F492632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1290 | 465 | 1252 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0313049|Ga0501047_0313049_159_1328 |
| Length | 389 |
| Sequence | MRALGLGGGVRRSRKQLYCRKSLNRIQVEIRKAWQGFLNFCRPSFVDSTEPFGHFPGPFGFYCQDPFRKVAMHAYLDFEKPIAELEGKIVELRQLAANDPTMEIDSDVARLQSKADALVRDTYAKLTPWQKVQVARHQNRPHFSDYVNHLIDEFTPLAGDRLYGEDAAVIAGLGRFRGRAVAVVGQEKGNDTKSRLKHNFGMAMPEGYRKAQRLFDMADRFGLPVLSLVDTSGAYPGVSAEERGQSEAIARSTQAGLELRVPFVCTIIGDGMSGGAIAIAAANRVYMLEHSIYSVISPEGCASILWRNADKAQDAATALKITAQDLLDLKIIDGIVSEPVGGAHRAPQEAIMNAGEQIAKALAELSSLSGDELRRQRREKFLAMGRNLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 2 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 5 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 6 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 7 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 8 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 9 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 10 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 11 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 12 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 13 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 14 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 15 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 16 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 17 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 18 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 19 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 20 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 21 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 22 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 23 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 24 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 25 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 26 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 27 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 28 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 29 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 30 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 31 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 32 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 33 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 34 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 35 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 38 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 39 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 142 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 161 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 162 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 163 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 245 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 251 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 252 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 280 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 283 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 284 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 285 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 286 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 287 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 295 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 296 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 299 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 300 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 374 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 375 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 376 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 377 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 403 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 432 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 433 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 434 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 436 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 437 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 438 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 439 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 441 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 442 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 443 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 445 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 446 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 447 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 448 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 449 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 450 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 451 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 452 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 455 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 456 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 458 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 461 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 462 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 463 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 464 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 465 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.82 |
| Metatranscriptomes | 0.23 |
| Isolates | 2.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 6.51 |
| Nodule | 0.16 |
| Rhizoplane | 3.41 |
| Rhizosphere | 85.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000201 | 3300001904 | Bacteria | 10736 |
| 2 | JGI24741J21665_1001549 | 3300001915 | Bacteria | 6501 |
| 3 | JGI24739J22299_10018850 | 3300001989 | Bacteria | 2475 |
| 4 | JGI24738J21930_10013641 | 3300002075 | Bacteria | 1753 |
| 5 | JGI25150J39212_1000340 | 3300002774 | Bacteria | 23053 |
| 6 | JGI25406J46586_10002125 | 3300003203 | Bacteria | 9358 |
| 7 | JGI25406J46586_10004558 | 3300003203 | Bacteria | 6449 |
| 8 | rootH2_10006377 | 3300003320 | Bacteria | 60685 |
| 9 | rootH2_10013646 | 3300003320 | Bacteria | 13171 |
| 10 | JGI25407J50210_10033264 | 3300003373 | Bacteria | 1331 |
| 11 | Ga0055526_1002614 | 3300003771 | Bacteria | 12040 |
| 12 | Ga0055524_1000205 | 3300003775 | Bacteria | 64186 |
| 13 | Ga0055524_1009309 | 3300003775 | Bacteria | 4010 |
| 14 | Ga0055530_10039828 | 3300003791 | Bacteria | 1158 |
| 15 | Ga0065165_1003151 | 3300005262 | Bacteria | 12160 |
| 16 | Ga0065712_10088759 | 3300005290 | Bacteria | 2503 |
| 17 | Ga0070658_10000379 | 3300005327 | Bacteria | 38762 |
| 18 | Ga0070658_10000629 | 3300005327 | Bacteria | 30443 |
| 19 | Ga0070658_10001363 | 3300005327 | Bacteria | 20879 |
| 20 | Ga0070658_10001797 | 3300005327 | Bacteria | 18034 |
| 21 | Ga0070658_10004427 | 3300005327 | Bacteria | 11443 |
| 22 | Ga0070658_10004769 | 3300005327 | Bacteria | 11028 |
| 23 | Ga0070658_10263739 | 3300005327 | Bacteria | 1463 |
| 24 | Ga0070683_100018947 | 3300005329 | Bacteria | 6106 |
| 25 | Ga0070683_100190337 | 3300005329 | Bacteria | 1948 |
| 26 | Ga0070690_100000750 | 3300005330 | Bacteria | 16607 |
| 27 | Ga0070670_100042476 | 3300005331 | Bacteria | 3908 |
| 28 | Ga0068869_100069402 | 3300005334 | Bacteria | 2605 |
| 29 | Ga0068869_100086347 | 3300005334 | Bacteria | 2352 |
| 30 | Ga0070666_10090471 | 3300005335 | Bacteria | 2102 |
| 31 | Ga0070680_100000533 | 3300005336 | Bacteria | 25986 |
| 32 | Ga0070680_100001991 | 3300005336 | Bacteria | 15033 |
| 33 | Ga0070680_100011194 | 3300005336 | Bacteria | 6939 |
| 34 | Ga0070680_100012364 | 3300005336 | Bacteria | 6629 |
| 35 | Ga0070680_100025656 | 3300005336 | Bacteria | 4712 |
| 36 | Ga0070680_100134645 | 3300005336 | Bacteria | 2069 |
| 37 | Ga0070680_100217605 | 3300005336 | Bacteria | 1612 |
| 38 | Ga0070682_100075508 | 3300005337 | Bacteria | 2167 |
| 39 | Ga0068868_100013002 | 3300005338 | Bacteria | 6091 |
| 40 | Ga0070660_100000085 | 3300005339 | Bacteria | 56233 |
| 41 | Ga0070660_100003873 | 3300005339 | Bacteria | 10334 |
| 42 | Ga0070660_100006908 | 3300005339 | Bacteria | 7873 |
| 43 | Ga0070660_100010943 | 3300005339 | Bacteria | 6424 |
| 44 | Ga0070660_100017238 | 3300005339 | Bacteria | 5262 |
| 45 | Ga0070660_100041942 | 3300005339 | Bacteria | 3490 |
| 46 | Ga0070660_100072550 | 3300005339 | Bacteria | 2691 |
| 47 | Ga0070660_100152121 | 3300005339 | Bacteria | 1861 |
| 48 | Ga0070691_10000436 | 3300005341 | Bacteria | 15410 |
| 49 | Ga0070661_100008874 | 3300005344 | Bacteria | 6961 |
| 50 | Ga0070661_100036493 | 3300005344 | Bacteria | 3573 |
| 51 | Ga0070661_100059067 | 3300005344 | Bacteria | 2811 |
| 52 | Ga0070661_100067263 | 3300005344 | Bacteria | 2633 |
| 53 | Ga0070661_100416099 | 3300005344 | Bacteria | 1065 |
| 54 | Ga0070692_10000996 | 3300005345 | Bacteria | 9712 |
| 55 | Ga0070692_10121551 | 3300005345 | Bacteria | 1457 |
| 56 | Ga0070668_100004964 | 3300005347 | Bacteria | 9852 |
| 57 | Ga0070668_100041725 | 3300005347 | Bacteria | 3516 |
| 58 | Ga0070668_100051129 | 3300005347 | Bacteria | 3183 |
| 59 | Ga0070669_100014161 | 3300005353 | Bacteria | 5675 |
| 60 | Ga0070669_100046987 | 3300005353 | Bacteria | 3148 |
| 61 | Ga0070671_100019489 | 3300005355 | Bacteria | 5522 |
| 62 | Ga0070671_100140493 | 3300005355 | Bacteria | 2038 |
| 63 | Ga0070671_100167661 | 3300005355 | Bacteria | 1857 |
| 64 | Ga0070688_100020935 | 3300005365 | Bacteria | 3812 |
| 65 | Ga0070659_100034927 | 3300005366 | Bacteria | 3913 |
| 66 | Ga0070659_100050154 | 3300005366 | Bacteria | 3282 |
| 67 | Ga0070659_100052987 | 3300005366 | Bacteria | 3192 |
| 68 | Ga0070659_100082226 | 3300005366 | Bacteria | 2573 |
| 69 | Ga0070667_100000128 | 3300005367 | Bacteria | 95780 |
| 70 | Ga0070667_100101349 | 3300005367 | Bacteria | 2487 |
| 71 | Ga0070667_100176654 | 3300005367 | Bacteria | 1887 |
| 72 | Ga0070667_100452247 | 3300005367 | Bacteria | 1174 |
| 73 | Ga0070709_10022286 | 3300005434 | Bacteria | 3703 |
| 74 | Ga0070709_10045104 | 3300005434 | Bacteria | 2734 |
| 75 | Ga0070709_10050465 | 3300005434 | Bacteria | 2607 |
| 76 | Ga0070709_10073352 | 3300005434 | Bacteria | 2215 |
| 77 | Ga0070709_10213562 | 3300005434 | Bacteria | 1372 |
| 78 | Ga0070714_100001555 | 3300005435 | Bacteria | 16718 |
| 79 | Ga0070714_100092568 | 3300005435 | Bacteria | 2650 |
| 80 | Ga0070714_100143734 | 3300005435 | Bacteria | 2144 |
| 81 | Ga0070714_100159661 | 3300005435 | Bacteria | 2039 |
| 82 | Ga0070714_100175048 | 3300005435 | Bacteria | 1950 |
| 83 | Ga0070714_100287153 | 3300005435 | Bacteria | 1530 |
| 84 | Ga0070714_100407097 | 3300005435 | Bacteria | 1287 |
| 85 | Ga0070713_100000046 | 3300005436 | Bacteria | 77263 |
| 86 | Ga0070713_100035064 | 3300005436 | Bacteria | 4037 |
| 87 | Ga0070713_100066889 | 3300005436 | Bacteria | 3023 |
| 88 | Ga0070713_100105035 | 3300005436 | Bacteria | 2453 |
| 89 | Ga0070713_100278926 | 3300005436 | Bacteria | 1533 |
| 90 | Ga0070710_10155478 | 3300005437 | Bacteria | 1414 |
| 91 | Ga0070710_10181264 | 3300005437 | Bacteria | 1319 |
| 92 | Ga0070710_10182275 | 3300005437 | Bacteria | 1315 |
| 93 | Ga0070711_100033505 | 3300005439 | Bacteria | 3420 |
| 94 | Ga0070711_100106035 | 3300005439 | Bacteria | 2054 |
| 95 | Ga0070711_100115903 | 3300005439 | Bacteria | 1973 |
| 96 | Ga0070711_100248073 | 3300005439 | Bacteria | 1395 |
| 97 | Ga0070705_100000255 | 3300005440 | Bacteria | 31677 |
| 98 | Ga0070700_100000791 | 3300005441 | Bacteria | 15529 |
| 99 | Ga0070708_100146096 | 3300005445 | Bacteria | 2196 |
| 100 | Ga0070663_100002086 | 3300005455 | Bacteria | 11179 |
| 101 | Ga0070663_100015553 | 3300005455 | Bacteria | 4917 |
| 102 | Ga0070663_100020448 | 3300005455 | Bacteria | 4384 |
| 103 | Ga0070663_100218586 | 3300005455 | Bacteria | 1495 |
| 104 | Ga0070678_100022241 | 3300005456 | Bacteria | 4197 |
| 105 | Ga0070662_100012251 | 3300005457 | Bacteria | 5679 |
| 106 | Ga0070662_100182915 | 3300005457 | Bacteria | 1653 |
| 107 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 108 | Ga0070681_10013587 | 3300005458 | Bacteria | 8101 |
| 109 | Ga0070681_10016380 | 3300005458 | Bacteria | 7400 |
| 110 | Ga0070681_10033804 | 3300005458 | Bacteria | 5133 |
| 111 | Ga0070681_10039831 | 3300005458 | Bacteria | 4710 |
| 112 | Ga0070681_10099789 | 3300005458 | Bacteria | 2849 |
| 113 | Ga0070681_10145238 | 3300005458 | Bacteria | 2301 |
| 114 | Ga0070681_10292648 | 3300005458 | Bacteria | 1538 |
| 115 | Ga0070706_100137911 | 3300005467 | Bacteria | 2276 |
| 116 | Ga0070707_100061943 | 3300005468 | Bacteria | 3589 |
| 117 | Ga0070698_100209583 | 3300005471 | Bacteria | 1884 |
| 118 | Ga0070698_100225709 | 3300005471 | Bacteria | 1806 |
| 119 | Ga0070699_100001711 | 3300005518 | Bacteria | 20006 |
| 120 | Ga0070699_100022541 | 3300005518 | Bacteria | 5428 |
| 121 | Ga0070699_100054126 | 3300005518 | Bacteria | 3474 |
| 122 | Ga0070679_100008607 | 3300005530 | Bacteria | 9619 |
| 123 | Ga0070679_100049485 | 3300005530 | Bacteria | 4186 |
| 124 | Ga0070679_100150468 | 3300005530 | Bacteria | 2304 |
| 125 | Ga0070679_100218911 | 3300005530 | Bacteria | 1865 |
| 126 | Ga0070679_100244695 | 3300005530 | Bacteria | 1750 |
| 127 | Ga0070679_100341713 | 3300005530 | Bacteria | 1445 |
| 128 | Ga0070679_100449157 | 3300005530 | Bacteria | 1234 |
| 129 | Ga0070684_100068767 | 3300005535 | Bacteria | 3113 |
| 130 | Ga0070684_100276095 | 3300005535 | Bacteria | 1539 |
| 131 | Ga0070697_100003111 | 3300005536 | Bacteria | 12747 |
| 132 | Ga0070697_100112469 | 3300005536 | Bacteria | 2271 |
| 133 | Ga0070697_100342900 | 3300005536 | Bacteria | 1289 |
| 134 | Ga0068853_100032596 | 3300005539 | Bacteria | 4415 |
| 135 | Ga0068853_100034820 | 3300005539 | Bacteria | 4276 |
| 136 | Ga0068853_100226575 | 3300005539 | Bacteria | 1709 |
| 137 | Ga0068853_100227876 | 3300005539 | Bacteria | 1704 |
| 138 | Ga0070695_100000220 | 3300005545 | Bacteria | 27875 |
| 139 | Ga0070695_100037083 | 3300005545 | Bacteria | 3071 |
| 140 | Ga0070695_100112590 | 3300005545 | Bacteria | 1849 |
| 141 | Ga0070696_100000497 | 3300005546 | Bacteria | 24787 |
| 142 | Ga0070696_100085113 | 3300005546 | Bacteria | 2244 |
| 143 | Ga0070693_100039630 | 3300005547 | Bacteria | 2640 |
| 144 | Ga0070665_100000044 | 3300005548 | Bacteria | 276702 |
| 145 | Ga0070665_100008964 | 3300005548 | Bacteria | 10136 |
| 146 | Ga0070665_100049422 | 3300005548 | Bacteria | 4219 |
| 147 | Ga0070704_100008113 | 3300005549 | Bacteria | 6278 |
| 148 | Ga0070704_100030739 | 3300005549 | Bacteria | 3602 |
| 149 | Ga0068855_100000022 | 3300005563 | Bacteria | 190807 |
| 150 | Ga0068855_100000300 | 3300005563 | Bacteria | 61687 |
| 151 | Ga0068855_100005454 | 3300005563 | Bacteria | 15509 |
| 152 | Ga0068855_100011392 | 3300005563 | Bacteria | 10739 |
| 153 | Ga0068855_100013133 | 3300005563 | Bacteria | 9989 |
| 154 | Ga0068855_100071882 | 3300005563 | Bacteria | 4021 |
| 155 | Ga0068855_100076637 | 3300005563 | Bacteria | 3880 |
| 156 | Ga0068855_100106140 | 3300005563 | Bacteria | 3229 |
| 157 | Ga0068855_100212238 | 3300005563 | Bacteria | 2174 |
| 158 | Ga0068855_100503035 | 3300005563 | Bacteria | 1316 |
| 159 | Ga0068855_100533468 | 3300005563 | Bacteria | 1272 |
| 160 | Ga0068855_100808508 | 3300005563 | Bacteria | 996 |
| 161 | Ga0070664_100016737 | 3300005564 | Bacteria | 6015 |
| 162 | Ga0070664_100031720 | 3300005564 | Bacteria | 4418 |
| 163 | Ga0070664_100070065 | 3300005564 | Bacteria | 3002 |
| 164 | Ga0070664_100200308 | 3300005564 | Bacteria | 1782 |
| 165 | Ga0068857_100000031 | 3300005577 | Bacteria | 75513 |
| 166 | Ga0068857_100047135 | 3300005577 | Bacteria | 3826 |
| 167 | Ga0068857_100092376 | 3300005577 | Bacteria | 2710 |
| 168 | Ga0068857_100103343 | 3300005577 | Bacteria | 2558 |
| 169 | Ga0068854_100040816 | 3300005578 | Bacteria | 3276 |
| 170 | Ga0068854_100063265 | 3300005578 | Bacteria | 2685 |
| 171 | Ga0068854_100146336 | 3300005578 | Bacteria | 1818 |
| 172 | Ga0068856_100000379 | 3300005614 | Bacteria | 48620 |
| 173 | Ga0068856_100001105 | 3300005614 | Bacteria | 28524 |
| 174 | Ga0068856_100005014 | 3300005614 | Bacteria | 13112 |
| 175 | Ga0068856_100038634 | 3300005614 | Bacteria | 4686 |
| 176 | Ga0068856_100039824 | 3300005614 | Bacteria | 4614 |
| 177 | Ga0068856_100062239 | 3300005614 | Bacteria | 3686 |
| 178 | Ga0068856_100135736 | 3300005614 | Bacteria | 2465 |
| 179 | Ga0068856_100382471 | 3300005614 | Bacteria | 1427 |
| 180 | Ga0068852_100013898 | 3300005616 | Bacteria | 6174 |
| 181 | Ga0068852_100017797 | 3300005616 | Bacteria | 5585 |
| 182 | Ga0068852_100044561 | 3300005616 | Bacteria | 3768 |
| 183 | Ga0068852_100094589 | 3300005616 | Bacteria | 2681 |
| 184 | Ga0068852_100422311 | 3300005616 | Bacteria | 1315 |
| 185 | Ga0068859_100000221 | 3300005617 | Bacteria | 56589 |
| 186 | Ga0068859_100102251 | 3300005617 | Bacteria | 2923 |
| 187 | Ga0068864_100000324 | 3300005618 | Bacteria | 42149 |
| 188 | Ga0068851_10111336 | 3300005834 | Bacteria | 1462 |
| 189 | Ga0068863_100000988 | 3300005841 | Bacteria | 28552 |
| 190 | Ga0068858_100000038 | 3300005842 | Bacteria | 137131 |
| 191 | Ga0068858_100302282 | 3300005842 | Bacteria | 1527 |
| 192 | Ga0068858_100357961 | 3300005842 | Bacteria | 1399 |
| 193 | Ga0068858_100532904 | 3300005842 | Bacteria | 1136 |
| 194 | Ga0068860_100012362 | 3300005843 | Bacteria | 8410 |
| 195 | Ga0068860_100038050 | 3300005843 | Bacteria | 4603 |
| 196 | Ga0068860_100048226 | 3300005843 | Bacteria | 4059 |
| 197 | Ga0068860_100121793 | 3300005843 | Bacteria | 2498 |
| 198 | Ga0068862_100000435 | 3300005844 | Bacteria | 45439 |
| 199 | Ga0068862_100011492 | 3300005844 | Bacteria | 7309 |
| 200 | Ga0068862_100323761 | 3300005844 | Bacteria | 1424 |
| 201 | Ga0081455_10000149 | 3300005937 | Bacteria | 83756 |
| 202 | Ga0081455_10000211 | 3300005937 | Bacteria | 74488 |
| 203 | Ga0081455_10000736 | 3300005937 | Bacteria | 42524 |
| 204 | Ga0081455_10002000 | 3300005937 | Bacteria | 24347 |
| 205 | Ga0081538_10006504 | 3300005981 | Bacteria | 10278 |
| 206 | Ga0081538_10012501 | 3300005981 | Bacteria | 6801 |
| 207 | Ga0081540_1001053 | 3300005983 | Bacteria | 24603 |
| 208 | Ga0081540_1001559 | 3300005983 | Bacteria | 19626 |
| 209 | Ga0081539_10000618 | 3300005985 | Bacteria | 71969 |
| 210 | Ga0081539_10000954 | 3300005985 | Bacteria | 54181 |
| 211 | Ga0081539_10006940 | 3300005985 | Bacteria | 10532 |
| 212 | Ga0081539_10010399 | 3300005985 | Bacteria | 7565 |
| 213 | Ga0081539_10036460 | 3300005985 | Bacteria | 2943 |
| 214 | Ga0070717_10024484 | 3300006028 | Bacteria | 4794 |
| 215 | Ga0070717_10117189 | 3300006028 | Bacteria | 2278 |
| 216 | Ga0070717_10266506 | 3300006028 | Bacteria | 1516 |
| 217 | Ga0075365_10031254 | 3300006038 | Bacteria | 3415 |
| 218 | Ga0075365_10056117 | 3300006038 | Bacteria | 2617 |
| 219 | Ga0075365_10068296 | 3300006038 | Bacteria | 2388 |
| 220 | Ga0075365_10099284 | 3300006038 | Bacteria | 1992 |
| 221 | Ga0075365_10262520 | 3300006038 | Bacteria | 1214 |
| 222 | Ga0075368_10025070 | 3300006042 | Bacteria | 2288 |
| 223 | Ga0075368_10075290 | 3300006042 | Bacteria | 1368 |
| 224 | Ga0075363_100031931 | 3300006048 | Bacteria | 2732 |
| 225 | Ga0075364_10030585 | 3300006051 | Bacteria | 3457 |
| 226 | Ga0075364_10033207 | 3300006051 | Bacteria | 3321 |
| 227 | Ga0075364_10133005 | 3300006051 | Bacteria | 1670 |
| 228 | Ga0075364_10163234 | 3300006051 | Bacteria | 1504 |
| 229 | Ga0070716_100112601 | 3300006173 | Bacteria | 1689 |
| 230 | Ga0070712_100000218 | 3300006175 | Bacteria | 32344 |
| 231 | Ga0070712_100003438 | 3300006175 | Bacteria | 9743 |
| 232 | Ga0070712_100005245 | 3300006175 | Bacteria | 8018 |
| 233 | Ga0070712_100018646 | 3300006175 | Bacteria | 4511 |
| 234 | Ga0070712_100048413 | 3300006175 | Bacteria | 2946 |
| 235 | Ga0070712_100096860 | 3300006175 | Bacteria | 2173 |
| 236 | Ga0075367_10030349 | 3300006178 | Bacteria | 3099 |
| 237 | Ga0075367_10079105 | 3300006178 | Bacteria | 1986 |
| 238 | Ga0075369_10027277 | 3300006186 | Bacteria | 2387 |
| 239 | Ga0075366_10010922 | 3300006195 | Bacteria | 5110 |
| 240 | Ga0075366_10026437 | 3300006195 | Bacteria | 3399 |
| 241 | Ga0075366_10046671 | 3300006195 | Bacteria | 2567 |
| 242 | Ga0075428_100000606 | 3300006844 | Bacteria | 36554 |
| 243 | Ga0075428_100060712 | 3300006844 | Bacteria | 4140 |
| 244 | Ga0075428_100068529 | 3300006844 | Bacteria | 3881 |
| 245 | Ga0075428_100109364 | 3300006844 | Bacteria | 3012 |
| 246 | Ga0075430_100051888 | 3300006846 | Bacteria | 3454 |
| 247 | Ga0075430_100057443 | 3300006846 | Bacteria | 3273 |
| 248 | Ga0075430_100084206 | 3300006846 | Bacteria | 2663 |
| 249 | Ga0075430_100182139 | 3300006846 | Bacteria | 1747 |
| 250 | Ga0075430_100251388 | 3300006846 | Bacteria | 1465 |
| 251 | Ga0075431_100000032 | 3300006847 | Bacteria | 72293 |
| 252 | Ga0075431_100006971 | 3300006847 | Bacteria | 11238 |
| 253 | Ga0075431_100028286 | 3300006847 | Bacteria | 5757 |
| 254 | Ga0075431_100136702 | 3300006847 | Bacteria | 2527 |
| 255 | Ga0075433_10067598 | 3300006852 | Bacteria | 3137 |
| 256 | Ga0075433_10125346 | 3300006852 | Bacteria | 2281 |
| 257 | Ga0075433_10315850 | 3300006852 | Bacteria | 1382 |
| 258 | Ga0075434_100105187 | 3300006871 | Bacteria | 2832 |
| 259 | Ga0075429_100031410 | 3300006880 | Bacteria | 4615 |
| 260 | Ga0075429_100045311 | 3300006880 | Bacteria | 3826 |
| 261 | Ga0075436_100001529 | 3300006914 | Bacteria | 15800 |
| 262 | Ga0097620_100000221 | 3300006931 | Bacteria | 56589 |
| 263 | Ga0097620_100102244 | 3300006931 | Bacteria | 2923 |
| 264 | Ga0075435_100219157 | 3300007076 | Bacteria | 1616 |
| 265 | Ga0099794_10028110 | 3300007265 | Bacteria | 2613 |
| 266 | Ga0099795_10014147 | 3300007788 | Bacteria | 2466 |
| 267 | Ga0105250_10006178 | 3300009092 | Bacteria | 5262 |
| 268 | Ga0105240_10000430 | 3300009093 | Bacteria | 77531 |
| 269 | Ga0105240_10002169 | 3300009093 | Bacteria | 32009 |
| 270 | Ga0105240_10033000 | 3300009093 | Bacteria | 6694 |
| 271 | Ga0105240_10051735 | 3300009093 | Bacteria | 5167 |
| 272 | Ga0105240_10070930 | 3300009093 | Bacteria | 4309 |
| 273 | Ga0105240_10076343 | 3300009093 | Bacteria | 4131 |
| 274 | Ga0105240_10185191 | 3300009093 | Bacteria | 2453 |
