6407 313
943 3300037418 Ga0395900_0091877 Ga0395900_0091877_132_1073 313
944 3300037418 Ga0395900_0131334 Ga0395900_0131334_209_1150 313
945 3300037418 Ga0395900_0186006 Ga0395900_0186006_1094_2035 313
946 3300037418 Ga0395900_0204397 Ga0395900_0204397_581_1543 313
947 3300037418 Ga0395900_0411048 Ga0395900_0411048_184_1125 313
948 3300037466 Ga0395898_0021159 Ga0395898_0021159_3171_4112 313
949 3300037466 Ga0395898_0067814 Ga0395898_0067814_1599_2540 313
950 3300037466 Ga0395898_0071691 Ga0395898_0071691_2032_2973 313
951 3300037466 Ga0395898_0129509 Ga0395898_0129509_203_1144 313
952 3300037466 Ga0395898_0165391 Ga0395898_0165391_439_1410 313
953 3300037466 Ga0395898_0182532 Ga0395898_0182532_1036_1977 313
954 3300037466 Ga0395898_0303673 Ga0395898_0303673_517_1458 313
955 3300037466 Ga0395898_0626186 Ga0395898_0626186_29_970 313
956 3300037471 Ga0395905_0001952 Ga0395905_0001952_7412_8356 313
957 3300037471 Ga0395905_0002564 Ga0395905_0002564_13858_14802 313
958 3300037471 Ga0395905_0094841 Ga0395905_0094841_1083_2024 313
959 3300037471 Ga0395905_0113726 Ga0395905_0113726_1305_2246 313
960 3300037471 Ga0395905_0257928 Ga0395905_0257928_139_1110 313
961 3300038443 Ga0395901_0000249 Ga0395901_0000249_50805_51746 313
962 3300038443 Ga0395901_0028554 Ga0395901_0028554_1274_2215 313
963 3300038443 Ga0395901_0032611 Ga0395901_0032611_2869_3813 313
964 3300038443 Ga0395901_0064971 Ga0395901_0064971_79_1020 313
965 3300038443 Ga0395901_0239538 Ga0395901_0239538_440_1381 313
966 3300038741 Ga0400488_42668 Ga0400488_42668_1187_2194 313
967 3300038742 Ga0400486_23075 Ga0400486_23075_806_1780 313
968 3300039437 Ga0436365_0388612 Ga0436365_0388612_57_1010 313
969 3300039437 Ga0436365_0710251 Ga0436365_0710251_1748_2701 313
970 3300039437 Ga0436365_1432912 Ga0436365_1432912_16232_17188 313
971 3300039447 Ga0436361_0124441 Ga0436361_0124441_597_1553 313
972 3300039447 Ga0436361_0198498 Ga0436361_0198498_3018_3974 313
973 3300039447 Ga0436361_0833088 Ga0436361_0833088_323_1276 313
974 3300039450 Ga0436363_0036075 Ga0436363_0036075_13555_14511 313
975 3300042439 Ga0439464_0000604 Ga0439464_0000604_1029_1970 313
976 3300044683 Ga0466965_0107407 Ga0466965_0107407_153_1094 313
977 3300044684 Ga0466966_0000001 Ga0466966_0000001_380557_381498 313
978 3300044684 Ga0466966_0007678 Ga0466966_0007678_2335_3276 313
979 3300044693 Ga0466961_0001957 Ga0466961_0001957_743_1687 313
980 3300044693 Ga0466961_0021341 Ga0466961_0021341_2476_3417 313
981 3300044694 Ga0466963_0060957 Ga0466963_0060957_1209_2150 313
982 3300044694 Ga0466963_0066699 Ga0466963_0066699_915_1856 313
983 3300044694 Ga0466963_0098529 Ga0466963_0098529_359_1303 313
984 3300044706 Ga0466964_0045424 Ga0466964_0045424_382_1323 313
985 3300044719 Ga0466971_0049154 Ga0466971_0049154_526_1467 313
986 3300044735 Ga0466968_0033418 Ga0466968_0033418_845_1786 313
987 3300044765 Ga0466970_0015793 Ga0466970_0015793_355_1296 313
988 3300044765 Ga0466970_0018885 Ga0466970_0018885_164_1105 313
989 3300044765 Ga0466970_0041527 Ga0466970_0041527_386_1327 313