| 275 | Ga0105240_10388079 | 3300009093 | Bacteria | 1575 |
| 276 | Ga0105240_10651770 | 3300009093 | Bacteria | 1154 |
| 277 | Ga0105240_10728330 | 3300009093 | Bacteria | 1080 |
| 278 | Ga0111539_10001089 | 3300009094 | Bacteria | 35899 |
| 279 | Ga0111539_10003408 | 3300009094 | Bacteria | 20944 |
| 280 | Ga0111539_10020065 | 3300009094 | Bacteria | 8234 |
| 281 | Ga0111539_10251657 | 3300009094 | Bacteria | 2057 |
| 282 | Ga0111539_10462833 | 3300009094 | Bacteria | 1477 |
| 283 | Ga0111539_10600315 | 3300009094 | Bacteria | 1282 |
| 284 | Ga0105245_10000484 | 3300009098 | Bacteria | 36479 |
| 285 | Ga0105247_10038214 | 3300009101 | Bacteria | 2929 |
| 286 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 287 | Ga0114129_10001060 | 3300009147 | Bacteria | 36097 |
| 288 | Ga0114129_10244180 | 3300009147 | Bacteria | 2413 |
| 289 | Ga0114129_10589531 | 3300009147 | Bacteria | 1441 |
| 290 | Ga0105243_10246979 | 3300009148 | Bacteria | 1591 |
| 291 | Ga0105243_10275585 | 3300009148 | Bacteria | 1513 |
| 292 | Ga0105241_10013670 | 3300009174 | Bacteria | 5948 |
| 293 | Ga0105241_10073900 | 3300009174 | Bacteria | 2654 |
| 294 | Ga0105241_10114489 | 3300009174 | Bacteria | 2163 |
| 295 | Ga0105241_10228088 | 3300009174 | Bacteria | 1569 |
| 296 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 297 | Ga0105248_10001342 | 3300009177 | Bacteria | 27431 |
| 298 | Ga0105248_10505355 | 3300009177 | Bacteria | 1363 |
| 299 | Ga0105237_10001309 | 3300009545 | Bacteria | 33107 |
| 300 | Ga0105237_10202392 | 3300009545 | Bacteria | 1986 |
| 301 | Ga0105238_10004028 | 3300009551 | Bacteria | 14580 |
| 302 | Ga0105238_10017014 | 3300009551 | Bacteria | 7381 |
| 303 | Ga0105238_10033305 | 3300009551 | Bacteria | 5244 |
| 304 | Ga0105249_10017541 | 3300009553 | Bacteria | 6357 |
| 305 | Ga0099796_10027095 | 3300010159 | Bacteria | 1827 |
| 306 | Ga0105239_10002559 | 3300010375 | Bacteria | 23073 |
| 307 | Ga0105239_10004314 | 3300010375 | Bacteria | 17052 |
| 308 | Ga0105239_10008789 | 3300010375 | Bacteria | 11430 |
| 309 | Ga0157373_10001315 | 3300013100 | Bacteria | 19009 |
| 310 | Ga0157373_10014370 | 3300013100 | Bacteria | 5803 |
| 311 | Ga0157373_10064155 | 3300013100 | Bacteria | 2600 |
| 312 | Ga0157371_10006249 | 3300013102 | Bacteria | 9871 |
| 313 | Ga0157371_10014275 | 3300013102 | Bacteria | 6002 |
| 314 | Ga0157370_10007564 | 3300013104 | Bacteria | 11801 |
| 315 | Ga0157370_10039763 | 3300013104 | Bacteria | 4544 |
| 316 | Ga0157370_10053908 | 3300013104 | Bacteria | 3834 |
| 317 | Ga0157370_10117220 | 3300013104 | Bacteria | 2487 |
| 318 | Ga0157370_10117302 | 3300013104 | Bacteria | 2486 |
| 319 | Ga0157370_10156819 | 3300013104 | Bacteria | 2118 |
| 320 | Ga0157370_10180436 | 3300013104 | Bacteria | 1962 |
| 321 | Ga0157370_10348261 | 3300013104 | Bacteria | 1365 |
| 322 | Ga0157370_10469073 | 3300013104 | Bacteria | 1157 |
| 323 | Ga0157369_10000756 | 3300013105 | Bacteria | 41660 |
| 324 | Ga0157369_10000881 | 3300013105 | Bacteria | 38268 |
| 325 | Ga0157369_10018172 | 3300013105 | Bacteria | 7886 |
| 326 | Ga0157369_10023244 | 3300013105 | Bacteria | 6907 |
| 327 | Ga0157369_10083966 | 3300013105 | Bacteria | 3405 |
| 328 | Ga0157369_10274749 | 3300013105 | Bacteria | 1755 |
| 329 | Ga0157369_10619993 | 3300013105 | Bacteria | 1116 |
| 330 | Ga0157374_10024477 | 3300013296 | Bacteria | 5414 |
| 331 | Ga0157374_10131397 | 3300013296 | Bacteria | 2423 |
| 332 | Ga0157374_10332038 | 3300013296 | Bacteria | 1508 |
| 333 | Ga0157378_10087458 | 3300013297 | Bacteria | 2827 |
| 334 | Ga0157372_10004048 | 3300013307 | Bacteria | 15708 |
| 335 | Ga0157372_10016212 | 3300013307 | Bacteria | 7994 |
| 336 | Ga0163163_10000489 | 3300014325 | Bacteria | 35830 |
| 337 | Ga0163163_10253252 | 3300014325 | Bacteria | 1811 |
| 338 | Ga0163163_10596353 | 3300014325 | Bacteria | 1168 |
| 339 | Ga0157379_10002131 | 3300014968 | Bacteria | 16408 |
| 340 | Ga0157379_10011138 | 3300014968 | Bacteria | 7839 |
| 341 | Ga0157379_10063465 | 3300014968 | Bacteria | 3302 |
| 342 | Ga0157379_10092288 | 3300014968 | Bacteria | 2716 |
| 343 | Ga0157379_10299331 | 3300014968 | Bacteria | 1466 |
| 344 | Ga0157379_10473095 | 3300014968 | Bacteria | 1159 |
| 345 | Ga0163161_10230658 | 3300017792 | Bacteria | 1437 |
| 346 | Ga0206354_11027225 | 3300020081 | Bacteria | 1350 |
| 347 | Ga0206353_11504462 | 3300020082 | Bacteria | 1254 |
| 348 | Ga0213873_10056291 | 3300021358 | Bacteria | 1054 |
| 349 | Ga0213872_10060633 | 3300021361 | Bacteria | 1711 |
| 350 | Ga0213872_10088358 | 3300021361 | Bacteria | 1388 |
| 351 | Ga0213874_10001553 | 3300021377 | Bacteria | 4786 |
| 352 | Ga0213876_10001206 | 3300021384 | Bacteria | 16300 |
| 353 | Ga0213876_10154312 | 3300021384 | Bacteria | 1221 |
| 354 | Ga0213875_10000674 | 3300021388 | Bacteria | 26801 |
| 355 | Ga0213875_10004650 | 3300021388 | Bacteria | 7481 |
| 356 | Ga0213875_10004811 | 3300021388 | Bacteria | 7340 |
| 357 | Ga0213875_10007532 | 3300021388 | Bacteria | 5612 |
| 358 | Ga0213875_10020458 | 3300021388 | Bacteria | 3175 |
| 359 | Ga0213871_10005226 | 3300021441 | Bacteria | 2662 |
| 360 | Ga0213871_10018486 | 3300021441 | Bacteria | 1706 |
| 361 | Ga0224572_1003951 | 3300024225 | Bacteria | 2543 |
| 362 | Ga0224572_1012161 | 3300024225 | Bacteria | 1632 |
| 363 | Ga0228598_1009795 | 3300024227 | Bacteria | 1915 |
| 364 | Ga0209147_103646 | 3300025229 | Bacteria | 2882 |
| 365 | Ga0209565_1000054 | 3300025263 | Bacteria | 206016 |
| 366 | Ga0209673_1017066 | 3300025273 | Bacteria | 2687 |
| 367 | Ga0209675_1002435 | 3300025291 | Bacteria | 9572 |
| 368 | Ga0209025_1036751 | 3300025294 | Bacteria | 2187 |
| 369 | Ga0209564_1000177 | 3300025295 | Bacteria | 152313 |
| 370 | Ga0209564_1001852 | 3300025295 | Bacteria | 19200 |
| 371 | Ga0209256_1000032 | 3300025299 | Bacteria | 395041 |
| 372 | Ga0209256_1000547 | 3300025299 | Bacteria | 53996 |
| 373 | Ga0207656_10098138 | 3300025321 | Bacteria | 1339 |
| 374 | Ga0207696_1008107 | 3300025711 | Bacteria | 4053 |
| 375 | Ga0207710_10065182 | 3300025900 | Bacteria | 1660 |
| 376 | Ga0207680_10000466 | 3300025903 | Bacteria | 19090 |
| 377 | Ga0207647_10003785 | 3300025904 | Bacteria | 11307 |
| 378 | Ga0207647_10004237 | 3300025904 | Bacteria | 10629 |
| 379 | Ga0207647_10018861 | 3300025904 | Bacteria | 4651 |
| 380 | Ga0207647_10037669 | 3300025904 | Bacteria | 3064 |
| 381 | Ga0207699_10000310 | 3300025906 | Bacteria | 26065 |
| 382 | Ga0207699_10039135 | 3300025906 | Bacteria | 2722 |
| 383 | Ga0207699_10077590 | 3300025906 | Bacteria | 2050 |
| 384 | Ga0207699_10175871 | 3300025906 | Bacteria | 1435 |
| 385 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 386 | Ga0207705_10000061 | 3300025909 | Bacteria | 150179 |
| 387 | Ga0207705_10000522 | 3300025909 | Bacteria | 32721 |
| 388 | Ga0207705_10000704 | 3300025909 | Bacteria | 27609 |
| 389 | Ga0207705_10004521 | 3300025909 | Bacteria | 10510 |
| 390 | Ga0207705_10018789 | 3300025909 | Bacteria | 4944 |
| 391 | Ga0207705_10034746 | 3300025909 | Bacteria | 3605 |
| 392 | Ga0207705_10062918 | 3300025909 | Bacteria | 2680 |
| 393 | Ga0207705_10260852 | 3300025909 | Bacteria | 1323 |
| 394 | Ga0207705_10288154 | 3300025909 | Bacteria | 1258 |
| 395 | Ga0207705_10341801 | 3300025909 | Bacteria | 1152 |
| 396 | Ga0207684_10075405 | 3300025910 | Bacteria | 2866 |
| 397 | Ga0207684_10088784 | 3300025910 | Bacteria | 2634 |
| 398 | Ga0207684_10097405 | 3300025910 | Bacteria | 2511 |
| 399 | Ga0207684_10430784 | 3300025910 | Bacteria | 1133 |
| 400 | Ga0207654_10174227 | 3300025911 | Bacteria | 1399 |
| 401 | Ga0207654_10206847 | 3300025911 | Bacteria | 1295 |
| 402 | Ga0207707_10000011 | 3300025912 | Bacteria | 282857 |
| 403 | Ga0207707_10003695 | 3300025912 | Bacteria | 13568 |
| 404 | Ga0207707_10005561 | 3300025912 | Bacteria | 11025 |
| 405 | Ga0207707_10024159 | 3300025912 | Bacteria | 5317 |
| 406 | Ga0207707_10320517 | 3300025912 | Bacteria | 1338 |
| 407 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 408 | Ga0207695_10006765 | 3300025913 | Bacteria | 14782 |
| 409 | Ga0207695_10006975 | 3300025913 | Bacteria | 14503 |
| 410 | Ga0207695_10012037 | 3300025913 | Bacteria | 10405 |
| 411 | Ga0207695_10016569 | 3300025913 | Bacteria | 8618 |
| 412 | Ga0207695_10053216 | 3300025913 | Bacteria | 4235 |
| 413 | Ga0207695_10101865 | 3300025913 | Bacteria | 2865 |
| 414 | Ga0207695_10139030 | 3300025913 | Bacteria | 2379 |
| 415 | Ga0207695_10149130 | 3300025913 | Bacteria | 2279 |
| 416 | Ga0207695_10262908 | 3300025913 | Bacteria | 1623 |
| 417 | Ga0207671_10100361 | 3300025914 | Bacteria | 2191 |
| 418 | Ga0207671_10151241 | 3300025914 | Bacteria | 1793 |
| 419 | Ga0207671_10359018 | 3300025914 | Bacteria | 1156 |
| 420 | Ga0207693_10000663 | 3300025915 | Bacteria | 30928 |
| 421 | Ga0207693_10001492 | 3300025915 | Bacteria | 20643 |
| 422 | Ga0207693_10010617 | 3300025915 | Bacteria | 7472 |
| 423 | Ga0207693_10016004 | 3300025915 | Bacteria | 6003 |
| 424 | Ga0207693_10018927 | 3300025915 | Bacteria | 5481 |
| 425 | Ga0207693_10019783 | 3300025915 | Bacteria | 5352 |
| 426 | Ga0207693_10146564 | 3300025915 | Bacteria | 1856 |
| 427 | Ga0207663_10025072 | 3300025916 | Bacteria | 3442 |
| 428 | Ga0207660_10000737 | 3300025917 | Bacteria | 21749 |
| 429 | Ga0207660_10002355 | 3300025917 | Bacteria | 12445 |
| 430 | Ga0207660_10005544 | 3300025917 | Bacteria | 8197 |
| 431 | Ga0207660_10051470 | 3300025917 | Bacteria | 2928 |
| 432 | Ga0207660_10070703 | 3300025917 | Bacteria | 2537 |
| 433 | Ga0207660_10104875 | 3300025917 | Bacteria | 2117 |
| 434 | Ga0207660_10155309 | 3300025917 | Bacteria | 1761 |
| 435 | Ga0207660_10178237 | 3300025917 | Bacteria | 1649 |
| 436 | Ga0207657_10000101 | 3300025919 | Bacteria | 82962 |
| 437 | Ga0207657_10000631 | 3300025919 | Bacteria | 37345 |
| 438 | Ga0207657_10001405 | 3300025919 | Bacteria | 25680 |
| 439 | Ga0207657_10001922 | 3300025919 | Bacteria | 22436 |
| 440 | Ga0207657_10007725 | 3300025919 | Bacteria | 10982 |
| 441 | Ga0207657_10012424 | 3300025919 | Bacteria | 8412 |
| 442 | Ga0207657_10034343 | 3300025919 | Bacteria | 4562 |
| 443 | Ga0207657_10050184 | 3300025919 | Bacteria | 3632 |
| 444 | Ga0207657_10143431 | 3300025919 | Bacteria | 1950 |
| 445 | Ga0207657_10188959 | 3300025919 | Bacteria | 1663 |
| 446 | Ga0207657_10238560 | 3300025919 | Bacteria | 1452 |
| 447 | Ga0207657_10292141 | 3300025919 | Bacteria | 1292 |
| 448 | Ga0207657_10409508 | 3300025919 | Bacteria | 1066 |
| 449 | Ga0207649_10000494 | 3300025920 | Bacteria | 28001 |
| 450 | Ga0207649_10001179 | 3300025920 | Bacteria | 15748 |
| 451 | Ga0207649_10004815 | 3300025920 | Bacteria | 7299 |
| 452 | Ga0207649_10049357 | 3300025920 | Bacteria | 2599 |
| 453 | Ga0207649_10090808 | 3300025920 | Bacteria | 1999 |
| 454 | Ga0207652_10000089 | 3300025921 | Bacteria | 99680 |
| 455 | Ga0207652_10000334 | 3300025921 | Bacteria | 48952 |
| 456 | Ga0207652_10062747 | 3300025921 | Bacteria | 3212 |
| 457 | Ga0207652_10132412 | 3300025921 | Bacteria | 2225 |
| 458 | Ga0207652_10294109 | 3300025921 | Bacteria | 1466 |
| 459 | Ga0207652_10374399 | 3300025921 | Bacteria | 1285 |
| 460 | Ga0207652_10401522 | 3300025921 | Bacteria | 1237 |
| 461 | Ga0207646_10022399 | 3300025922 | Bacteria | 5821 |
| 462 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 463 | Ga0207694_10024662 | 3300025924 | Bacteria | 4568 |
| 464 | Ga0207650_10074789 | 3300025925 | Bacteria | 2555 |
| 465 | Ga0207687_10032337 | 3300025927 | Bacteria | 3543 |
| 466 | Ga0207700_10000017 | 3300025928 | Bacteria | 195983 |
| 467 | Ga0207700_10175549 | 3300025928 | Bacteria | 1790 |
| 468 | Ga0207664_10030301 | 3300025929 | Bacteria | 4131 |
| 469 | Ga0207664_10034053 | 3300025929 | Bacteria | 3920 |
| 470 | Ga0207664_10056751 | 3300025929 | Bacteria | 3111 |
| 471 | Ga0207664_10067798 | 3300025929 | Bacteria | 2864 |
| 472 | Ga0207664_10139268 | 3300025929 | Bacteria | 2051 |
| 473 | Ga0207664_10160393 | 3300025929 | Bacteria | 1918 |
| 474 | Ga0207664_10538999 | 3300025929 | Bacteria | 1046 |
| 475 | Ga0207644_10105586 | 3300025931 | Bacteria | 2122 |
| 476 | Ga0207690_10021392 | 3300025932 | Bacteria | 4011 |
| 477 | Ga0207690_10034093 | 3300025932 | Bacteria | 3278 |
| 478 | Ga0207690_10039976 | 3300025932 | Bacteria | 3063 |
| 479 | Ga0207690_10043002 | 3300025932 | Bacteria | 2971 |
| 480 | Ga0207690_10054649 | 3300025932 | Bacteria | 2686 |
| 481 | Ga0207690_10184130 | 3300025932 | Bacteria | 1575 |
| 482 | Ga0207690_10268363 | 3300025932 | Bacteria | 1325 |
| 483 | Ga0207706_10009699 | 3300025933 | Bacteria | 8836 |
| 484 | Ga0207706_10019485 | 3300025933 | Bacteria | 6104 |
| 485 | Ga0207706_10190413 | 3300025933 | Bacteria | 1801 |
| 486 | Ga0207665_10059848 | 3300025939 | Bacteria | 2579 |
| 487 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 488 | Ga0207711_10000042 | 3300025941 | Bacteria | 158782 |
| 489 | Ga0207711_10015104 | 3300025941 | Bacteria | 6413 |
| 490 | Ga0207711_10047034 | 3300025941 | Bacteria | 3688 |
| 491 | Ga0207689_10102631 | 3300025942 | Bacteria | 2350 |
| 492 | Ga0207689_10134030 | 3300025942 | Bacteria | 2039 |
| 493 | Ga0207661_10023150 | 3300025944 | Bacteria | 4690 |
| 494 | Ga0207661_10090760 | 3300025944 | Bacteria | 2544 |
| 495 | Ga0207661_10216926 | 3300025944 | Bacteria | 1689 |
| 496 | Ga0207679_10113338 | 3300025945 | Bacteria | 2145 |
| 497 | Ga0207679_10153289 | 3300025945 | Bacteria | 1878 |
| 498 | Ga0207667_10000061 | 3300025949 | Bacteria | 190818 |
| 499 | Ga0207667_10000187 | 3300025949 | Bacteria | 90766 |
| 500 | Ga0207667_10005445 | 3300025949 | Bacteria | 15518 |
| 501 | Ga0207667_10009340 | 3300025949 | Bacteria | 11566 |
| 502 | Ga0207667_10013895 | 3300025949 | Bacteria | 9197 |
| 503 | Ga0207667_10031158 | 3300025949 | Bacteria | 5760 |
| 504 | Ga0207667_10078431 | 3300025949 | Bacteria | 3423 |
| 505 | Ga0207667_10534911 | 3300025949 | Bacteria | 1186 |
| 506 | Ga0207651_10045319 | 3300025960 | Bacteria | 2949 |
| 507 | Ga0207712_10005400 | 3300025961 | Bacteria | 8069 |
| 508 | Ga0207668_10003197 | 3300025972 | Bacteria | 9597 |
| 509 | Ga0207668_10033479 | 3300025972 | Bacteria | 3404 |
| 510 | Ga0207668_10110453 | 3300025972 | Bacteria | 2062 |
| 511 | Ga0207640_10002139 | 3300025981 | Bacteria | 10614 |
| 512 | Ga0207640_10005375 | 3300025981 | Bacteria | 6984 |
| 513 | Ga0207640_10055031 | 3300025981 | Bacteria | 2604 |
| 514 | Ga0207658_10004787 | 3300025986 | Bacteria | 9364 |
| 515 | Ga0207658_10027427 | 3300025986 | Bacteria | 4002 |
| 516 | Ga0207658_10043127 | 3300025986 | Bacteria | 3277 |
| 517 | Ga0207703_10000440 | 3300026035 | Bacteria | 43772 |
| 518 | Ga0207703_10001009 | 3300026035 | Bacteria | 27028 |
| 519 | Ga0207703_10244799 | 3300026035 | Bacteria | 1614 |
| 520 | Ga0207703_10344945 | 3300026035 | Bacteria | 1370 |
| 521 | Ga0207639_10004301 | 3300026041 | Bacteria | 9593 |
| 522 | Ga0207639_10029891 | 3300026041 | Bacteria | 3993 |
| 523 | Ga0207639_10032439 | 3300026041 | Bacteria | 3845 |
| 524 | Ga0207639_10106886 | 3300026041 | Bacteria | 2272 |
| 525 | Ga0207639_10261874 | 3300026041 | Bacteria | 1513 |
| 526 | Ga0207678_10003050 | 3300026067 | Bacteria | 15155 |
| 527 | Ga0207678_10005069 | 3300026067 | Bacteria | 11810 |
| 528 | Ga0207678_10050319 | 3300026067 | Bacteria | 3600 |
| 529 | Ga0207678_10254549 | 3300026067 | Bacteria | 1504 |
| 530 | Ga0207708_10000384 | 3300026075 | Bacteria | 34526 |
| 531 | Ga0207702_10000035 | 3300026078 | Bacteria | 158744 |
| 532 | Ga0207702_10000182 | 3300026078 | Bacteria | 75732 |
| 533 | Ga0207702_10000875 | 3300026078 | Bacteria | 31344 |
| 534 | Ga0207702_10045038 | 3300026078 | Bacteria | 3711 |
| 535 | Ga0207702_10294177 | 3300026078 | Bacteria | 1539 |
| 536 | Ga0207702_10330786 | 3300026078 | Bacteria | 1453 |
| 537 | Ga0207702_10451192 | 3300026078 | Bacteria | 1248 |
| 538 | Ga0207641_10000415 | 3300026088 | Bacteria | 49760 |
| 539 | Ga0207676_10002042 | 3300026095 | Bacteria | 14668 |
| 540 | Ga0207676_10155364 | 3300026095 | Bacteria | 1976 |
| 541 | Ga0207674_10000003 | 3300026116 | Bacteria | 241674 |
| 542 | Ga0207674_10015341 | 3300026116 | Bacteria | 8420 |
| 543 | Ga0207674_10034758 | 3300026116 | Bacteria | 5266 |
| 544 | Ga0207674_10055630 | 3300026116 | Bacteria | 4022 |
| 545 | Ga0207675_100387745 | 3300026118 | Bacteria | 1375 |
| 546 | Ga0207675_100619089 | 3300026118 | Bacteria | 1087 |
| 547 | Ga0207683_10028724 | 3300026121 | Bacteria | 4811 |
| 548 | Ga0207698_10002033 | 3300026142 | Bacteria | 11927 |
| 549 | Ga0207698_10049620 | 3300026142 | Bacteria | 3196 |
| 550 | Ga0207698_10069627 | 3300026142 | Bacteria | 2783 |
| 551 | Ga0209813_10006106 | 3300027866 | Bacteria | 2962 |
| 552 | Ga0207428_10000203 | 3300027907 | Bacteria | 82534 |
| 553 | Ga0207428_10007154 | 3300027907 | Bacteria | 10211 |
| 554 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 555 | Ga0268266_10009292 | 3300028379 | Bacteria | 8673 |
| 556 | Ga0268266_10070415 | 3300028379 | Bacteria | 3031 |
| 557 | Ga0268266_10106600 | 3300028379 | Bacteria | 2477 |
| 558 | Ga0268265_10000793 | 3300028380 | Bacteria | 30088 |
| 559 | Ga0268265_10003811 | 3300028380 | Bacteria | 10685 |
| 560 | Ga0268265_10066985 | 3300028380 | Bacteria | 2778 |
| 561 | Ga0268265_10443854 | 3300028380 | Bacteria | 1210 |
| 562 | Ga0268265_10464241 | 3300028380 | Bacteria | 1185 |
| 563 | Ga0268264_10002765 | 3300028381 | Bacteria | 15302 |
| 564 | Ga0268264_10023310 | 3300028381 | Bacteria | 5050 |
| 565 | Ga0268264_10040033 | 3300028381 | Bacteria | 3872 |
| 566 | Ga0265334_10000953 | 3300028573 | Bacteria | 14401 |
| 567 | Ga0265334_10002804 | 3300028573 | Bacteria | 8035 |
| 568 | Ga0265338_10005581 | 3300028800 | Bacteria | 16367 |
| 569 | Ga0265338_10019894 | 3300028800 | Bacteria | 7092 |
| 570 | Ga0265338_10020732 | 3300028800 | Bacteria | 6896 |
| 571 | Ga0265338_10050438 | 3300028800 | Bacteria | 3762 |
| 572 | Ga0265330_10025130 | 3300031235 | Bacteria | 2700 |
| 573 | Ga0265330_10053156 | 3300031235 | Bacteria | 1773 |
| 574 | Ga0265330_10086903 | 3300031235 | Bacteria | 1344 |
| 575 | Ga0265332_10071114 | 3300031238 | Bacteria | 1481 |
| 576 | Ga0265328_10000046 | 3300031239 | Bacteria | 81288 |
| 577 | Ga0265325_10000567 | 3300031241 | Bacteria | 26847 |
| 578 | Ga0265325_10005899 | 3300031241 | Bacteria | 7508 |
| 579 | Ga0265325_10044214 | 3300031241 | Bacteria | 2321 |
| 580 | Ga0265340_10000428 | 3300031247 | Bacteria | 22576 |
| 581 | Ga0265340_10000540 | 3300031247 | Bacteria | 20903 |
| 582 | Ga0265340_10006101 | 3300031247 | Bacteria | 6645 |
| 583 | Ga0265340_10006948 | 3300031247 | Bacteria | 6178 |
| 584 | Ga0265340_10014313 | 3300031247 | Bacteria | 4148 |
| 585 | Ga0265340_10036841 | 3300031247 | Bacteria | 2423 |
| 586 | Ga0265339_10003873 | 3300031249 | Bacteria | 10385 |
| 587 | Ga0265339_10006509 | 3300031249 | Bacteria | 7656 |
| 588 | Ga0265339_10123637 | 3300031249 | Bacteria | 1328 |
| 589 | Ga0265331_10000054 | 3300031250 | Bacteria | 180181 |
| 590 | Ga0265331_10004958 | 3300031250 | Bacteria | 8175 |
| 591 | Ga0265331_10013768 | 3300031250 | Bacteria | 4337 |
| 592 | Ga0265331_10016457 | 3300031250 | Bacteria | 3881 |
| 593 | Ga0265327_10000179 | 3300031251 | Bacteria | 135005 |
| 594 | Ga0265316_10000099 | 3300031344 | Bacteria | 95020 |
| 595 | Ga0265316_10017095 | 3300031344 | Bacteria | 6278 |
| 596 | Ga0265316_10084400 | 3300031344 | Bacteria | 2432 |
| 597 | Ga0265316_10114507 | 3300031344 | Bacteria | 2040 |
| 598 | Ga0265316_10217742 | 3300031344 | Bacteria | 1410 |
| 599 | Ga0265316_10392352 | 3300031344 | Bacteria | 1000 |
| 600 | Ga0307408_100189182 | 3300031548 | Bacteria | 1657 |
| 601 | Ga0307408_100221489 | 3300031548 | Bacteria | 1544 |
| 602 | Ga0265313_10000216 | 3300031595 | Bacteria | 62003 |
| 603 | Ga0265313_10011560 | 3300031595 | Bacteria | 5475 |
| 604 | Ga0265313_10028965 | 3300031595 | Bacteria | 2871 |
| 605 | Ga0316579_10115829 | 3300031691 | Bacteria | 1286 |
| 606 | Ga0265314_10000160 | 3300031711 | Bacteria | 102289 |
| 607 | Ga0265314_10019986 | 3300031711 | Bacteria | 5178 |
| 608 | Ga0265314_10023980 | 3300031711 | Bacteria | 4636 |
| 609 | Ga0265314_10048739 | 3300031711 | Bacteria | 2970 |
| 610 | Ga0265314_10091869 | 3300031711 | Bacteria | 1974 |
| 611 | Ga0265314_10093099 | 3300031711 | Bacteria | 1957 |
| 612 | Ga0265314_10115196 | 3300031711 | Bacteria | 1701 |
| 613 | Ga0265314_10165398 | 3300031711 | Bacteria | 1341 |
| 614 | Ga0265342_10000139 | 3300031712 | Bacteria | 81785 |
| 615 | Ga0265342_10001957 | 3300031712 | Bacteria | 18419 |
| 616 | Ga0265342_10004338 | 3300031712 | Bacteria | 11220 |
| 617 | Ga0265342_10022508 | 3300031712 | Bacteria | 4004 |
| 618 | Ga0265342_10086638 | 3300031712 | Bacteria | 1801 |
| 619 | Ga0265342_10101609 | 3300031712 | Bacteria | 1637 |
| 620 | Ga0316578_10125608 | 3300031728 | Bacteria | 1542 |
| 621 | Ga0307516_10033704 | 3300031730 | Bacteria | 5153 |
| 622 | Ga0307405_10042115 | 3300031731 | Bacteria | 2777 |
| 623 | Ga0307413_10006025 | 3300031824 | Bacteria | 5489 |
| 624 | Ga0307413_10047640 | 3300031824 | Bacteria | 2557 |
| 625 | Ga0307410_10017956 | 3300031852 | Bacteria | 4262 |
| 626 | Ga0307410_10044829 | 3300031852 | Bacteria | 2940 |
| 627 | Ga0307407_10016181 | 3300031903 | Bacteria | 3707 |
| 628 | Ga0307407_10020660 | 3300031903 | Bacteria | 3378 |
| 629 | Ga0307412_10020774 | 3300031911 | Bacteria | 4001 |
| 630 | Ga0307409_100010082 | 3300031995 | Bacteria | 5847 |
| 631 | Ga0307409_100052374 | 3300031995 | Bacteria | 3129 |
| 632 | Ga0307416_100023757 | 3300032002 | Bacteria | 4457 |
| 633 | Ga0307416_100044905 | 3300032002 | Bacteria | 3474 |
| 634 | Ga0307414_10004083 | 3300032004 | Bacteria | 7874 |
| 635 | Ga0307414_10208203 | 3300032004 | Bacteria | 1596 |
| 636 | Ga0307411_10007821 | 3300032005 | Bacteria | 5487 |
| 637 | Ga0307411_10010197 | 3300032005 | Bacteria | 4995 |
| 638 | Ga0307411_10020382 | 3300032005 | Bacteria | 3855 |
| 639 | Ga0307411_10036072 | 3300032005 | Bacteria | 3094 |
| 640 | Ga0307415_100000374 | 3300032126 | Bacteria | 19118 |
| 641 | Ga0307415_100007417 | 3300032126 | Bacteria | 5998 |
| 642 | Ga0316596_1043264 | 3300033541 | Bacteria | 1186 |
| 643 | Ga0373926_0014359 | 3300035083 | Bacteria | 2693 |
| 644 | Ga0373923_0005873 | 3300035111 | Bacteria | 4194 |
| 645 | Ga0373936_0074704 | 3300035113 | Bacteria | 1403 |
| 646 | Ga0373945_0011777 | 3300035116 | Bacteria | 2896 |
| 647 | Ga0373945_0033883 | 3300035116 | Bacteria | 1818 |
| 648 | Ga0373953_0001424 | 3300035117 | Bacteria | 6914 |
| 649 | Ga0373954_0002291 | 3300035118 | Bacteria | 7971 |
| 650 | Ga0373954_0008633 | 3300035118 | Bacteria | 4481 |
| 651 | Ga0373954_0032949 | 3300035118 | Bacteria | 2397 |
| 652 | Ga0373956_0003222 | 3300035119 | Bacteria | 6590 |
| 653 | Ga0373956_0027878 | 3300035119 | Bacteria | 2455 |
| 654 | Ga0373956_0035196 | 3300035119 | Bacteria | 2208 |
| 655 | Ga0373957_0006598 | 3300035120 | Bacteria | 3666 |
| 656 | Ga0373957_0016614 | 3300035120 | Bacteria | 2550 |
| 657 | Ga0373957_0090602 | 3300035120 | Bacteria | 1215 |
| 658 | Ga0373943_0001584 | 3300035170 | Bacteria | 10306 |
| 659 | Ga0373943_0061477 | 3300035170 | Bacteria | 1878 |
| 660 | Ga0373946_0002328 | 3300035171 | Bacteria | 6719 |
| 661 | Ga0373955_0000338 | 3300035172 | Bacteria | 19607 |
| 662 | Ga0373955_0036945 | 3300035172 | Bacteria | 2595 |
| 663 | Ga0373955_0160865 | 3300035172 | Bacteria | 1325 |
| 664 | Ga0373924_0005579 | 3300035410 | Bacteria | 4463 |
| 665 | Ga0373924_0030474 | 3300035410 | Bacteria | 2163 |
| 666 | Ga0373931_0043536 | 3300035691 | Bacteria | 2365 |
| 667 | Ga0373931_0117728 | 3300035691 | Bacteria | 1515 |
| 668 | Ga0373935_0000281 | 3300035692 | Bacteria | 25102 |
| 669 | Ga0373935_0024213 | 3300035692 | Bacteria | 3735 |
| 670 | Ga0373935_0026454 | 3300035692 | Bacteria | 3581 |
| 671 | Ga0373935_0040406 | 3300035692 | Bacteria | 2928 |
| 672 | Ga0373935_0093528 | 3300035692 | Bacteria | 1972 |
| 673 | Ga0373935_0097538 | 3300035692 | Bacteria | 1934 |
| 674 | Ga0373935_0126777 | 3300035692 | Bacteria | 1711 |
| 675 | Ga0373935_0152662 | 3300035692 | Bacteria | 1568 |
| 676 | Ga0373927_0022573 | 3300035695 | Bacteria | 4122 |
| 677 | Ga0373927_0060294 | 3300035695 | Bacteria | 2455 |
| 678 | Ga0373927_0086861 | 3300035695 | Bacteria | 2030 |
| 679 | Ga0373927_0086944 | 3300035695 | Bacteria | 2029 |
| 680 | Ga0373927_0099209 | 3300035695 | Bacteria | 1894 |
| 681 | Ga0373927_0147041 | 3300035695 | Bacteria | 1543 |
| 682 | Ga0373927_0177722 | 3300035695 | Bacteria | 1396 |
| 683 | Ga0373933_0012856 | 3300035724 | Bacteria | 4629 |
| 684 | Ga0373933_0017737 | 3300035724 | Bacteria | 3994 |
| 685 | Ga0373933_0039569 | 3300035724 | Bacteria | 2774 |
| 686 | Ga0373933_0076526 | 3300035724 | Bacteria | 2044 |
| 687 | Ga0373933_0125479 | 3300035724 | Bacteria | 1610 |
| 688 | Ga0373933_0130999 | 3300035724 | Bacteria | 1577 |
| 689 | Ga0373947_0003801 | 3300035725 | Bacteria | 8902 |
| 690 | Ga0373947_0008856 | 3300035725 | Bacteria | 5790 |
| 691 | Ga0373947_0032588 | 3300035725 | Bacteria | 3072 |
| 692 | Ga0373947_0035434 | 3300035725 | Bacteria | 2955 |
| 693 | Ga0373947_0182087 | 3300035725 | Bacteria | 1368 |
| 694 | Ga0373947_0200265 | 3300035725 | Bacteria | 1306 |
| 695 | Ga0373947_0259854 | 3300035725 | Bacteria | 1150 |
| 696 | Ga0373937_0000005 | 3300036401 | Bacteria | 199965 |
| 697 | Ga0373937_0003891 | 3300036401 | Bacteria | 12634 |
| 698 | Ga0373937_0006693 | 3300036401 | Bacteria | 9944 |
| 699 | Ga0373937_0014147 | 3300036401 | Bacteria | 7038 |
| 700 | Ga0373937_0020900 | 3300036401 | Bacteria | 5871 |
| 701 | Ga0373937_0025615 | 3300036401 | Bacteria | 5327 |
| 702 | Ga0373937_0048456 | 3300036401 | Bacteria | 3890 |
| 703 | Ga0373937_0073318 | 3300036401 | Bacteria | 3158 |
| 704 | Ga0373937_0091428 | 3300036401 | Bacteria | 2820 |
| 705 | Ga0373937_0103858 | 3300036401 | Bacteria | 2639 |
| 706 | Ga0373937_0110420 | 3300036401 | Bacteria | 2557 |
| 707 | Ga0373937_0178582 | 3300036401 | Bacteria | 1993 |
| 708 | Ga0373937_0335086 | 3300036401 | Bacteria | 1432 |
| 709 | Ga0316582_0082434 | 3300036647 | Bacteria | 2102 |
| 710 | Ga0316582_0110442 | 3300036647 | Bacteria | 1829 |
| 711 | Ga0373925_0000007 | 3300037068 | Bacteria | 257023 |
| 712 | Ga0373925_0006090 | 3300037068 | Bacteria | 8920 |
| 713 | Ga0373925_0006256 | 3300037068 | Bacteria | 8779 |
| 714 | Ga0373925_0007976 | 3300037068 | Bacteria | 7710 |
| 715 | Ga0373925_0053155 | 3300037068 | Bacteria | 3027 |
| 716 | Ga0373925_0311510 | 3300037068 | Bacteria | 1272 |
| 717 | Ga0395899_0000112 | 3300037312 | Bacteria | 138389 |
| 718 | Ga0395899_0015917 | 3300037312 | Bacteria | 5735 |
| 719 | Ga0395899_0020389 | 3300037312 | Bacteria | 5026 |
| 720 | Ga0395899_0029465 | 3300037312 | Bacteria | 4128 |
| 721 | Ga0395899_0045807 | 3300037312 | Bacteria | 3259 |
| 722 | Ga0395899_0103687 | 3300037312 | Bacteria | 2051 |
| 723 | Ga0395899_0128167 | 3300037312 | Bacteria | 1814 |
| 724 | Ga0395900_0000126 | 3300037418 | Bacteria | 127586 |
| 725 | Ga0395900_0001168 | 3300037418 | Bacteria | 32771 |
| 726 | Ga0395900_0004045 | 3300037418 | Bacteria | 15646 |
| 727 | Ga0395900_0004704 | 3300037418 | Bacteria | 14390 |
| 728 | Ga0395900_0005035 | 3300037418 | Bacteria | 13871 |
| 729 | Ga0395900_0015042 | 3300037418 | Bacteria | 7887 |
| 730 | Ga0395900_0026720 | 3300037418 | Bacteria | 5909 |
| 731 | Ga0395900_0091877 | 3300037418 | Bacteria | 3118 |
| 732 | Ga0395900_0110853 | 3300037418 | Bacteria | 2819 |
| 733 | Ga0395900_0131334 | 3300037418 | Bacteria | 2566 |
| 734 | Ga0395900_0135244 | 3300037418 | Bacteria | 2525 |
| 735 | Ga0395900_0186006 | 3300037418 | Bacteria | 2108 |
| 736 | Ga0395900_0204397 | 3300037418 | Bacteria | 1997 |
| 737 | Ga0395900_0411048 | 3300037418 | Bacteria | 1315 |
| 738 | Ga0395898_0012308 | 3300037466 | Bacteria | 8847 |
| 739 | Ga0395898_0015527 | 3300037466 | Bacteria | 7809 |
| 740 | Ga0395898_0021159 | 3300037466 | Bacteria | 6598 |
| 741 | Ga0395898_0057536 | 3300037466 | Bacteria | 3788 |
| 742 | Ga0395898_0067814 | 3300037466 | Bacteria | 3453 |
| 743 | Ga0395898_0071691 | 3300037466 | Bacteria | 3347 |
| 744 | Ga0395898_0129509 | 3300037466 | Bacteria | 2417 |
| 745 | Ga0395898_0165391 | 3300037466 | Bacteria | 2116 |
| 746 | Ga0395898_0182532 | 3300037466 | Bacteria | 2005 |
| 747 | Ga0395898_0299275 | 3300037466 | Bacteria | 1535 |
| 748 | Ga0395898_0303673 | 3300037466 | Bacteria | 1522 |
| 749 | Ga0395898_0626186 | 3300037466 | Bacteria | 1018 |
| 750 | Ga0395905_0000490 | 3300037471 | Bacteria | 54512 |
| 751 | Ga0395905_0001952 | 3300037471 | Bacteria | 23608 |
| 752 | Ga0395905_0002564 | 3300037471 | Bacteria | 20014 |
| 753 | Ga0395905_0030798 | 3300037471 | Bacteria | 5053 |
| 754 | Ga0395905_0038530 | 3300037471 | Bacteria | 4486 |
| 755 | Ga0395905_0044910 | 3300037471 | Bacteria | 4145 |
| 756 | Ga0395905_0094841 | 3300037471 | Bacteria | 2799 |
| 757 | Ga0395905_0113726 | 3300037471 | Bacteria | 2543 |
| 758 | Ga0395905_0257928 | 3300037471 | Bacteria | 1628 |
| 759 | Ga0436364_0315170 | 3300037853 | Bacteria | 2953 |
| 760 | Ga0436364_0981594 | 3300037853 | Bacteria | 21203 |
| 761 | Ga0436364_1094905 | 3300037853 | Bacteria | 8704 |
| 762 | Ga0436364_1123333 | 3300037853 | Bacteria | 3003 |
| 763 | Ga0436364_1183619 | 3300037853 | Bacteria | 29970 |
| 764 | Ga0436364_1316620 | 3300037853 | Bacteria | 1871 |
| 765 | Ga0395901_0000249 | 3300038443 | Bacteria | 66993 |
| 766 | Ga0395901_0028554 | 3300038443 | Bacteria | 5737 |
| 767 | Ga0395901_0032611 | 3300038443 | Bacteria | 5372 |
| 768 | Ga0395901_0033897 | 3300038443 | Bacteria | 5272 |
| 769 | Ga0395901_0062128 | 3300038443 | Bacteria | 3887 |
| 770 | Ga0395901_0064971 | 3300038443 | Bacteria | 3798 |
| 771 | Ga0395901_0239538 | 3300038443 | Bacteria | 1892 |
| 772 | Ga0400488_42668 | 3300038741 | Bacteria | 3342 |
| 773 | Ga0400486_23075 | 3300038742 | Bacteria | 3644 |
| 774 | Ga0436365_0385120 | 3300039437 | Bacteria | 1533 |
| 775 | Ga0436365_0388612 | 3300039437 | Bacteria | 1233 |
| 776 | Ga0436365_0452497 | 3300039437 | Bacteria | 2345 |
| 777 | Ga0436365_0710251 | 3300039437 | Bacteria | 5854 |
| 778 | Ga0436365_0821816 | 3300039437 | Bacteria | 1072 |
| 779 | Ga0436365_1432912 | 3300039437 | Bacteria | 91459 |
| 780 | Ga0436365_1747331 | 3300039437 | Bacteria | 2372 |
| 781 | Ga0436360_0189891 | 3300039438 | Bacteria | 1629 |
| 782 | Ga0436360_0321394 | 3300039438 | Bacteria | 2413 |
| 783 | Ga0436360_0776057 | 3300039438 | Bacteria | 1545 |
| 784 | Ga0436360_0865765 | 3300039438 | Bacteria | 1680 |
| 785 | Ga0436360_1119660 | 3300039438 | Bacteria | 1635 |
| 786 | Ga0436360_1203410 | 3300039438 | Bacteria | 10729 |
| 787 | Ga0436360_1333994 | 3300039438 | Bacteria | 3408 |
| 788 | Ga0436361_0007600 | 3300039447 | Bacteria | 4929 |
| 789 | Ga0436361_0124441 | 3300039447 | Bacteria | 1656 |
| 790 | Ga0436361_0198498 | 3300039447 | Bacteria | 5615 |
| 791 | Ga0436361_0216543 | 3300039447 | Bacteria | 1302 |
| 792 | Ga0436361_0833088 | 3300039447 | Bacteria | 2174 |
| 793 | Ga0436363_0036075 | 3300039450 | Bacteria | 20430 |
| 794 | Ga0436363_0055727 | 3300039450 | Bacteria | 5665 |
| 795 | Ga0436363_0792304 | 3300039450 | Bacteria | 2245 |
| 796 | Ga0436363_1377919 | 3300039450 | Bacteria | 1387 |
| 797 | Ga0436362_0692635 | 3300039453 | Bacteria | 1601 |
| 798 | Ga0436362_0958195 | 3300039453 | Bacteria | 7517 |
| 799 | Ga0439441_006052 | 3300042001 | Bacteria | 1904 |
| 800 | Ga0439464_0000604 | 3300042439 | Bacteria | 7574 |
| 801 | Ga0466965_0107407 | 3300044683 | Bacteria | 1432 |
| 802 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 803 | Ga0466966_0007678 | 3300044684 | Bacteria | 7146 |
| 804 | Ga0466961_0001957 | 3300044693 | Bacteria | 12837 |
| 805 | Ga0466961_0021341 | 3300044693 | Bacteria | 4169 |
| 806 | Ga0466963_0060957 | 3300044694 | Bacteria | 2520 |
| 807 | Ga0466963_0066699 | 3300044694 | Bacteria | 2415 |
| 808 | Ga0466963_0088879 | 3300044694 | Bacteria | 2101 |
| 809 | Ga0466963_0098529 | 3300044694 | Bacteria | 1998 |
| 810 | Ga0466964_0045424 | 3300044706 | Bacteria | 1787 |
| 811 | Ga0466971_0049154 | 3300044719 | Bacteria | 1897 |
| 812 | Ga0466968_0033418 | 3300044735 | Bacteria | 2143 |
| 813 | Ga0466970_0015793 | 3300044765 | Bacteria | 3887 |
| 814 | Ga0466970_0018885 | 3300044765 | Bacteria | 3570 |
| 815 | Ga0466970_0041527 | 3300044765 | Bacteria | 2444 |
| 816 | Ga0466957_0001548 | 3300044842 | Bacteria | 12099 |
| 817 | Ga0466957_0013787 | 3300044842 | Bacteria | 4696 |
| 818 | Ga0466957_0131477 | 3300044842 | Bacteria | 1604 |
| 819 | Ga0466959_0059278 | 3300045049 | Bacteria | 2787 |
| 820 | Ga0466959_0086949 | 3300045049 | Bacteria | 2248 |
| 821 | Ga0466959_0425139 | 3300045049 | Bacteria | 901 |
| 822 | Ga0466958_0017411 | 3300045836 | Bacteria | 4153 |
| 823 | Ga0466958_0063706 | 3300045836 | Bacteria | 2248 |
| 824 | Ga0466958_0096927 | 3300045836 | Bacteria | 1830 |
| 825 | Ga0466958_0116963 | 3300045836 | Bacteria | 1667 |
| 826 | Ga0466967_0104109 | 3300045976 | Bacteria | 2598 |
| 827 | Ga0466967_0174449 | 3300045976 | Bacteria | 2025 |
| 828 | Ga0466967_0215765 | 3300045976 | Bacteria | 1821 |
| 829 | Ga0466967_0300392 | 3300045976 | Bacteria | 1544 |
| 830 | Ga0466967_0459947 | 3300045976 | Bacteria | 1244 |
| 831 | Ga0466967_0586481 | 3300045976 | Bacteria | 1099 |
| 832 | Ga0495627_000353 | 3300046453 | Bacteria | 43133 |
| 833 | Ga0495627_000615 | 3300046453 | Bacteria | 28285 |
| 834 | Ga0495592_0000241 | 3300046454 | Bacteria | 46812 |
| 835 | Ga0495603_0130304 | 3300046455 | Bacteria | 1465 |
| 836 | Ga0495629_0015097 | 3300046459 | Bacteria | 5552 |
| 837 | Ga0495638_0088182 | 3300046460 | Bacteria | 1873 |
| 838 | Ga0495651_0000555 | 3300046462 | Bacteria | 28819 |
| 839 | Ga0495651_0020950 | 3300046462 | Bacteria | 5076 |
| 840 | Ga0495651_0071936 | 3300046462 | Bacteria | 2628 |
| 841 | Ga0495653_0000103 | 3300046463 | Bacteria | 69772 |
| 842 | Ga0495580_0023628 | 3300046472 | Bacteria | 4510 |
| 843 | Ga0495582_0106757 | 3300046473 | Bacteria | 1571 |
| 844 | Ga0495639_0087870 | 3300046475 | Bacteria | 1455 |
| 845 | Ga0495662_0012843 | 3300046476 | Bacteria | 4082 |
| 846 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 847 | Ga0495664_0005148 | 3300046477 | Bacteria | 7173 |
| 848 | Ga0495594_0159278 | 3300046499 | Bacteria | 1283 |
| 849 | Ga0495607_0013505 | 3300046501 | Bacteria | 5350 |
| 850 | Ga0495583_0004819 | 3300046506 | Bacteria | 9455 |
| 851 | Ga0495606_0068911 | 3300046507 | Bacteria | 2237 |
| 852 | Ga0495608_0000131 | 3300046511 | Bacteria | 53612 |
| 853 | Ga0495608_0002138 | 3300046511 | Bacteria | 14259 |
| 854 | Ga0495608_0043182 | 3300046511 | Bacteria | 3013 |
| 855 | Ga0495610_0000186 | 3300046512 | Bacteria | 69408 |
| 856 | Ga0495610_0047236 | 3300046512 | Bacteria | 2119 |
| 857 | Ga0495618_0000019 | 3300046514 | Bacteria | 136770 |
| 858 | Ga0495628_0000080 | 3300046516 | Bacteria | 75108 |
| 859 | Ga0495628_0052855 | 3300046516 | Bacteria | 3208 |
| 860 | Ga0495628_0129636 | 3300046516 | Bacteria | 1930 |
| 861 | Ga0495630_0000989 | 3300046517 | Bacteria | 19766 |
| 862 | Ga0495630_0027488 | 3300046517 | Bacteria | 4222 |
| 863 | Ga0495632_0129557 | 3300046519 | Bacteria | 1175 |
| 864 | Ga0495637_0018683 | 3300046520 | Bacteria | 3212 |
| 865 | Ga0495637_0045769 | 3300046520 | Bacteria | 1854 |
| 866 | Ga0495637_0080112 | 3300046520 | Bacteria | 1303 |
| 867 | Ga0495643_0001215 | 3300046522 | Bacteria | 24923 |
| 868 | Ga0495643_0004105 | 3300046522 | Bacteria | 10360 |
| 869 | Ga0495648_0043810 | 3300046524 | Bacteria | 2801 |
| 870 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 871 | Ga0495652_0256481 | 3300046529 | Bacteria | 1293 |
| 872 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 873 | Ga0495640_0027742 | 3300046533 | Bacteria | 4081 |
| 874 | Ga0495640_0056264 | 3300046533 | Bacteria | 2688 |
| 875 | Ga0495640_0170358 | 3300046533 | Bacteria | 1391 |
| 876 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 877 | Ga0495587_0071295 | 3300046536 | Bacteria | 2021 |
| 878 | Ga0495645_0000009 | 3300046543 | Bacteria | 239632 |
| 879 | Ga0495645_0001435 | 3300046543 | Bacteria | 16064 |
| 880 | Ga0495645_0115662 | 3300046543 | Bacteria | 1894 |
| 881 | Ga0495633_0002461 | 3300046558 | Bacteria | 13068 |
| 882 | Ga0495667_0000021 | 3300046559 | Bacteria | 180625 |
| 883 | Ga0495667_0029141 | 3300046559 | Bacteria | 3715 |
| 884 | Ga0495667_0251498 | 3300046559 | Bacteria | 1125 |
| 885 | Ga0495668_0000258 | 3300046616 | Bacteria | 75022 |
| 886 | Ga0495668_0018062 | 3300046616 | Bacteria | 4082 |
| 887 | Ga0495668_0119050 | 3300046616 | Bacteria | 1444 |
| 888 | Ga0495634_0000396 | 3300046642 | Bacteria | 42784 |
| 889 | Ga0495634_0017941 | 3300046642 | Bacteria | 5044 |
| 890 | Ga0495634_0182947 | 3300046642 | Bacteria | 1311 |
| 891 | Ga0495634_0198400 | 3300046642 | Bacteria | 1248 |
| 892 | Ga0495611_0004123 | 3300046648 | Bacteria | 6330 |
| 893 | Ga0495625_0076122 | 3300046660 | Bacteria | 2347 |
| 894 | Ga0495625_0089169 | 3300046660 | Bacteria | 2135 |
| 895 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 896 | Ga0495635_0040769 | 3300046663 | Bacteria | 3208 |
| 897 | Ga0495657_0000088 | 3300046675 | Bacteria | 81307 |
| 898 | Ga0495657_0066311 | 3300046675 | Bacteria | 2372 |
| 899 | Ga0495599_0000025 | 3300046678 | Bacteria | 120337 |
| 900 | Ga0495623_0000018 | 3300046679 | Bacteria | 107338 |
| 901 | Ga0495623_0040784 | 3300046679 | Bacteria | 2963 |
| 902 | Ga0495623_0170245 | 3300046679 | Bacteria | 1273 |
| 903 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 904 | Ga0495658_0000497 | 3300046683 | Bacteria | 21583 |
| 905 | Ga0495669_0000096 | 3300046684 | Bacteria | 56184 |
| 906 | Ga0495624_0046274 | 3300046690 | Bacteria | 2767 |
| 907 | Ga0495624_0163952 | 3300046690 | Bacteria | 1357 |
| 908 | Ga0495600_0000042 | 3300046809 | Bacteria | 74873 |
| 909 | Ga0495581_0008078 | 3300047315 | Bacteria | 6092 |
| 910 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 911 | Ga0495674_0000028 | 3300047319 | Bacteria | 124722 |
| 912 | Ga0495674_0043205 | 3300047319 | Bacteria | 4013 |
| 913 | Ga0495674_0076822 | 3300047319 | Bacteria | 2872 |
| 914 | Ga0495674_0192162 | 3300047319 | Bacteria | 1696 |
| 915 | Ga0495674_0350370 | 3300047319 | Bacteria | 1199 |
| 916 | Ga0495680_0001113 | 3300047322 | Bacteria | 29690 |
| 917 | Ga0495687_000378 | 3300047443 | Bacteria | 55453 |
| 918 | Ga0495675_0000691 | 3300047444 | Bacteria | 21173 |
| 919 | Ga0495675_0018021 | 3300047444 | Bacteria | 4477 |
| 920 | Ga0495677_0002781 | 3300047445 | Bacteria | 6826 |
| 921 | Ga0495681_0000110 | 3300047470 | Bacteria | 70960 |
| 922 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 923 | Ga0495684_0074731 | 3300047471 | Bacteria | 2575 |
| 924 | Ga0495686_0029419 | 3300047472 | Bacteria | 3574 |
| 925 | Ga0495686_0066427 | 3300047472 | Bacteria | 2228 |
| 926 | Ga0495593_0005631 | 3300047673 | Bacteria | 7394 |
| 927 | Ga0495602_0000022 | 3300048088 | Bacteria | 163672 |
| 928 | Ga0495602_0001350 | 3300048088 | Bacteria | 24223 |
| 929 | Ga0495602_0023164 | 3300048088 | Bacteria | 6058 |
| 930 | Ga0495615_0022915 | 3300048090 | Bacteria | 1426 |
| 931 | Ga0496101_0091665 | 3300048904 | Bacteria | 2262 |
| 932 | Ga0496101_0164931 | 3300048904 | Bacteria | 1701 |
| 933 | Ga0496101_0283930 | 3300048904 | Bacteria | 1294 |
| 934 | Ga0496102_0008864 | 3300048905 | Bacteria | 8634 |
| 935 | Ga0496102_0023431 | 3300048905 | Bacteria | 5484 |
| 936 | Ga0496102_0059494 | 3300048905 | Bacteria | 3494 |
| 937 | Ga0496103_0002167 | 3300048906 | Bacteria | 12476 |
| 938 | Ga0496103_0039827 | 3300048906 | Bacteria | 2888 |
| 939 | Ga0496104_0000040 | 3300048907 | Bacteria | 162886 |
| 940 | Ga0496104_0000316 | 3300048907 | Bacteria | 43064 |
| 941 | Ga0496104_0002075 | 3300048907 | Bacteria | 17406 |
| 942 | Ga0496104_0035963 | 3300048907 | Bacteria | 4626 |
| 943 | Ga0496104_0096964 | 3300048907 | Bacteria | 2821 |
| 944 | Ga0496104_0165598 | 3300048907 | Bacteria | 2120 |
| 945 | Ga0496104_0403309 | 3300048907 | Bacteria | 1279 |
| 946 | Ga0496105_0000060 | 3300048908 | Bacteria | 86019 |
| 947 | Ga0496105_0026202 | 3300048908 | Bacteria | 4753 |
| 948 | Ga0496105_0036677 | 3300048908 | Bacteria | 4039 |
| 949 | Ga0496106_0000674 | 3300048909 | Bacteria | 24467 |
| 950 | Ga0496107_0002521 | 3300048910 | Bacteria | 11914 |
| 951 | Ga0496107_0111587 | 3300048910 | Bacteria | 2010 |
| 952 | Ga0496108_0005349 | 3300048911 | Bacteria | 10379 |
| 953 | Ga0496108_0021285 | 3300048911 | Bacteria | 5330 |
| 954 | Ga0496108_0108637 | 3300048911 | Bacteria | 2370 |
| 955 | Ga0496109_0070289 | 3300048912 | Bacteria | 3212 |
| 956 | Ga0496109_0076001 | 3300048912 | Bacteria | 3089 |
| 957 | Ga0496110_0002032 | 3300048913 | Bacteria | 15081 |
| 958 | Ga0496111_0030447 | 3300048914 | Bacteria | 3837 |
| 959 | Ga0496111_0042787 | 3300048914 | Bacteria | 3253 |
| 960 | Ga0496111_0084443 | 3300048914 | Bacteria | 2321 |
| 961 | Ga0496111_0139830 | 3300048914 | Bacteria | 1794 |
| 962 | Ga0496112_0004086 | 3300048915 | Bacteria | 12259 |
| 963 | Ga0496112_0027234 | 3300048915 | Bacteria | 5512 |
| 964 | Ga0496112_0317958 | 3300048915 | Bacteria | 1501 |
| 965 | Ga0496112_0339454 | 3300048915 | Bacteria | 1446 |
| 966 | Ga0496112_0432041 | 3300048915 | Bacteria | 1255 |
| 967 | Ga0496113_0004024 | 3300048916 | Bacteria | 8946 |
| 968 | Ga0496113_0040657 | 3300048916 | Bacteria | 3427 |
| 969 | Ga0496113_0246116 | 3300048916 | Bacteria | 1427 |
| 970 | Ga0496115_0028629 | 3300048918 | Bacteria | 4368 |
| 971 | Ga0496115_0060528 | 3300048918 | Bacteria | 3051 |
| 972 | Ga0496115_0096158 | 3300048918 | Bacteria | 2425 |
| 973 | Ga0496119_0002688 | 3300048922 | Bacteria | 19208 |
| 974 | Ga0496121_0147076 | 3300048924 | Bacteria | 1739 |
| 975 | Ga0496123_0129844 | 3300048926 | Bacteria | 1398 |
| 976 | Ga0496124_0232116 | 3300048927 | Bacteria | 1379 |
| 977 | Ga0496125_0009891 | 3300048928 | Bacteria | 9701 |
| 978 | Ga0496125_0292461 | 3300048928 | Bacteria | 1002 |
| 979 | Ga0496126_0002680 | 3300048929 | Bacteria | 23522 |
| 980 | Ga0496126_0091139 | 3300048929 | Bacteria | 2681 |
| 981 | Ga0496126_0091998 | 3300048929 | Bacteria | 2666 |
| 982 | Ga0496126_0195334 | 3300048929 | Bacteria | 1712 |
| 983 | Ga0495678_015954 | 3300049459 | Bacteria | 3447 |
| 984 | Ga0495682_0005841 | 3300049460 | Bacteria | 5055 |
| 985 | Ga0501031_0014292 | 3300049568 | Bacteria | 5163 |
| 986 | Ga0501031_0022369 | 3300049568 | Bacteria | 4121 |
| 987 | Ga0501031_0060240 | 3300049568 | Bacteria | 2474 |
| 988 | Ga0501032_0011626 | 3300049569 | Bacteria | 6312 |
| 989 | Ga0501032_0026639 | 3300049569 | Bacteria | 3974 |
| 990 | Ga0501032_0181853 | 3300049569 | Bacteria | 1376 |
| 991 | Ga0501033_0000385 | 3300049570 | Bacteria | 42475 |
| 992 | Ga0501033_0003573 | 3300049570 | Bacteria | 12720 |
| 993 | Ga0501033_0010904 | 3300049570 | Bacteria | 6967 |
| 994 | Ga0501033_0089119 | 3300049570 | Bacteria | 2257 |
| 995 | Ga0501033_0095068 | 3300049570 | Bacteria | 2178 |
| 996 | Ga0501033_0120461 | 3300049570 | Bacteria | 1905 |
| 997 | Ga0501033_0165665 | 3300049570 | Bacteria | 1589 |
| 998 | Ga0501034_0001717 | 3300049571 | Bacteria | 28196 |
| 999 | Ga0501034_0005576 | 3300049571 | Bacteria | 13711 |
| 1000 | Ga0501034_0006988 | 3300049571 | Bacteria | 12053 |
| 1001 | Ga0501034_0009108 | 3300049571 | Bacteria | 10426 |
| 1002 | Ga0501034_0009494 | 3300049571 | Bacteria | 10183 |
| 1003 | Ga0501034_0054483 | 3300049571 | Bacteria | 4026 |
| 1004 | Ga0501034_0061063 | 3300049571 | Bacteria | 3786 |
| 1005 | Ga0501034_0072766 | 3300049571 | Bacteria | 3446 |
| 1006 | Ga0501034_0142028 | 3300049571 | Bacteria | 2380 |
| 1007 | Ga0501034_0193315 | 3300049571 | Bacteria | 1996 |
| 1008 | Ga0501034_0199574 | 3300049571 | Bacteria | 1959 |
| 1009 | Ga0501034_0237408 | 3300049571 | Bacteria | 1770 |
| 1010 | Ga0501034_0313760 | 3300049571 | Bacteria | 1502 |
| 1011 | Ga0501036_0005785 | 3300049572 | Bacteria | 10021 |
| 1012 | Ga0501036_0123265 | 3300049572 | Bacteria | 2189 |
| 1013 | Ga0501036_0177235 | 3300049572 | Bacteria | 1795 |
| 1014 | Ga0501037_0000049 | 3300049573 | Bacteria | 113246 |
| 1015 | Ga0501037_0002948 | 3300049573 | Bacteria | 12337 |
| 1016 | Ga0501037_0008002 | 3300049573 | Bacteria | 7747 |
| 1017 | Ga0501037_0124211 | 3300049573 | Bacteria | 1854 |