990 3300044842 Ga0466957_0001548 Ga0466957_0001548_8431_9372 313
991 3300044842 Ga0466957_0013787 Ga0466957_0013787_2593_3549 313
992 3300045049 Ga0466959_0059278 Ga0466959_0059278_410_1351 313
993 3300045049 Ga0466959_0086949 Ga0466959_0086949_1025_1966 313
994 3300045836 Ga0466958_0017411 Ga0466958_0017411_342_1283 313
995 3300045836 Ga0466958_0063706 Ga0466958_0063706_1025_1966 313
996 3300045836 Ga0466958_0096927 Ga0466958_0096927_798_1739 313
997 3300045836 Ga0466958_0116963 Ga0466958_0116963_98_1039 313
998 3300045976 Ga0466967_0300392 Ga0466967_0300392_297_1238 313
999 3300045976 Ga0466967_0459947 Ga0466967_0459947_84_1025 313
1000 3300045976 Ga0466967_0586481 Ga0466967_0586481_94_1035 313
1001 3300046453 Ga0495627_000353 Ga0495627_000353_8251_9195 313
1002 3300046453 Ga0495627_000615 Ga0495627_000615_8124_9068 313
1003 3300046454 Ga0495592_0000241 Ga0495592_0000241_44264_45220 313
1004 3300046455 Ga0495603_0130304 Ga0495603_0130304_138_1157 313
1005 3300046459 Ga0495629_0015097 Ga0495629_0015097_3756_4712 313
1006 3300046460 Ga0495638_0088182 Ga0495638_0088182_296_1255 313
1007 3300046462 Ga0495651_0000555 Ga0495651_0000555_7202_8158 313
1008 3300046463 Ga0495653_0000103 Ga0495653_0000103_8117_9073 313
1009 3300046472 Ga0495580_0023628 Ga0495580_0023628_1765_2721 313
1010 3300046473 Ga0495582_0106757 Ga0495582_0106757_85_1041 313
1011 3300046475 Ga0495639_0087870 Ga0495639_0087870_407_1363 313
1012 3300046476 Ga0495662_0012843 Ga0495662_0012843_1703_2659 313
1013 3300046477 Ga0495664_0000003 Ga0495664_0000003_441771_442727 313
1014 3300046499 Ga0495594_0159278 Ga0495594_0159278_49_1068 313
1015 3300046501 Ga0495607_0013505 Ga0495607_0013505_4234_5184 313
1016 3300046506 Ga0495583_0004819 Ga0495583_0004819_1380_2327 313
1017 3300046507 Ga0495606_0068911 Ga0495606_0068911_1013_1960 313
1018 3300046511 Ga0495608_0000131 Ga0495608_0000131_23286_24242 313
1019 3300046512 Ga0495610_0000186 Ga0495610_0000186_68190_69134 313
1020 3300046512 Ga0495610_0047236 Ga0495610_0047236_63_1016 313
1021 3300046514 Ga0495618_0000019 Ga0495618_0000019_6938_7894 313
1022 3300046516 Ga0495628_0000080 Ga0495628_0000080_60596_61552 313
1023 3300046517 Ga0495630_0000989 Ga0495630_0000989_14325_15281 313
1024 3300046517 Ga0495630_0027488 Ga0495630_0027488_2461_3417 313
1025 3300046519 Ga0495632_0129557 Ga0495632_0129557_74_1027 313
1026 3300046520 Ga0495637_0018683 Ga0495637_0018683_1638_2582 313
1027 3300046520 Ga0495637_0045769 Ga0495637_0045769_301_1242 313
1028 3300046520 Ga0495637_0080112 Ga0495637_0080112_52_999 313
1029 3300046522 Ga0495643_0001215 Ga0495643_0001215_14143_15090 313
1030 3300046522 Ga0495643_0004105 Ga0495643_0004105_6660_7607 313
1031 3300046524 Ga0495648_0043810 Ga0495648_0043810_1102_2046 313
1032 3300046529 Ga0495652_0000006 Ga0495652_0000006_199244_200200 313
1033 3300046533 Ga0495640_0000002 Ga0495640_0000002_385985_386941 313
1034 3300046533 Ga0495640_0027742 Ga0495640_0027742_1279_2235 313
1035 3300046536 Ga0495587_0000001 Ga0495587_0000001_458441_459397 313
1036 3300046543 Ga0495645_0000009 Ga0495645_0000009_23287_24243 313