| 1018 | Ga0501037_0263761 | 3300049573 | Bacteria | 1203 |
| 1019 | Ga0501037_0316101 | 3300049573 | Bacteria | 1082 |
| 1020 | Ga0501037_0350299 | 3300049573 | Bacteria | 1019 |
| 1021 | Ga0501038_0000010 | 3300049574 | Bacteria | 182652 |
| 1022 | Ga0501038_0000843 | 3300049574 | Bacteria | 27250 |
| 1023 | Ga0501038_0028450 | 3300049574 | Bacteria | 4966 |
| 1024 | Ga0501038_0052840 | 3300049574 | Bacteria | 3501 |
| 1025 | Ga0501038_0089951 | 3300049574 | Bacteria | 2574 |
| 1026 | Ga0501038_0143461 | 3300049574 | Bacteria | 1952 |
| 1027 | Ga0501038_0194151 | 3300049574 | Bacteria | 1632 |
| 1028 | Ga0501039_0006533 | 3300049575 | Bacteria | 8854 |
| 1029 | Ga0501043_0000006 | 3300049579 | Bacteria | 234413 |
| 1030 | Ga0501043_0010724 | 3300049579 | Bacteria | 7178 |
| 1031 | Ga0501043_0049522 | 3300049579 | Bacteria | 3303 |
| 1032 | Ga0501046_0000035 | 3300049580 | Bacteria | 161495 |
| 1033 | Ga0501046_0003200 | 3300049580 | Bacteria | 15070 |
| 1034 | Ga0501046_0012717 | 3300049580 | Bacteria | 7157 |
| 1035 | Ga0501047_0006810 | 3300049581 | Bacteria | 10739 |
| 1036 | Ga0501047_0010868 | 3300049581 | Bacteria | 8605 |
| 1037 | Ga0501047_0013059 | 3300049581 | Bacteria | 7867 |
| 1038 | Ga0501047_0092119 | 3300049581 | Bacteria | 2909 |
| 1039 | Ga0501047_0167775 | 3300049581 | Bacteria | 2065 |
| 1040 | Ga0501047_0313049 | 3300049581 | Bacteria | 1410 |
| 1041 | Ga0501047_0505445 | 3300049581 | Bacteria | 1035 |
| 1042 | Ga0501048_0003240 | 3300049582 | Bacteria | 12399 |
| 1043 | Ga0501048_0098135 | 3300049582 | Bacteria | 2067 |
| 1044 | Ga0501067_0003372 | 3300049583 | Bacteria | 8781 |
| 1045 | Ga0501067_0015846 | 3300049583 | Bacteria | 4169 |
| 1046 | Ga0501067_0055584 | 3300049583 | Bacteria | 2193 |
| 1047 | Ga0501067_0063225 | 3300049583 | Bacteria | 2049 |
| 1048 | Ga0501068_0001776 | 3300049584 | Bacteria | 11468 |
| 1049 | Ga0501068_0010765 | 3300049584 | Bacteria | 5143 |
| 1050 | Ga0501068_0032115 | 3300049584 | Bacteria | 3121 |
| 1051 | Ga0501068_0072378 | 3300049584 | Bacteria | 2105 |
| 1052 | Ga0501069_0000141 | 3300049585 | Bacteria | 31844 |
| 1053 | Ga0501069_0006219 | 3300049585 | Bacteria | 6237 |
| 1054 | Ga0501069_0031823 | 3300049585 | Bacteria | 2903 |
| 1055 | Ga0501069_0103639 | 3300049585 | Bacteria | 1616 |
| 1056 | Ga0501070_0000024 | 3300049586 | Bacteria | 159781 |
| 1057 | Ga0501070_0000081 | 3300049586 | Bacteria | 81543 |
| 1058 | Ga0501070_0000254 | 3300049586 | Bacteria | 50216 |
| 1059 | Ga0501070_0003223 | 3300049586 | Bacteria | 14190 |
| 1060 | Ga0501070_0008662 | 3300049586 | Bacteria | 8600 |
| 1061 | Ga0501070_0012129 | 3300049586 | Bacteria | 7275 |
| 1062 | Ga0501070_0023248 | 3300049586 | Bacteria | 5191 |
| 1063 | Ga0501070_0025471 | 3300049586 | Bacteria | 4961 |
| 1064 | Ga0501070_0030575 | 3300049586 | Bacteria | 4513 |
| 1065 | Ga0501070_0058101 | 3300049586 | Bacteria | 3206 |
| 1066 | Ga0501070_0063974 | 3300049586 | Bacteria | 3047 |
| 1067 | Ga0501070_0065460 | 3300049586 | Bacteria | 3009 |
| 1068 | Ga0501070_0128281 | 3300049586 | Bacteria | 2096 |
| 1069 | Ga0501070_0163411 | 3300049586 | Bacteria | 1835 |
| 1070 | Ga0501070_0361742 | 3300049586 | Bacteria | 1177 |
| 1071 | Ga0501071_0018083 | 3300049587 | Bacteria | 4874 |
| 1072 | Ga0501071_0067976 | 3300049587 | Bacteria | 2592 |
| 1073 | Ga0501071_0081436 | 3300049587 | Bacteria | 2369 |
| 1074 | Ga0501072_0010755 | 3300049588 | Bacteria | 6973 |
| 1075 | Ga0501072_0122482 | 3300049588 | Bacteria | 2072 |
| 1076 | Ga0501072_0135142 | 3300049588 | Bacteria | 1966 |
| 1077 | Ga0501073_0015833 | 3300049589 | Bacteria | 5464 |
| 1078 | Ga0501073_0019692 | 3300049589 | Bacteria | 4870 |
| 1079 | Ga0501073_0024481 | 3300049589 | Bacteria | 4335 |
| 1080 | Ga0501073_0029021 | 3300049589 | Bacteria | 3953 |
| 1081 | Ga0501073_0046862 | 3300049589 | Bacteria | 3039 |
| 1082 | Ga0501073_0051648 | 3300049589 | Bacteria | 2879 |
| 1083 | Ga0501073_0083510 | 3300049589 | Bacteria | 2222 |
| 1084 | Ga0501073_0111541 | 3300049589 | Bacteria | 1897 |
| 1085 | Ga0501073_0234866 | 3300049589 | Bacteria | 1266 |
| 1086 | Ga0501073_0368523 | 3300049589 | Bacteria | 992 |
| 1087 | Ga0501074_0000011 | 3300049590 | Bacteria | 93181 |
| 1088 | Ga0501074_0003356 | 3300049590 | Bacteria | 11346 |
| 1089 | Ga0501074_0018814 | 3300049590 | Bacteria | 5017 |
| 1090 | Ga0501074_0071243 | 3300049590 | Bacteria | 2499 |
| 1091 | Ga0501074_0107374 | 3300049590 | Bacteria | 1999 |
| 1092 | Ga0501074_0146591 | 3300049590 | Bacteria | 1688 |
| 1093 | Ga0501075_0097733 | 3300049591 | Bacteria | 2228 |
| 1094 | Ga0501076_0004022 | 3300049592 | Bacteria | 10391 |
| 1095 | Ga0501076_0032561 | 3300049592 | Bacteria | 4069 |
| 1096 | Ga0501077_0001770 | 3300049593 | Bacteria | 13042 |
| 1097 | Ga0501257_006979 | 3300049686 | Bacteria | 2516 |
| 1098 | Ga0501079_0033484 | 3300049741 | Bacteria | 3953 |
| 1099 | Ga0501079_0046635 | 3300049741 | Bacteria | 3344 |
| 1100 | Ga0501079_0138816 | 3300049741 | Bacteria | 1893 |
| 1101 | Ga0501079_0188434 | 3300049741 | Bacteria | 1610 |
| 1102 | Ga0501079_0338998 | 3300049741 | Bacteria | 1178 |
| 1103 | Ga0501080_0001944 | 3300049742 | Bacteria | 17847 |
| 1104 | Ga0501080_0002670 | 3300049742 | Bacteria | 15612 |
| 1105 | Ga0501080_0002884 | 3300049742 | Bacteria | 15122 |
| 1106 | Ga0501080_0011105 | 3300049742 | Bacteria | 8241 |
| 1107 | Ga0501080_0019967 | 3300049742 | Bacteria | 6202 |
| 1108 | Ga0501080_0026141 | 3300049742 | Bacteria | 5423 |
| 1109 | Ga0501080_0043428 | 3300049742 | Bacteria | 4186 |
| 1110 | Ga0501080_0068934 | 3300049742 | Bacteria | 3290 |
| 1111 | Ga0501080_0095249 | 3300049742 | Bacteria | 2764 |
| 1112 | Ga0501080_0158149 | 3300049742 | Bacteria | 2093 |
| 1113 | Ga0501080_0186438 | 3300049742 | Bacteria | 1907 |
| 1114 | Ga0501080_0349284 | 3300049742 | Bacteria | 1336 |
| 1115 | Ga0501081_0007060 | 3300049743 | Bacteria | 7302 |
| 1116 | Ga0501081_0048889 | 3300049743 | Bacteria | 2911 |
| 1117 | Ga0501083_0000338 | 3300049744 | Bacteria | 29749 |
| 1118 | Ga0501083_0010892 | 3300049744 | Bacteria | 6397 |
| 1119 | Ga0501035_0000068 | 3300049822 | Bacteria | 128392 |
| 1120 | Ga0501035_0000371 | 3300049822 | Bacteria | 51668 |
| 1121 | Ga0501035_0000695 | 3300049822 | Bacteria | 36638 |
| 1122 | Ga0501035_0004271 | 3300049822 | Bacteria | 13564 |
| 1123 | Ga0501035_0009698 | 3300049822 | Bacteria | 8957 |
| 1124 | Ga0501035_0029527 | 3300049822 | Bacteria | 5000 |
| 1125 | Ga0501035_0057030 | 3300049822 | Bacteria | 3483 |
| 1126 | Ga0501035_0095699 | 3300049822 | Bacteria | 2610 |
| 1127 | Ga0501035_0099572 | 3300049822 | Bacteria | 2551 |
| 1128 | Ga0501035_0147032 | 3300049822 | Bacteria | 2046 |
| 1129 | Ga0501035_0147823 | 3300049822 | Bacteria | 2040 |
| 1130 | Ga0501035_0207155 | 3300049822 | Bacteria | 1679 |
| 1131 | Ga0501035_0431924 | 3300049822 | Bacteria | 1092 |
| 1132 | Ga0501044_0000082 | 3300049823 | Bacteria | 115127 |
| 1133 | Ga0501044_0002209 | 3300049823 | Bacteria | 22334 |
| 1134 | Ga0501044_0013515 | 3300049823 | Bacteria | 8828 |
| 1135 | Ga0501044_0019534 | 3300049823 | Bacteria | 7246 |
| 1136 | Ga0501044_0020418 | 3300049823 | Bacteria | 7074 |
| 1137 | Ga0501044_0026362 | 3300049823 | Bacteria | 6153 |
| 1138 | Ga0501044_0033513 | 3300049823 | Bacteria | 5397 |
| 1139 | Ga0501044_0042427 | 3300049823 | Bacteria | 4732 |
| 1140 | Ga0501044_0059040 | 3300049823 | Bacteria | 3932 |
| 1141 | Ga0501044_0081092 | 3300049823 | Bacteria | 3285 |
| 1142 | Ga0501044_0087370 | 3300049823 | Bacteria | 3149 |
| 1143 | Ga0501044_0114874 | 3300049823 | Bacteria | 2697 |
| 1144 | Ga0501044_0125060 | 3300049823 | Bacteria | 2569 |
| 1145 | Ga0501044_0193349 | 3300049823 | Bacteria | 1996 |
| 1146 | Ga0501044_0247551 | 3300049823 | Bacteria | 1725 |
| 1147 | Ga0501044_0435360 | 3300049823 | Bacteria | 1220 |
| 1148 | Ga0501045_0371486 | 3300049824 | Bacteria | 1064 |
| 1149 | nmdc:mga03n38_238014_c1 | 3300050490 | Bacteria | 957 |
| 1150 | nmdc:mga03n38_54946_c1 | 3300050490 | Bacteria | 1792 |
| 1151 | nmdc:mga03n38_595_c1 | 3300050490 | Bacteria | 9212 |
| 1152 | nmdc:mga03n38_73454_c1 | 3300050490 | Bacteria | 1588 |
| 1153 | nmdc:mga00v17_148556_c1 | 3300050491 | Bacteria | 1505 |
| 1154 | nmdc:mga00v17_5162_c1 | 3300050491 | Bacteria | 6868 |
| 1155 | nmdc:mga0yw44_207906_c1 | 3300050492 | Bacteria | 1294 |
| 1156 | nmdc:mga0yw44_2703_c1 | 3300050492 | Bacteria | 7651 |
| 1157 | nmdc:mga0yw44_50038_c1 | 3300050492 | Bacteria | 2525 |
| 1158 | nmdc:mga0k408_88267_c1 | 3300050493 | Bacteria | 1821 |
| 1159 | nmdc:mga06z11_123_c1 | 3300050494 | Bacteria | 31898 |
| 1160 | nmdc:mga06z11_40694_c1 | 3300050494 | Bacteria | 2321 |
| 1161 | nmdc:mga06z11_65058_c1 | 3300050494 | Bacteria | 1913 |
| 1162 | nmdc:mga06z11_87811_c1 | 3300050494 | Bacteria | 1683 |
| 1163 | nmdc:mga04h51_46045_c1 | 3300050495 | Bacteria | 1445 |
| 1164 | nmdc:mga05p37_197560_c1 | 3300050507 | Bacteria | 2438 |
| 1165 | nmdc:mga05p37_2001_c1 | 3300050507 | Bacteria | 23793 |
| 1166 | nmdc:mga05p37_216337_c1 | 3300050507 | Bacteria | 2314 |
| 1167 | nmdc:mga05p37_564_c1 | 3300050507 | Bacteria | 40786 |
| 1168 | nmdc:mga05p37_94737_c1 | 3300050507 | Bacteria | 3678 |
| 1169 | nmdc:mga09592_20905_c1 | 3300050508 | Bacteria | 5390 |
| 1170 | nmdc:mga09592_287282_c1 | 3300050508 | Bacteria | 1426 |
| 1171 | nmdc:mga09592_430002_c1 | 3300050508 | Bacteria | 1140 |
| 1172 | nmdc:mga09592_47868_c1 | 3300050508 | Bacteria | 3604 |
| 1173 | nmdc:mga0qj67_21757_c1 | 3300050509 | Bacteria | 4920 |
| 1174 | nmdc:mga0qj67_3413_c1 | 3300050509 | Bacteria | 11462 |
| 1175 | nmdc:mga0qj67_46501_c1 | 3300050509 | Bacteria | 3426 |
| 1176 | nmdc:mga06r32_150255_c1 | 3300050510 | Bacteria | 2307 |
| 1177 | nmdc:mga06r32_191_c1 | 3300050510 | Bacteria | 49056 |
| 1178 | nmdc:mga06r32_335094_c1 | 3300050510 | Bacteria | 1498 |
| 1179 | nmdc:mga06r32_4147_c1 | 3300050510 | Bacteria | 12977 |
| 1180 | nmdc:mga08y16_272171_c1 | 3300050511 | Bacteria | 1748 |
| 1181 | nmdc:mga08y16_67805_c1 | 3300050511 | Bacteria | 3722 |
| 1182 | nmdc:mga08y16_82_c1 | 3300050511 | Bacteria | 81080 |
| 1183 | nmdc:mga08y16_89_c1 | 3300050511 | Bacteria | 76793 |
| 1184 | nmdc:mga0n895_110202_c1 | 3300050512 | Bacteria | 2768 |
| 1185 | nmdc:mga0n895_22520_c1 | 3300050512 | Bacteria | 5909 |
| 1186 | nmdc:mga0n895_97197_c1 | 3300050512 | Bacteria | 2950 |
| 1187 | nmdc:mga0rr50_34672_c1 | 3300050513 | Bacteria | 3616 |
| 1188 | nmdc:mga0rr50_81139_c1 | 3300050513 | Bacteria | 2502 |
| 1189 | nmdc:mga08x19_129089_c1 | 3300050514 | Bacteria | 1699 |
| 1190 | nmdc:mga08x19_94_c1 | 3300050514 | Bacteria | 79727 |
| 1191 | nmdc:mga0a205_74953_c1 | 3300050515 | Bacteria | 3269 |
| 1192 | nmdc:mga0sz30_357_c1 | 3300050516 | Bacteria | 17392 |
| 1193 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 1194 | Ga0495601_0000911 | 3300053077 | Bacteria | 16102 |
| 1195 | Ga0495601_0046582 | 3300053077 | Bacteria | 2730 |
| 1196 | Ga0495601_0287949 | 3300053077 | Bacteria | 1071 |
| 1197 | Ga0495612_0000003 | 3300053078 | Bacteria | 303629 |
| 1198 | Ga0495612_0000639 | 3300053078 | Bacteria | 14049 |
| 1199 | Ga0500610_0000197 | 3300053079 | Bacteria | 18347 |
| 1200 | Ga0495595_0000093 | 3300053084 | Bacteria | 42083 |
| 1201 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 1202 | Ga0495619_0050091 | 3300053085 | Bacteria | 2756 |
| 1203 | Ga0495619_0230697 | 3300053085 | Bacteria | 1282 |
| 1204 | Ga0500578_0118312 | 3300053086 | Bacteria | 1667 |
| 1205 | Ga0500647_0030771 | 3300053091 | Bacteria | 2551 |
| 1206 | Ga0500651_0006181 | 3300053093 | Bacteria | 6880 |
| 1207 | Ga0500566_0166802 | 3300053094 | Bacteria | 1142 |
| 1208 | Ga0500641_0000277 | 3300053096 | Bacteria | 19051 |
| 1209 | Ga0500641_0020633 | 3300053096 | Bacteria | 2502 |
| 1210 | Ga0500562_000173 | 3300053108 | Bacteria | 17722 |
| 1211 | Ga0500595_013327 | 3300053119 | Bacteria | 3152 |
| 1212 | Ga0500595_021227 | 3300053119 | Bacteria | 2321 |
| 1213 | Ga0500597_002095 | 3300053120 | Bacteria | 5399 |
| 1214 | Ga0500618_004151 | 3300053125 | Bacteria | 4733 |
| 1215 | Ga0500642_0009494 | 3300053130 | Bacteria | 3380 |
| 1216 | Ga0500652_000056 | 3300053131 | Bacteria | 51871 |
| 1217 | Ga0500655_000024 | 3300053133 | Bacteria | 43300 |
| 1218 | Ga0500655_010896 | 3300053133 | Bacteria | 1644 |
| 1219 | Ga0500658_0050268 | 3300053134 | Bacteria | 1701 |
| 1220 | Ga0500658_0056297 | 3300053134 | Bacteria | 1622 |
| 1221 | Ga0500561_0040921 | 3300053137 | Bacteria | 1223 |
| 1222 | Ga0500573_0000046 | 3300053140 | Bacteria | 98723 |
| 1223 | Ga0500590_000243 | 3300053148 | Bacteria | 16712 |
| 1224 | Ga0500604_0002073 | 3300053151 | Bacteria | 5523 |
| 1225 | Ga0500616_0003666 | 3300053153 | Bacteria | 11519 |
| 1226 | Ga0500616_0062964 | 3300053153 | Bacteria | 1914 |
| 1227 | Ga0500619_005042 | 3300053154 | Bacteria | 2904 |
| 1228 | Ga0500622_0011869 | 3300053156 | Bacteria | 4735 |
| 1229 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 1230 | Ga0500627_0046749 | 3300053158 | Bacteria | 1876 |
| 1231 | Ga0500636_0010157 | 3300053177 | Bacteria | 5489 |
| 1232 | Ga0500636_0060093 | 3300053177 | Bacteria | 2219 |
| 1233 | Ga0500637_0000010 | 3300053178 | Bacteria | 81649 |
| 1234 | Ga0500570_000188 | 3300053724 | Bacteria | 19563 |
| 1235 | Ga0500645_000008 | 3300053730 | Bacteria | 212254 |
| 1236 | Ga0500552_003131 | 3300053733 | Bacteria | 1656 |
| 1237 | Ga0501084_0000363 | 3300054114 | Bacteria | 34695 |
| 1238 | Ga0501084_0006757 | 3300054114 | Bacteria | 9429 |
| 1239 | Ga0501084_0028335 | 3300054114 | Bacteria | 4681 |
| 1240 | Ga0501084_0071402 | 3300054114 | Bacteria | 2907 |
| 1241 | Ga0501084_0075852 | 3300054114 | Bacteria | 2817 |
| 1242 | Ga0501084_0127741 | 3300054114 | Bacteria | 2140 |
| 1243 | Ga0501082_0002420 | 3300060353 | Bacteria | 16378 |
| 1244 | Ga0501082_0012588 | 3300060353 | Bacteria | 7270 |
| 1245 | Ga0501082_0016405 | 3300060353 | Bacteria | 6376 |
| 1246 | Ga0501082_0071723 | 3300060353 | Bacteria | 2983 |
| 1247 | Ga0501082_0087693 | 3300060353 | Bacteria | 2685 |
| 1248 | Ga0501082_0137163 | 3300060353 | Bacteria | 2123 |
| 1249 | Ga0501082_0289568 | 3300060353 | Bacteria | 1426 |
| 1250 | Ga0466962_0000607 | 3300061719 | Bacteria | 15864 |
| 1251 | Ga0466962_0014485 | 3300061719 | Bacteria | 3801 |
| 1252 | Ga0466962_0074237 | 3300061719 | Bacteria | 1625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0350299 | Ga0501037_0350299_21_791 | 252 |
| 2 | 3300020082 | Ga0206353_11504462 | Ga0206353_115044622 | 271 |
| 3 | 3300035119 | Ga0373956_0035196 | Ga0373956_0035196_1364_2197 | 275 |
| 4 | 3300006847 | Ga0075431_100136702 | Ga0075431_1001367022 | 276 |
| 5 | 3300009147 | Ga0114129_10589531 | Ga0114129_105895312 | 276 |
| 6 | 3300050510 | nmdc:mga06r32_150255_c1 | nmdc:mga06r32_150255_c1_1281_2249 | 276 |
| 7 | iso_pu_bacteria | 2909399089 | 2909403067 | 281 |
| 8 | 3300013296 | Ga0157374_10024477 | Ga0157374_100244777 | 284 |
| 9 | 3300045049 | Ga0466959_0425139 | Ga0466959_0425139_14_868 | 284 |
| 10 | 3300050490 | nmdc:mga03n38_238014_c1 | nmdc:mga03n38_238014_c1_11_874 | 284 |
| 11 | 3300061719 | Ga0466962_0000607 | Ga0466962_0000607_19_873 | 284 |
| 12 | 3300006846 | Ga0075430_100084206 | Ga0075430_1000842062 | 290 |
| 13 | 3300006847 | Ga0075431_100006971 | Ga0075431_1000069712 | 290 |
| 14 | 3300050508 | nmdc:mga09592_287282_c1 | nmdc:mga09592_287282_c1_394_1347 | 290 |
| 15 | 3300050509 | nmdc:mga0qj67_3413_c1 | nmdc:mga0qj67_3413_c1_697_1650 | 290 |
| 16 | 3300050510 | nmdc:mga06r32_4147_c1 | nmdc:mga06r32_4147_c1_10841_11794 | 290 |
| 17 | 3300032005 | Ga0307411_10007821 | Ga0307411_100078214 | 295 |
| 18 | 3300037418 | Ga0395900_0110853 | Ga0395900_0110853_1567_2616 | 295 |
| 19 | 3300037466 | Ga0395898_0299275 | Ga0395898_0299275_179_1228 | 295 |
| 20 | 3300037471 | Ga0395905_0038530 | Ga0395905_0038530_764_1813 | 295 |
| 21 | 3300037312 | Ga0395899_0045807 | Ga0395899_0045807_2332_3222 | 296 |
| 22 | 3300037471 | Ga0395905_0000490 | Ga0395905_0000490_16038_17084 | 296 |
| 23 | 3300006844 | Ga0075428_100109364 | Ga0075428_1001093642 | 300 |
| 24 | 3300005844 | Ga0068862_100011492 | Ga0068862_1000114925 | 301 |
| 25 | 3300006846 | Ga0075430_100182139 | Ga0075430_1001821391 | 301 |
| 26 | 3300009094 | Ga0111539_10462833 | Ga0111539_104628331 | 301 |
| 27 | 3300028380 | Ga0268265_10003811 | Ga0268265_100038116 | 301 |
| 28 | 3300049573 | Ga0501037_0316101 | Ga0501037_0316101_49_1029 | 301 |
| 29 | 3300053153 | Ga0500616_0003666 | Ga0500616_0003666_1232_2200 | 301 |
| 30 | 3300060353 | Ga0501082_0289568 | Ga0501082_0289568_293_1273 | 301 |
| 31 | 3300039438 | Ga0436360_0865765 | Ga0436360_0865765_540_1496 | 302 |
| 32 | 3300047472 | Ga0495686_0029419 | Ga0495686_0029419_789_1736 | 302 |
| 33 | 3300045976 | Ga0466967_0215765 | Ga0466967_0215765_147_1142 | 303 |
| 34 | 3300005563 | Ga0068855_100808508 | Ga0068855_1008085081 | 306 |
| 35 | 3300037471 | Ga0395905_0044910 | Ga0395905_0044910_1051_2082 | 307 |
| 36 | iso_pu_bacteria | 2524023250 | 2524609436 | 307 |
| 37 | 3300031852 | Ga0307410_10017956 | Ga0307410_100179563 | 308 |
| 38 | 3300032005 | Ga0307411_10010197 | Ga0307411_100101975 | 308 |
| 39 | 3300049589 | Ga0501073_0111541 | Ga0501073_0111541_679_1635 | 308 |
| 40 | 3300049742 | Ga0501080_0043428 | Ga0501080_0043428_2721_3677 | 308 |
| 41 | iso_pu_bacteria | 2643221550 | 2643771757 | 308 |
| 42 | iso_pu_bacteria | 2643221623 | 2644130850 | 308 |
| 43 | iso_pu_bacteria | 2842775625 | 2842778881 | 308 |
| 44 | iso_pu_bacteria | 2883577096 | 2883581621 | 308 |
| 45 | iso_pu_bacteria | 2894772417 | 2894773497 | 308 |
| 46 | iso_pu_bacteria | 2929199973 | 2929204729 | 308 |
| 47 | iso_pu_bacteria | 2937843397 | 2937845187 | 308 |
| 48 | iso_pu_bacteria | 2996336353 | 2996341328 | 308 |
| 49 | iso_pu_bacteria | 641228493 | 641336132 | 308 |
| 50 | iso_pu_bacteria | 643348555 | 643389932 | 308 |
| 51 | iso_pu_bacteria | 8002285264 | 8002290230 | 308 |
| 52 | iso_pu_bacteria | 8055909800 | 8055913475 | 308 |
| 53 | iso_pu_bacteria | 2523231067 | 2523467723 | 309 |
| 54 | iso_pu_bacteria | 2582581305 | 2585260459 | 309 |
| 55 | iso_pu_bacteria | 2671180139 | 2671692524 | 309 |
| 56 | iso_pu_bacteria | 2738543031 | 2739349174 | 309 |
| 57 | iso_pu_bacteria | 2839993093 | 2839997936 | 309 |
| 58 | iso_pu_bacteria | 2840764183 | 2840765569 | 309 |
| 59 | iso_pu_bacteria | 2894652903 | 2894654142 | 309 |
| 60 | iso_pu_bacteria | 2904578770 | 2904580407 | 309 |
| 61 | iso_pu_bacteria | 2919119836 | 2919119918 | 309 |
| 62 | 3300003320 | rootH2_10006377 | rootH2_1000637740 | 310 |
| 63 | 3300021377 | Ga0213874_10001553 | Ga0213874_100015533 | 310 |
| 64 | 3300031711 | Ga0265314_10165398 | Ga0265314_101653981 | 310 |
| 65 | 3300049580 | Ga0501046_0000035 | Ga0501046_0000035_47428_48459 | 310 |
| 66 | 3300049823 | Ga0501044_0247551 | Ga0501044_0247551_118_1065 | 310 |
| 67 | iso_pu_bacteria | 2885429604 | 2885429969 | 310 |
| 68 | iso_pu_bacteria | 2928027323 | 2928027665 | 310 |
| 69 | iso_pu_bacteria | 2984555340 | 2984558041 | 310 |
| 70 | iso_pu_bacteria | 2984564862 | 2984567591 | 310 |
| 71 | iso_pu_bacteria | 2993356040 | 2993358644 | 310 |
| 72 | 3300005437 | Ga0070710_10181264 | Ga0070710_101812641 | 311 |
| 73 | 3300005457 | Ga0070662_100182915 | Ga0070662_1001829152 | 311 |
| 74 | 3300005458 | Ga0070681_10099789 | Ga0070681_100997892 | 311 |
| 75 | 3300005458 | Ga0070681_10145238 | Ga0070681_101452382 | 311 |
| 76 | 3300005578 | Ga0068854_100063265 | Ga0068854_1000632653 | 311 |
| 77 | 3300005937 | Ga0081455_10000149 | Ga0081455_100001497 | 311 |
| 78 | 3300014968 | Ga0157379_10473095 | Ga0157379_104730951 | 311 |
| 79 | 3300024225 | Ga0224572_1003951 | Ga0224572_10039513 | 311 |
| 80 | 3300024225 | Ga0224572_1012161 | Ga0224572_10121612 | 311 |
| 81 | 3300024227 | Ga0228598_1009795 | Ga0228598_10097951 | 311 |
| 82 | 3300026041 | Ga0207639_10029891 | Ga0207639_100298912 | 311 |
| 83 | 3300031548 | Ga0307408_100189182 | Ga0307408_1001891822 | 311 |
| 84 | 3300031731 | Ga0307405_10042115 | Ga0307405_100421152 | 311 |
| 85 | 3300031911 | Ga0307412_10020774 | Ga0307412_100207742 | 311 |
| 86 | 3300031995 | Ga0307409_100052374 | Ga0307409_1000523743 | 311 |
| 87 | 3300032002 | Ga0307416_100044905 | Ga0307416_1000449052 | 311 |
| 88 | 3300036401 | Ga0373937_0073318 | Ga0373937_0073318_354_1310 | 311 |
| 89 | 3300037312 | Ga0395899_0015917 | Ga0395899_0015917_406_1380 | 311 |
| 90 | 3300037418 | Ga0395900_0004045 | Ga0395900_0004045_7709_8683 | 311 |
| 91 | 3300037418 | Ga0395900_0015042 | Ga0395900_0015042_6428_7402 | 311 |
| 92 | 3300037466 | Ga0395898_0012308 | Ga0395898_0012308_6267_7241 | 311 |
| 93 | 3300037466 | Ga0395898_0057536 | Ga0395898_0057536_1568_2542 | 311 |
| 94 | 3300049568 | Ga0501031_0060240 | Ga0501031_0060240_1360_2307 | 311 |
| 95 | 3300049571 | Ga0501034_0006988 | Ga0501034_0006988_1585_2532 | 311 |
| 96 | 3300049571 | Ga0501034_0199574 | Ga0501034_0199574_24_971 | 311 |
| 97 | 3300049574 | Ga0501038_0000010 | Ga0501038_0000010_174761_175708 | 311 |
| 98 | 3300049686 | Ga0501257_006979 | Ga0501257_006979_789_1742 | 311 |
| 99 | 3300049823 | Ga0501044_0193349 | Ga0501044_0193349_905_1852 | 311 |
| 100 | 3300053108 | Ga0500562_000173 | Ga0500562_000173_8500_9456 | 311 |
| 101 | iso_pu_bacteria | 2841911363 | 2841914659 | 311 |
| 102 | 3300003203 | JGI25406J46586_10002125 | JGI25406J46586_1000212512 | 312 |
| 103 | 3300003203 | JGI25406J46586_10004558 | JGI25406J46586_100045584 | 312 |
| 104 | 3300005327 | Ga0070658_10001363 | Ga0070658_1000136320 | 312 |
| 105 | 3300005334 | Ga0068869_100086347 | Ga0068869_1000863471 | 312 |
| 106 | 3300005336 | Ga0070680_100012364 | Ga0070680_1000123647 | 312 |
| 107 | 3300005336 | Ga0070680_100217605 | Ga0070680_1002176052 | 312 |
| 108 | 3300005353 | Ga0070669_100014161 | Ga0070669_1000141617 | 312 |
| 109 | 3300005355 | Ga0070671_100019489 | Ga0070671_1000194892 | 312 |
| 110 | 3300005355 | Ga0070671_100140493 | Ga0070671_1001404932 | 312 |
| 111 | 3300005367 | Ga0070667_100452247 | Ga0070667_1004522471 | 312 |
| 112 | 3300005434 | Ga0070709_10045104 | Ga0070709_100451044 | 312 |
| 113 | 3300005434 | Ga0070709_10073352 | Ga0070709_100733523 | 312 |
| 114 | 3300005434 | Ga0070709_10213562 | Ga0070709_102135622 | 312 |
| 115 | 3300005435 | Ga0070714_100001555 | Ga0070714_10000155514 | 312 |
| 116 | 3300005436 | Ga0070713_100066889 | Ga0070713_1000668892 | 312 |
| 117 | 3300005436 | Ga0070713_100105035 | Ga0070713_1001050353 | 312 |
| 118 | 3300005436 | Ga0070713_100278926 | Ga0070713_1002789262 | 312 |
| 119 | 3300005439 | Ga0070711_100033505 | Ga0070711_1000335055 | 312 |
| 120 | 3300005439 | Ga0070711_100106035 | Ga0070711_1001060351 | 312 |
| 121 | 3300005439 | Ga0070711_100115903 | Ga0070711_1001159032 | 312 |
| 122 | 3300005440 | Ga0070705_100000255 | Ga0070705_10000025529 | 312 |
| 123 | 3300005441 | Ga0070700_100000791 | Ga0070700_10000079112 | 312 |
| 124 | 3300005445 | Ga0070708_100146096 | Ga0070708_1001460962 | 312 |
| 125 | 3300005456 | Ga0070678_100022241 | Ga0070678_1000222412 | 312 |
| 126 | 3300005458 | Ga0070681_10013587 | Ga0070681_100135872 | 312 |
| 127 | 3300005458 | Ga0070681_10033804 | Ga0070681_100338046 | 312 |
| 128 | 3300005458 | Ga0070681_10292648 | Ga0070681_102926482 | 312 |
| 129 | 3300005467 | Ga0070706_100137911 | Ga0070706_1001379112 | 312 |
| 130 | 3300005468 | Ga0070707_100061943 | Ga0070707_1000619432 | 312 |
| 131 | 3300005471 | Ga0070698_100209583 | Ga0070698_1002095832 | 312 |
| 132 | 3300005518 | Ga0070699_100001711 | Ga0070699_10000171119 | 312 |
| 133 | 3300005518 | Ga0070699_100022541 | Ga0070699_1000225415 | 312 |
| 134 | 3300005530 | Ga0070679_100008607 | Ga0070679_1000086073 | 312 |
| 135 | 3300005530 | Ga0070679_100049485 | Ga0070679_1000494851 | 312 |
| 136 | 3300005535 | Ga0070684_100068767 | Ga0070684_1000687672 | 312 |
| 137 | 3300005536 | Ga0070697_100003111 | Ga0070697_1000031112 | 312 |
| 138 | 3300005536 | Ga0070697_100112469 | Ga0070697_1001124692 | 312 |
| 139 | 3300005545 | Ga0070695_100000220 | Ga0070695_10000022012 | 312 |
| 140 | 3300005545 | Ga0070695_100112590 | Ga0070695_1001125902 | 312 |
| 141 | 3300005546 | Ga0070696_100000497 | Ga0070696_10000049715 | 312 |
| 142 | 3300005546 | Ga0070696_100085113 | Ga0070696_1000851131 | 312 |
| 143 | 3300005547 | Ga0070693_100039630 | Ga0070693_1000396301 | 312 |
| 144 | 3300005548 | Ga0070665_100008964 | Ga0070665_10000896412 | 312 |
| 145 | 3300005548 | Ga0070665_100049422 | Ga0070665_1000494225 | 312 |
| 146 | 3300005549 | Ga0070704_100008113 | Ga0070704_1000081135 | 312 |
| 147 | 3300005563 | Ga0068855_100533468 | Ga0068855_1005334682 | 312 |
| 148 | 3300005577 | Ga0068857_100047135 | Ga0068857_1000471353 | 312 |
| 149 | 3300005577 | Ga0068857_100092376 | Ga0068857_1000923762 | 312 |
| 150 | 3300005614 | Ga0068856_100382471 | Ga0068856_1003824712 | 312 |
| 151 | 3300005617 | Ga0068859_100102251 | Ga0068859_1001022513 | 312 |
| 152 | 3300005842 | Ga0068858_100302282 | Ga0068858_1003022821 | 312 |
| 153 | 3300005842 | Ga0068858_100357961 | Ga0068858_1003579612 | 312 |
| 154 | 3300005843 | Ga0068860_100121793 | Ga0068860_1001217931 | 312 |
| 155 | 3300005844 | Ga0068862_100000435 | Ga0068862_10000043522 | 312 |
| 156 | 3300005937 | Ga0081455_10000211 | Ga0081455_1000021112 | 312 |
| 157 | 3300005937 | Ga0081455_10002000 | Ga0081455_1000200012 | 312 |
| 158 | 3300005981 | Ga0081538_10006504 | Ga0081538_100065046 | 312 |
| 159 | 3300005985 | Ga0081539_10000618 | Ga0081539_1000061863 | 312 |
| 160 | 3300005985 | Ga0081539_10000954 | Ga0081539_1000095414 | 312 |
| 161 | 3300005985 | Ga0081539_10006940 | Ga0081539_100069409 | 312 |
| 162 | 3300005985 | Ga0081539_10010399 | Ga0081539_100103994 | 312 |
| 163 | 3300006028 | Ga0070717_10117189 | Ga0070717_101171893 | 312 |
| 164 | 3300006038 | Ga0075365_10031254 | Ga0075365_100312542 | 312 |
| 165 | 3300006038 | Ga0075365_10099284 | Ga0075365_100992841 | 312 |
| 166 | 3300006048 | Ga0075363_100031931 | Ga0075363_1000319313 | 312 |
| 167 | 3300006051 | Ga0075364_10030585 | Ga0075364_100305853 | 312 |
| 168 | 3300006051 | Ga0075364_10163234 | Ga0075364_101632342 | 312 |
| 169 | 3300006175 | Ga0070712_100003438 | Ga0070712_10000343815 | 312 |
| 170 | 3300006175 | Ga0070712_100018646 | Ga0070712_1000186462 | 312 |
| 171 | 3300006175 | Ga0070712_100048413 | Ga0070712_1000484133 | 312 |
| 172 | 3300006175 | Ga0070712_100096860 | Ga0070712_1000968602 | 312 |
| 173 | 3300006178 | Ga0075367_10030349 | Ga0075367_100303494 | 312 |
| 174 | 3300006195 | Ga0075366_10010922 | Ga0075366_100109226 | 312 |
| 175 | 3300006195 | Ga0075366_10026437 | Ga0075366_100264371 | 312 |
| 176 | 3300006931 | Ga0097620_100102244 | Ga0097620_1001022441 | 312 |
| 177 | 3300007788 | Ga0099795_10014147 | Ga0099795_100141472 | 312 |
| 178 | 3300009093 | Ga0105240_10076343 | Ga0105240_100763433 | 312 |
| 179 | 3300009093 | Ga0105240_10388079 | Ga0105240_103880791 | 312 |
| 180 | 3300009094 | Ga0111539_10003408 | Ga0111539_1000340824 | 312 |
| 181 | 3300009094 | Ga0111539_10600315 | Ga0111539_106003151 | 312 |
| 182 | 3300009148 | Ga0105243_10246979 | Ga0105243_102469791 | 312 |
| 183 | 3300013104 | Ga0157370_10117220 | Ga0157370_101172201 | 312 |
| 184 | 3300013104 | Ga0157370_10117302 | Ga0157370_101173022 | 312 |
| 185 | 3300013104 | Ga0157370_10156819 | Ga0157370_101568192 | 312 |
| 186 | 3300013104 | Ga0157370_10469073 | Ga0157370_104690731 | 312 |
| 187 | 3300013105 | Ga0157369_10023244 | Ga0157369_100232444 | 312 |
| 188 | 3300013105 | Ga0157369_10083966 | Ga0157369_100839663 | 312 |
| 189 | 3300013296 | Ga0157374_10332038 | Ga0157374_103320382 | 312 |
| 190 | 3300020081 | Ga0206354_11027225 | Ga0206354_110272252 | 312 |
| 191 | 3300021358 | Ga0213873_10056291 | Ga0213873_100562911 | 312 |
| 192 | 3300021361 | Ga0213872_10088358 | Ga0213872_100883581 | 312 |
| 193 | 3300021388 | Ga0213875_10000674 | Ga0213875_1000067421 | 312 |
| 194 | 3300021388 | Ga0213875_10004650 | Ga0213875_100046504 | 312 |
| 195 | 3300021388 | Ga0213875_10004811 | Ga0213875_100048117 | 312 |
| 196 | 3300021388 | Ga0213875_10007532 | Ga0213875_100075322 | 312 |
| 197 | 3300021388 | Ga0213875_10020458 | Ga0213875_100204585 | 312 |
| 198 | 3300021441 | Ga0213871_10005226 | Ga0213871_100052263 | 312 |
| 199 | 3300021441 | Ga0213871_10018486 | Ga0213871_100184862 | 312 |
| 200 | 3300025906 | Ga0207699_10039135 | Ga0207699_100391353 | 312 |
| 201 | 3300025906 | Ga0207699_10077590 | Ga0207699_100775903 | 312 |
| 202 | 3300025909 | Ga0207705_10288154 | Ga0207705_102881542 | 312 |
| 203 | 3300025910 | Ga0207684_10075405 | Ga0207684_100754052 | 312 |
| 204 | 3300025910 | Ga0207684_10088784 | Ga0207684_100887842 | 312 |
| 205 | 3300025910 | Ga0207684_10097405 | Ga0207684_100974052 | 312 |
| 206 | 3300025910 | Ga0207684_10430784 | Ga0207684_104307841 | 312 |
| 207 | 3300025911 | Ga0207654_10174227 | Ga0207654_101742272 | 312 |
| 208 | 3300025912 | Ga0207707_10003695 | Ga0207707_100036953 | 312 |
| 209 | 3300025912 | Ga0207707_10005561 | Ga0207707_1000556113 | 312 |
| 210 | 3300025912 | Ga0207707_10320517 | Ga0207707_103205172 | 312 |
| 211 | 3300025913 | Ga0207695_10149130 | Ga0207695_101491303 | 312 |
| 212 | 3300025913 | Ga0207695_10262908 | Ga0207695_102629081 | 312 |
| 213 | 3300025914 | Ga0207671_10359018 | Ga0207671_103590182 | 312 |
| 214 | 3300025915 | Ga0207693_10001492 | Ga0207693_100014924 | 312 |
| 215 | 3300025915 | Ga0207693_10016004 | Ga0207693_100160044 | 312 |
| 216 | 3300025915 | Ga0207693_10018927 | Ga0207693_100189276 | 312 |
| 217 | 3300025915 | Ga0207693_10019783 | Ga0207693_100197835 | 312 |
| 218 | 3300025915 | Ga0207693_10146564 | Ga0207693_101465642 | 312 |
| 219 | 3300025916 | Ga0207663_10025072 | Ga0207663_100250722 | 312 |
| 220 | 3300025917 | Ga0207660_10051470 | Ga0207660_100514703 | 312 |
| 221 | 3300025917 | Ga0207660_10178237 | Ga0207660_101782372 | 312 |
| 222 | 3300025919 | Ga0207657_10050184 | Ga0207657_100501842 | 312 |
| 223 | 3300025921 | Ga0207652_10062747 | Ga0207652_100627472 | 312 |
| 224 | 3300025922 | Ga0207646_10022399 | Ga0207646_100223994 | 312 |
| 225 | 3300025928 | Ga0207700_10175549 | Ga0207700_101755492 | 312 |
| 226 | 3300025929 | Ga0207664_10034053 | Ga0207664_100340532 | 312 |
| 227 | 3300025931 | Ga0207644_10105586 | Ga0207644_101055862 | 312 |
| 228 | 3300025942 | Ga0207689_10102631 | Ga0207689_101026312 | 312 |
| 229 | 3300025944 | Ga0207661_10090760 | Ga0207661_100907602 | 312 |
| 230 | 3300025944 | Ga0207661_10216926 | Ga0207661_102169262 | 312 |
| 231 | 3300025945 | Ga0207679_10153289 | Ga0207679_101532892 | 312 |
| 232 | 3300025961 | Ga0207712_10005400 | Ga0207712_100054004 | 312 |
| 233 | 3300026035 | Ga0207703_10244799 | Ga0207703_102447992 | 312 |
| 234 | 3300026035 | Ga0207703_10344945 | Ga0207703_103449452 | 312 |
| 235 | 3300026075 | Ga0207708_10000384 | Ga0207708_1000038417 | 312 |
| 236 | 3300026078 | Ga0207702_10330786 | Ga0207702_103307862 | 312 |
| 237 | 3300026078 | Ga0207702_10451192 | Ga0207702_104511922 | 312 |
| 238 | 3300026095 | Ga0207676_10155364 | Ga0207676_101553641 | 312 |
| 239 | 3300026116 | Ga0207674_10015341 | Ga0207674_100153416 | 312 |
| 240 | 3300026116 | Ga0207674_10055630 | Ga0207674_100556302 | 312 |
| 241 | 3300026118 | Ga0207675_100619089 | Ga0207675_1006190891 | 312 |
| 242 | 3300026121 | Ga0207683_10028724 | Ga0207683_100287245 | 312 |
| 243 | 3300027907 | Ga0207428_10000203 | Ga0207428_1000020346 | 312 |
| 244 | 3300028379 | Ga0268266_10009292 | Ga0268266_100092922 | 312 |
| 245 | 3300028379 | Ga0268266_10106600 | Ga0268266_101066002 | 312 |
| 246 | 3300028380 | Ga0268265_10000793 | Ga0268265_1000079316 | 312 |
| 247 | 3300028381 | Ga0268264_10002765 | Ga0268264_100027651 | 312 |
| 248 | 3300028573 | Ga0265334_10002804 | Ga0265334_100028047 | 312 |
| 249 | 3300028800 | Ga0265338_10020732 | Ga0265338_100207326 | 312 |
| 250 | 3300031247 | Ga0265340_10014313 | Ga0265340_100143133 | 312 |
| 251 | 3300031712 | Ga0265342_10086638 | Ga0265342_100866382 | 312 |
| 252 | 3300032004 | Ga0307414_10208203 | Ga0307414_102082032 | 312 |
| 253 | 3300035083 | Ga0373926_0014359 | Ga0373926_0014359_1278_2234 | 312 |
| 254 | 3300035118 | Ga0373954_0008633 | Ga0373954_0008633_2878_3834 | 312 |
| 255 | 3300035119 | Ga0373956_0003222 | Ga0373956_0003222_4885_5841 | 312 |
| 256 | 3300035120 | Ga0373957_0090602 | Ga0373957_0090602_236_1192 | 312 |
| 257 | 3300035172 | Ga0373955_0036945 | Ga0373955_0036945_304_1260 | 312 |
| 258 | 3300035172 | Ga0373955_0160865 | Ga0373955_0160865_225_1181 | 312 |
| 259 | 3300035410 | Ga0373924_0030474 | Ga0373924_0030474_703_1659 | 312 |
| 260 | 3300035691 | Ga0373931_0043536 | Ga0373931_0043536_913_1866 | 312 |
| 261 | 3300035691 | Ga0373931_0117728 | Ga0373931_0117728_416_1372 | 312 |
| 262 | 3300035692 | Ga0373935_0093528 | Ga0373935_0093528_648_1604 | 312 |
| 263 | 3300035692 | Ga0373935_0097538 | Ga0373935_0097538_44_997 | 312 |
| 264 | 3300035692 | Ga0373935_0126777 | Ga0373935_0126777_251_1204 | 312 |
| 265 | 3300035692 | Ga0373935_0152662 | Ga0373935_0152662_131_1087 | 312 |
| 266 | 3300035695 | Ga0373927_0147041 | Ga0373927_0147041_309_1265 | 312 |
| 267 | 3300035695 | Ga0373927_0177722 | Ga0373927_0177722_251_1204 | 312 |
| 268 | 3300035724 | Ga0373933_0017737 | Ga0373933_0017737_755_1711 | 312 |
| 269 | 3300035724 | Ga0373933_0039569 | Ga0373933_0039569_1679_2635 | 312 |
| 270 | 3300035724 | Ga0373933_0125479 | Ga0373933_0125479_497_1450 | 312 |
| 271 | 3300035725 | Ga0373947_0182087 | Ga0373947_0182087_353_1324 | 312 |
| 272 | 3300035725 | Ga0373947_0200265 | Ga0373947_0200265_50_1006 | 312 |
| 273 | 3300036401 | Ga0373937_0003891 | Ga0373937_0003891_1844_2800 | 312 |
| 274 | 3300036401 | Ga0373937_0006693 | Ga0373937_0006693_3036_3992 | 312 |
| 275 | 3300036401 | Ga0373937_0014147 | Ga0373937_0014147_1225_2181 | 312 |
| 276 | 3300036401 | Ga0373937_0020900 | Ga0373937_0020900_4139_5092 | 312 |
| 277 | 3300036401 | Ga0373937_0091428 | Ga0373937_0091428_1165_2121 | 312 |
| 278 | 3300036401 | Ga0373937_0103858 | Ga0373937_0103858_1062_2018 | 312 |
| 279 | 3300036401 | Ga0373937_0335086 | Ga0373937_0335086_248_1201 | 312 |
| 280 | 3300037068 | Ga0373925_0006090 | Ga0373925_0006090_3805_4761 | 312 |
| 281 | 3300037068 | Ga0373925_0053155 | Ga0373925_0053155_364_1320 | 312 |
| 282 | 3300037312 | Ga0395899_0103687 | Ga0395899_0103687_925_1878 | 312 |
| 283 | 3300037418 | Ga0395900_0004704 | Ga0395900_0004704_9061_10014 | 312 |
| 284 | 3300037418 | Ga0395900_0026720 | Ga0395900_0026720_2345_3298 | 312 |
| 285 | 3300037418 | Ga0395900_0135244 | Ga0395900_0135244_281_1234 | 312 |
| 286 | 3300037466 | Ga0395898_0015527 | Ga0395898_0015527_6484_7437 | 312 |
| 287 | 3300037471 | Ga0395905_0030798 | Ga0395905_0030798_499_1452 | 312 |
| 288 | 3300037853 | Ga0436364_0315170 | Ga0436364_0315170_1385_2341 | 312 |
| 289 | 3300037853 | Ga0436364_0981594 | Ga0436364_0981594_6405_7361 | 312 |
| 290 | 3300037853 | Ga0436364_1094905 | Ga0436364_1094905_7665_8660 | 312 |
| 291 | 3300037853 | Ga0436364_1123333 | Ga0436364_1123333_965_1921 | 312 |
| 292 | 3300037853 | Ga0436364_1183619 | Ga0436364_1183619_8274_9230 | 312 |
| 293 | 3300037853 | Ga0436364_1316620 | Ga0436364_1316620_26_1000 | 312 |
| 294 | 3300038443 | Ga0395901_0033897 | Ga0395901_0033897_3731_4684 | 312 |
| 295 | 3300038443 | Ga0395901_0062128 | Ga0395901_0062128_2650_3603 | 312 |
| 296 | 3300039437 | Ga0436365_0385120 | Ga0436365_0385120_507_1463 | 312 |
| 297 | 3300039437 | Ga0436365_0452497 | Ga0436365_0452497_1012_1965 | 312 |
| 298 | 3300039437 | Ga0436365_0821816 | Ga0436365_0821816_77_1030 | 312 |
| 299 | 3300039437 | Ga0436365_1747331 | Ga0436365_1747331_79_1032 | 312 |
| 300 | 3300039438 | Ga0436360_0189891 | Ga0436360_0189891_142_1098 | 312 |
| 301 | 3300039438 | Ga0436360_0321394 | Ga0436360_0321394_336_1292 | 312 |
| 302 | 3300039438 | Ga0436360_0776057 | Ga0436360_0776057_224_1180 | 312 |
| 303 | 3300039438 | Ga0436360_1119660 | Ga0436360_1119660_191_1147 | 312 |
| 304 | 3300039438 | Ga0436360_1203410 | Ga0436360_1203410_9618_10571 | 312 |
| 305 | 3300039438 | Ga0436360_1333994 | Ga0436360_1333994_1589_2545 | 312 |
| 306 | 3300039447 | Ga0436361_0007600 | Ga0436361_0007600_1131_2084 | 312 |
| 307 | 3300039447 | Ga0436361_0216543 | Ga0436361_0216543_42_998 | 312 |
| 308 | 3300039450 | Ga0436363_0055727 | Ga0436363_0055727_306_1262 | 312 |
| 309 | 3300039450 | Ga0436363_0792304 | Ga0436363_0792304_889_1845 | 312 |
| 310 | 3300039450 | Ga0436363_1377919 | Ga0436363_1377919_186_1142 | 312 |
| 311 | 3300039453 | Ga0436362_0692635 | Ga0436362_0692635_167_1123 | 312 |
| 312 | 3300039453 | Ga0436362_0958195 | Ga0436362_0958195_2747_3703 | 312 |
| 313 | 3300042001 | Ga0439441_006052 | Ga0439441_006052_505_1458 | 312 |
| 314 | 3300044694 | Ga0466963_0088879 | Ga0466963_0088879_325_1278 | 312 |
| 315 | 3300044842 | Ga0466957_0131477 | Ga0466957_0131477_587_1540 | 312 |
| 316 | 3300045976 | Ga0466967_0104109 | Ga0466967_0104109_503_1531 | 312 |
| 317 | 3300045976 | Ga0466967_0174449 | Ga0466967_0174449_341_1291 | 312 |
| 318 | 3300046462 | Ga0495651_0020950 | Ga0495651_0020950_544_1500 | 312 |
| 319 | 3300046462 | Ga0495651_0071936 | Ga0495651_0071936_1305_2261 | 312 |
| 320 | 3300046477 | Ga0495664_0005148 | Ga0495664_0005148_4262_5218 | 312 |
| 321 | 3300046511 | Ga0495608_0002138 | Ga0495608_0002138_7032_7988 | 312 |
| 322 | 3300046511 | Ga0495608_0043182 | Ga0495608_0043182_497_1453 | 312 |
| 323 | 3300046516 | Ga0495628_0052855 | Ga0495628_0052855_1392_2348 | 312 |
| 324 | 3300046516 | Ga0495628_0129636 | Ga0495628_0129636_659_1615 | 312 |
| 325 | 3300046529 | Ga0495652_0256481 | Ga0495652_0256481_282_1238 | 312 |
| 326 | 3300046533 | Ga0495640_0056264 | Ga0495640_0056264_1381_2337 | 312 |
| 327 | 3300046533 | Ga0495640_0170358 | Ga0495640_0170358_244_1200 | 312 |
| 328 | 3300046536 | Ga0495587_0071295 | Ga0495587_0071295_13_969 | 312 |
| 329 | 3300046543 | Ga0495645_0001435 | Ga0495645_0001435_10659_11615 | 312 |
| 330 | 3300046559 | Ga0495667_0029141 | Ga0495667_0029141_1197_2153 | 312 |
| 331 | 3300046663 | Ga0495635_0040769 | Ga0495635_0040769_1942_2898 | 312 |
| 332 | 3300046679 | Ga0495623_0040784 | Ga0495623_0040784_542_1498 | 312 |
| 333 | 3300046679 | Ga0495623_0170245 | Ga0495623_0170245_70_1026 | 312 |
| 334 | 3300047319 | Ga0495674_0043205 | Ga0495674_0043205_1810_2766 | 312 |
| 335 | 3300047319 | Ga0495674_0076822 | Ga0495674_0076822_790_1746 | 312 |
| 336 | 3300047444 | Ga0495675_0018021 | Ga0495675_0018021_2644_3600 | 312 |
| 337 | 3300047471 | Ga0495684_0074731 | Ga0495684_0074731_17_973 | 312 |
| 338 | 3300047472 | Ga0495686_0066427 | Ga0495686_0066427_370_1320 | 312 |
| 339 | 3300048088 | Ga0495602_0001350 | Ga0495602_0001350_8835_9791 | 312 |
| 340 | 3300048904 | Ga0496101_0283930 | Ga0496101_0283930_49_1020 | 312 |
| 341 | 3300048905 | Ga0496102_0008864 | Ga0496102_0008864_5263_6234 | 312 |
| 342 | 3300048906 | Ga0496103_0002167 | Ga0496103_0002167_4297_5268 | 312 |
| 343 | 3300048907 | Ga0496104_0165598 | Ga0496104_0165598_676_1647 | 312 |
| 344 | 3300048909 | Ga0496106_0000674 | Ga0496106_0000674_2195_3166 | 312 |
| 345 | 3300048910 | Ga0496107_0002521 | Ga0496107_0002521_5491_6462 | 312 |
| 346 | 3300048911 | Ga0496108_0108637 | Ga0496108_0108637_1189_2160 | 312 |
| 347 | 3300048915 | Ga0496112_0339454 | Ga0496112_0339454_345_1298 | 312 |
| 348 | 3300048915 | Ga0496112_0432041 | Ga0496112_0432041_65_1021 | 312 |
| 349 | 3300048916 | Ga0496113_0246116 | Ga0496113_0246116_376_1347 | 312 |
| 350 | 3300048918 | Ga0496115_0096158 | Ga0496115_0096158_937_1887 | 312 |
| 351 | 3300048927 | Ga0496124_0232116 | Ga0496124_0232116_37_987 | 312 |
| 352 | 3300048928 | Ga0496125_0009891 | Ga0496125_0009891_4791_5741 | 312 |
| 353 | 3300048929 | Ga0496126_0091139 | Ga0496126_0091139_1624_2577 | 312 |
| 354 | 3300049568 | Ga0501031_0014292 | Ga0501031_0014292_1041_1985 | 312 |
| 355 | 3300049569 | Ga0501032_0011626 | Ga0501032_0011626_993_1937 | 312 |
| 356 | 3300049570 | Ga0501033_0000385 | Ga0501033_0000385_34391_35335 | 312 |
| 357 | 3300049570 | Ga0501033_0003573 | Ga0501033_0003573_6765_7709 | 312 |
| 358 | 3300049570 | Ga0501033_0095068 | Ga0501033_0095068_658_1602 | 312 |
| 359 | 3300049570 | Ga0501033_0165665 | Ga0501033_0165665_445_1389 | 312 |
| 360 | 3300049571 | Ga0501034_0001717 | Ga0501034_0001717_19438_20391 | 312 |
| 361 | 3300049571 | Ga0501034_0009108 | Ga0501034_0009108_6542_7495 | 312 |
| 362 | 3300049571 | Ga0501034_0054483 | Ga0501034_0054483_254_1213 | 312 |
| 363 | 3300049571 | Ga0501034_0193315 | Ga0501034_0193315_144_1088 | 312 |
| 364 | 3300049571 | Ga0501034_0237408 | Ga0501034_0237408_767_1720 | 312 |
| 365 | 3300049572 | Ga0501036_0177235 | Ga0501036_0177235_450_1394 | 312 |
| 366 | 3300049573 | Ga0501037_0000049 | Ga0501037_0000049_103157_104101 | 312 |
| 367 | 3300049573 | Ga0501037_0008002 | Ga0501037_0008002_1947_2903 | 312 |
| 368 | 3300049573 | Ga0501037_0124211 | Ga0501037_0124211_121_1065 | 312 |
| 369 | 3300049574 | Ga0501038_0194151 | Ga0501038_0194151_280_1224 | 312 |
| 370 | 3300049579 | Ga0501043_0000006 | Ga0501043_0000006_130198_131142 | 312 |
| 371 | 3300049579 | Ga0501043_0049522 | Ga0501043_0049522_2111_3055 | 312 |
| 372 | 3300049581 | Ga0501047_0013059 | Ga0501047_0013059_4392_5351 | 312 |
| 373 | 3300049581 | Ga0501047_0092119 | Ga0501047_0092119_544_1488 | 312 |
| 374 | 3300049581 | Ga0501047_0505445 | Ga0501047_0505445_61_1014 | 312 |
| 375 | 3300049582 | Ga0501048_0098135 | Ga0501048_0098135_348_1307 | 312 |
| 376 | 3300049584 | Ga0501068_0010765 | Ga0501068_0010765_1767_2711 | 312 |
| 377 | 3300049585 | Ga0501069_0000141 | Ga0501069_0000141_20061_21005 | 312 |
| 378 | 3300049586 | Ga0501070_0000081 | Ga0501070_0000081_30040_30984 | 312 |
| 379 | 3300049586 | Ga0501070_0000254 | Ga0501070_0000254_26680_27624 | 312 |
| 380 | 3300049586 | Ga0501070_0012129 | Ga0501070_0012129_1017_1970 | 312 |
| 381 | 3300049586 | Ga0501070_0023248 | Ga0501070_0023248_3119_4063 | 312 |
| 382 | 3300049586 | Ga0501070_0128281 | Ga0501070_0128281_753_1697 | 312 |
| 383 | 3300049586 | Ga0501070_0361742 | Ga0501070_0361742_70_1029 | 312 |
| 384 | 3300049587 | Ga0501071_0067976 | Ga0501071_0067976_1212_2156 | 312 |
| 385 | 3300049587 | Ga0501071_0081436 | Ga0501071_0081436_1167_2126 | 312 |
| 386 | 3300049588 | Ga0501072_0122482 | Ga0501072_0122482_972_1928 | 312 |
| 387 | 3300049588 | Ga0501072_0135142 | Ga0501072_0135142_44_1003 | 312 |
| 388 | 3300049589 | Ga0501073_0015833 | Ga0501073_0015833_1905_2849 | 312 |
| 389 | 3300049589 | Ga0501073_0024481 | Ga0501073_0024481_2225_3169 | 312 |
| 390 | 3300049589 | Ga0501073_0368523 | Ga0501073_0368523_29_973 | 312 |
| 391 | 3300049590 | Ga0501074_0000011 | Ga0501074_0000011_48455_49399 | 312 |
| 392 | 3300049590 | Ga0501074_0018814 | Ga0501074_0018814_799_1743 | 312 |
| 393 | 3300049592 | Ga0501076_0032561 | Ga0501076_0032561_728_1687 | 312 |
| 394 | 3300049741 | Ga0501079_0046635 | Ga0501079_0046635_954_1913 | 312 |
| 395 | 3300049742 | Ga0501080_0001944 | Ga0501080_0001944_9915_10859 | 312 |
| 396 | 3300049742 | Ga0501080_0002670 | Ga0501080_0002670_8120_9064 | 312 |
| 397 | 3300049742 | Ga0501080_0095249 | Ga0501080_0095249_1795_2739 | 312 |
| 398 | 3300049743 | Ga0501081_0048889 | Ga0501081_0048889_282_1241 | 312 |
| 399 | 3300049744 | Ga0501083_0000338 | Ga0501083_0000338_8893_9837 | 312 |
| 400 | 3300049822 | Ga0501035_0000068 | Ga0501035_0000068_21041_21985 | 312 |
| 401 | 3300049822 | Ga0501035_0000695 | Ga0501035_0000695_28480_29424 | 312 |
| 402 | 3300049822 | Ga0501035_0004271 | Ga0501035_0004271_2206_3150 | 312 |
| 403 | 3300049822 | Ga0501035_0095699 | Ga0501035_0095699_1075_2031 | 312 |
| 404 | 3300049822 | Ga0501035_0099572 | Ga0501035_0099572_187_1131 | 312 |
| 405 | 3300049822 | Ga0501035_0147032 | Ga0501035_0147032_1038_1982 | 312 |
| 406 | 3300049823 | Ga0501044_0000082 | Ga0501044_0000082_103284_104228 | 312 |
| 407 | 3300049823 | Ga0501044_0013515 | Ga0501044_0013515_3761_4714 | 312 |
| 408 | 3300049823 | Ga0501044_0019534 | Ga0501044_0019534_1053_1997 | 312 |
| 409 | 3300049823 | Ga0501044_0033513 | Ga0501044_0033513_2815_3759 | 312 |
| 410 | 3300049823 | Ga0501044_0042427 | Ga0501044_0042427_3774_4718 | 312 |
| 411 | 3300049823 | Ga0501044_0059040 | Ga0501044_0059040_2362_3318 | 312 |
| 412 | 3300049823 | Ga0501044_0081092 | Ga0501044_0081092_214_1173 | 312 |
| 413 | 3300049823 | Ga0501044_0125060 | Ga0501044_0125060_1322_2266 | 312 |