1037 3300046543 Ga0495645_0115662 Ga0495645_0115662_721_1677 313
1038 3300046558 Ga0495633_0002461 Ga0495633_0002461_9054_10001 313
1039 3300046559 Ga0495667_0000021 Ga0495667_0000021_62918_63874 313
1040 3300046559 Ga0495667_0251498 Ga0495667_0251498_147_1109 313
1041 3300046616 Ga0495668_0000258 Ga0495668_0000258_34027_34974 313
1042 3300046616 Ga0495668_0018062 Ga0495668_0018062_294_1235 313
1043 3300046616 Ga0495668_0119050 Ga0495668_0119050_76_1032 313
1044 3300046642 Ga0495634_0000396 Ga0495634_0000396_41257_42213 313
1045 3300046642 Ga0495634_0017941 Ga0495634_0017941_2552_3508 313
1046 3300046642 Ga0495634_0182947 Ga0495634_0182947_192_1148 313
1047 3300046642 Ga0495634_0198400 Ga0495634_0198400_197_1153 313
1048 3300046648 Ga0495611_0004123 Ga0495611_0004123_1213_2160 313
1049 3300046660 Ga0495625_0076122 Ga0495625_0076122_687_1628 313
1050 3300046660 Ga0495625_0089169 Ga0495625_0089169_200_1147 313
1051 3300046663 Ga0495635_0000001 Ga0495635_0000001_444252_445208 313
1052 3300046675 Ga0495657_0000088 Ga0495657_0000088_58014_58970 313
1053 3300046675 Ga0495657_0066311 Ga0495657_0066311_949_1908 313
1054 3300046678 Ga0495599_0000025 Ga0495599_0000025_58719_59675 313
1055 3300046679 Ga0495623_0000018 Ga0495623_0000018_12763_13719 313
1056 3300046680 Ga0495646_0000003 Ga0495646_0000003_22240_23196 313
1057 3300046683 Ga0495658_0000497 Ga0495658_0000497_18938_19894 313
1058 3300046684 Ga0495669_0000096 Ga0495669_0000096_39377_40324 313
1059 3300046690 Ga0495624_0046274 Ga0495624_0046274_553_1509 313
1060 3300046690 Ga0495624_0163952 Ga0495624_0163952_349_1305 313
1061 3300046809 Ga0495600_0000042 Ga0495600_0000042_23316_24272 313
1062 3300047315 Ga0495581_0008078 Ga0495581_0008078_2651_3607 313
1063 3300047317 Ga0495604_0000008 Ga0495604_0000008_60637_61593 313
1064 3300047319 Ga0495674_0000028 Ga0495674_0000028_63046_64002 313
1065 3300047319 Ga0495674_0192162 Ga0495674_0192162_333_1316 313
1066 3300047319 Ga0495674_0350370 Ga0495674_0350370_185_1141 313
1067 3300047322 Ga0495680_0001113 Ga0495680_0001113_5410_6366 313
1068 3300047443 Ga0495687_000378 Ga0495687_000378_15253_16200 313
1069 3300047444 Ga0495675_0000691 Ga0495675_0000691_18986_19942 313
1070 3300047445 Ga0495677_0002781 Ga0495677_0002781_2943_3890 313
1071 3300047470 Ga0495681_0000110 Ga0495681_0000110_61919_62863 313
1072 3300047471 Ga0495684_0000002 Ga0495684_0000002_60695_61651 313
1073 3300047673 Ga0495593_0005631 Ga0495593_0005631_3356_4312 313
1074 3300048088 Ga0495602_0000022 Ga0495602_0000022_23300_24256 313
1075 3300048088 Ga0495602_0023164 Ga0495602_0023164_1594_2535 313
1076 3300048090 Ga0495615_0022915 Ga0495615_0022915_194_1135 313
1077 3300048904 Ga0496101_0091665 Ga0496101_0091665_1194_2252 313
1078 3300048904 Ga0496101_0164931 Ga0496101_0164931_23_979 313
1079 3300048905 Ga0496102_0023431 Ga0496102_0023431_2007_3065 313
1080 3300048905 Ga0496102_0059494 Ga0496102_0059494_1549_2505 313
1081 3300048906 Ga0496103_0039827 Ga0496103_0039827_1159_2115 313
1082 3300048907 Ga0496104_0000040 Ga0496104_0000040_82175_83128 313