| 414 | 3300049824 | Ga0501045_0371486 | Ga0501045_0371486_28_987 | 312 |
| 415 | 3300050490 | nmdc:mga03n38_54946_c1 | nmdc:mga03n38_54946_c1_816_1769 | 312 |
| 416 | 3300050491 | nmdc:mga00v17_148556_c1 | nmdc:mga00v17_148556_c1_44_997 | 312 |
| 417 | 3300050492 | nmdc:mga0yw44_50038_c1 | nmdc:mga0yw44_50038_c1_1539_2489 | 312 |
| 418 | 3300050493 | nmdc:mga0k408_88267_c1 | nmdc:mga0k408_88267_c1_161_1114 | 312 |
| 419 | 3300050494 | nmdc:mga06z11_40694_c1 | nmdc:mga06z11_40694_c1_1038_1991 | 312 |
| 420 | 3300050494 | nmdc:mga06z11_65058_c1 | nmdc:mga06z11_65058_c1_527_1480 | 312 |
| 421 | 3300050511 | nmdc:mga08y16_82_c1 | nmdc:mga08y16_82_c1_69383_70342 | 312 |
| 422 | 3300050516 | nmdc:mga0sz30_357_c1 | nmdc:mga0sz30_357_c1_2080_3033 | 312 |
| 423 | 3300053077 | Ga0495601_0000911 | Ga0495601_0000911_11017_11973 | 312 |
| 424 | 3300053077 | Ga0495601_0046582 | Ga0495601_0046582_1127_2083 | 312 |
| 425 | 3300053078 | Ga0495612_0000639 | Ga0495612_0000639_9409_10365 | 312 |
| 426 | 3300053096 | Ga0500641_0000277 | Ga0500641_0000277_11938_12891 | 312 |
| 427 | 3300053151 | Ga0500604_0002073 | Ga0500604_0002073_2449_3408 | 312 |
| 428 | 3300053158 | Ga0500627_0046749 | Ga0500627_0046749_348_1298 | 312 |
| 429 | 3300053733 | Ga0500552_003131 | Ga0500552_003131_41_994 | 312 |
| 430 | 3300054114 | Ga0501084_0071402 | Ga0501084_0071402_1136_2095 | 312 |
| 431 | 3300060353 | Ga0501082_0087693 | Ga0501082_0087693_1584_2528 | 312 |
| 432 | 3300060353 | Ga0501082_0137163 | Ga0501082_0137163_285_1229 | 312 |
| 433 | iso_pu_bacteria | 2738543032 | 2739355110 | 312 |
| 434 | iso_pu_bacteria | 2889306138 | 2889306724 | 312 |
| 435 | iso_pu_bacteria | 2902405164 | 2902409627 | 312 |
| 436 | 3300001904 | JGI24736J21556_1000201 | JGI24736J21556_100020112 | 313 |
| 437 | 3300001915 | JGI24741J21665_1001549 | JGI24741J21665_10015492 | 313 |
| 438 | 3300001989 | JGI24739J22299_10018850 | JGI24739J22299_100188502 | 313 |
| 439 | 3300002075 | JGI24738J21930_10013641 | JGI24738J21930_100136412 | 313 |
| 440 | 3300002774 | JGI25150J39212_1000340 | JGI25150J39212_100034012 | 313 |
| 441 | 3300003320 | rootH2_10013646 | rootH2_100136467 | 313 |
| 442 | 3300003373 | JGI25407J50210_10033264 | JGI25407J50210_100332641 | 313 |
| 443 | 3300003771 | Ga0055526_1002614 | Ga0055526_100261410 | 313 |
| 444 | 3300003775 | Ga0055524_1000205 | Ga0055524_100020530 | 313 |
| 445 | 3300003775 | Ga0055524_1009309 | Ga0055524_10093092 | 313 |
| 446 | 3300003791 | Ga0055530_10039828 | Ga0055530_100398281 | 313 |
| 447 | 3300005262 | Ga0065165_1003151 | Ga0065165_10031513 | 313 |
| 448 | 3300005290 | Ga0065712_10088759 | Ga0065712_100887592 | 313 |
| 449 | 3300005327 | Ga0070658_10000379 | Ga0070658_1000037933 | 313 |
| 450 | 3300005327 | Ga0070658_10000629 | Ga0070658_1000062911 | 313 |
| 451 | 3300005327 | Ga0070658_10001797 | Ga0070658_1000179714 | 313 |
| 452 | 3300005327 | Ga0070658_10004427 | Ga0070658_100044275 | 313 |
| 453 | 3300005327 | Ga0070658_10004769 | Ga0070658_100047696 | 313 |
| 454 | 3300005327 | Ga0070658_10263739 | Ga0070658_102637391 | 313 |
| 455 | 3300005329 | Ga0070683_100018947 | Ga0070683_1000189477 | 313 |
| 456 | 3300005329 | Ga0070683_100190337 | Ga0070683_1001903372 | 313 |
| 457 | 3300005330 | Ga0070690_100000750 | Ga0070690_10000075010 | 313 |
| 458 | 3300005331 | Ga0070670_100042476 | Ga0070670_1000424761 | 313 |
| 459 | 3300005334 | Ga0068869_100069402 | Ga0068869_1000694022 | 313 |
| 460 | 3300005335 | Ga0070666_10090471 | Ga0070666_100904712 | 313 |
| 461 | 3300005336 | Ga0070680_100000533 | Ga0070680_10000053332 | 313 |
| 462 | 3300005336 | Ga0070680_100001991 | Ga0070680_1000019914 | 313 |
| 463 | 3300005336 | Ga0070680_100011194 | Ga0070680_1000111942 | 313 |
| 464 | 3300005336 | Ga0070680_100025656 | Ga0070680_1000256564 | 313 |
| 465 | 3300005336 | Ga0070680_100134645 | Ga0070680_1001346451 | 313 |
| 466 | 3300005337 | Ga0070682_100075508 | Ga0070682_1000755081 | 313 |
| 467 | 3300005338 | Ga0068868_100013002 | Ga0068868_1000130023 | 313 |
| 468 | 3300005339 | Ga0070660_100000085 | Ga0070660_10000008510 | 313 |
| 469 | 3300005339 | Ga0070660_100003873 | Ga0070660_1000038736 | 313 |
| 470 | 3300005339 | Ga0070660_100006908 | Ga0070660_1000069082 | 313 |
| 471 | 3300005339 | Ga0070660_100010943 | Ga0070660_1000109433 | 313 |
| 472 | 3300005339 | Ga0070660_100017238 | Ga0070660_1000172385 | 313 |
| 473 | 3300005339 | Ga0070660_100041942 | Ga0070660_1000419422 | 313 |
| 474 | 3300005339 | Ga0070660_100072550 | Ga0070660_1000725502 | 313 |
| 475 | 3300005339 | Ga0070660_100152121 | Ga0070660_1001521211 | 313 |
| 476 | 3300005341 | Ga0070691_10000436 | Ga0070691_100004364 | 313 |
| 477 | 3300005344 | Ga0070661_100008874 | Ga0070661_1000088747 | 313 |
| 478 | 3300005344 | Ga0070661_100036493 | Ga0070661_1000364935 | 313 |
| 479 | 3300005344 | Ga0070661_100059067 | Ga0070661_1000590672 | 313 |
| 480 | 3300005344 | Ga0070661_100067263 | Ga0070661_1000672632 | 313 |
| 481 | 3300005344 | Ga0070661_100416099 | Ga0070661_1004160991 | 313 |
| 482 | 3300005345 | Ga0070692_10000996 | Ga0070692_100009962 | 313 |
| 483 | 3300005345 | Ga0070692_10121551 | Ga0070692_101215512 | 313 |
| 484 | 3300005347 | Ga0070668_100004964 | Ga0070668_1000049642 | 313 |
| 485 | 3300005347 | Ga0070668_100041725 | Ga0070668_1000417252 | 313 |
| 486 | 3300005347 | Ga0070668_100051129 | Ga0070668_1000511293 | 313 |
| 487 | 3300005353 | Ga0070669_100046987 | Ga0070669_1000469872 | 313 |
| 488 | 3300005355 | Ga0070671_100167661 | Ga0070671_1001676612 | 313 |
| 489 | 3300005365 | Ga0070688_100020935 | Ga0070688_1000209353 | 313 |
| 490 | 3300005366 | Ga0070659_100034927 | Ga0070659_1000349273 | 313 |
| 491 | 3300005366 | Ga0070659_100050154 | Ga0070659_1000501542 | 313 |
| 492 | 3300005366 | Ga0070659_100052987 | Ga0070659_1000529872 | 313 |
| 493 | 3300005366 | Ga0070659_100082226 | Ga0070659_1000822262 | 313 |
| 494 | 3300005367 | Ga0070667_100000128 | Ga0070667_10000012814 | 313 |
| 495 | 3300005367 | Ga0070667_100101349 | Ga0070667_1001013492 | 313 |
| 496 | 3300005367 | Ga0070667_100176654 | Ga0070667_1001766542 | 313 |
| 497 | 3300005434 | Ga0070709_10022286 | Ga0070709_100222862 | 313 |
| 498 | 3300005434 | Ga0070709_10050465 | Ga0070709_100504653 | 313 |
| 499 | 3300005435 | Ga0070714_100092568 | Ga0070714_1000925682 | 313 |
| 500 | 3300005435 | Ga0070714_100143734 | Ga0070714_1001437342 | 313 |
| 501 | 3300005435 | Ga0070714_100159661 | Ga0070714_1001596612 | 313 |
| 502 | 3300005435 | Ga0070714_100175048 | Ga0070714_1001750481 | 313 |
| 503 | 3300005435 | Ga0070714_100287153 | Ga0070714_1002871532 | 313 |
| 504 | 3300005435 | Ga0070714_100407097 | Ga0070714_1004070972 | 313 |
| 505 | 3300005436 | Ga0070713_100000046 | Ga0070713_10000004636 | 313 |
| 506 | 3300005436 | Ga0070713_100035064 | Ga0070713_1000350641 | 313 |
| 507 | 3300005437 | Ga0070710_10155478 | Ga0070710_101554782 | 313 |
| 508 | 3300005437 | Ga0070710_10182275 | Ga0070710_101822751 | 313 |
| 509 | 3300005439 | Ga0070711_100248073 | Ga0070711_1002480732 | 313 |
| 510 | 3300005455 | Ga0070663_100002086 | Ga0070663_1000020867 | 313 |
| 511 | 3300005455 | Ga0070663_100015553 | Ga0070663_1000155537 | 313 |
| 512 | 3300005455 | Ga0070663_100020448 | Ga0070663_1000204482 | 313 |
| 513 | 3300005455 | Ga0070663_100218586 | Ga0070663_1002185862 | 313 |
| 514 | 3300005457 | Ga0070662_100012251 | Ga0070662_1000122512 | 313 |
| 515 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001171 | 313 |
| 516 | 3300005458 | Ga0070681_10016380 | Ga0070681_100163806 | 313 |
| 517 | 3300005458 | Ga0070681_10039831 | Ga0070681_100398314 | 313 |
| 518 | 3300005471 | Ga0070698_100225709 | Ga0070698_1002257092 | 313 |
| 519 | 3300005518 | Ga0070699_100054126 | Ga0070699_1000541262 | 313 |
| 520 | 3300005530 | Ga0070679_100150468 | Ga0070679_1001504682 | 313 |
| 521 | 3300005530 | Ga0070679_100218911 | Ga0070679_1002189112 | 313 |
| 522 | 3300005530 | Ga0070679_100244695 | Ga0070679_1002446951 | 313 |
| 523 | 3300005530 | Ga0070679_100341713 | Ga0070679_1003417132 | 313 |
| 524 | 3300005530 | Ga0070679_100449157 | Ga0070679_1004491572 | 313 |
| 525 | 3300005535 | Ga0070684_100276095 | Ga0070684_1002760952 | 313 |
| 526 | 3300005536 | Ga0070697_100342900 | Ga0070697_1003429001 | 313 |
| 527 | 3300005539 | Ga0068853_100032596 | Ga0068853_1000325962 | 313 |
| 528 | 3300005539 | Ga0068853_100034820 | Ga0068853_1000348204 | 313 |
| 529 | 3300005539 | Ga0068853_100226575 | Ga0068853_1002265751 | 313 |
| 530 | 3300005539 | Ga0068853_100227876 | Ga0068853_1002278762 | 313 |
| 531 | 3300005545 | Ga0070695_100037083 | Ga0070695_1000370831 | 313 |
| 532 | 3300005548 | Ga0070665_100000044 | Ga0070665_10000004477 | 313 |
| 533 | 3300005549 | Ga0070704_100030739 | Ga0070704_1000307392 | 313 |
| 534 | 3300005563 | Ga0068855_100000022 | Ga0068855_10000002266 | 313 |
| 535 | 3300005563 | Ga0068855_100000300 | Ga0068855_10000030048 | 313 |
| 536 | 3300005563 | Ga0068855_100005454 | Ga0068855_10000545410 | 313 |
| 537 | 3300005563 | Ga0068855_100011392 | Ga0068855_1000113928 | 313 |
| 538 | 3300005563 | Ga0068855_100013133 | Ga0068855_1000131335 | 313 |
| 539 | 3300005563 | Ga0068855_100071882 | Ga0068855_1000718824 | 313 |
| 540 | 3300005563 | Ga0068855_100076637 | Ga0068855_1000766374 | 313 |
| 541 | 3300005563 | Ga0068855_100106140 | Ga0068855_1001061402 | 313 |
| 542 | 3300005563 | Ga0068855_100212238 | Ga0068855_1002122383 | 313 |
| 543 | 3300005563 | Ga0068855_100503035 | Ga0068855_1005030352 | 313 |
| 544 | 3300005564 | Ga0070664_100016737 | Ga0070664_1000167377 | 313 |
| 545 | 3300005564 | Ga0070664_100031720 | Ga0070664_1000317204 | 313 |
| 546 | 3300005564 | Ga0070664_100070065 | Ga0070664_1000700653 | 313 |
| 547 | 3300005564 | Ga0070664_100200308 | Ga0070664_1002003082 | 313 |
| 548 | 3300005577 | Ga0068857_100000031 | Ga0068857_10000003130 | 313 |
| 549 | 3300005577 | Ga0068857_100103343 | Ga0068857_1001033432 | 313 |
| 550 | 3300005578 | Ga0068854_100040816 | Ga0068854_1000408163 | 313 |
| 551 | 3300005578 | Ga0068854_100146336 | Ga0068854_1001463362 | 313 |
| 552 | 3300005614 | Ga0068856_100000379 | Ga0068856_10000037938 | 313 |
| 553 | 3300005614 | Ga0068856_100001105 | Ga0068856_10000110520 | 313 |
| 554 | 3300005614 | Ga0068856_100005014 | Ga0068856_1000050143 | 313 |
| 555 | 3300005614 | Ga0068856_100038634 | Ga0068856_1000386342 | 313 |
| 556 | 3300005614 | Ga0068856_100039824 | Ga0068856_1000398244 | 313 |
| 557 | 3300005614 | Ga0068856_100062239 | Ga0068856_1000622392 | 313 |
| 558 | 3300005614 | Ga0068856_100135736 | Ga0068856_1001357362 | 313 |
| 559 | 3300005616 | Ga0068852_100013898 | Ga0068852_1000138984 | 313 |
| 560 | 3300005616 | Ga0068852_100017797 | Ga0068852_1000177975 | 313 |
| 561 | 3300005616 | Ga0068852_100044561 | Ga0068852_1000445613 | 313 |
| 562 | 3300005616 | Ga0068852_100094589 | Ga0068852_1000945891 | 313 |
| 563 | 3300005616 | Ga0068852_100422311 | Ga0068852_1004223111 | 313 |
| 564 | 3300005617 | Ga0068859_100000221 | Ga0068859_10000022124 | 313 |
| 565 | 3300005618 | Ga0068864_100000324 | Ga0068864_10000032419 | 313 |
| 566 | 3300005834 | Ga0068851_10111336 | Ga0068851_101113361 | 313 |
| 567 | 3300005841 | Ga0068863_100000988 | Ga0068863_10000098827 | 313 |
| 568 | 3300005842 | Ga0068858_100000038 | Ga0068858_10000003862 | 313 |
| 569 | 3300005842 | Ga0068858_100532904 | Ga0068858_1005329042 | 313 |
| 570 | 3300005843 | Ga0068860_100012362 | Ga0068860_1000123628 | 313 |
| 571 | 3300005843 | Ga0068860_100038050 | Ga0068860_1000380503 | 313 |
| 572 | 3300005843 | Ga0068860_100048226 | Ga0068860_1000482264 | 313 |
| 573 | 3300005844 | Ga0068862_100323761 | Ga0068862_1003237612 | 313 |
| 574 | 3300005937 | Ga0081455_10000736 | Ga0081455_1000073633 | 313 |
| 575 | 3300005981 | Ga0081538_10012501 | Ga0081538_100125015 | 313 |
| 576 | 3300005983 | Ga0081540_1001053 | Ga0081540_100105311 | 313 |
| 577 | 3300005983 | Ga0081540_1001559 | Ga0081540_10015593 | 313 |
| 578 | 3300005985 | Ga0081539_10036460 | Ga0081539_100364602 | 313 |
| 579 | 3300006028 | Ga0070717_10024484 | Ga0070717_100244845 | 313 |
| 580 | 3300006028 | Ga0070717_10266506 | Ga0070717_102665062 | 313 |
| 581 | 3300006038 | Ga0075365_10056117 | Ga0075365_100561172 | 313 |
| 582 | 3300006038 | Ga0075365_10068296 | Ga0075365_100682963 | 313 |
| 583 | 3300006038 | Ga0075365_10262520 | Ga0075365_102625201 | 313 |
| 584 | 3300006042 | Ga0075368_10025070 | Ga0075368_100250701 | 313 |
| 585 | 3300006042 | Ga0075368_10075290 | Ga0075368_100752901 | 313 |
| 586 | 3300006051 | Ga0075364_10033207 | Ga0075364_100332072 | 313 |
| 587 | 3300006051 | Ga0075364_10133005 | Ga0075364_101330051 | 313 |
| 588 | 3300006173 | Ga0070716_100112601 | Ga0070716_1001126011 | 313 |
| 589 | 3300006175 | Ga0070712_100000218 | Ga0070712_10000021823 | 313 |
| 590 | 3300006175 | Ga0070712_100005245 | Ga0070712_1000052453 | 313 |
| 591 | 3300006178 | Ga0075367_10079105 | Ga0075367_100791052 | 313 |
| 592 | 3300006186 | Ga0075369_10027277 | Ga0075369_100272772 | 313 |
| 593 | 3300006195 | Ga0075366_10046671 | Ga0075366_100466712 | 313 |
| 594 | 3300006844 | Ga0075428_100000606 | Ga0075428_10000060615 | 313 |
| 595 | 3300006844 | Ga0075428_100060712 | Ga0075428_1000607124 | 313 |
| 596 | 3300006844 | Ga0075428_100068529 | Ga0075428_1000685291 | 313 |
| 597 | 3300006846 | Ga0075430_100051888 | Ga0075430_1000518884 | 313 |
| 598 | 3300006846 | Ga0075430_100057443 | Ga0075430_1000574433 | 313 |
| 599 | 3300006846 | Ga0075430_100251388 | Ga0075430_1002513882 | 313 |
| 600 | 3300006847 | Ga0075431_100000032 | Ga0075431_10000003239 | 313 |
| 601 | 3300006847 | Ga0075431_100028286 | Ga0075431_1000282865 | 313 |
| 602 | 3300006852 | Ga0075433_10067598 | Ga0075433_100675982 | 313 |
| 603 | 3300006852 | Ga0075433_10125346 | Ga0075433_101253462 | 313 |
| 604 | 3300006852 | Ga0075433_10315850 | Ga0075433_103158502 | 313 |
| 605 | 3300006871 | Ga0075434_100105187 | Ga0075434_1001051872 | 313 |
| 606 | 3300006880 | Ga0075429_100031410 | Ga0075429_1000314104 | 313 |
| 607 | 3300006880 | Ga0075429_100045311 | Ga0075429_1000453111 | 313 |
| 608 | 3300006914 | Ga0075436_100001529 | Ga0075436_10000152912 | 313 |
| 609 | 3300006931 | Ga0097620_100000221 | Ga0097620_10000022124 | 313 |
| 610 | 3300007076 | Ga0075435_100219157 | Ga0075435_1002191572 | 313 |
| 611 | 3300007265 | Ga0099794_10028110 | Ga0099794_100281102 | 313 |
| 612 | 3300009092 | Ga0105250_10006178 | Ga0105250_100061785 | 313 |
| 613 | 3300009093 | Ga0105240_10000430 | Ga0105240_1000043072 | 313 |
| 614 | 3300009093 | Ga0105240_10002169 | Ga0105240_1000216927 | 313 |
| 615 | 3300009093 | Ga0105240_10033000 | Ga0105240_100330007 | 313 |
| 616 | 3300009093 | Ga0105240_10051735 | Ga0105240_100517354 | 313 |
| 617 | 3300009093 | Ga0105240_10070930 | Ga0105240_100709302 | 313 |
| 618 | 3300009093 | Ga0105240_10185191 | Ga0105240_101851912 | 313 |
| 619 | 3300009093 | Ga0105240_10651770 | Ga0105240_106517702 | 313 |
| 620 | 3300009093 | Ga0105240_10728330 | Ga0105240_107283301 | 313 |
| 621 | 3300009094 | Ga0111539_10001089 | Ga0111539_1000108916 | 313 |
| 622 | 3300009094 | Ga0111539_10020065 | Ga0111539_100200658 | 313 |
| 623 | 3300009094 | Ga0111539_10251657 | Ga0111539_102516572 | 313 |
| 624 | 3300009098 | Ga0105245_10000484 | Ga0105245_1000048425 | 313 |
| 625 | 3300009101 | Ga0105247_10038214 | Ga0105247_100382141 | 313 |
| 626 | 3300009147 | Ga0114129_10000062 | Ga0114129_1000006238 | 313 |
| 627 | 3300009147 | Ga0114129_10001060 | Ga0114129_1000106016 | 313 |
| 628 | 3300009147 | Ga0114129_10244180 | Ga0114129_102441802 | 313 |
| 629 | 3300009148 | Ga0105243_10275585 | Ga0105243_102755852 | 313 |
| 630 | 3300009174 | Ga0105241_10013670 | Ga0105241_100136701 | 313 |
| 631 | 3300009174 | Ga0105241_10073900 | Ga0105241_100739002 | 313 |
| 632 | 3300009174 | Ga0105241_10114489 | Ga0105241_101144891 | 313 |
| 633 | 3300009174 | Ga0105241_10228088 | Ga0105241_102280882 | 313 |
| 634 | 3300009177 | Ga0105248_10000005 | Ga0105248_10000005274 | 313 |
| 635 | 3300009177 | Ga0105248_10001342 | Ga0105248_1000134211 | 313 |
| 636 | 3300009177 | Ga0105248_10505355 | Ga0105248_105053552 | 313 |
| 637 | 3300009545 | Ga0105237_10001309 | Ga0105237_1000130924 | 313 |
| 638 | 3300009545 | Ga0105237_10202392 | Ga0105237_102023922 | 313 |
| 639 | 3300009551 | Ga0105238_10004028 | Ga0105238_1000402814 | 313 |
| 640 | 3300009551 | Ga0105238_10017014 | Ga0105238_100170145 | 313 |
| 641 | 3300009551 | Ga0105238_10033305 | Ga0105238_100333055 | 313 |
| 642 | 3300009553 | Ga0105249_10017541 | Ga0105249_100175416 | 313 |
| 643 | 3300010159 | Ga0099796_10027095 | Ga0099796_100270952 | 313 |
| 644 | 3300010375 | Ga0105239_10002559 | Ga0105239_1000255920 | 313 |
| 645 | 3300010375 | Ga0105239_10004314 | Ga0105239_1000431410 | 313 |
| 646 | 3300010375 | Ga0105239_10008789 | Ga0105239_1000878910 | 313 |
| 647 | 3300013100 | Ga0157373_10001315 | Ga0157373_100013157 | 313 |
| 648 | 3300013100 | Ga0157373_10014370 | Ga0157373_100143703 | 313 |
| 649 | 3300013100 | Ga0157373_10064155 | Ga0157373_100641552 | 313 |
| 650 | 3300013102 | Ga0157371_10006249 | Ga0157371_100062499 | 313 |
| 651 | 3300013102 | Ga0157371_10014275 | Ga0157371_100142753 | 313 |
| 652 | 3300013104 | Ga0157370_10007564 | Ga0157370_100075648 | 313 |
| 653 | 3300013104 | Ga0157370_10039763 | Ga0157370_100397633 | 313 |
| 654 | 3300013104 | Ga0157370_10053908 | Ga0157370_100539082 | 313 |
| 655 | 3300013104 | Ga0157370_10180436 | Ga0157370_101804362 | 313 |
| 656 | 3300013104 | Ga0157370_10348261 | Ga0157370_103482612 | 313 |
| 657 | 3300013105 | Ga0157369_10000756 | Ga0157369_1000075624 | 313 |
| 658 | 3300013105 | Ga0157369_10000881 | Ga0157369_1000088130 | 313 |
| 659 | 3300013105 | Ga0157369_10018172 | Ga0157369_100181727 | 313 |
| 660 | 3300013105 | Ga0157369_10274749 | Ga0157369_102747492 | 313 |
| 661 | 3300013105 | Ga0157369_10619993 | Ga0157369_106199932 | 313 |
| 662 | 3300013296 | Ga0157374_10131397 | Ga0157374_101313972 | 313 |
| 663 | 3300013297 | Ga0157378_10087458 | Ga0157378_100874582 | 313 |
| 664 | 3300013307 | Ga0157372_10004048 | Ga0157372_1000404817 | 313 |
| 665 | 3300013307 | Ga0157372_10016212 | Ga0157372_1001621211 | 313 |
| 666 | 3300014325 | Ga0163163_10000489 | Ga0163163_100004899 | 313 |
| 667 | 3300014325 | Ga0163163_10253252 | Ga0163163_102532521 | 313 |
| 668 | 3300014325 | Ga0163163_10596353 | Ga0163163_105963531 | 313 |
| 669 | 3300014968 | Ga0157379_10002131 | Ga0157379_100021317 | 313 |
| 670 | 3300014968 | Ga0157379_10011138 | Ga0157379_100111384 | 313 |
| 671 | 3300014968 | Ga0157379_10063465 | Ga0157379_100634651 | 313 |
| 672 | 3300014968 | Ga0157379_10092288 | Ga0157379_100922882 | 313 |
| 673 | 3300014968 | Ga0157379_10299331 | Ga0157379_102993312 | 313 |
| 674 | 3300017792 | Ga0163161_10230658 | Ga0163161_102306581 | 313 |
| 675 | 3300021361 | Ga0213872_10060633 | Ga0213872_100606331 | 313 |
| 676 | 3300021384 | Ga0213876_10001206 | Ga0213876_1000120613 | 313 |
| 677 | 3300021384 | Ga0213876_10154312 | Ga0213876_101543121 | 313 |
| 678 | 3300025229 | Ga0209147_103646 | Ga0209147_1036463 | 313 |
| 679 | 3300025263 | Ga0209565_1000054 | Ga0209565_1000054151 | 313 |
| 680 | 3300025273 | Ga0209673_1017066 | Ga0209673_10170663 | 313 |
| 681 | 3300025291 | Ga0209675_1002435 | Ga0209675_10024358 | 313 |
| 682 | 3300025294 | Ga0209025_1036751 | Ga0209025_10367512 | 313 |
| 683 | 3300025295 | Ga0209564_1000177 | Ga0209564_1000177110 | 313 |
| 684 | 3300025295 | Ga0209564_1001852 | Ga0209564_100185210 | 313 |
| 685 | 3300025299 | Ga0209256_1000032 | Ga0209256_1000032296 | 313 |
| 686 | 3300025299 | Ga0209256_1000547 | Ga0209256_100054715 | 313 |
| 687 | 3300025321 | Ga0207656_10098138 | Ga0207656_100981381 | 313 |
| 688 | 3300025711 | Ga0207696_1008107 | Ga0207696_10081073 | 313 |
| 689 | 3300025900 | Ga0207710_10065182 | Ga0207710_100651821 | 313 |
| 690 | 3300025903 | Ga0207680_10000466 | Ga0207680_100004665 | 313 |
| 691 | 3300025904 | Ga0207647_10003785 | Ga0207647_100037857 | 313 |
| 692 | 3300025904 | Ga0207647_10004237 | Ga0207647_100042374 | 313 |
| 693 | 3300025904 | Ga0207647_10018861 | Ga0207647_100188612 | 313 |
| 694 | 3300025904 | Ga0207647_10037669 | Ga0207647_100376692 | 313 |
| 695 | 3300025906 | Ga0207699_10000310 | Ga0207699_100003105 | 313 |
| 696 | 3300025906 | Ga0207699_10175871 | Ga0207699_101758711 | 313 |
| 697 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003504 | 313 |
| 698 | 3300025909 | Ga0207705_10000061 | Ga0207705_1000006111 | 313 |
| 699 | 3300025909 | Ga0207705_10000522 | Ga0207705_1000052231 | 313 |
| 700 | 3300025909 | Ga0207705_10000704 | Ga0207705_1000070417 | 313 |
| 701 | 3300025909 | Ga0207705_10004521 | Ga0207705_100045215 | 313 |
| 702 | 3300025909 | Ga0207705_10018789 | Ga0207705_100187893 | 313 |
| 703 | 3300025909 | Ga0207705_10034746 | Ga0207705_100347462 | 313 |
| 704 | 3300025909 | Ga0207705_10062918 | Ga0207705_100629181 | 313 |
| 705 | 3300025909 | Ga0207705_10260852 | Ga0207705_102608522 | 313 |
| 706 | 3300025909 | Ga0207705_10341801 | Ga0207705_103418012 | 313 |
| 707 | 3300025911 | Ga0207654_10206847 | Ga0207654_102068472 | 313 |
| 708 | 3300025912 | Ga0207707_10000011 | Ga0207707_10000011288 | 313 |
| 709 | 3300025912 | Ga0207707_10024159 | Ga0207707_100241595 | 313 |
| 710 | 3300025913 | Ga0207695_10000018 | Ga0207695_10000018565 | 313 |
| 711 | 3300025913 | Ga0207695_10006765 | Ga0207695_100067654 | 313 |
| 712 | 3300025913 | Ga0207695_10006975 | Ga0207695_1000697515 | 313 |
| 713 | 3300025913 | Ga0207695_10012037 | Ga0207695_100120379 | 313 |
| 714 | 3300025913 | Ga0207695_10016569 | Ga0207695_100165693 | 313 |
| 715 | 3300025913 | Ga0207695_10053216 | Ga0207695_100532164 | 313 |
| 716 | 3300025913 | Ga0207695_10101865 | Ga0207695_101018652 | 313 |
| 717 | 3300025913 | Ga0207695_10139030 | Ga0207695_101390302 | 313 |
| 718 | 3300025914 | Ga0207671_10100361 | Ga0207671_101003612 | 313 |
| 719 | 3300025914 | Ga0207671_10151241 | Ga0207671_101512412 | 313 |
| 720 | 3300025915 | Ga0207693_10000663 | Ga0207693_100006638 | 313 |
| 721 | 3300025915 | Ga0207693_10010617 | Ga0207693_100106173 | 313 |
| 722 | 3300025917 | Ga0207660_10000737 | Ga0207660_1000073719 | 313 |
| 723 | 3300025917 | Ga0207660_10002355 | Ga0207660_100023557 | 313 |
| 724 | 3300025917 | Ga0207660_10005544 | Ga0207660_1000554412 | 313 |
| 725 | 3300025917 | Ga0207660_10070703 | Ga0207660_100707032 | 313 |
| 726 | 3300025917 | Ga0207660_10104875 | Ga0207660_101048752 | 313 |
| 727 | 3300025917 | Ga0207660_10155309 | Ga0207660_101553091 | 313 |
| 728 | 3300025919 | Ga0207657_10000101 | Ga0207657_1000010177 | 313 |
| 729 | 3300025919 | Ga0207657_10000631 | Ga0207657_100006319 | 313 |
| 730 | 3300025919 | Ga0207657_10001405 | Ga0207657_1000140518 | 313 |
| 731 | 3300025919 | Ga0207657_10001922 | Ga0207657_1000192222 | 313 |
| 732 | 3300025919 | Ga0207657_10007725 | Ga0207657_100077257 | 313 |
| 733 | 3300025919 | Ga0207657_10012424 | Ga0207657_100124244 | 313 |
| 734 | 3300025919 | Ga0207657_10034343 | Ga0207657_100343432 | 313 |
| 735 | 3300025919 | Ga0207657_10143431 | Ga0207657_101434312 | 313 |
| 736 | 3300025919 | Ga0207657_10188959 | Ga0207657_101889592 | 313 |
| 737 | 3300025919 | Ga0207657_10238560 | Ga0207657_102385601 | 313 |
| 738 | 3300025919 | Ga0207657_10292141 | Ga0207657_102921411 | 313 |
| 739 | 3300025919 | Ga0207657_10409508 | Ga0207657_104095081 | 313 |
| 740 | 3300025920 | Ga0207649_10000494 | Ga0207649_1000049424 | 313 |
| 741 | 3300025920 | Ga0207649_10001179 | Ga0207649_1000117916 | 313 |
| 742 | 3300025920 | Ga0207649_10004815 | Ga0207649_100048152 | 313 |
| 743 | 3300025920 | Ga0207649_10049357 | Ga0207649_100493574 | 313 |
| 744 | 3300025920 | Ga0207649_10090808 | Ga0207649_100908081 | 313 |
| 745 | 3300025921 | Ga0207652_10000089 | Ga0207652_1000008922 | 313 |
| 746 | 3300025921 | Ga0207652_10000334 | Ga0207652_1000033431 | 313 |
| 747 | 3300025921 | Ga0207652_10132412 | Ga0207652_101324122 | 313 |
| 748 | 3300025921 | Ga0207652_10294109 | Ga0207652_102941092 | 313 |
| 749 | 3300025921 | Ga0207652_10374399 | Ga0207652_103743992 | 313 |
| 750 | 3300025921 | Ga0207652_10401522 | Ga0207652_104015221 | 313 |
| 751 | 3300025924 | Ga0207694_10000005 | Ga0207694_1000000520 | 313 |
| 752 | 3300025924 | Ga0207694_10024662 | Ga0207694_100246622 | 313 |
| 753 | 3300025925 | Ga0207650_10074789 | Ga0207650_100747892 | 313 |
| 754 | 3300025927 | Ga0207687_10032337 | Ga0207687_100323372 | 313 |
| 755 | 3300025928 | Ga0207700_10000017 | Ga0207700_10000017191 | 313 |
| 756 | 3300025929 | Ga0207664_10030301 | Ga0207664_100303015 | 313 |
| 757 | 3300025929 | Ga0207664_10056751 | Ga0207664_100567512 | 313 |
| 758 | 3300025929 | Ga0207664_10067798 | Ga0207664_100677982 | 313 |
| 759 | 3300025929 | Ga0207664_10139268 | Ga0207664_101392682 | 313 |
| 760 | 3300025929 | Ga0207664_10160393 | Ga0207664_101603932 | 313 |
| 761 | 3300025929 | Ga0207664_10538999 | Ga0207664_105389991 | 313 |
| 762 | 3300025932 | Ga0207690_10021392 | Ga0207690_100213924 | 313 |
| 763 | 3300025932 | Ga0207690_10034093 | Ga0207690_100340933 | 313 |
| 764 | 3300025932 | Ga0207690_10039976 | Ga0207690_100399763 | 313 |
| 765 | 3300025932 | Ga0207690_10043002 | Ga0207690_100430023 | 313 |
| 766 | 3300025932 | Ga0207690_10054649 | Ga0207690_100546492 | 313 |
| 767 | 3300025932 | Ga0207690_10184130 | Ga0207690_101841302 | 313 |
| 768 | 3300025932 | Ga0207690_10268363 | Ga0207690_102683632 | 313 |
| 769 | 3300025933 | Ga0207706_10009699 | Ga0207706_100096993 | 313 |
| 770 | 3300025933 | Ga0207706_10019485 | Ga0207706_100194855 | 313 |
| 771 | 3300025933 | Ga0207706_10190413 | Ga0207706_101904132 | 313 |
| 772 | 3300025939 | Ga0207665_10059848 | Ga0207665_100598482 | 313 |
| 773 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002274 | 313 |
| 774 | 3300025941 | Ga0207711_10000042 | Ga0207711_10000042112 | 313 |
| 775 | 3300025941 | Ga0207711_10015104 | Ga0207711_100151045 | 313 |
| 776 | 3300025941 | Ga0207711_10047034 | Ga0207711_100470344 | 313 |
| 777 | 3300025942 | Ga0207689_10134030 | Ga0207689_101340302 | 313 |
| 778 | 3300025944 | Ga0207661_10023150 | Ga0207661_100231505 | 313 |
| 779 | 3300025945 | Ga0207679_10113338 | Ga0207679_101133382 | 313 |
| 780 | 3300025949 | Ga0207667_10000061 | Ga0207667_1000006165 | 313 |
| 781 | 3300025949 | Ga0207667_10000187 | Ga0207667_1000018755 | 313 |
| 782 | 3300025949 | Ga0207667_10005445 | Ga0207667_1000544510 | 313 |
| 783 | 3300025949 | Ga0207667_10009340 | Ga0207667_1000934014 | 313 |
| 784 | 3300025949 | Ga0207667_10013895 | Ga0207667_100138952 | 313 |
| 785 | 3300025949 | Ga0207667_10031158 | Ga0207667_100311585 | 313 |
| 786 | 3300025949 | Ga0207667_10078431 | Ga0207667_100784312 | 313 |
| 787 | 3300025949 | Ga0207667_10534911 | Ga0207667_105349111 | 313 |
| 788 | 3300025960 | Ga0207651_10045319 | Ga0207651_100453193 | 313 |
| 789 | 3300025972 | Ga0207668_10003197 | Ga0207668_100031972 | 313 |
| 790 | 3300025972 | Ga0207668_10033479 | Ga0207668_100334792 | 313 |
| 791 | 3300025972 | Ga0207668_10110453 | Ga0207668_101104532 | 313 |
| 792 | 3300025981 | Ga0207640_10002139 | Ga0207640_1000213914 | 313 |
| 793 | 3300025981 | Ga0207640_10005375 | Ga0207640_100053757 | 313 |
| 794 | 3300025981 | Ga0207640_10055031 | Ga0207640_100550312 | 313 |
| 795 | 3300025986 | Ga0207658_10004787 | Ga0207658_100047876 | 313 |
| 796 | 3300025986 | Ga0207658_10027427 | Ga0207658_100274273 | 313 |
| 797 | 3300025986 | Ga0207658_10043127 | Ga0207658_100431274 | 313 |
| 798 | 3300026035 | Ga0207703_10000440 | Ga0207703_1000044019 | 313 |
| 799 | 3300026035 | Ga0207703_10001009 | Ga0207703_1000100926 | 313 |
| 800 | 3300026041 | Ga0207639_10004301 | Ga0207639_100043013 | 313 |
| 801 | 3300026041 | Ga0207639_10032439 | Ga0207639_100324393 | 313 |
| 802 | 3300026041 | Ga0207639_10106886 | Ga0207639_101068861 | 313 |
| 803 | 3300026041 | Ga0207639_10261874 | Ga0207639_102618742 | 313 |
| 804 | 3300026067 | Ga0207678_10003050 | Ga0207678_100030503 | 313 |
| 805 | 3300026067 | Ga0207678_10005069 | Ga0207678_100050698 | 313 |
| 806 | 3300026067 | Ga0207678_10050319 | Ga0207678_100503192 | 313 |
| 807 | 3300026067 | Ga0207678_10254549 | Ga0207678_102545492 | 313 |
| 808 | 3300026078 | Ga0207702_10000035 | Ga0207702_1000003565 | 313 |
| 809 | 3300026078 | Ga0207702_10000182 | Ga0207702_1000018259 | 313 |
| 810 | 3300026078 | Ga0207702_10000875 | Ga0207702_1000087512 | 313 |
| 811 | 3300026078 | Ga0207702_10045038 | Ga0207702_100450383 | 313 |
| 812 | 3300026078 | Ga0207702_10294177 | Ga0207702_102941771 | 313 |
| 813 | 3300026088 | Ga0207641_10000415 | Ga0207641_100004154 | 313 |
| 814 | 3300026095 | Ga0207676_10002042 | Ga0207676_1000204212 | 313 |
| 815 | 3300026116 | Ga0207674_10000003 | Ga0207674_10000003134 | 313 |
| 816 | 3300026116 | Ga0207674_10034758 | Ga0207674_100347584 | 313 |
| 817 | 3300026118 | Ga0207675_100387745 | Ga0207675_1003877451 | 313 |
| 818 | 3300026142 | Ga0207698_10002033 | Ga0207698_100020333 | 313 |
| 819 | 3300026142 | Ga0207698_10049620 | Ga0207698_100496203 | 313 |
| 820 | 3300026142 | Ga0207698_10069627 | Ga0207698_100696272 | 313 |
| 821 | 3300027866 | Ga0209813_10006106 | Ga0209813_100061063 | 313 |
| 822 | 3300027907 | Ga0207428_10007154 | Ga0207428_100071546 | 313 |
| 823 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021968 | 313 |
| 824 | 3300028379 | Ga0268266_10070415 | Ga0268266_100704151 | 313 |
| 825 | 3300028380 | Ga0268265_10066985 | Ga0268265_100669853 | 313 |
| 826 | 3300028380 | Ga0268265_10443854 | Ga0268265_104438541 | 313 |
| 827 | 3300028380 | Ga0268265_10464241 | Ga0268265_104642411 | 313 |
| 828 | 3300028381 | Ga0268264_10023310 | Ga0268264_100233104 | 313 |
| 829 | 3300028381 | Ga0268264_10040033 | Ga0268264_100400334 | 313 |
| 830 | 3300028573 | Ga0265334_10000953 | Ga0265334_100009539 | 313 |
| 831 | 3300028800 | Ga0265338_10005581 | Ga0265338_100055818 | 313 |
| 832 | 3300028800 | Ga0265338_10019894 | Ga0265338_100198948 | 313 |
| 833 | 3300028800 | Ga0265338_10050438 | Ga0265338_100504383 | 313 |
| 834 | 3300031235 | Ga0265330_10025130 | Ga0265330_100251302 | 313 |
| 835 | 3300031235 | Ga0265330_10053156 | Ga0265330_100531561 | 313 |
| 836 | 3300031235 | Ga0265330_10086903 | Ga0265330_100869031 | 313 |
| 837 | 3300031238 | Ga0265332_10071114 | Ga0265332_100711142 | 313 |
| 838 | 3300031239 | Ga0265328_10000046 | Ga0265328_1000004639 | 313 |
| 839 | 3300031241 | Ga0265325_10000567 | Ga0265325_1000056713 | 313 |
| 840 | 3300031241 | Ga0265325_10005899 | Ga0265325_100058991 | 313 |
| 841 | 3300031241 | Ga0265325_10044214 | Ga0265325_100442141 | 313 |
| 842 | 3300031247 | Ga0265340_10000428 | Ga0265340_100004287 | 313 |
| 843 | 3300031247 | Ga0265340_10000540 | Ga0265340_1000054015 | 313 |
| 844 | 3300031247 | Ga0265340_10006101 | Ga0265340_100061015 | 313 |
| 845 | 3300031247 | Ga0265340_10006948 | Ga0265340_100069485 | 313 |
| 846 | 3300031247 | Ga0265340_10036841 | Ga0265340_100368411 | 313 |
| 847 | 3300031249 | Ga0265339_10003873 | Ga0265339_100038736 | 313 |
| 848 | 3300031249 | Ga0265339_10006509 | Ga0265339_100065092 | 313 |
| 849 | 3300031249 | Ga0265339_10123637 | Ga0265339_101236372 | 313 |
| 850 | 3300031250 | Ga0265331_10000054 | Ga0265331_10000054135 | 313 |
| 851 | 3300031250 | Ga0265331_10004958 | Ga0265331_100049587 | 313 |
| 852 | 3300031250 | Ga0265331_10013768 | Ga0265331_100137684 | 313 |
| 853 | 3300031250 | Ga0265331_10016457 | Ga0265331_100164572 | 313 |
| 854 | 3300031251 | Ga0265327_10000179 | Ga0265327_1000017957 | 313 |
| 855 | 3300031344 | Ga0265316_10000099 | Ga0265316_1000009938 | 313 |
| 856 | 3300031344 | Ga0265316_10017095 | Ga0265316_100170955 | 313 |
| 857 | 3300031344 | Ga0265316_10084400 | Ga0265316_100844002 | 313 |
| 858 | 3300031344 | Ga0265316_10114507 | Ga0265316_101145072 | 313 |
| 859 | 3300031344 | Ga0265316_10217742 | Ga0265316_102177421 | 313 |
| 860 | 3300031344 | Ga0265316_10392352 | Ga0265316_103923521 | 313 |
| 861 | 3300031548 | Ga0307408_100221489 | Ga0307408_1002214892 | 313 |
| 862 | 3300031595 | Ga0265313_10000216 | Ga0265313_1000021657 | 313 |
| 863 | 3300031595 | Ga0265313_10011560 | Ga0265313_100115606 | 313 |
| 864 | 3300031595 | Ga0265313_10028965 | Ga0265313_100289652 | 313 |
| 865 | 3300031691 | Ga0316579_10115829 | Ga0316579_101158291 | 313 |
| 866 | 3300031711 | Ga0265314_10000160 | Ga0265314_1000016025 | 313 |
| 867 | 3300031711 | Ga0265314_10019986 | Ga0265314_100199864 | 313 |
| 868 | 3300031711 | Ga0265314_10023980 | Ga0265314_100239804 | 313 |
| 869 | 3300031711 | Ga0265314_10048739 | Ga0265314_100487392 | 313 |
| 870 | 3300031711 | Ga0265314_10091869 | Ga0265314_100918693 | 313 |
| 871 | 3300031711 | Ga0265314_10093099 | Ga0265314_100930992 | 313 |
| 872 | 3300031711 | Ga0265314_10115196 | Ga0265314_101151962 | 313 |
| 873 | 3300031712 | Ga0265342_10000139 | Ga0265342_1000013940 | 313 |
| 874 | 3300031712 | Ga0265342_10001957 | Ga0265342_1000195719 | 313 |
| 875 | 3300031712 | Ga0265342_10004338 | Ga0265342_100043389 | 313 |
| 876 | 3300031712 | Ga0265342_10022508 | Ga0265342_100225082 | 313 |
| 877 | 3300031712 | Ga0265342_10101609 | Ga0265342_101016091 | 313 |
| 878 | 3300031728 | Ga0316578_10125608 | Ga0316578_101256082 | 313 |
| 879 | 3300031730 | Ga0307516_10033704 | Ga0307516_100337045 | 313 |
| 880 | 3300031824 | Ga0307413_10006025 | Ga0307413_100060253 | 313 |
| 881 | 3300031824 | Ga0307413_10047640 | Ga0307413_100476402 | 313 |
| 882 | 3300031852 | Ga0307410_10044829 | Ga0307410_100448293 | 313 |
| 883 | 3300031903 | Ga0307407_10016181 | Ga0307407_100161812 | 313 |
| 884 | 3300031903 | Ga0307407_10020660 | Ga0307407_100206602 | 313 |
| 885 | 3300031995 | Ga0307409_100010082 | Ga0307409_1000100823 | 313 |
| 886 | 3300032002 | Ga0307416_100023757 | Ga0307416_1000237573 | 313 |
| 887 | 3300032004 | Ga0307414_10004083 | Ga0307414_100040835 | 313 |
| 888 | 3300032005 | Ga0307411_10020382 | Ga0307411_100203824 | 313 |
| 889 | 3300032005 | Ga0307411_10036072 | Ga0307411_100360723 | 313 |
| 890 | 3300032126 | Ga0307415_100000374 | Ga0307415_10000037412 | 313 |
| 891 | 3300032126 | Ga0307415_100007417 | Ga0307415_1000074176 | 313 |
| 892 | 3300033541 | Ga0316596_1043264 | Ga0316596_10432641 | 313 |
| 893 | 3300035111 | Ga0373923_0005873 | Ga0373923_0005873_2556_3512 | 313 |
| 894 | 3300035113 | Ga0373936_0074704 | Ga0373936_0074704_419_1375 | 313 |
| 895 | 3300035116 | Ga0373945_0011777 | Ga0373945_0011777_1459_2415 | 313 |
| 896 | 3300035116 | Ga0373945_0033883 | Ga0373945_0033883_430_1386 | 313 |
| 897 | 3300035117 | Ga0373953_0001424 | Ga0373953_0001424_2745_3701 | 313 |
| 898 | 3300035118 | Ga0373954_0002291 | Ga0373954_0002291_3792_4748 | 313 |
| 899 | 3300035118 | Ga0373954_0032949 | Ga0373954_0032949_1164_2105 | 313 |
| 900 | 3300035119 | Ga0373956_0027878 | Ga0373956_0027878_901_1842 | 313 |
| 901 | 3300035120 | Ga0373957_0006598 | Ga0373957_0006598_1783_2739 | 313 |
| 902 | 3300035120 | Ga0373957_0016614 | Ga0373957_0016614_1089_2030 | 313 |
| 903 | 3300035170 | Ga0373943_0001584 | Ga0373943_0001584_4506_5462 | 313 |
| 904 | 3300035170 | Ga0373943_0061477 | Ga0373943_0061477_812_1771 | 313 |
| 905 | 3300035171 | Ga0373946_0002328 | Ga0373946_0002328_2521_3477 | 313 |
| 906 | 3300035172 | Ga0373955_0000338 | Ga0373955_0000338_6904_7860 | 313 |
| 907 | 3300035410 | Ga0373924_0005579 | Ga0373924_0005579_2109_3065 | 313 |
| 908 | 3300035692 | Ga0373935_0000281 | Ga0373935_0000281_23315_24271 | 313 |
| 909 | 3300035692 | Ga0373935_0024213 | Ga0373935_0024213_1551_2507 | 313 |
| 910 | 3300035692 | Ga0373935_0026454 | Ga0373935_0026454_2580_3536 | 313 |
| 911 | 3300035692 | Ga0373935_0040406 | Ga0373935_0040406_1076_2032 | 313 |
| 912 | 3300035695 | Ga0373927_0022573 | Ga0373927_0022573_201_1157 | 313 |
| 913 | 3300035695 | Ga0373927_0060294 | Ga0373927_0060294_421_1377 | 313 |
| 914 | 3300035695 | Ga0373927_0086861 | Ga0373927_0086861_192_1151 | 313 |
| 915 | 3300035695 | Ga0373927_0086944 | Ga0373927_0086944_393_1349 | 313 |
| 916 | 3300035695 | Ga0373927_0099209 | Ga0373927_0099209_387_1343 | 313 |
| 917 | 3300035724 | Ga0373933_0012856 | Ga0373933_0012856_1203_2159 | 313 |
| 918 | 3300035724 | Ga0373933_0076526 | Ga0373933_0076526_996_1937 | 313 |
| 919 | 3300035724 | Ga0373933_0130999 | Ga0373933_0130999_332_1294 | 313 |
| 920 | 3300035725 | Ga0373947_0003801 | Ga0373947_0003801_5240_6196 | 313 |
| 921 | 3300035725 | Ga0373947_0008856 | Ga0373947_0008856_4320_5276 | 313 |
| 922 | 3300035725 | Ga0373947_0032588 | Ga0373947_0032588_1532_2488 | 313 |
| 923 | 3300035725 | Ga0373947_0035434 | Ga0373947_0035434_76_1032 | 313 |
| 924 | 3300035725 | Ga0373947_0259854 | Ga0373947_0259854_35_994 | 313 |
| 925 | 3300036401 | Ga0373937_0000005 | Ga0373937_0000005_82403_83359 | 313 |
| 926 | 3300036401 | Ga0373937_0025615 | Ga0373937_0025615_1281_2243 | 313 |
| 927 | 3300036401 | Ga0373937_0048456 | Ga0373937_0048456_2392_3354 | 313 |
| 928 | 3300036401 | Ga0373937_0110420 | Ga0373937_0110420_89_1030 | 313 |
| 929 | 3300036401 | Ga0373937_0178582 | Ga0373937_0178582_817_1776 | 313 |
| 930 | 3300036647 | Ga0316582_0082434 | Ga0316582_0082434_828_1781 | 313 |
| 931 | 3300036647 | Ga0316582_0110442 | Ga0316582_0110442_555_1508 | 313 |
| 932 | 3300037068 | Ga0373925_0000007 | Ga0373925_0000007_116834_117790 | 313 |
| 933 | 3300037068 | Ga0373925_0006256 | Ga0373925_0006256_4781_5737 | 313 |
| 934 | 3300037068 | Ga0373925_0007976 | Ga0373925_0007976_2676_3632 | 313 |
| 935 | 3300037068 | Ga0373925_0311510 | Ga0373925_0311510_14_970 | 313 |
| 936 | 3300037312 | Ga0395899_0000112 | Ga0395899_0000112_135138_136079 | 313 |
| 937 | 3300037312 | Ga0395899_0020389 | Ga0395899_0020389_2207_3148 | 313 |
| 938 | 3300037312 | Ga0395899_0029465 | Ga0395899_0029465_2985_3926 | 313 |
| 939 | 3300037312 | Ga0395899_0128167 | Ga0395899_0128167_278_1249 | 313 |
| 940 | 3300037418 | Ga0395900_0000126 | Ga0395900_0000126_50825_51766 | 313 |
| 941 | 3300037418 | Ga0395900_0001168 | Ga0395900_0001168_5389_6333 | 313 |
| 942 | 3300037418 | Ga0395900_0005035 | Ga0395900_0005035_5466_6407 | 313 |
| 943 | 3300037418 | Ga0395900_0091877 | Ga0395900_0091877_132_1073 | 313 |
| 944 | 3300037418 | Ga0395900_0131334 | Ga0395900_0131334_209_1150 | 313 |
| 945 | 3300037418 | Ga0395900_0186006 | Ga0395900_0186006_1094_2035 | 313 |
| 946 | 3300037418 | Ga0395900_0204397 | Ga0395900_0204397_581_1543 | 313 |
| 947 | 3300037418 | Ga0395900_0411048 | Ga0395900_0411048_184_1125 | 313 |
| 948 | 3300037466 | Ga0395898_0021159 | Ga0395898_0021159_3171_4112 | 313 |
| 949 | 3300037466 | Ga0395898_0067814 | Ga0395898_0067814_1599_2540 | 313 |
| 950 | 3300037466 | Ga0395898_0071691 | Ga0395898_0071691_2032_2973 | 313 |
| 951 | 3300037466 | Ga0395898_0129509 | Ga0395898_0129509_203_1144 | 313 |
| 952 | 3300037466 | Ga0395898_0165391 | Ga0395898_0165391_439_1410 | 313 |
| 953 | 3300037466 | Ga0395898_0182532 | Ga0395898_0182532_1036_1977 | 313 |
| 954 | 3300037466 | Ga0395898_0303673 | Ga0395898_0303673_517_1458 | 313 |
| 955 | 3300037466 | Ga0395898_0626186 | Ga0395898_0626186_29_970 | 313 |
| 956 | 3300037471 | Ga0395905_0001952 | Ga0395905_0001952_7412_8356 | 313 |
| 957 | 3300037471 | Ga0395905_0002564 | Ga0395905_0002564_13858_14802 | 313 |
| 958 | 3300037471 | Ga0395905_0094841 | Ga0395905_0094841_1083_2024 | 313 |
| 959 | 3300037471 | Ga0395905_0113726 | Ga0395905_0113726_1305_2246 | 313 |
| 960 | 3300037471 | Ga0395905_0257928 | Ga0395905_0257928_139_1110 | 313 |
| 961 | 3300038443 | Ga0395901_0000249 | Ga0395901_0000249_50805_51746 | 313 |
| 962 | 3300038443 | Ga0395901_0028554 | Ga0395901_0028554_1274_2215 | 313 |
| 963 | 3300038443 | Ga0395901_0032611 | Ga0395901_0032611_2869_3813 | 313 |
| 964 | 3300038443 | Ga0395901_0064971 | Ga0395901_0064971_79_1020 | 313 |
| 965 | 3300038443 | Ga0395901_0239538 | Ga0395901_0239538_440_1381 | 313 |
| 966 | 3300038741 | Ga0400488_42668 | Ga0400488_42668_1187_2194 | 313 |
| 967 | 3300038742 | Ga0400486_23075 | Ga0400486_23075_806_1780 | 313 |
| 968 | 3300039437 | Ga0436365_0388612 | Ga0436365_0388612_57_1010 | 313 |
| 969 | 3300039437 | Ga0436365_0710251 | Ga0436365_0710251_1748_2701 | 313 |
| 970 | 3300039437 | Ga0436365_1432912 | Ga0436365_1432912_16232_17188 | 313 |
| 971 | 3300039447 | Ga0436361_0124441 | Ga0436361_0124441_597_1553 | 313 |
| 972 | 3300039447 | Ga0436361_0198498 | Ga0436361_0198498_3018_3974 | 313 |
| 973 | 3300039447 | Ga0436361_0833088 | Ga0436361_0833088_323_1276 | 313 |
| 974 | 3300039450 | Ga0436363_0036075 | Ga0436363_0036075_13555_14511 | 313 |
| 975 | 3300042439 | Ga0439464_0000604 | Ga0439464_0000604_1029_1970 | 313 |
| 976 | 3300044683 | Ga0466965_0107407 | Ga0466965_0107407_153_1094 | 313 |
| 977 | 3300044684 | Ga0466966_0000001 | Ga0466966_0000001_380557_381498 | 313 |
| 978 | 3300044684 | Ga0466966_0007678 | Ga0466966_0007678_2335_3276 | 313 |
| 979 | 3300044693 | Ga0466961_0001957 | Ga0466961_0001957_743_1687 | 313 |
| 980 | 3300044693 | Ga0466961_0021341 | Ga0466961_0021341_2476_3417 | 313 |
| 981 | 3300044694 | Ga0466963_0060957 | Ga0466963_0060957_1209_2150 | 313 |
| 982 | 3300044694 | Ga0466963_0066699 | Ga0466963_0066699_915_1856 | 313 |
| 983 | 3300044694 | Ga0466963_0098529 | Ga0466963_0098529_359_1303 | 313 |
| 984 | 3300044706 | Ga0466964_0045424 | Ga0466964_0045424_382_1323 | 313 |
| 985 | 3300044719 | Ga0466971_0049154 | Ga0466971_0049154_526_1467 | 313 |
| 986 | 3300044735 | Ga0466968_0033418 | Ga0466968_0033418_845_1786 | 313 |
| 987 | 3300044765 | Ga0466970_0015793 | Ga0466970_0015793_355_1296 | 313 |
| 988 | 3300044765 | Ga0466970_0018885 | Ga0466970_0018885_164_1105 | 313 |
| 989 | 3300044765 | Ga0466970_0041527 | Ga0466970_0041527_386_1327 | 313 |
| 990 | 3300044842 | Ga0466957_0001548 | Ga0466957_0001548_8431_9372 | 313 |
| 991 | 3300044842 | Ga0466957_0013787 | Ga0466957_0013787_2593_3549 | 313 |
| 992 | 3300045049 | Ga0466959_0059278 | Ga0466959_0059278_410_1351 | 313 |
| 993 | 3300045049 | Ga0466959_0086949 | Ga0466959_0086949_1025_1966 | 313 |
| 994 | 3300045836 | Ga0466958_0017411 | Ga0466958_0017411_342_1283 | 313 |
| 995 | 3300045836 | Ga0466958_0063706 | Ga0466958_0063706_1025_1966 | 313 |
| 996 | 3300045836 | Ga0466958_0096927 | Ga0466958_0096927_798_1739 | 313 |
| 997 | 3300045836 | Ga0466958_0116963 | Ga0466958_0116963_98_1039 | 313 |
| 998 | 3300045976 | Ga0466967_0300392 | Ga0466967_0300392_297_1238 | 313 |
| 999 | 3300045976 | Ga0466967_0459947 | Ga0466967_0459947_84_1025 | 313 |
| 1000 | 3300045976 | Ga0466967_0586481 | Ga0466967_0586481_94_1035 | 313 |
| 1001 | 3300046453 | Ga0495627_000353 | Ga0495627_000353_8251_9195 | 313 |
| 1002 | 3300046453 | Ga0495627_000615 | Ga0495627_000615_8124_9068 | 313 |
| 1003 | 3300046454 | Ga0495592_0000241 | Ga0495592_0000241_44264_45220 | 313 |
| 1004 | 3300046455 | Ga0495603_0130304 | Ga0495603_0130304_138_1157 | 313 |
| 1005 | 3300046459 | Ga0495629_0015097 | Ga0495629_0015097_3756_4712 | 313 |
| 1006 | 3300046460 | Ga0495638_0088182 | Ga0495638_0088182_296_1255 | 313 |
| 1007 | 3300046462 | Ga0495651_0000555 | Ga0495651_0000555_7202_8158 | 313 |
| 1008 | 3300046463 | Ga0495653_0000103 | Ga0495653_0000103_8117_9073 | 313 |
| 1009 | 3300046472 | Ga0495580_0023628 | Ga0495580_0023628_1765_2721 | 313 |
| 1010 | 3300046473 | Ga0495582_0106757 | Ga0495582_0106757_85_1041 | 313 |
| 1011 | 3300046475 | Ga0495639_0087870 | Ga0495639_0087870_407_1363 | 313 |
| 1012 | 3300046476 | Ga0495662_0012843 | Ga0495662_0012843_1703_2659 | 313 |
| 1013 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_441771_442727 | 313 |
| 1014 | 3300046499 | Ga0495594_0159278 | Ga0495594_0159278_49_1068 | 313 |
| 1015 | 3300046501 | Ga0495607_0013505 | Ga0495607_0013505_4234_5184 | 313 |
| 1016 | 3300046506 | Ga0495583_0004819 | Ga0495583_0004819_1380_2327 | 313 |
| 1017 | 3300046507 | Ga0495606_0068911 | Ga0495606_0068911_1013_1960 | 313 |
| 1018 | 3300046511 | Ga0495608_0000131 | Ga0495608_0000131_23286_24242 | 313 |
| 1019 | 3300046512 | Ga0495610_0000186 | Ga0495610_0000186_68190_69134 | 313 |
| 1020 | 3300046512 | Ga0495610_0047236 | Ga0495610_0047236_63_1016 | 313 |
| 1021 | 3300046514 | Ga0495618_0000019 | Ga0495618_0000019_6938_7894 | 313 |
| 1022 | 3300046516 | Ga0495628_0000080 | Ga0495628_0000080_60596_61552 | 313 |
| 1023 | 3300046517 | Ga0495630_0000989 | Ga0495630_0000989_14325_15281 | 313 |
| 1024 | 3300046517 | Ga0495630_0027488 | Ga0495630_0027488_2461_3417 | 313 |
| 1025 | 3300046519 | Ga0495632_0129557 | Ga0495632_0129557_74_1027 | 313 |