1083 3300048907 Ga0496104_0000316 Ga0496104_0000316_5094_6113 313
1084 3300048907 Ga0496104_0002075 Ga0496104_0002075_13588_14541 313
1085 3300048907 Ga0496104_0035963 Ga0496104_0035963_1351_2304 313
1086 3300048907 Ga0496104_0096964 Ga0496104_0096964_1031_2089 313
1087 3300048907 Ga0496104_0403309 Ga0496104_0403309_278_1231 313
1088 3300048908 Ga0496105_0000060 Ga0496105_0000060_82485_83438 313
1089 3300048908 Ga0496105_0026202 Ga0496105_0026202_1741_2694 313
1090 3300048908 Ga0496105_0036677 Ga0496105_0036677_2276_3229 313
1091 3300048910 Ga0496107_0111587 Ga0496107_0111587_1027_1971 313
1092 3300048911 Ga0496108_0005349 Ga0496108_0005349_7064_8008 313
1093 3300048911 Ga0496108_0021285 Ga0496108_0021285_2719_3777 313
1094 3300048912 Ga0496109_0070289 Ga0496109_0070289_868_1926 313
1095 3300048912 Ga0496109_0076001 Ga0496109_0076001_1289_2242 313
1096 3300048913 Ga0496110_0002032 Ga0496110_0002032_9353_10372 313
1097 3300048914 Ga0496111_0030447 Ga0496111_0030447_1743_2762 313
1098 3300048914 Ga0496111_0042787 Ga0496111_0042787_2147_3103 313
1099 3300048914 Ga0496111_0084443 Ga0496111_0084443_577_1518 313
1100 3300048914 Ga0496111_0139830 Ga0496111_0139830_389_1447 313
1101 3300048915 Ga0496112_0004086 Ga0496112_0004086_9765_10718 313
1102 3300048915 Ga0496112_0027234 Ga0496112_0027234_2334_3353 313
1103 3300048915 Ga0496112_0317958 Ga0496112_0317958_309_1277 313
1104 3300048916 Ga0496113_0004024 Ga0496113_0004024_2391_3410 313
1105 3300048916 Ga0496113_0040657 Ga0496113_0040657_1384_2337 313
1106 3300048918 Ga0496115_0028629 Ga0496115_0028629_1288_2346 313
1107 3300048918 Ga0496115_0060528 Ga0496115_0060528_1429_2385 313
1108 3300048922 Ga0496119_0002688 Ga0496119_0002688_15931_16884 313
1109 3300048924 Ga0496121_0147076 Ga0496121_0147076_444_1391 313
1110 3300048926 Ga0496123_0129844 Ga0496123_0129844_301_1338 313
1111 3300048928 Ga0496125_0292461 Ga0496125_0292461_14_958 313
1112 3300048929 Ga0496126_0002680 Ga0496126_0002680_9021_9980 313
1113 3300048929 Ga0496126_0091998 Ga0496126_0091998_431_1390 313
1114 3300048929 Ga0496126_0195334 Ga0496126_0195334_131_1084 313
1115 3300049459 Ga0495678_015954 Ga0495678_015954_1337_2281 313
1116 3300049460 Ga0495682_0005841 Ga0495682_0005841_4023_4979 313
1117 3300049568 Ga0501031_0022369 Ga0501031_0022369_2093_3052 313
1118 3300049569 Ga0501032_0026639 Ga0501032_0026639_2536_3504 313
1119 3300049569 Ga0501032_0181853 Ga0501032_0181853_234_1190 313
1120 3300049570 Ga0501033_0010904 Ga0501033_0010904_2182_3138 313
1121 3300049570 Ga0501033_0089119 Ga0501033_0089119_592_1548 313
1122 3300049570 Ga0501033_0120461 Ga0501033_0120461_551_1510 313
1123 3300049571 Ga0501034_0005576 Ga0501034_0005576_2182_3138 313
1124 3300049571 Ga0501034_0009494 Ga0501034_0009494_315_1271 313
1125 3300049571 Ga0501034_0061063 Ga0501034_0061063_903_1859 313
1126 3300049571 Ga0501034_0072766 Ga0501034_0072766_2131_3087 313
1127 3300049571 Ga0501034_0142028 Ga0501034_0142028_887_1861 313
1128 3300049571 Ga0501034_0313760 Ga0501034_0313760_305_1261 313
1129 3300049572 Ga0501036_0005785 Ga0501036_0005785_549_1505 313
1130 3300049572 Ga0501036_0123265 Ga0501036_0123265_991_1947 313
1131 3300049573 Ga0501037_0002948 Ga0501037_0002948_3834_4790 313
1132 3300049573 Ga0501037_0263761 Ga0501037_0263761_72_1031 313
1133 3300049574 Ga0501038_0000843 Ga0501038_0000843_5963_6919 313
1134 3300049574 Ga0501038_0028450 Ga0501038_0028450_3726_4694 313
1135 3300049574 Ga0501038_0052840 Ga0501038_0052840_2165_3124 313
1136 3300049574 Ga0501038_0089951 Ga0501038_0089951_235_1191 313
1137 3300049574 Ga0501038_0143461 Ga0501038_0143461_248_1204 313
1138 3300049575 Ga0501039_0006533 Ga0501039_0006533_4852_5808 313
1139 3300049579 Ga0501043_0010724 Ga0501043_0010724_3457_4413 313
1140 3300049580 Ga0501046_0003200 Ga0501046_0003200_3082_4038 313
1141 3300049580 Ga0501046_0012717 Ga0501046_0012717_531_1487 313
1142 3300049581 Ga0501047_0006810 Ga0501047_0006810_2310_3266 313
1143 3300049581 Ga0501047_0010868 Ga0501047_0010868_4854_5822 313
1144 3300049581 Ga0501047_0167775 Ga0501047_0167775_78_1034 313
1145 3300049581 Ga0501047_0313049 Ga0501047_0313049_159_1328 313
1146 3300049582 Ga0501048_0003240 Ga0501048_0003240_8176_9132 313
1147 3300049583 Ga0501067_0003372 Ga0501067_0003372_7499_8455 313
1148 3300049583 Ga0501067_0015846 Ga0501067_0015846_2936_3892 313
1149 3300049583 Ga0501067_0055584 Ga0501067_0055584_755_1699 313
1150 3300049583 Ga0501067_0063225 Ga0501067_0063225_1012_1968 313
1151 3300049584 Ga0501068_0001776 Ga0501068_0001776_3882_4838 313
1152 3300049584 Ga0501068_0032115 Ga0501068_0032115_182_1138 313
1153 3300049584 Ga0501068_0072378 Ga0501068_0072378_959_1903 313
1154 3300049585 Ga0501069_0006219 Ga0501069_0006219_5244_6200 313
1155 3300049585 Ga0501069_0031823 Ga0501069_0031823_1388_2344 313
1156 3300049585 Ga0501069_0103639 Ga0501069_0103639_148_1104 313
1157 3300049586 Ga0501070_0000024 Ga0501070_0000024_122818_123777 313
1158 3300049586 Ga0501070_0003223 Ga0501070_0003223_7382_8338 313
1159 3300049586 Ga0501070_0008662 Ga0501070_0008662_264_1220 313
1160 3300049586 Ga0501070_0025471 Ga0501070_0025471_3457_4413 313
1161 3300049586 Ga0501070_0030575 Ga0501070_0030575_1938_2891 313
1162 3300049586 Ga0501070_0058101 Ga0501070_0058101_906_1862 313
1163 3300049586 Ga0501070_0063974 Ga0501070_0063974_164_1120 313
1164 3300049586 Ga0501070_0065460 Ga0501070_0065460_471_1427 313
1165 3300049586 Ga0501070_0163411 Ga0501070_0163411_12_968 313
1166 3300049587 Ga0501071_0018083 Ga0501071_0018083_2867_3823 313
1167 3300049588 Ga0501072_0010755 Ga0501072_0010755_5888_6844 313
1168 3300049589 Ga0501073_0019692 Ga0501073_0019692_1957_2913 313
1169 3300049589 Ga0501073_0029021 Ga0501073_0029021_689_1645 313
1170 3300049589 Ga0501073_0046862 Ga0501073_0046862_1175_2134 313
1171 3300049589 Ga0501073_0051648 Ga0501073_0051648_233_1189 313
1172 3300049589 Ga0501073_0083510 Ga0501073_0083510_308_1264 313
1173 3300049589 Ga0501073_0234866 Ga0501073_0234866_36_1004 313
1174 3300049590 Ga0501074_0003356 Ga0501074_0003356_1691_2647 313
1175 3300049590 Ga0501074_0071243 Ga0501074_0071243_12_965 313
1176 3300049590 Ga0501074_0107374 Ga0501074_0107374_352_1335 313
1177 3300049590 Ga0501074_0146591 Ga0501074_0146591_204_1160 313
1178 3300049591 Ga0501075_0097733 Ga0501075_0097733_12_965 313
1179 3300049592 Ga0501076_0004022 Ga0501076_0004022_6029_6982 313
1180 3300049593 Ga0501077_0001770 Ga0501077_0001770_4784_5737 313
1181 3300049741 Ga0501079_0033484 Ga0501079_0033484_54_1007 313
1182 3300049741 Ga0501079_0138816 Ga0501079_0138816_387_1343 313
1183 3300049741 Ga0501079_0188434 Ga0501079_0188434_213_1172 313
1184 3300049741 Ga0501079_0338998 Ga0501079_0338998_178_1134 313
1185 3300049742 Ga0501080_0002884 Ga0501080_0002884_9180_10139 313
1186 3300049742 Ga0501080_0011105 Ga0501080_0011105_3829_4785 313
1187 3300049742 Ga0501080_0019967 Ga0501080_0019967_3740_4909 313
1188 3300049742 Ga0501080_0026141 Ga0501080_0026141_3044_4000 313
1189 3300049742 Ga0501080_0068934 Ga0501080_0068934_2235_3191 313
1190 3300049742 Ga0501080_0158149 Ga0501080_0158149_388_1347 313
1191 3300049742 Ga0501080_0186438 Ga0501080_0186438_406_1362 313
1192 3300049742 Ga0501080_0349284 Ga0501080_0349284_170_1129 313
1193 3300049743 Ga0501081_0007060 Ga0501081_0007060_2405_3358 313
1194 3300049744 Ga0501083_0010892 Ga0501083_0010892_3269_4225 313
1195 3300049822 Ga0501035_0000371 Ga0501035_0000371_44118_45074 313
1196 3300049822 Ga0501035_0009698 Ga0501035_0009698_3918_4877 313
1197 3300049822 Ga0501035_0029527 Ga0501035_0029527_3457_4413 313
1198 3300049822 Ga0501035_0057030 Ga0501035_0057030_385_1341 313
1199 3300049822 Ga0501035_0147823 Ga0501035_0147823_151_1107 313
1200 3300049822 Ga0501035_0207155 Ga0501035_0207155_661_1629 313
1201 3300049822 Ga0501035_0431924 Ga0501035_0431924_58_1014 313
1202 3300049823 Ga0501044_0002209 Ga0501044_0002209_6752_7711 313
1203 3300049823 Ga0501044_0020418 Ga0501044_0020418_1538_2506 313
1204 3300049823 Ga0501044_0026362 Ga0501044_0026362_4375_5331 313
1205 3300049823 Ga0501044_0087370 Ga0501044_0087370_1958_2914 313
1206 3300049823 Ga0501044_0114874 Ga0501044_0114874_1235_2191 313
1207 3300049823 Ga0501044_0435360 Ga0501044_0435360_226_1182 313
1208 3300050490 nmdc:mga03n38_595_c1 nmdc:mga03n38_595_c1_4487_5506 313
1209 3300050490 nmdc:mga03n38_73454_c1 nmdc:mga03n38_73454_c1_311_1270 313
1210 3300050491 nmdc:mga00v17_5162_c1 nmdc:mga00v17_5162_c1_1080_2099 313
1211 3300050492 nmdc:mga0yw44_207906_c1 nmdc:mga0yw44_207906_c1_71_1033 313
1212 3300050492 nmdc:mga0yw44_2703_c1 nmdc:mga0yw44_2703_c1_3086_4042 313
1213 3300050494 nmdc:mga06z11_123_c1 nmdc:mga06z11_123_c1_27119_28138 313
1214 3300050494 nmdc:mga06z11_87811_c1 nmdc:mga06z11_87811_c1_44_1018 313
1215 3300050495 nmdc:mga04h51_46045_c1 nmdc:mga04h51_46045_c1_370_1344 313
1216 3300050507 nmdc:mga05p37_197560_c1 nmdc:mga05p37_197560_c1_741_1715 313
1217 3300050507 nmdc:mga05p37_2001_c1 nmdc:mga05p37_2001_c1_18069_19025 313
1218 3300050507 nmdc:mga05p37_216337_c1 nmdc:mga05p37_216337_c1_731_1705 313
1219 3300050507 nmdc:mga05p37_564_c1 nmdc:mga05p37_564_c1_7255_8211 313
1220 3300050507 nmdc:mga05p37_94737_c1 nmdc:mga05p37_94737_c1_1754_2710 313
1221 3300050508 nmdc:mga09592_20905_c1 nmdc:mga09592_20905_c1_745_1701 313
1222 3300050508 nmdc:mga09592_430002_c1 nmdc:mga09592_430002_c1_15_989 313
1223 3300050508 nmdc:mga09592_47868_c1 nmdc:mga09592_47868_c1_2056_3030 313
1224 3300050509 nmdc:mga0qj67_21757_c1 nmdc:mga0qj67_21757_c1_823_1764 313
1225 3300050509 nmdc:mga0qj67_46501_c1 nmdc:mga0qj67_46501_c1_190_1164 313
1226 3300050510 nmdc:mga06r32_191_c1 nmdc:mga06r32_191_c1_32583_33539 313
1227 3300050510 nmdc:mga06r32_335094_c1 nmdc:mga06r32_335094_c1_226_1200 313
1228 3300050511 nmdc:mga08y16_272171_c1 nmdc:mga08y16_272171_c1_526_1479 313
1229 3300050511 nmdc:mga08y16_67805_c1 nmdc:mga08y16_67805_c1_916_1890 313
1230 3300050511 nmdc:mga08y16_89_c1 nmdc:mga08y16_89_c1_70222_71178 313
1231 3300050512 nmdc:mga0n895_110202_c1 nmdc:mga0n895_110202_c1_1243_2199 313
1232 3300050512 nmdc:mga0n895_22520_c1 nmdc:mga0n895_22520_c1_3203_4162 313
1233 3300050512 nmdc:mga0n895_97197_c1 nmdc:mga0n895_97197_c1_1225_2178 313
1234 3300050513 nmdc:mga0rr50_34672_c1 nmdc:mga0rr50_34672_c1_606_1565 313
1235 3300050513 nmdc:mga0rr50_81139_c1 nmdc:mga0rr50_81139_c1_1055_2008 313
1236 3300050514 nmdc:mga08x19_129089_c1 nmdc:mga08x19_129089_c1_481_1440 313
1237 3300050514 nmdc:mga08x19_94_c1 nmdc:mga08x19_94_c1_43395_44354 313
1238 3300050515 nmdc:mga0a205_74953_c1 nmdc:mga0a205_74953_c1_2129_3085 313
1239 3300053077 Ga0495601_0000001 Ga0495601_0000001_100195_101151 313
1240 3300053077 Ga0495601_0287949 Ga0495601_0287949_77_1027 313
1241 3300053078 Ga0495612_0000003 Ga0495612_0000003_241954_242910 313
1242 3300053079 Ga0500610_0000197 Ga0500610_0000197_11747_12694 313
1243 3300053084 Ga0495595_0000093 Ga0495595_0000093_23308_24264 313
1244 3300053085 Ga0495619_0000004 Ga0495619_0000004_100226_101182 313
1245 3300053085 Ga0495619_0050091 Ga0495619_0050091_1780_2736 313
1246 3300053085 Ga0495619_0230697 Ga0495619_0230697_265_1221 313
1247 3300053086 Ga0500578_0118312 Ga0500578_0118312_194_1147 313
1248 3300053091 Ga0500647_0030771 Ga0500647_0030771_1134_2081 313
1249 3300053093 Ga0500651_0006181 Ga0500651_0006181_5787_6728 313
1250 3300053094 Ga0500566_0166802 Ga0500566_0166802_31_984 313
1251 3300053096 Ga0500641_0020633 Ga0500641_0020633_1479_2438 313
1252 3300053119 Ga0500595_013327 Ga0500595_013327_610_1566 313
1253 3300053119 Ga0500595_021227 Ga0500595_021227_977_1930 313
1254 3300053120 Ga0500597_002095 Ga0500597_002095_2955_3902 313
1255 3300053125 Ga0500618_004151 Ga0500618_004151_55_1002 313
1256 3300053130 Ga0500642_0009494 Ga0500642_0009494_1945_2886 313
1257 3300053131 Ga0500652_000056 Ga0500652_000056_997_1950 313
1258 3300053133 Ga0500655_000024 Ga0500655_000024_11992_12933 313
1259 3300053133 Ga0500655_010896 Ga0500655_010896_38_994 313
1260 3300053134 Ga0500658_0050268 Ga0500658_0050268_175_1131 313
1261 3300053134 Ga0500658_0056297 Ga0500658_0056297_308_1264 313
1262 3300053137 Ga0500561_0040921 Ga0500561_0040921_51_1004 313
1263 3300053140 Ga0500573_0000046 Ga0500573_0000046_11392_12339 313
1264 3300053148 Ga0500590_000243 Ga0500590_000243_12840_13781 313
1265 3300053153 Ga0500616_0062964 Ga0500616_0062964_273_1226 313
1266 3300053154 Ga0500619_005042 Ga0500619_005042_471_1427 313
1267 3300053156 Ga0500622_0011869 Ga0500622_0011869_239_1180 313
1268 3300053157 Ga0500624_000001 Ga0500624_000001_166285_167232 313
1269 3300053177 Ga0500636_0010157 Ga0500636_0010157_4462_5415 313
1270 3300053177 Ga0500636_0060093 Ga0500636_0060093_155_1108 313
1271 3300053178 Ga0500637_0000010 Ga0500637_0000010_30806_31753 313
1272 3300053724 Ga0500570_000188 Ga0500570_000188_11723_12664 313
1273 3300053730 Ga0500645_000008 Ga0500645_000008_169100_170047 313
1274 3300054114 Ga0501084_0000363 Ga0501084_0000363_14922_15878 313
1275 3300054114 Ga0501084_0006757 Ga0501084_0006757_4642_5595 313
1276 3300054114 Ga0501084_0028335 Ga0501084_0028335_386_1342 313
1277 3300054114 Ga0501084_0075852 Ga0501084_0075852_87_1043 313
1278 3300054114 Ga0501084_0127741 Ga0501084_0127741_285_1241 313
1279 3300060353 Ga0501082_0002420 Ga0501082_0002420_3275_4228 313
1280 3300060353 Ga0501082_0012588 Ga0501082_0012588_4828_5796 313
1281 3300060353 Ga0501082_0016405 Ga0501082_0016405_403_1359 313
1282 3300060353 Ga0501082_0071723 Ga0501082_0071723_106_1062 313
1283 3300061719 Ga0466962_0014485 Ga0466962_0014485_432_1376 313
1284 3300061719 Ga0466962_0074237 Ga0466962_0074237_275_1216 313
1285 iso_pu_bacteria 2765235802 2765467876 313
1286 iso_pu_bacteria 2767802442 2770198622 313
1287 iso_pu_bacteria 2818991467 2819721296 313
1288 iso_pu_bacteria 2928521798 2928526593 313
1289 iso_pu_bacteria 2954011201 2954013417 313
1290 iso_pu_bacteria 8054302542 8054304165 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

75

385

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

153

375

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.965 4 313
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9574 5 313
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9564 3 313
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9548 2 313
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9492 4 313
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9693 4 313 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9572 4 313 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9363 54 313 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9222 54 313 3.90.226.10
af_A4I399_1_165_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.817 143 295 3.90.226.10
ID Description Score Start End GO Terms
AF-Q1YGC9-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9927 1 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1V5LIY6-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9924 185 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A258Z5K8-F1-model_v4 deleted 0.9922 1 313
AF-A0A7W6H3U6-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9918 1 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A7Y9RDZ1-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9914 1 310 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Feature Viewer

pLDDT pTM Quality
95.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map