| 1026 | 3300046520 | Ga0495637_0018683 | Ga0495637_0018683_1638_2582 | 313 |
| 1027 | 3300046520 | Ga0495637_0045769 | Ga0495637_0045769_301_1242 | 313 |
| 1028 | 3300046520 | Ga0495637_0080112 | Ga0495637_0080112_52_999 | 313 |
| 1029 | 3300046522 | Ga0495643_0001215 | Ga0495643_0001215_14143_15090 | 313 |
| 1030 | 3300046522 | Ga0495643_0004105 | Ga0495643_0004105_6660_7607 | 313 |
| 1031 | 3300046524 | Ga0495648_0043810 | Ga0495648_0043810_1102_2046 | 313 |
| 1032 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_199244_200200 | 313 |
| 1033 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_385985_386941 | 313 |
| 1034 | 3300046533 | Ga0495640_0027742 | Ga0495640_0027742_1279_2235 | 313 |
| 1035 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_458441_459397 | 313 |
| 1036 | 3300046543 | Ga0495645_0000009 | Ga0495645_0000009_23287_24243 | 313 |
| 1037 | 3300046543 | Ga0495645_0115662 | Ga0495645_0115662_721_1677 | 313 |
| 1038 | 3300046558 | Ga0495633_0002461 | Ga0495633_0002461_9054_10001 | 313 |
| 1039 | 3300046559 | Ga0495667_0000021 | Ga0495667_0000021_62918_63874 | 313 |
| 1040 | 3300046559 | Ga0495667_0251498 | Ga0495667_0251498_147_1109 | 313 |
| 1041 | 3300046616 | Ga0495668_0000258 | Ga0495668_0000258_34027_34974 | 313 |
| 1042 | 3300046616 | Ga0495668_0018062 | Ga0495668_0018062_294_1235 | 313 |
| 1043 | 3300046616 | Ga0495668_0119050 | Ga0495668_0119050_76_1032 | 313 |
| 1044 | 3300046642 | Ga0495634_0000396 | Ga0495634_0000396_41257_42213 | 313 |
| 1045 | 3300046642 | Ga0495634_0017941 | Ga0495634_0017941_2552_3508 | 313 |
| 1046 | 3300046642 | Ga0495634_0182947 | Ga0495634_0182947_192_1148 | 313 |
| 1047 | 3300046642 | Ga0495634_0198400 | Ga0495634_0198400_197_1153 | 313 |
| 1048 | 3300046648 | Ga0495611_0004123 | Ga0495611_0004123_1213_2160 | 313 |
| 1049 | 3300046660 | Ga0495625_0076122 | Ga0495625_0076122_687_1628 | 313 |
| 1050 | 3300046660 | Ga0495625_0089169 | Ga0495625_0089169_200_1147 | 313 |
| 1051 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_444252_445208 | 313 |
| 1052 | 3300046675 | Ga0495657_0000088 | Ga0495657_0000088_58014_58970 | 313 |
| 1053 | 3300046675 | Ga0495657_0066311 | Ga0495657_0066311_949_1908 | 313 |
| 1054 | 3300046678 | Ga0495599_0000025 | Ga0495599_0000025_58719_59675 | 313 |
| 1055 | 3300046679 | Ga0495623_0000018 | Ga0495623_0000018_12763_13719 | 313 |
| 1056 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_22240_23196 | 313 |
| 1057 | 3300046683 | Ga0495658_0000497 | Ga0495658_0000497_18938_19894 | 313 |
| 1058 | 3300046684 | Ga0495669_0000096 | Ga0495669_0000096_39377_40324 | 313 |
| 1059 | 3300046690 | Ga0495624_0046274 | Ga0495624_0046274_553_1509 | 313 |
| 1060 | 3300046690 | Ga0495624_0163952 | Ga0495624_0163952_349_1305 | 313 |
| 1061 | 3300046809 | Ga0495600_0000042 | Ga0495600_0000042_23316_24272 | 313 |
| 1062 | 3300047315 | Ga0495581_0008078 | Ga0495581_0008078_2651_3607 | 313 |
| 1063 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_60637_61593 | 313 |
| 1064 | 3300047319 | Ga0495674_0000028 | Ga0495674_0000028_63046_64002 | 313 |
| 1065 | 3300047319 | Ga0495674_0192162 | Ga0495674_0192162_333_1316 | 313 |
| 1066 | 3300047319 | Ga0495674_0350370 | Ga0495674_0350370_185_1141 | 313 |
| 1067 | 3300047322 | Ga0495680_0001113 | Ga0495680_0001113_5410_6366 | 313 |
| 1068 | 3300047443 | Ga0495687_000378 | Ga0495687_000378_15253_16200 | 313 |
| 1069 | 3300047444 | Ga0495675_0000691 | Ga0495675_0000691_18986_19942 | 313 |
| 1070 | 3300047445 | Ga0495677_0002781 | Ga0495677_0002781_2943_3890 | 313 |
| 1071 | 3300047470 | Ga0495681_0000110 | Ga0495681_0000110_61919_62863 | 313 |
| 1072 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_60695_61651 | 313 |
| 1073 | 3300047673 | Ga0495593_0005631 | Ga0495593_0005631_3356_4312 | 313 |
| 1074 | 3300048088 | Ga0495602_0000022 | Ga0495602_0000022_23300_24256 | 313 |
| 1075 | 3300048088 | Ga0495602_0023164 | Ga0495602_0023164_1594_2535 | 313 |
| 1076 | 3300048090 | Ga0495615_0022915 | Ga0495615_0022915_194_1135 | 313 |
| 1077 | 3300048904 | Ga0496101_0091665 | Ga0496101_0091665_1194_2252 | 313 |
| 1078 | 3300048904 | Ga0496101_0164931 | Ga0496101_0164931_23_979 | 313 |
| 1079 | 3300048905 | Ga0496102_0023431 | Ga0496102_0023431_2007_3065 | 313 |
| 1080 | 3300048905 | Ga0496102_0059494 | Ga0496102_0059494_1549_2505 | 313 |
| 1081 | 3300048906 | Ga0496103_0039827 | Ga0496103_0039827_1159_2115 | 313 |
| 1082 | 3300048907 | Ga0496104_0000040 | Ga0496104_0000040_82175_83128 | 313 |
| 1083 | 3300048907 | Ga0496104_0000316 | Ga0496104_0000316_5094_6113 | 313 |
| 1084 | 3300048907 | Ga0496104_0002075 | Ga0496104_0002075_13588_14541 | 313 |
| 1085 | 3300048907 | Ga0496104_0035963 | Ga0496104_0035963_1351_2304 | 313 |
| 1086 | 3300048907 | Ga0496104_0096964 | Ga0496104_0096964_1031_2089 | 313 |
| 1087 | 3300048907 | Ga0496104_0403309 | Ga0496104_0403309_278_1231 | 313 |
| 1088 | 3300048908 | Ga0496105_0000060 | Ga0496105_0000060_82485_83438 | 313 |
| 1089 | 3300048908 | Ga0496105_0026202 | Ga0496105_0026202_1741_2694 | 313 |
| 1090 | 3300048908 | Ga0496105_0036677 | Ga0496105_0036677_2276_3229 | 313 |
| 1091 | 3300048910 | Ga0496107_0111587 | Ga0496107_0111587_1027_1971 | 313 |
| 1092 | 3300048911 | Ga0496108_0005349 | Ga0496108_0005349_7064_8008 | 313 |
| 1093 | 3300048911 | Ga0496108_0021285 | Ga0496108_0021285_2719_3777 | 313 |
| 1094 | 3300048912 | Ga0496109_0070289 | Ga0496109_0070289_868_1926 | 313 |
| 1095 | 3300048912 | Ga0496109_0076001 | Ga0496109_0076001_1289_2242 | 313 |
| 1096 | 3300048913 | Ga0496110_0002032 | Ga0496110_0002032_9353_10372 | 313 |
| 1097 | 3300048914 | Ga0496111_0030447 | Ga0496111_0030447_1743_2762 | 313 |
| 1098 | 3300048914 | Ga0496111_0042787 | Ga0496111_0042787_2147_3103 | 313 |
| 1099 | 3300048914 | Ga0496111_0084443 | Ga0496111_0084443_577_1518 | 313 |
| 1100 | 3300048914 | Ga0496111_0139830 | Ga0496111_0139830_389_1447 | 313 |
| 1101 | 3300048915 | Ga0496112_0004086 | Ga0496112_0004086_9765_10718 | 313 |
| 1102 | 3300048915 | Ga0496112_0027234 | Ga0496112_0027234_2334_3353 | 313 |
| 1103 | 3300048915 | Ga0496112_0317958 | Ga0496112_0317958_309_1277 | 313 |
| 1104 | 3300048916 | Ga0496113_0004024 | Ga0496113_0004024_2391_3410 | 313 |
| 1105 | 3300048916 | Ga0496113_0040657 | Ga0496113_0040657_1384_2337 | 313 |
| 1106 | 3300048918 | Ga0496115_0028629 | Ga0496115_0028629_1288_2346 | 313 |
| 1107 | 3300048918 | Ga0496115_0060528 | Ga0496115_0060528_1429_2385 | 313 |
| 1108 | 3300048922 | Ga0496119_0002688 | Ga0496119_0002688_15931_16884 | 313 |
| 1109 | 3300048924 | Ga0496121_0147076 | Ga0496121_0147076_444_1391 | 313 |
| 1110 | 3300048926 | Ga0496123_0129844 | Ga0496123_0129844_301_1338 | 313 |
| 1111 | 3300048928 | Ga0496125_0292461 | Ga0496125_0292461_14_958 | 313 |
| 1112 | 3300048929 | Ga0496126_0002680 | Ga0496126_0002680_9021_9980 | 313 |
| 1113 | 3300048929 | Ga0496126_0091998 | Ga0496126_0091998_431_1390 | 313 |
| 1114 | 3300048929 | Ga0496126_0195334 | Ga0496126_0195334_131_1084 | 313 |
| 1115 | 3300049459 | Ga0495678_015954 | Ga0495678_015954_1337_2281 | 313 |
| 1116 | 3300049460 | Ga0495682_0005841 | Ga0495682_0005841_4023_4979 | 313 |
| 1117 | 3300049568 | Ga0501031_0022369 | Ga0501031_0022369_2093_3052 | 313 |
| 1118 | 3300049569 | Ga0501032_0026639 | Ga0501032_0026639_2536_3504 | 313 |
| 1119 | 3300049569 | Ga0501032_0181853 | Ga0501032_0181853_234_1190 | 313 |
| 1120 | 3300049570 | Ga0501033_0010904 | Ga0501033_0010904_2182_3138 | 313 |
| 1121 | 3300049570 | Ga0501033_0089119 | Ga0501033_0089119_592_1548 | 313 |
| 1122 | 3300049570 | Ga0501033_0120461 | Ga0501033_0120461_551_1510 | 313 |
| 1123 | 3300049571 | Ga0501034_0005576 | Ga0501034_0005576_2182_3138 | 313 |
| 1124 | 3300049571 | Ga0501034_0009494 | Ga0501034_0009494_315_1271 | 313 |
| 1125 | 3300049571 | Ga0501034_0061063 | Ga0501034_0061063_903_1859 | 313 |
| 1126 | 3300049571 | Ga0501034_0072766 | Ga0501034_0072766_2131_3087 | 313 |
| 1127 | 3300049571 | Ga0501034_0142028 | Ga0501034_0142028_887_1861 | 313 |
| 1128 | 3300049571 | Ga0501034_0313760 | Ga0501034_0313760_305_1261 | 313 |
| 1129 | 3300049572 | Ga0501036_0005785 | Ga0501036_0005785_549_1505 | 313 |
| 1130 | 3300049572 | Ga0501036_0123265 | Ga0501036_0123265_991_1947 | 313 |
| 1131 | 3300049573 | Ga0501037_0002948 | Ga0501037_0002948_3834_4790 | 313 |
| 1132 | 3300049573 | Ga0501037_0263761 | Ga0501037_0263761_72_1031 | 313 |
| 1133 | 3300049574 | Ga0501038_0000843 | Ga0501038_0000843_5963_6919 | 313 |
| 1134 | 3300049574 | Ga0501038_0028450 | Ga0501038_0028450_3726_4694 | 313 |
| 1135 | 3300049574 | Ga0501038_0052840 | Ga0501038_0052840_2165_3124 | 313 |
| 1136 | 3300049574 | Ga0501038_0089951 | Ga0501038_0089951_235_1191 | 313 |
| 1137 | 3300049574 | Ga0501038_0143461 | Ga0501038_0143461_248_1204 | 313 |
| 1138 | 3300049575 | Ga0501039_0006533 | Ga0501039_0006533_4852_5808 | 313 |
| 1139 | 3300049579 | Ga0501043_0010724 | Ga0501043_0010724_3457_4413 | 313 |
| 1140 | 3300049580 | Ga0501046_0003200 | Ga0501046_0003200_3082_4038 | 313 |
| 1141 | 3300049580 | Ga0501046_0012717 | Ga0501046_0012717_531_1487 | 313 |
| 1142 | 3300049581 | Ga0501047_0006810 | Ga0501047_0006810_2310_3266 | 313 |
| 1143 | 3300049581 | Ga0501047_0010868 | Ga0501047_0010868_4854_5822 | 313 |
| 1144 | 3300049581 | Ga0501047_0167775 | Ga0501047_0167775_78_1034 | 313 |
| 1145 | 3300049581 | Ga0501047_0313049 | Ga0501047_0313049_159_1328 | 313 |
| 1146 | 3300049582 | Ga0501048_0003240 | Ga0501048_0003240_8176_9132 | 313 |
| 1147 | 3300049583 | Ga0501067_0003372 | Ga0501067_0003372_7499_8455 | 313 |
| 1148 | 3300049583 | Ga0501067_0015846 | Ga0501067_0015846_2936_3892 | 313 |
| 1149 | 3300049583 | Ga0501067_0055584 | Ga0501067_0055584_755_1699 | 313 |
| 1150 | 3300049583 | Ga0501067_0063225 | Ga0501067_0063225_1012_1968 | 313 |
| 1151 | 3300049584 | Ga0501068_0001776 | Ga0501068_0001776_3882_4838 | 313 |
| 1152 | 3300049584 | Ga0501068_0032115 | Ga0501068_0032115_182_1138 | 313 |
| 1153 | 3300049584 | Ga0501068_0072378 | Ga0501068_0072378_959_1903 | 313 |
| 1154 | 3300049585 | Ga0501069_0006219 | Ga0501069_0006219_5244_6200 | 313 |
| 1155 | 3300049585 | Ga0501069_0031823 | Ga0501069_0031823_1388_2344 | 313 |
| 1156 | 3300049585 | Ga0501069_0103639 | Ga0501069_0103639_148_1104 | 313 |
| 1157 | 3300049586 | Ga0501070_0000024 | Ga0501070_0000024_122818_123777 | 313 |
| 1158 | 3300049586 | Ga0501070_0003223 | Ga0501070_0003223_7382_8338 | 313 |
| 1159 | 3300049586 | Ga0501070_0008662 | Ga0501070_0008662_264_1220 | 313 |
| 1160 | 3300049586 | Ga0501070_0025471 | Ga0501070_0025471_3457_4413 | 313 |
| 1161 | 3300049586 | Ga0501070_0030575 | Ga0501070_0030575_1938_2891 | 313 |
| 1162 | 3300049586 | Ga0501070_0058101 | Ga0501070_0058101_906_1862 | 313 |
| 1163 | 3300049586 | Ga0501070_0063974 | Ga0501070_0063974_164_1120 | 313 |
| 1164 | 3300049586 | Ga0501070_0065460 | Ga0501070_0065460_471_1427 | 313 |
| 1165 | 3300049586 | Ga0501070_0163411 | Ga0501070_0163411_12_968 | 313 |
| 1166 | 3300049587 | Ga0501071_0018083 | Ga0501071_0018083_2867_3823 | 313 |
| 1167 | 3300049588 | Ga0501072_0010755 | Ga0501072_0010755_5888_6844 | 313 |
| 1168 | 3300049589 | Ga0501073_0019692 | Ga0501073_0019692_1957_2913 | 313 |
| 1169 | 3300049589 | Ga0501073_0029021 | Ga0501073_0029021_689_1645 | 313 |
| 1170 | 3300049589 | Ga0501073_0046862 | Ga0501073_0046862_1175_2134 | 313 |
| 1171 | 3300049589 | Ga0501073_0051648 | Ga0501073_0051648_233_1189 | 313 |
| 1172 | 3300049589 | Ga0501073_0083510 | Ga0501073_0083510_308_1264 | 313 |
| 1173 | 3300049589 | Ga0501073_0234866 | Ga0501073_0234866_36_1004 | 313 |
| 1174 | 3300049590 | Ga0501074_0003356 | Ga0501074_0003356_1691_2647 | 313 |
| 1175 | 3300049590 | Ga0501074_0071243 | Ga0501074_0071243_12_965 | 313 |
| 1176 | 3300049590 | Ga0501074_0107374 | Ga0501074_0107374_352_1335 | 313 |
| 1177 | 3300049590 | Ga0501074_0146591 | Ga0501074_0146591_204_1160 | 313 |
| 1178 | 3300049591 | Ga0501075_0097733 | Ga0501075_0097733_12_965 | 313 |
| 1179 | 3300049592 | Ga0501076_0004022 | Ga0501076_0004022_6029_6982 | 313 |
| 1180 | 3300049593 | Ga0501077_0001770 | Ga0501077_0001770_4784_5737 | 313 |
| 1181 | 3300049741 | Ga0501079_0033484 | Ga0501079_0033484_54_1007 | 313 |
| 1182 | 3300049741 | Ga0501079_0138816 | Ga0501079_0138816_387_1343 | 313 |
| 1183 | 3300049741 | Ga0501079_0188434 | Ga0501079_0188434_213_1172 | 313 |
| 1184 | 3300049741 | Ga0501079_0338998 | Ga0501079_0338998_178_1134 | 313 |
| 1185 | 3300049742 | Ga0501080_0002884 | Ga0501080_0002884_9180_10139 | 313 |
| 1186 | 3300049742 | Ga0501080_0011105 | Ga0501080_0011105_3829_4785 | 313 |
| 1187 | 3300049742 | Ga0501080_0019967 | Ga0501080_0019967_3740_4909 | 313 |
| 1188 | 3300049742 | Ga0501080_0026141 | Ga0501080_0026141_3044_4000 | 313 |
| 1189 | 3300049742 | Ga0501080_0068934 | Ga0501080_0068934_2235_3191 | 313 |
| 1190 | 3300049742 | Ga0501080_0158149 | Ga0501080_0158149_388_1347 | 313 |
| 1191 | 3300049742 | Ga0501080_0186438 | Ga0501080_0186438_406_1362 | 313 |
| 1192 | 3300049742 | Ga0501080_0349284 | Ga0501080_0349284_170_1129 | 313 |
| 1193 | 3300049743 | Ga0501081_0007060 | Ga0501081_0007060_2405_3358 | 313 |
| 1194 | 3300049744 | Ga0501083_0010892 | Ga0501083_0010892_3269_4225 | 313 |
| 1195 | 3300049822 | Ga0501035_0000371 | Ga0501035_0000371_44118_45074 | 313 |
| 1196 | 3300049822 | Ga0501035_0009698 | Ga0501035_0009698_3918_4877 | 313 |
| 1197 | 3300049822 | Ga0501035_0029527 | Ga0501035_0029527_3457_4413 | 313 |
| 1198 | 3300049822 | Ga0501035_0057030 | Ga0501035_0057030_385_1341 | 313 |
| 1199 | 3300049822 | Ga0501035_0147823 | Ga0501035_0147823_151_1107 | 313 |
| 1200 | 3300049822 | Ga0501035_0207155 | Ga0501035_0207155_661_1629 | 313 |
| 1201 | 3300049822 | Ga0501035_0431924 | Ga0501035_0431924_58_1014 | 313 |
| 1202 | 3300049823 | Ga0501044_0002209 | Ga0501044_0002209_6752_7711 | 313 |
| 1203 | 3300049823 | Ga0501044_0020418 | Ga0501044_0020418_1538_2506 | 313 |
| 1204 | 3300049823 | Ga0501044_0026362 | Ga0501044_0026362_4375_5331 | 313 |
| 1205 | 3300049823 | Ga0501044_0087370 | Ga0501044_0087370_1958_2914 | 313 |
| 1206 | 3300049823 | Ga0501044_0114874 | Ga0501044_0114874_1235_2191 | 313 |
| 1207 | 3300049823 | Ga0501044_0435360 | Ga0501044_0435360_226_1182 | 313 |
| 1208 | 3300050490 | nmdc:mga03n38_595_c1 | nmdc:mga03n38_595_c1_4487_5506 | 313 |
| 1209 | 3300050490 | nmdc:mga03n38_73454_c1 | nmdc:mga03n38_73454_c1_311_1270 | 313 |
| 1210 | 3300050491 | nmdc:mga00v17_5162_c1 | nmdc:mga00v17_5162_c1_1080_2099 | 313 |
| 1211 | 3300050492 | nmdc:mga0yw44_207906_c1 | nmdc:mga0yw44_207906_c1_71_1033 | 313 |
| 1212 | 3300050492 | nmdc:mga0yw44_2703_c1 | nmdc:mga0yw44_2703_c1_3086_4042 | 313 |
| 1213 | 3300050494 | nmdc:mga06z11_123_c1 | nmdc:mga06z11_123_c1_27119_28138 | 313 |
| 1214 | 3300050494 | nmdc:mga06z11_87811_c1 | nmdc:mga06z11_87811_c1_44_1018 | 313 |
| 1215 | 3300050495 | nmdc:mga04h51_46045_c1 | nmdc:mga04h51_46045_c1_370_1344 | 313 |
| 1216 | 3300050507 | nmdc:mga05p37_197560_c1 | nmdc:mga05p37_197560_c1_741_1715 | 313 |
| 1217 | 3300050507 | nmdc:mga05p37_2001_c1 | nmdc:mga05p37_2001_c1_18069_19025 | 313 |
| 1218 | 3300050507 | nmdc:mga05p37_216337_c1 | nmdc:mga05p37_216337_c1_731_1705 | 313 |
| 1219 | 3300050507 | nmdc:mga05p37_564_c1 | nmdc:mga05p37_564_c1_7255_8211 | 313 |
| 1220 | 3300050507 | nmdc:mga05p37_94737_c1 | nmdc:mga05p37_94737_c1_1754_2710 | 313 |
| 1221 | 3300050508 | nmdc:mga09592_20905_c1 | nmdc:mga09592_20905_c1_745_1701 | 313 |
| 1222 | 3300050508 | nmdc:mga09592_430002_c1 | nmdc:mga09592_430002_c1_15_989 | 313 |
| 1223 | 3300050508 | nmdc:mga09592_47868_c1 | nmdc:mga09592_47868_c1_2056_3030 | 313 |
| 1224 | 3300050509 | nmdc:mga0qj67_21757_c1 | nmdc:mga0qj67_21757_c1_823_1764 | 313 |
| 1225 | 3300050509 | nmdc:mga0qj67_46501_c1 | nmdc:mga0qj67_46501_c1_190_1164 | 313 |
| 1226 | 3300050510 | nmdc:mga06r32_191_c1 | nmdc:mga06r32_191_c1_32583_33539 | 313 |
| 1227 | 3300050510 | nmdc:mga06r32_335094_c1 | nmdc:mga06r32_335094_c1_226_1200 | 313 |
| 1228 | 3300050511 | nmdc:mga08y16_272171_c1 | nmdc:mga08y16_272171_c1_526_1479 | 313 |
| 1229 | 3300050511 | nmdc:mga08y16_67805_c1 | nmdc:mga08y16_67805_c1_916_1890 | 313 |
| 1230 | 3300050511 | nmdc:mga08y16_89_c1 | nmdc:mga08y16_89_c1_70222_71178 | 313 |
| 1231 | 3300050512 | nmdc:mga0n895_110202_c1 | nmdc:mga0n895_110202_c1_1243_2199 | 313 |
| 1232 | 3300050512 | nmdc:mga0n895_22520_c1 | nmdc:mga0n895_22520_c1_3203_4162 | 313 |
| 1233 | 3300050512 | nmdc:mga0n895_97197_c1 | nmdc:mga0n895_97197_c1_1225_2178 | 313 |
| 1234 | 3300050513 | nmdc:mga0rr50_34672_c1 | nmdc:mga0rr50_34672_c1_606_1565 | 313 |
| 1235 | 3300050513 | nmdc:mga0rr50_81139_c1 | nmdc:mga0rr50_81139_c1_1055_2008 | 313 |
| 1236 | 3300050514 | nmdc:mga08x19_129089_c1 | nmdc:mga08x19_129089_c1_481_1440 | 313 |
| 1237 | 3300050514 | nmdc:mga08x19_94_c1 | nmdc:mga08x19_94_c1_43395_44354 | 313 |
| 1238 | 3300050515 | nmdc:mga0a205_74953_c1 | nmdc:mga0a205_74953_c1_2129_3085 | 313 |
| 1239 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_100195_101151 | 313 |
| 1240 | 3300053077 | Ga0495601_0287949 | Ga0495601_0287949_77_1027 | 313 |
| 1241 | 3300053078 | Ga0495612_0000003 | Ga0495612_0000003_241954_242910 | 313 |
| 1242 | 3300053079 | Ga0500610_0000197 | Ga0500610_0000197_11747_12694 | 313 |
| 1243 | 3300053084 | Ga0495595_0000093 | Ga0495595_0000093_23308_24264 | 313 |
| 1244 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_100226_101182 | 313 |
| 1245 | 3300053085 | Ga0495619_0050091 | Ga0495619_0050091_1780_2736 | 313 |
| 1246 | 3300053085 | Ga0495619_0230697 | Ga0495619_0230697_265_1221 | 313 |
| 1247 | 3300053086 | Ga0500578_0118312 | Ga0500578_0118312_194_1147 | 313 |
| 1248 | 3300053091 | Ga0500647_0030771 | Ga0500647_0030771_1134_2081 | 313 |
| 1249 | 3300053093 | Ga0500651_0006181 | Ga0500651_0006181_5787_6728 | 313 |
| 1250 | 3300053094 | Ga0500566_0166802 | Ga0500566_0166802_31_984 | 313 |
| 1251 | 3300053096 | Ga0500641_0020633 | Ga0500641_0020633_1479_2438 | 313 |
| 1252 | 3300053119 | Ga0500595_013327 | Ga0500595_013327_610_1566 | 313 |
| 1253 | 3300053119 | Ga0500595_021227 | Ga0500595_021227_977_1930 | 313 |
| 1254 | 3300053120 | Ga0500597_002095 | Ga0500597_002095_2955_3902 | 313 |
| 1255 | 3300053125 | Ga0500618_004151 | Ga0500618_004151_55_1002 | 313 |
| 1256 | 3300053130 | Ga0500642_0009494 | Ga0500642_0009494_1945_2886 | 313 |
| 1257 | 3300053131 | Ga0500652_000056 | Ga0500652_000056_997_1950 | 313 |
| 1258 | 3300053133 | Ga0500655_000024 | Ga0500655_000024_11992_12933 | 313 |
| 1259 | 3300053133 | Ga0500655_010896 | Ga0500655_010896_38_994 | 313 |
| 1260 | 3300053134 | Ga0500658_0050268 | Ga0500658_0050268_175_1131 | 313 |
| 1261 | 3300053134 | Ga0500658_0056297 | Ga0500658_0056297_308_1264 | 313 |
| 1262 | 3300053137 | Ga0500561_0040921 | Ga0500561_0040921_51_1004 | 313 |
| 1263 | 3300053140 | Ga0500573_0000046 | Ga0500573_0000046_11392_12339 | 313 |
| 1264 | 3300053148 | Ga0500590_000243 | Ga0500590_000243_12840_13781 | 313 |
| 1265 | 3300053153 | Ga0500616_0062964 | Ga0500616_0062964_273_1226 | 313 |
| 1266 | 3300053154 | Ga0500619_005042 | Ga0500619_005042_471_1427 | 313 |
| 1267 | 3300053156 | Ga0500622_0011869 | Ga0500622_0011869_239_1180 | 313 |
| 1268 | 3300053157 | Ga0500624_000001 | Ga0500624_000001_166285_167232 | 313 |
| 1269 | 3300053177 | Ga0500636_0010157 | Ga0500636_0010157_4462_5415 | 313 |
| 1270 | 3300053177 | Ga0500636_0060093 | Ga0500636_0060093_155_1108 | 313 |
| 1271 | 3300053178 | Ga0500637_0000010 | Ga0500637_0000010_30806_31753 | 313 |
| 1272 | 3300053724 | Ga0500570_000188 | Ga0500570_000188_11723_12664 | 313 |
| 1273 | 3300053730 | Ga0500645_000008 | Ga0500645_000008_169100_170047 | 313 |
| 1274 | 3300054114 | Ga0501084_0000363 | Ga0501084_0000363_14922_15878 | 313 |
| 1275 | 3300054114 | Ga0501084_0006757 | Ga0501084_0006757_4642_5595 | 313 |
| 1276 | 3300054114 | Ga0501084_0028335 | Ga0501084_0028335_386_1342 | 313 |
| 1277 | 3300054114 | Ga0501084_0075852 | Ga0501084_0075852_87_1043 | 313 |
| 1278 | 3300054114 | Ga0501084_0127741 | Ga0501084_0127741_285_1241 | 313 |
| 1279 | 3300060353 | Ga0501082_0002420 | Ga0501082_0002420_3275_4228 | 313 |
| 1280 | 3300060353 | Ga0501082_0012588 | Ga0501082_0012588_4828_5796 | 313 |
| 1281 | 3300060353 | Ga0501082_0016405 | Ga0501082_0016405_403_1359 | 313 |
| 1282 | 3300060353 | Ga0501082_0071723 | Ga0501082_0071723_106_1062 | 313 |
| 1283 | 3300061719 | Ga0466962_0014485 | Ga0466962_0014485_432_1376 | 313 |
| 1284 | 3300061719 | Ga0466962_0074237 | Ga0466962_0074237_275_1216 | 313 |
| 1285 | iso_pu_bacteria | 2765235802 | 2765467876 | 313 |
| 1286 | iso_pu_bacteria | 2767802442 | 2770198622 | 313 |
| 1287 | iso_pu_bacteria | 2818991467 | 2819721296 | 313 |
| 1288 | iso_pu_bacteria | 2928521798 | 2928526593 | 313 |
| 1289 | iso_pu_bacteria | 2954011201 | 2954013417 | 313 |
| 1290 | iso_pu_bacteria | 8054302542 | 8054304165 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.965 | 4 | 313 |
| 5kdr-assembly1.cif.gz_A-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.9574 | 5 | 313 |
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9564 | 3 | 313 |
| 2f9i-assembly1.cif.gz_A | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9548 | 2 | 313 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9492 | 4 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9693 | 4 | 313 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9572 | 4 | 313 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9363 | 54 | 313 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9222 | 54 | 313 | 3.90.226.10 |
| af_A4I399_1_165_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.817 | 143 | 295 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1YGC9-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9927 | 1 | 313 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A1V5LIY6-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9924 | 185 | 313 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A258Z5K8-F1-model_v4 | deleted | 0.9922 | 1 | 313 |
|
| AF-A0A7W6H3U6-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9918 | 1 | 313 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A7Y9RDZ1-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9914 | 1 | 310 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar