F492555
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1283 | 542 | 2566 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0730883|Ga0466965_0730883_154_522 |
| Length | 109 |
| Sequence | LVVTPWRRVDMKLITAIVKPFTLDDVKTSLEEAGVLGMTVSEVQGYGRQKGHTEVYRGAEYSVEFVPKVRIEVVVRAARTGKIGDGKVWVSPVETVVRVRTGERGPDAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 225 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 226 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 227 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 228 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 229 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 230 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 231 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 246 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 254 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 255 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 262 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 263 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 264 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 265 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 266 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 271 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 273 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 285 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 292 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 293 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 300 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 308 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 313 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 320 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 321 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 322 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 323 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 324 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 325 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 326 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 327 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 328 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 329 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 330 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 333 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 334 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 335 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 336 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 337 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 338 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 339 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 340 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 341 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 342 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 408 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 463 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 467 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 470 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 471 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 473 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 474 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 476 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 477 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 478 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 480 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 482 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 492 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 493 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 494 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 495 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 496 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 497 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 498 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 499 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 500 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 501 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 502 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 503 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 504 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 505 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 506 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 507 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 508 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 509 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 510 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 511 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 512 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 513 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 514 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 515 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 516 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 517 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 518 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 519 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 520 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 521 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 522 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 523 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 524 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 525 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 526 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 527 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 528 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 529 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 530 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 531 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 532 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 533 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 534 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 535 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 536 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 537 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 538 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 539 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 540 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 541 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 542 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.3 |
| Metatranscriptomes | 2.65 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.08 |
| Bulb | 0 |
| Endosphere | 5.77 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 79.58 |
| Stem | 0 |
| Stem Tuber | 0.16 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466965_0730883 | 3300044683 | Bacteria | 570 |
| 2 | MBSR1b_contig_13805831 | 2162886012 | Bacteria | 1919 |
| 3 | LJQas_1036547 | 3300000549 | Bacteria | 578 |
| 4 | LJQas_1046351 | 3300000549 | Bacteria | 518 |
| 5 | JGI24737J22298_10192071 | 3300001990 | Bacteria | 603 |
| 6 | JGI24735J21928_10219037 | 3300002067 | Bacteria | 553 |
| 7 | JGI24745J21846_1050926 | 3300002073 | Bacteria | 525 |
| 8 | JGI24738J21930_10007846 | 3300002075 | Bacteria | 2447 |
| 9 | JGI24744J21845_10004671 | 3300002077 | Bacteria | 2831 |
| 10 | JGI25406J46586_10000557 | 3300003203 | Bacteria | 17606 |
| 11 | JGI25404J52841_10117817 | 3300003659 | Bacteria | 559 |
| 12 | Ga0032354_1059068 | 3300003693 | Bacteria | 568 |
| 13 | JGI25405J52794_10122767 | 3300003911 | Bacteria | 586 |
| 14 | JGI25405J52794_10127411 | 3300003911 | Bacteria | 575 |
| 15 | Ga0058861_10062782 | 3300004800 | Bacteria | 677 |
| 16 | Ga0065715_10107560 | 3300005293 | Bacteria | 2765 |
| 17 | Ga0070658_10002468 | 3300005327 | Bacteria | 15449 |
| 18 | Ga0070658_10043582 | 3300005327 | Bacteria | 3624 |
| 19 | Ga0070658_10109830 | 3300005327 | Bacteria | 2284 |
| 20 | Ga0070683_100107447 | 3300005329 | Bacteria | 2631 |
| 21 | Ga0070683_100820770 | 3300005329 | Bacteria | 892 |
| 22 | Ga0070683_100969589 | 3300005329 | Bacteria | 816 |
| 23 | Ga0070683_101124831 | 3300005329 | Bacteria | 754 |
| 24 | Ga0070683_101747337 | 3300005329 | Bacteria | 598 |
| 25 | Ga0070683_101811745 | 3300005329 | Bacteria | 587 |
| 26 | Ga0070690_100193406 | 3300005330 | Bacteria | 1412 |
| 27 | Ga0070670_100088299 | 3300005331 | Bacteria | 2665 |
| 28 | Ga0070670_100923993 | 3300005331 | Bacteria | 792 |
| 29 | Ga0070677_10030834 | 3300005333 | Bacteria | 2044 |
| 30 | Ga0068869_100137882 | 3300005334 | Bacteria | 1881 |
| 31 | Ga0068869_100277018 | 3300005334 | Bacteria | 1348 |
| 32 | Ga0070666_10060982 | 3300005335 | Bacteria | 2553 |
| 33 | Ga0070666_11502518 | 3300005335 | Bacteria | 504 |
| 34 | Ga0070680_100092789 | 3300005336 | Bacteria | 2500 |
| 35 | Ga0070680_100335651 | 3300005336 | Bacteria | 1284 |
| 36 | Ga0070680_100997479 | 3300005336 | Bacteria | 723 |
| 37 | Ga0070682_100022697 | 3300005337 | Bacteria | 3719 |
| 38 | Ga0070682_100038748 | 3300005337 | Bacteria | 2925 |
| 39 | Ga0070682_101319965 | 3300005337 | Bacteria | 614 |
| 40 | Ga0070682_101940647 | 3300005337 | Bacteria | 517 |
| 41 | Ga0068868_100005750 | 3300005338 | Bacteria | 8729 |
| 42 | Ga0068868_100048391 | 3300005338 | Bacteria | 3335 |
| 43 | Ga0068868_100100866 | 3300005338 | Bacteria | 2336 |
| 44 | Ga0070660_100840550 | 3300005339 | Bacteria | 773 |
| 45 | Ga0070687_100055582 | 3300005343 | Bacteria | 2068 |
| 46 | Ga0070661_100002837 | 3300005344 | Bacteria | 11909 |
| 47 | Ga0070661_100063531 | 3300005344 | Bacteria | 2712 |
| 48 | Ga0070692_10040065 | 3300005345 | Bacteria | 2394 |
| 49 | Ga0070692_10328616 | 3300005345 | Bacteria | 943 |
| 50 | Ga0070668_100014673 | 3300005347 | Bacteria | 5854 |
| 51 | Ga0070668_100544140 | 3300005347 | Bacteria | 1010 |
| 52 | Ga0070668_100568207 | 3300005347 | Bacteria | 989 |
| 53 | Ga0070668_101101810 | 3300005347 | Bacteria | 717 |
| 54 | Ga0070669_100032308 | 3300005353 | Bacteria | 3781 |
| 55 | Ga0070669_100593025 | 3300005353 | Bacteria | 928 |
| 56 | Ga0070675_100008970 | 3300005354 | Bacteria | 7769 |
| 57 | Ga0070675_100116574 | 3300005354 | Bacteria | 2266 |
| 58 | Ga0070671_100009707 | 3300005355 | Bacteria | 7733 |
| 59 | Ga0070671_100059001 | 3300005355 | Bacteria | 3193 |
| 60 | Ga0070674_100016409 | 3300005356 | Bacteria | 4640 |
| 61 | Ga0070674_100112789 | 3300005356 | Bacteria | 1999 |
| 62 | Ga0070673_100038671 | 3300005364 | Bacteria | 3645 |
| 63 | Ga0070673_100106514 | 3300005364 | Bacteria | 2318 |
| 64 | Ga0070688_100457717 | 3300005365 | Bacteria | 955 |
| 65 | Ga0070659_100003049 | 3300005366 | Bacteria | 11910 |
| 66 | Ga0070659_100138579 | 3300005366 | Bacteria | 1980 |
| 67 | Ga0070659_101135028 | 3300005366 | Bacteria | 690 |
| 68 | Ga0070667_100002382 | 3300005367 | Bacteria | 16463 |
| 69 | Ga0070667_101023389 | 3300005367 | Bacteria | 771 |
| 70 | Ga0070667_102240508 | 3300005367 | Bacteria | 515 |
| 71 | Ga0070709_10004981 | 3300005434 | Bacteria | 7175 |
| 72 | Ga0070709_10488370 | 3300005434 | Bacteria | 934 |
| 73 | Ga0070714_100003983 | 3300005435 | Bacteria | 11105 |
| 74 | Ga0070714_100342641 | 3300005435 | Bacteria | 1402 |
| 75 | Ga0070714_100467228 | 3300005435 | Bacteria | 1200 |
| 76 | Ga0070714_101186435 | 3300005435 | Bacteria | 744 |
| 77 | Ga0070714_101283910 | 3300005435 | Bacteria | 714 |
| 78 | Ga0070714_101286937 | 3300005435 | Bacteria | 714 |
| 79 | Ga0070714_101324811 | 3300005435 | Bacteria | 703 |
| 80 | Ga0070714_101404150 | 3300005435 | Bacteria | 682 |
| 81 | Ga0070713_100011881 | 3300005436 | Bacteria | 6364 |
| 82 | Ga0070713_100017433 | 3300005436 | Bacteria | 5431 |
| 83 | Ga0070713_100048887 | 3300005436 | Bacteria | 3486 |
| 84 | Ga0070713_100353447 | 3300005436 | Bacteria | 1364 |
| 85 | Ga0070710_11311151 | 3300005437 | Bacteria | 539 |
| 86 | Ga0070701_10239923 | 3300005438 | Bacteria | 1090 |
| 87 | Ga0070711_100094253 | 3300005439 | Bacteria | 2164 |
| 88 | Ga0070711_100393065 | 3300005439 | Bacteria | 1124 |
| 89 | Ga0070705_100062276 | 3300005440 | Bacteria | 2221 |
| 90 | Ga0070705_100144281 | 3300005440 | Bacteria | 1571 |
| 91 | Ga0070705_100241026 | 3300005440 | Bacteria | 1263 |
| 92 | Ga0070700_100000496 | 3300005441 | Bacteria | 19728 |
| 93 | Ga0070700_101016083 | 3300005441 | Bacteria | 682 |
| 94 | Ga0070700_101048998 | 3300005441 | Bacteria | 673 |
| 95 | Ga0070694_101037677 | 3300005444 | Bacteria | 682 |
| 96 | Ga0070708_100005249 | 3300005445 | Bacteria | 10254 |
| 97 | Ga0070708_100096059 | 3300005445 | Bacteria | 2707 |
| 98 | Ga0070708_100247871 | 3300005445 | Bacteria | 1673 |
| 99 | Ga0070708_100264011 | 3300005445 | Bacteria | 1619 |
| 100 | Ga0070708_100308219 | 3300005445 | Bacteria | 1491 |
| 101 | Ga0070708_102151090 | 3300005445 | Bacteria | 516 |
| 102 | Ga0070663_100983908 | 3300005455 | Bacteria | 733 |
| 103 | Ga0070663_101150253 | 3300005455 | Bacteria | 680 |
| 104 | Ga0070678_100975708 | 3300005456 | Bacteria | 778 |
| 105 | Ga0070662_100006929 | 3300005457 | Bacteria | 7337 |
| 106 | Ga0070662_100748197 | 3300005457 | Bacteria | 829 |
| 107 | Ga0070681_10043185 | 3300005458 | Bacteria | 4517 |
| 108 | Ga0070681_10105264 | 3300005458 | Bacteria | 2763 |
| 109 | Ga0070681_10506869 | 3300005458 | Bacteria | 1120 |
| 110 | Ga0068867_100032224 | 3300005459 | Bacteria | 3789 |
| 111 | Ga0070685_10580833 | 3300005466 | Bacteria | 804 |
| 112 | Ga0070706_100010863 | 3300005467 | Bacteria | 8452 |
| 113 | Ga0070706_100020839 | 3300005467 | Bacteria | 6036 |
| 114 | Ga0070706_100111106 | 3300005467 | Bacteria | 2551 |
| 115 | Ga0070706_100123859 | 3300005467 | Bacteria | 2410 |
| 116 | Ga0070706_100254659 | 3300005467 | Bacteria | 1639 |
| 117 | Ga0070706_100395776 | 3300005467 | Bacteria | 1286 |
| 118 | Ga0070706_100431228 | 3300005467 | Bacteria | 1227 |
| 119 | Ga0070706_100510977 | 3300005467 | Bacteria | 1118 |
| 120 | Ga0070706_100923094 | 3300005467 | Bacteria | 806 |
| 121 | Ga0070706_101289851 | 3300005467 | Bacteria | 670 |
| 122 | Ga0070707_100026702 | 3300005468 | Bacteria | 5485 |
| 123 | Ga0070707_100036027 | 3300005468 | Bacteria | 4720 |
| 124 | Ga0070707_100053090 | 3300005468 | Bacteria | 3885 |
| 125 | Ga0070707_100597833 | 3300005468 | Bacteria | 1066 |
| 126 | Ga0070707_100648085 | 3300005468 | Bacteria | 1019 |
| 127 | Ga0070707_100752743 | 3300005468 | Bacteria | 938 |
| 128 | Ga0070698_100010804 | 3300005471 | Bacteria | 9716 |
| 129 | Ga0070698_100026804 | 3300005471 | Bacteria | 5994 |
| 130 | Ga0070698_100636328 | 3300005471 | Bacteria | 1008 |
| 131 | Ga0070698_101187327 | 3300005471 | Bacteria | 712 |
| 132 | Ga0070698_101953425 | 3300005471 | Bacteria | 540 |
| 133 | Ga0070699_100142129 | 3300005518 | Bacteria | 2120 |
| 134 | Ga0070699_100279351 | 3300005518 | Bacteria | 1496 |
| 135 | Ga0070699_100852791 | 3300005518 | Bacteria | 834 |
| 136 | Ga0070679_100020333 | 3300005530 | Bacteria | 6470 |
| 137 | Ga0070679_100268044 | 3300005530 | Bacteria | 1662 |
| 138 | Ga0070679_100473434 | 3300005530 | Bacteria | 1197 |
| 139 | Ga0070679_101455580 | 3300005530 | Bacteria | 632 |
| 140 | Ga0070679_101722982 | 3300005530 | Bacteria | 575 |
| 141 | Ga0070684_100034430 | 3300005535 | Bacteria | 4331 |
| 142 | Ga0070684_100098733 | 3300005535 | Bacteria | 2605 |
| 143 | Ga0070684_100240053 | 3300005535 | Bacteria | 1656 |
| 144 | Ga0070684_100750930 | 3300005535 | Bacteria | 911 |
| 145 | Ga0070684_100784902 | 3300005535 | Bacteria | 890 |
| 146 | Ga0070684_101139896 | 3300005535 | Bacteria | 733 |
| 147 | Ga0070684_101552384 | 3300005535 | Bacteria | 624 |
| 148 | Ga0070684_101642613 | 3300005535 | Bacteria | 606 |
| 149 | Ga0070684_101647483 | 3300005535 | Bacteria | 605 |
| 150 | Ga0070684_101831130 | 3300005535 | Bacteria | 573 |
| 151 | Ga0070697_100076709 | 3300005536 | Bacteria | 2748 |
| 152 | Ga0070697_100309081 | 3300005536 | Bacteria | 1360 |
| 153 | Ga0070697_100343878 | 3300005536 | Bacteria | 1287 |
| 154 | Ga0068853_101645086 | 3300005539 | Bacteria | 622 |
| 155 | Ga0070672_100003015 | 3300005543 | Bacteria | 10850 |
| 156 | Ga0070672_100023529 | 3300005543 | Bacteria | 4542 |
| 157 | Ga0070672_101403547 | 3300005543 | Bacteria | 625 |
| 158 | Ga0070686_101842284 | 3300005544 | Bacteria | 516 |
| 159 | Ga0070695_100002318 | 3300005545 | Bacteria | 10917 |
| 160 | Ga0070696_100013997 | 3300005546 | Bacteria | 5386 |
| 161 | Ga0070696_101562685 | 3300005546 | Bacteria | 566 |
| 162 | Ga0070693_101476577 | 3300005547 | Bacteria | 531 |
| 163 | Ga0070665_100343871 | 3300005548 | Bacteria | 1497 |
| 164 | Ga0070665_100396861 | 3300005548 | Bacteria | 1387 |
| 165 | Ga0070665_100999683 | 3300005548 | Bacteria | 849 |
| 166 | Ga0070665_101652289 | 3300005548 | Bacteria | 648 |
| 167 | Ga0070665_101749318 | 3300005548 | Bacteria | 629 |
| 168 | Ga0070704_100069626 | 3300005549 | Bacteria | 2550 |
| 169 | Ga0070704_100130951 | 3300005549 | Bacteria | 1944 |
| 170 | Ga0068855_100400976 | 3300005563 | Bacteria | 1503 |
| 171 | Ga0070664_100010679 | 3300005564 | Bacteria | 7444 |
| 172 | Ga0070664_100405112 | 3300005564 | Bacteria | 1248 |
| 173 | Ga0070664_100945411 | 3300005564 | Bacteria | 809 |
| 174 | Ga0068857_100085936 | 3300005577 | Bacteria | 2812 |
| 175 | Ga0068857_100425411 | 3300005577 | Bacteria | 1239 |
| 176 | Ga0068857_101468536 | 3300005577 | Bacteria | 664 |
| 177 | Ga0068857_101582244 | 3300005577 | Bacteria | 640 |
| 178 | Ga0068854_100554433 | 3300005578 | Bacteria | 975 |
| 179 | Ga0068854_100557693 | 3300005578 | Bacteria | 973 |
| 180 | Ga0068854_101360254 | 3300005578 | Bacteria | 641 |
| 181 | Ga0068856_100006013 | 3300005614 | Bacteria | 11943 |
| 182 | Ga0068856_100575722 | 3300005614 | Bacteria | 1147 |
| 183 | Ga0068856_100736820 | 3300005614 | Bacteria | 1006 |
| 184 | Ga0068856_100845803 | 3300005614 | Bacteria | 934 |
| 185 | Ga0068856_101045040 | 3300005614 | Bacteria | 835 |
| 186 | Ga0068856_102544859 | 3300005614 | Bacteria | 518 |
| 187 | Ga0070702_100008637 | 3300005615 | Bacteria | 4945 |
| 188 | Ga0070702_100875171 | 3300005615 | Bacteria | 701 |
| 189 | Ga0068852_100283388 | 3300005616 | Bacteria | 1598 |
| 190 | Ga0068852_100464557 | 3300005616 | Bacteria | 1255 |
| 191 | Ga0068852_100673797 | 3300005616 | Bacteria | 1043 |
| 192 | Ga0068859_102043802 | 3300005617 | Bacteria | 633 |
| 193 | Ga0068859_102087715 | 3300005617 | Bacteria | 626 |
| 194 | Ga0068864_100019997 | 3300005618 | Bacteria | 5598 |
| 195 | Ga0068864_100156166 | 3300005618 | Bacteria | 2071 |
| 196 | Ga0068864_101198524 | 3300005618 | Bacteria | 758 |
| 197 | Ga0068861_100012401 | 3300005719 | Bacteria | 5943 |
| 198 | Ga0068851_10053954 | 3300005834 | Bacteria | 2047 |
| 199 | Ga0068870_10002986 | 3300005840 | Bacteria | 7122 |
| 200 | Ga0068870_10298767 | 3300005840 | Bacteria | 1016 |
| 201 | Ga0068863_100003819 | 3300005841 | Bacteria | 14893 |
| 202 | Ga0068863_100343770 | 3300005841 | Bacteria | 1452 |
| 203 | Ga0068858_101070606 | 3300005842 | Bacteria | 791 |
| 204 | Ga0068860_102061356 | 3300005843 | Bacteria | 592 |
| 205 | Ga0068862_101061002 | 3300005844 | Bacteria | 804 |
| 206 | Ga0068862_102392078 | 3300005844 | Bacteria | 540 |
| 207 | Ga0081455_10000011 | 3300005937 | Bacteria | 203132 |
| 208 | Ga0081455_10000146 | 3300005937 | Bacteria | 83878 |
| 209 | Ga0081455_10060369 | 3300005937 | Bacteria | 3197 |
| 210 | Ga0081455_10207048 | 3300005937 | Bacteria | 1464 |
| 211 | Ga0081455_10592939 | 3300005937 | Bacteria | 724 |
| 212 | Ga0081455_10886914 | 3300005937 | Bacteria | 555 |
| 213 | Ga0081538_10113978 | 3300005981 | Bacteria | 1318 |
| 214 | Ga0081540_1005748 | 3300005983 | Bacteria | 9187 |
| 215 | Ga0081540_1012491 | 3300005983 | Bacteria | 5584 |
| 216 | Ga0081540_1184034 | 3300005983 | Bacteria | 778 |
| 217 | Ga0081539_10000680 | 3300005985 | Bacteria | 68157 |
| 218 | Ga0081539_10008252 | 3300005985 | Bacteria | 9150 |
| 219 | Ga0081539_10012205 | 3300005985 | Bacteria | 6666 |
| 220 | Ga0081539_10110850 | 3300005985 | Bacteria | 1381 |
| 221 | Ga0070717_10516064 | 3300006028 | Bacteria | 1081 |
| 222 | Ga0075365_10022436 | 3300006038 | Bacteria | 3955 |
| 223 | Ga0075365_10135314 | 3300006038 | Bacteria | 1708 |
| 224 | Ga0075365_10457265 | 3300006038 | Bacteria | 901 |
| 225 | Ga0075365_10883836 | 3300006038 | Bacteria | 630 |
| 226 | Ga0075368_10198448 | 3300006042 | Bacteria | 849 |
| 227 | Ga0075363_100225157 | 3300006048 | Bacteria | 1076 |
| 228 | Ga0075363_100239534 | 3300006048 | Bacteria | 1043 |
| 229 | Ga0075363_100322303 | 3300006048 | Bacteria | 899 |
| 230 | Ga0075363_100374463 | 3300006048 | Bacteria | 834 |
| 231 | Ga0075363_100799460 | 3300006048 | Bacteria | 574 |
| 232 | Ga0075364_10001970 | 3300006051 | Bacteria | 11437 |
| 233 | Ga0075364_10046982 | 3300006051 | Bacteria | 2811 |
| 234 | Ga0075364_10079296 | 3300006051 | Bacteria | 2170 |
| 235 | Ga0075364_10291890 | 3300006051 | Bacteria | 1110 |
| 236 | Ga0075364_10519831 | 3300006051 | Bacteria | 814 |
| 237 | Ga0075364_10744395 | 3300006051 | Bacteria | 669 |
| 238 | Ga0070712_100099237 | 3300006175 | Bacteria | 2149 |
| 239 | Ga0070712_100123350 | 3300006175 | Bacteria | 1953 |
| 240 | Ga0070712_100172158 | 3300006175 | Bacteria | 1681 |
| 241 | Ga0075362_10051899 | 3300006177 | Bacteria | 1836 |
| 242 | Ga0075367_10231875 | 3300006178 | Bacteria | 1156 |
| 243 | Ga0075367_10351188 | 3300006178 | Bacteria | 931 |
| 244 | Ga0075367_11134290 | 3300006178 | Bacteria | 500 |
| 245 | Ga0075369_10002158 | 3300006186 | Bacteria | 6951 |
| 246 | Ga0075369_10029977 | 3300006186 | Bacteria | 2289 |
| 247 | Ga0075369_10047735 | 3300006186 | Bacteria | 1846 |
| 248 | Ga0075369_10108859 | 3300006186 | Bacteria | 1248 |
| 249 | Ga0075369_10381764 | 3300006186 | Bacteria | 663 |
| 250 | Ga0075370_10060732 | 3300006353 | Bacteria | 2153 |
| 251 | Ga0075370_10308899 | 3300006353 | Bacteria | 941 |
| 252 | Ga0075428_100005376 | 3300006844 | Bacteria | 14240 |
| 253 | Ga0075428_100101616 | 3300006844 | Bacteria | 3134 |
| 254 | Ga0075428_100132135 | 3300006844 | Bacteria | 2715 |
| 255 | Ga0075428_100148020 | 3300006844 | Bacteria | 2552 |
| 256 | Ga0075428_100305488 | 3300006844 | Bacteria | 1710 |
| 257 | Ga0075428_102101881 | 3300006844 | Bacteria | 584 |
| 258 | Ga0075428_102128485 | 3300006844 | Bacteria | 580 |
| 259 | Ga0075430_100020264 | 3300006846 | Bacteria | 5659 |
| 260 | Ga0075430_100039113 | 3300006846 | Bacteria | 4017 |
| 261 | Ga0075430_100056359 | 3300006846 | Bacteria | 3304 |
| 262 | Ga0075430_100466811 | 3300006846 | Bacteria | 1042 |
| 263 | Ga0075430_100666913 | 3300006846 | Bacteria | 858 |
| 264 | Ga0075430_101182232 | 3300006846 | Bacteria | 630 |
| 265 | Ga0075430_101514131 | 3300006846 | Bacteria | 551 |
| 266 | Ga0075431_100024151 | 3300006847 | Bacteria | 6224 |
| 267 | Ga0075431_100058242 | 3300006847 | Bacteria | 3986 |
| 268 | Ga0075431_100325399 | 3300006847 | Bacteria | 1549 |
| 269 | Ga0075431_100397141 | 3300006847 | Bacteria | 1380 |
| 270 | Ga0075433_10001247 | 3300006852 | Bacteria | 18559 |
| 271 | Ga0075433_11702713 | 3300006852 | Bacteria | 543 |
| 272 | Ga0075434_100012123 | 3300006871 | Bacteria | 8162 |
| 273 | Ga0075429_100008749 | 3300006880 | Bacteria | 8805 |
| 274 | Ga0075429_100030849 | 3300006880 | Bacteria | 4658 |
| 275 | Ga0075429_100157500 | 3300006880 | Bacteria | 1989 |
| 276 | Ga0075429_101651734 | 3300006880 | Bacteria | 557 |
| 277 | Ga0068865_100017855 | 3300006881 | Bacteria | 4568 |
| 278 | Ga0068865_100453135 | 3300006881 | Bacteria | 1061 |
| 279 | Ga0068865_101762633 | 3300006881 | Bacteria | 559 |
| 280 | Ga0075436_100007862 | 3300006914 | Bacteria | 7296 |
| 281 | Ga0075436_100458466 | 3300006914 | Bacteria | 929 |
| 282 | Ga0097620_102043915 | 3300006931 | Bacteria | 633 |
| 283 | Ga0097620_102087836 | 3300006931 | Bacteria | 626 |
| 284 | Ga0075435_100007473 | 3300007076 | Bacteria | 7791 |
| 285 | Ga0105250_10554690 | 3300009092 | Bacteria | 527 |
| 286 | Ga0105240_12307560 | 3300009093 | Bacteria | 557 |
| 287 | Ga0111539_10002357 | 3300009094 | Bacteria | 25105 |
| 288 | Ga0111539_10224514 | 3300009094 | Bacteria | 2188 |
| 289 | Ga0111539_10315643 | 3300009094 | Bacteria | 1819 |
| 290 | Ga0111539_10722001 | 3300009094 | Bacteria | 1160 |
| 291 | Ga0111539_10902671 | 3300009094 | Bacteria | 1028 |
| 292 | Ga0105245_10017895 | 3300009098 | Bacteria | 6188 |
| 293 | Ga0105245_10033741 | 3300009098 | Bacteria | 4536 |
| 294 | Ga0105245_10192653 | 3300009098 | Bacteria | 1953 |
| 295 | Ga0105245_10599460 | 3300009098 | Bacteria | 1128 |
| 296 | Ga0105245_10981512 | 3300009098 | Bacteria | 889 |
| 297 | Ga0105247_10956556 | 3300009101 | Bacteria | 665 |
| 298 | Ga0114129_10029661 | 3300009147 | Bacteria | 7747 |
| 299 | Ga0114129_10046672 | 3300009147 | Bacteria | 6087 |
| 300 | Ga0114129_10414997 | 3300009147 | Bacteria | 1772 |
| 301 | Ga0114129_10530242 | 3300009147 | Bacteria | 1534 |
| 302 | Ga0114129_10550483 | 3300009147 | Bacteria | 1500 |
| 303 | Ga0114129_10965093 | 3300009147 | Bacteria | 1076 |
| 304 | Ga0114129_11349640 | 3300009147 | Bacteria | 882 |
| 305 | Ga0114129_12836769 | 3300009147 | Bacteria | 575 |
| 306 | Ga0114129_13046711 | 3300009147 | Bacteria | 549 |
| 307 | Ga0105243_10004734 | 3300009148 | Bacteria | 10703 |
| 308 | Ga0105243_11683948 | 3300009148 | Bacteria | 663 |
| 309 | Ga0105241_10521708 | 3300009174 | Bacteria | 1062 |
| 310 | Ga0105241_11984814 | 3300009174 | Bacteria | 572 |
| 311 | Ga0105242_10360774 | 3300009176 | Bacteria | 1345 |
| 312 | Ga0105242_10493056 | 3300009176 | Bacteria | 1164 |
| 313 | Ga0105242_12610326 | 3300009176 | Bacteria | 554 |
| 314 | Ga0105248_10002978 | 3300009177 | Bacteria | 18772 |
| 315 | Ga0105248_10519552 | 3300009177 | Bacteria | 1342 |
| 316 | Ga0105237_10380647 | 3300009545 | Bacteria | 1416 |
| 317 | Ga0105237_10478802 | 3300009545 | Bacteria | 1251 |
| 318 | Ga0105238_10379370 | 3300009551 | Bacteria | 1405 |
| 319 | Ga0105238_10529754 | 3300009551 | Bacteria | 1181 |
| 320 | Ga0105238_11006104 | 3300009551 | Bacteria | 854 |
| 321 | Ga0105249_10015360 | 3300009553 | Bacteria | 6775 |
| 322 | Ga0105249_10824157 | 3300009553 | Bacteria | 992 |
| 323 | Ga0105035_118861 | 3300009988 | Bacteria | 650 |
| 324 | Ga0105239_10180706 | 3300010375 | Bacteria | 2360 |
| 325 | Ga0105239_10448944 | 3300010375 | Bacteria | 1463 |
| 326 | Ga0105239_10647011 | 3300010375 | Bacteria | 1207 |
| 327 | Ga0105239_10681292 | 3300010375 | Bacteria | 1175 |
| 328 | Ga0105239_11577761 | 3300010375 | Bacteria | 759 |
| 329 | Ga0105246_10753942 | 3300011119 | Bacteria | 859 |
| 330 | Ga0157371_10222559 | 3300013102 | Bacteria | 1355 |
| 331 | Ga0157369_10217259 | 3300013105 | Bacteria | 2002 |
| 332 | Ga0157369_10236958 | 3300013105 | Bacteria | 1906 |
| 333 | Ga0157369_10616586 | 3300013105 | Bacteria | 1119 |
| 334 | Ga0157369_10973712 | 3300013105 | Bacteria | 869 |
| 335 | Ga0157369_11896490 | 3300013105 | Bacteria | 605 |
| 336 | Ga0157369_12131692 | 3300013105 | Bacteria | 568 |
| 337 | Ga0157374_10674288 | 3300013296 | Bacteria | 1046 |
| 338 | Ga0157374_10688828 | 3300013296 | Bacteria | 1035 |
| 339 | Ga0157374_10730838 | 3300013296 | Bacteria | 1004 |
| 340 | Ga0157378_10052428 | 3300013297 | Bacteria | 3630 |
| 341 | Ga0157378_11781487 | 3300013297 | Bacteria | 664 |
| 342 | Ga0163162_10572328 | 3300013306 | Bacteria | 1257 |
| 343 | Ga0163162_11978618 | 3300013306 | Bacteria | 668 |
| 344 | Ga0157372_10311882 | 3300013307 | Bacteria | 1831 |
| 345 | Ga0157372_12500509 | 3300013307 | Bacteria | 593 |
| 346 | Ga0157375_10026663 | 3300013308 | Bacteria | 5391 |
| 347 | Ga0157375_10546546 | 3300013308 | Bacteria | 1320 |
| 348 | Ga0157375_10713901 | 3300013308 | Bacteria | 1156 |
| 349 | Ga0163163_10251580 | 3300014325 | Bacteria | 1817 |
| 350 | Ga0163163_10522777 | 3300014325 | Bacteria | 1249 |
| 351 | Ga0163163_10595621 | 3300014325 | Bacteria | 1169 |
| 352 | Ga0163163_11045321 | 3300014325 | Bacteria | 880 |
| 353 | Ga0163163_11144669 | 3300014325 | Bacteria | 841 |
| 354 | Ga0163163_11443746 | 3300014325 | Bacteria | 749 |
| 355 | Ga0163163_12183434 | 3300014325 | Bacteria | 613 |
| 356 | Ga0163163_12707929 | 3300014325 | Bacteria | 553 |
| 357 | Ga0157380_10036095 | 3300014326 | Bacteria | 3823 |
| 358 | Ga0157380_11505212 | 3300014326 | Bacteria | 726 |
| 359 | Ga0157380_12720055 | 3300014326 | Bacteria | 561 |
| 360 | Ga0157380_13337032 | 3300014326 | Bacteria | 513 |
| 361 | Ga0182008_10392954 | 3300014497 | Bacteria | 743 |
| 362 | Ga0182008_10459175 | 3300014497 | Bacteria | 694 |
| 363 | Ga0157377_11500419 | 3300014745 | Bacteria | 536 |
| 364 | Ga0157379_10031926 | 3300014968 | Bacteria | 4692 |
| 365 | Ga0157379_10625741 | 3300014968 | Bacteria | 1006 |
| 366 | Ga0157379_11677156 | 3300014968 | Bacteria | 622 |
| 367 | Ga0157376_10182380 | 3300014969 | Bacteria | 1920 |
| 368 | Ga0157376_11584268 | 3300014969 | Bacteria | 689 |
| 369 | Ga0157376_12053295 | 3300014969 | Bacteria | 610 |
| 370 | Ga0157376_13092230 | 3300014969 | Bacteria | 504 |
| 371 | Ga0163161_10467329 | 3300017792 | Bacteria | 1022 |
| 372 | Ga0163161_11007107 | 3300017792 | Bacteria | 711 |
| 373 | Ga0163161_11202371 | 3300017792 | Bacteria | 655 |
| 374 | Ga0163161_11775857 | 3300017792 | Bacteria | 548 |
| 375 | Ga0197907_10146932 | 3300020069 | Bacteria | 901 |
| 376 | Ga0197907_11131751 | 3300020069 | Bacteria | 911 |
| 377 | Ga0206356_10738473 | 3300020070 | Bacteria | 2399 |
| 378 | Ga0206349_1135760 | 3300020075 | Bacteria | 1051 |
| 379 | Ga0206355_1430210 | 3300020076 | Bacteria | 508 |
| 380 | Ga0206351_10859302 | 3300020077 | Bacteria | 661 |
| 381 | Ga0206352_10875590 | 3300020078 | Bacteria | 1333 |
| 382 | Ga0206350_10076879 | 3300020080 | Bacteria | 846 |
| 383 | Ga0206354_10429281 | 3300020081 | Bacteria | 1086 |
| 384 | Ga0206354_10768390 | 3300020081 | Bacteria | 1222 |
| 385 | Ga0206354_11604246 | 3300020081 | Bacteria | 973 |
| 386 | Ga0206353_10238432 | 3300020082 | Bacteria | 1339 |
| 387 | Ga0206353_10596355 | 3300020082 | Bacteria | 1747 |
| 388 | Ga0213874_10036632 | 3300021377 | Bacteria | 1447 |
| 389 | Ga0213874_10046654 | 3300021377 | Bacteria | 1316 |
| 390 | Ga0213876_10009652 | 3300021384 | Bacteria | 5193 |
| 391 | Ga0213876_10018841 | 3300021384 | Bacteria | 3645 |
| 392 | Ga0213876_10641434 | 3300021384 | Bacteria | 565 |
| 393 | Ga0213875_10000073 | 3300021388 | Bacteria | 119027 |
| 394 | Ga0213875_10045780 | 3300021388 | Bacteria | 2054 |
| 395 | Ga0224712_10094121 | 3300022467 | Bacteria | 1260 |
| 396 | Ga0224572_1063462 | 3300024225 | Bacteria | 683 |
| 397 | Ga0209051_1022107 | 3300025303 | Bacteria | 2687 |
| 398 | Ga0209051_1060753 | 3300025303 | Bacteria | 1191 |
| 399 | Ga0207682_10051233 | 3300025893 | Bacteria | 1709 |
| 400 | Ga0207692_10844259 | 3300025898 | Bacteria | 601 |
| 401 | Ga0207642_10214254 | 3300025899 | Bacteria | 1072 |
| 402 | Ga0207642_10233058 | 3300025899 | Bacteria | 1035 |
| 403 | Ga0207688_10025811 | 3300025901 | Bacteria | 3229 |
| 404 | Ga0207680_10104393 | 3300025903 | Bacteria | 1827 |
| 405 | Ga0207680_10280405 | 3300025903 | Bacteria | 1158 |
| 406 | Ga0207680_10603768 | 3300025903 | Bacteria | 785 |
| 407 | Ga0207647_10073923 | 3300025904 | Bacteria | 2054 |
| 408 | Ga0207647_10509330 | 3300025904 | Bacteria | 670 |
| 409 | Ga0207645_11026122 | 3300025907 | Bacteria | 558 |
| 410 | Ga0207643_10001705 | 3300025908 | Bacteria | 12334 |
| 411 | Ga0207643_10131982 | 3300025908 | Bacteria | 1487 |
| 412 | Ga0207705_10074685 | 3300025909 | Bacteria | 2461 |
| 413 | Ga0207705_10155879 | 3300025909 | Bacteria | 1713 |
| 414 | Ga0207705_10195407 | 3300025909 | Bacteria | 1531 |
| 415 | Ga0207705_11177134 | 3300025909 | Bacteria | 589 |
| 416 | Ga0207684_10007698 | 3300025910 | Bacteria | 9657 |
| 417 | Ga0207684_10121331 | 3300025910 | Archaea | 2241 |
| 418 | Ga0207684_10168881 | 3300025910 | Bacteria | 1885 |
| 419 | Ga0207684_10197399 | 3300025910 | Bacteria | 1736 |
| 420 | Ga0207684_10306887 | 3300025910 | Bacteria | 1368 |
| 421 | Ga0207684_10315895 | 3300025910 | Bacteria | 1347 |
| 422 | Ga0207684_10479521 | 3300025910 | Bacteria | 1067 |
| 423 | Ga0207684_10518360 | 3300025910 | Bacteria | 1021 |
| 424 | Ga0207684_11039932 | 3300025910 | Bacteria | 684 |
| 425 | Ga0207684_11246656 | 3300025910 | Bacteria | 614 |
| 426 | Ga0207707_10014387 | 3300025912 | Bacteria | 6892 |
| 427 | Ga0207707_10076608 | 3300025912 | Bacteria | 2919 |
| 428 | Ga0207707_10440818 | 3300025912 | Bacteria | 1115 |
| 429 | Ga0207693_10093591 | 3300025915 | Bacteria | 2356 |
| 430 | Ga0207693_10235745 | 3300025915 | Bacteria | 1437 |
| 431 | Ga0207663_10022011 | 3300025916 | Bacteria | 3637 |
| 432 | Ga0207663_10430123 | 3300025916 | Bacteria | 1015 |
| 433 | Ga0207663_10452826 | 3300025916 | Bacteria | 990 |
| 434 | Ga0207660_10042355 | 3300025917 | Bacteria | 3195 |
| 435 | Ga0207662_10054240 | 3300025918 | Bacteria | 2390 |
| 436 | Ga0207657_10084430 | 3300025919 | Bacteria | 2661 |
| 437 | Ga0207649_10019634 | 3300025920 | Bacteria | 3866 |
| 438 | Ga0207649_10064996 | 3300025920 | Bacteria | 2308 |
| 439 | Ga0207652_10056899 | 3300025921 | Bacteria | 3367 |
| 440 | Ga0207652_10219506 | 3300025921 | Bacteria | 1713 |
| 441 | Ga0207652_10220028 | 3300025921 | Bacteria | 1711 |
| 442 | Ga0207652_10747316 | 3300025921 | Bacteria | 871 |
| 443 | Ga0207652_10874837 | 3300025921 | Bacteria | 795 |
| 444 | Ga0207652_11710239 | 3300025921 | Bacteria | 534 |
| 445 | Ga0207646_10194944 | 3300025922 | Bacteria | 1829 |
| 446 | Ga0207646_10199317 | 3300025922 | Bacteria | 1808 |
| 447 | Ga0207646_10205026 | 3300025922 | Bacteria | 1781 |
| 448 | Ga0207646_10208990 | 3300025922 | Bacteria | 1763 |
| 449 | Ga0207646_10265832 | 3300025922 | Bacteria | 1550 |
| 450 | Ga0207681_10538998 | 3300025923 | Bacteria | 959 |
| 451 | Ga0207694_10236073 | 3300025924 | Bacteria | 1494 |
| 452 | Ga0207694_11597694 | 3300025924 | Bacteria | 549 |
| 453 | Ga0207650_10032101 | 3300025925 | Bacteria | 3798 |
| 454 | Ga0207650_11133731 | 3300025925 | Bacteria | 666 |
| 455 | Ga0207659_10003563 | 3300025926 | Bacteria | 9370 |
| 456 | Ga0207659_10201165 | 3300025926 | Bacteria | 1591 |
| 457 | Ga0207687_10012641 | 3300025927 | Bacteria | 5515 |
| 458 | Ga0207687_10098228 | 3300025927 | Bacteria | 2149 |
| 459 | Ga0207687_10230900 | 3300025927 | Bacteria | 1461 |
| 460 | Ga0207687_10310594 | 3300025927 | Bacteria | 1273 |
| 461 | Ga0207687_10562014 | 3300025927 | Bacteria | 958 |
| 462 | Ga0207687_11232516 | 3300025927 | Bacteria | 643 |
| 463 | Ga0207700_10004768 | 3300025928 | Bacteria | 8043 |
| 464 | Ga0207700_10016883 | 3300025928 | Bacteria | 4861 |
| 465 | Ga0207700_10044626 | 3300025928 | Bacteria | 3265 |
| 466 | Ga0207700_10465789 | 3300025928 | Bacteria | 1115 |
| 467 | Ga0207700_11706065 | 3300025928 | Bacteria | 555 |
| 468 | Ga0207664_10016747 | 3300025929 | Bacteria | 5354 |
| 469 | Ga0207664_10042520 | 3300025929 | Bacteria | 3547 |
| 470 | Ga0207664_10062808 | 3300025929 | Bacteria | 2967 |
| 471 | Ga0207664_10271596 | 3300025929 | Bacteria | 1485 |
| 472 | Ga0207664_10407736 | 3300025929 | Bacteria | 1209 |
| 473 | Ga0207664_11295428 | 3300025929 | Bacteria | 648 |
| 474 | Ga0207644_10047477 | 3300025931 | Bacteria | 3064 |
| 475 | Ga0207644_10209092 | 3300025931 | Bacteria | 1542 |
| 476 | Ga0207690_10000157 | 3300025932 | Bacteria | 53457 |
| 477 | Ga0207690_11759524 | 3300025932 | Bacteria | 518 |
| 478 | Ga0207690_11823740 | 3300025932 | Bacteria | 508 |
| 479 | Ga0207706_10003191 | 3300025933 | Bacteria | 15738 |
| 480 | Ga0207706_11052251 | 3300025933 | Bacteria | 682 |
| 481 | Ga0207686_10010391 | 3300025934 | Bacteria | 5070 |
| 482 | Ga0207686_10119645 | 3300025934 | Bacteria | 1790 |
| 483 | Ga0207686_10261264 | 3300025934 | Bacteria | 1270 |
| 484 | Ga0207709_10012216 | 3300025935 | Bacteria | 4731 |
| 485 | Ga0207670_10117933 | 3300025936 | Bacteria | 1924 |
| 486 | Ga0207670_11494449 | 3300025936 | Bacteria | 574 |
| 487 | Ga0207669_10055082 | 3300025937 | Bacteria | 2406 |
| 488 | Ga0207669_10404449 | 3300025937 | Bacteria | 1070 |
| 489 | Ga0207704_10249612 | 3300025938 | Bacteria | 1331 |
| 490 | Ga0207665_10479130 | 3300025939 | Bacteria | 958 |
| 491 | Ga0207665_11195206 | 3300025939 | Bacteria | 607 |
| 492 | Ga0207691_10001940 | 3300025940 | Bacteria | 20185 |
| 493 | Ga0207691_10007065 | 3300025940 | Bacteria | 10833 |
| 494 | Ga0207691_10846018 | 3300025940 | Bacteria | 767 |
| 495 | Ga0207691_11571290 | 3300025940 | Bacteria | 536 |
| 496 | Ga0207711_10003778 | 3300025941 | Bacteria | 13042 |
| 497 | Ga0207711_10045400 | 3300025941 | Bacteria | 3755 |
| 498 | Ga0207711_11576202 | 3300025941 | Bacteria | 600 |
| 499 | Ga0207689_10150275 | 3300025942 | Bacteria | 1920 |
| 500 | Ga0207661_10001620 | 3300025944 | Bacteria | 15317 |
| 501 | Ga0207661_10145504 | 3300025944 | Bacteria | 2044 |
| 502 | Ga0207661_10579811 | 3300025944 | Bacteria | 1029 |
| 503 | Ga0207679_10124492 | 3300025945 | Bacteria | 2058 |
| 504 | Ga0207679_11385578 | 3300025945 | Bacteria | 645 |
| 505 | Ga0207667_10245366 | 3300025949 | Bacteria | 1832 |
| 506 | Ga0207667_11786390 | 3300025949 | Bacteria | 579 |
| 507 | Ga0207651_10011023 | 3300025960 | Bacteria | 5039 |
| 508 | Ga0207712_10068908 | 3300025961 | Bacteria | 2537 |
| 509 | Ga0207668_10036956 | 3300025972 | Bacteria | 3264 |
| 510 | Ga0207668_10441199 | 3300025972 | Bacteria | 1109 |
| 511 | Ga0207668_10442547 | 3300025972 | Bacteria | 1107 |
| 512 | Ga0207668_10701443 | 3300025972 | Bacteria | 890 |
| 513 | Ga0207668_12032070 | 3300025972 | Bacteria | 518 |
| 514 | Ga0207640_10427601 | 3300025981 | Bacteria | 1085 |
| 515 | Ga0207640_11276319 | 3300025981 | Bacteria | 655 |
| 516 | Ga0207658_10025871 | 3300025986 | Bacteria | 4111 |
| 517 | Ga0207658_10048109 | 3300025986 | Bacteria | 3125 |
| 518 | Ga0207677_10012793 | 3300026023 | Bacteria | 4842 |
| 519 | Ga0207677_10235345 | 3300026023 | Bacteria | 1478 |
| 520 | Ga0207677_10246468 | 3300026023 | Bacteria | 1448 |
| 521 | Ga0207703_10008492 | 3300026035 | Bacteria | 8115 |
| 522 | Ga0207703_11935869 | 3300026035 | Bacteria | 566 |
| 523 | Ga0207639_10085927 | 3300026041 | Bacteria | 2503 |
| 524 | Ga0207678_10506323 | 3300026067 | Bacteria | 1053 |
| 525 | Ga0207678_11004621 | 3300026067 | Bacteria | 738 |
| 526 | Ga0207708_10845520 | 3300026075 | Bacteria | 790 |
| 527 | Ga0207702_10005382 | 3300026078 | Bacteria | 11211 |
| 528 | Ga0207702_10678870 | 3300026078 | Bacteria | 1014 |
| 529 | Ga0207702_11930168 | 3300026078 | Bacteria | 581 |
| 530 | Ga0207702_12228601 | 3300026078 | Bacteria | 536 |
| 531 | Ga0207641_10001754 | 3300026088 | Bacteria | 20888 |
| 532 | Ga0207648_10002197 | 3300026089 | Bacteria | 21185 |
| 533 | Ga0207648_11444177 | 3300026089 | Bacteria | 647 |
| 534 | Ga0207648_11668048 | 3300026089 | Bacteria | 599 |
| 535 | Ga0207676_10938684 | 3300026095 | Bacteria | 850 |
| 536 | Ga0207674_10029816 | 3300026116 | Bacteria | 5740 |
| 537 | Ga0207674_10050383 | 3300026116 | Bacteria | 4254 |
| 538 | Ga0207674_11964347 | 3300026116 | Bacteria | 550 |
| 539 | Ga0207675_100001152 | 3300026118 | Bacteria | 26247 |
| 540 | Ga0207675_101982188 | 3300026118 | Bacteria | 600 |
| 541 | Ga0207683_10460357 | 3300026121 | Bacteria | 1173 |
| 542 | Ga0207683_10749163 | 3300026121 | Bacteria | 906 |
| 543 | Ga0207698_10379534 | 3300026142 | Bacteria | 1344 |
| 544 | Ga0207698_10445369 | 3300026142 | Bacteria | 1249 |
| 545 | Ga0207698_10640965 | 3300026142 | Bacteria | 1051 |
| 546 | Ga0207698_10934363 | 3300026142 | Bacteria | 876 |
| 547 | Ga0207698_11146580 | 3300026142 | Bacteria | 791 |
| 548 | Ga0209998_10024421 | 3300027717 | Bacteria | 1311 |
| 549 | Ga0209813_10302357 | 3300027866 | Bacteria | 622 |
| 550 | Ga0207428_10010302 | 3300027907 | Bacteria | 8355 |
| 551 | Ga0207428_10078479 | 3300027907 | Bacteria | 2583 |
| 552 | Ga0207428_10162625 | 3300027907 | Bacteria | 1694 |
| 553 | Ga0207428_10258173 | 3300027907 | Bacteria | 1298 |
| 554 | Ga0268266_10263390 | 3300028379 | Bacteria | 1598 |
| 555 | Ga0268266_10277584 | 3300028379 | Bacteria | 1557 |
| 556 | Ga0268266_10349932 | 3300028379 | Bacteria | 1388 |
| 557 | Ga0268266_12295889 | 3300028379 | Bacteria | 511 |
| 558 | Ga0268265_10128980 | 3300028380 | Bacteria | 2098 |
| 559 | Ga0268265_11889270 | 3300028380 | Bacteria | 604 |
| 560 | Ga0268264_10697552 | 3300028381 | Bacteria | 1008 |
| 561 | Ga0268264_10947087 | 3300028381 | Bacteria | 866 |
| 562 | Ga0265326_10027348 | 3300028558 | Bacteria | 1626 |
| 563 | Ga0265326_10094489 | 3300028558 | Bacteria | 847 |
| 564 | Ga0265319_1162847 | 3300028563 | Bacteria | 689 |
| 565 | Ga0265336_10006446 | 3300028666 | Bacteria | 4227 |
| 566 | Ga0265336_10192348 | 3300028666 | Bacteria | 606 |
| 567 | Ga0307515_10607596 | 3300028794 | Bacteria | 704 |
| 568 | Ga0265338_10009713 | 3300028800 | Bacteria | 11414 |
| 569 | Ga0265338_10034430 | 3300028800 | Bacteria | 4895 |
| 570 | Ga0265338_10501904 | 3300028800 | Bacteria | 854 |
| 571 | Ga0265338_10521919 | 3300028800 | Bacteria | 834 |
| 572 | Ga0307511_10062279 | 3300030521 | Bacteria | 2833 |
| 573 | Ga0307511_10096193 | 3300030521 | Bacteria | 1974 |
| 574 | Ga0316177_1207210 | 3300030731 | Bacteria | 2041 |
| 575 | Ga0316176_1186483 | 3300030732 | Bacteria | 1325 |
| 576 | Ga0316179_1088487 | 3300030734 | Bacteria | 1332 |
| 577 | Ga0316178_1070530 | 3300030735 | Bacteria | 1781 |
| 578 | Ga0316180_1064925 | 3300030736 | Bacteria | 957 |
| 579 | Ga0316180_1121429 | 3300030736 | Bacteria | 1608 |
| 580 | Ga0316182_1127369 | 3300030745 | Bacteria | 585 |
| 581 | Ga0265766_1020627 | 3300030863 | Bacteria | 541 |
| 582 | Ga0265330_10223224 | 3300031235 | Bacteria | 795 |
| 583 | Ga0265320_10140667 | 3300031240 | Bacteria | 1093 |
| 584 | Ga0265325_10019205 | 3300031241 | Bacteria | 3782 |
| 585 | Ga0265329_10212143 | 3300031242 | Bacteria | 639 |
| 586 | Ga0265340_10001402 | 3300031247 | Bacteria | 13830 |
| 587 | Ga0265339_10091701 | 3300031249 | Bacteria | 1592 |
| 588 | Ga0265327_10000134 | 3300031251 | Bacteria | 163243 |
| 589 | Ga0265327_10001291 | 3300031251 | Bacteria | 32872 |
| 590 | Ga0265327_10036187 | 3300031251 | Bacteria | 2717 |
| 591 | Ga0265327_10344898 | 3300031251 | Bacteria | 651 |
| 592 | Ga0265327_10479132 | 3300031251 | Bacteria | 537 |
| 593 | Ga0307513_10007005 | 3300031456 | Bacteria | 14667 |
| 594 | Ga0307513_10024102 | 3300031456 | Bacteria | 7087 |
| 595 | Ga0307509_10199798 | 3300031507 | Bacteria | 1838 |
| 596 | Ga0265313_10012099 | 3300031595 | Bacteria | 5311 |
| 597 | Ga0310107_108231 | 3300031615 | Bacteria | 1379 |
| 598 | Ga0307508_10017109 | 3300031616 | Bacteria | 6594 |
| 599 | Ga0307514_10374863 | 3300031649 | Bacteria | 743 |
| 600 | Ga0316575_10000833 | 3300031665 | Bacteria | 9406 |
| 601 | Ga0316579_10004180 | 3300031691 | Bacteria | 5707 |
| 602 | Ga0265314_10047326 | 3300031711 | Bacteria | 3027 |
| 603 | Ga0265314_10068252 | 3300031711 | Bacteria | 2391 |
| 604 | Ga0316576_10000924 | 3300031727 | Bacteria | 15000 |
| 605 | Ga0316576_10001581 | 3300031727 | Bacteria | 12384 |
| 606 | Ga0316576_10002702 | 3300031727 | Bacteria | 10144 |
| 607 | Ga0316578_10000378 | 3300031728 | Bacteria | 14221 |
| 608 | Ga0316578_10019860 | 3300031728 | Bacteria | 3706 |
| 609 | Ga0316578_10020313 | 3300031728 | Bacteria | 3668 |
| 610 | Ga0316578_10174439 | 3300031728 | Bacteria | 1296 |
| 611 | Ga0316577_10139428 | 3300031733 | Bacteria | 1366 |
| 612 | Ga0316577_10236000 | 3300031733 | Bacteria | 1034 |
| 613 | Ga0316577_10390646 | 3300031733 | Bacteria | 790 |
| 614 | Ga0316045_127936 | 3300031815 | Bacteria | 501 |
| 615 | Ga0307413_10077997 | 3300031824 | Bacteria | 2112 |
| 616 | Ga0307413_10574101 | 3300031824 | Bacteria | 919 |
| 617 | Ga0316043_124307 | 3300031828 | Bacteria | 643 |
| 618 | Ga0307518_10000495 | 3300031838 | Bacteria | 30033 |
| 619 | Ga0307410_10016672 | 3300031852 | Bacteria | 4390 |
| 620 | Ga0307410_12087229 | 3300031852 | Bacteria | 507 |
| 621 | Ga0307407_10002033 | 3300031903 | Bacteria | 7716 |
| 622 | Ga0307409_100001791 | 3300031995 | Bacteria | 10858 |
| 623 | Ga0307409_100051098 | 3300031995 | Bacteria | 3161 |
| 624 | Ga0307409_101125357 | 3300031995 | Bacteria | 807 |
| 625 | Ga0307409_101142625 | 3300031995 | Bacteria | 801 |
| 626 | Ga0307416_100052932 | 3300032002 | Bacteria | 3253 |
| 627 | Ga0307416_100512522 | 3300032002 | Bacteria | 1266 |
| 628 | Ga0307416_102027330 | 3300032002 | Bacteria | 678 |
| 629 | Ga0307414_10085339 | 3300032004 | Bacteria | 2326 |
| 630 | Ga0307415_100009069 | 3300032126 | Bacteria | 5554 |
| 631 | Ga0307415_100019420 | 3300032126 | Bacteria | 4126 |
| 632 | Ga0307415_100063419 | 3300032126 | Bacteria | 2568 |
| 633 | Ga0307415_100949789 | 3300032126 | Bacteria | 796 |
| 634 | Ga0307415_101507838 | 3300032126 | Bacteria | 643 |
| 635 | Ga0316583_10012637 | 3300032133 | Bacteria | 3047 |
| 636 | Ga0316585_10018701 | 3300032137 | Bacteria | 2105 |
| 637 | Ga0316580_10253060 | 3300032139 | Bacteria | 545 |
| 638 | Ga0307507_10000001 | 3300033179 | Bacteria | 417520 |
| 639 | Ga0307507_10012252 | 3300033179 | Bacteria | 10635 |
| 640 | Ga0307507_10044503 | 3300033179 | Bacteria | 4385 |
| 641 | Ga0307510_10148106 | 3300033180 | Bacteria | 1974 |
| 642 | Ga0307510_10327193 | 3300033180 | Bacteria | 988 |
| 643 | Ga0316588_1118344 | 3300033528 | Bacteria | 669 |
| 644 | Ga0316596_1016657 | 3300033541 | Bacteria | 1842 |
| 645 | Ga0316596_1060649 | 3300033541 | Bacteria | 1009 |
| 646 | Ga0373930_0132872 | 3300034816 | Bacteria | 614 |
| 647 | Ga0373950_0010883 | 3300034818 | Bacteria | 1477 |
| 648 | Ga0373958_0049757 | 3300034819 | Bacteria | 882 |
| 649 | Ga0373959_0176490 | 3300034820 | Bacteria | 553 |
| 650 | Ga0373926_0253025 | 3300035083 | Bacteria | 683 |
| 651 | Ga0373940_0045253 | 3300035088 | Bacteria | 1221 |
| 652 | Ga0373940_0126257 | 3300035088 | Bacteria | 798 |
| 653 | Ga0373944_0355567 | 3300035089 | Bacteria | 558 |
| 654 | Ga0373951_0000004 | 3300035091 | Bacteria | 95240 |
| 655 | Ga0373951_0197155 | 3300035091 | Bacteria | 585 |
| 656 | Ga0373936_0223761 | 3300035113 | Bacteria | 835 |
| 657 | Ga0373939_0076060 | 3300035114 | Bacteria | 1105 |
| 658 | Ga0373945_0027344 | 3300035116 | Bacteria | 1992 |
| 659 | Ga0373945_0490341 | 3300035116 | Bacteria | 547 |
| 660 | Ga0373954_0368528 | 3300035118 | Bacteria | 710 |
| 661 | Ga0373960_0266727 | 3300035121 | Bacteria | 627 |
| 662 | Ga0373943_0034594 | 3300035170 | Bacteria | 2411 |
| 663 | Ga0373943_0041257 | 3300035170 | Bacteria | 2231 |
| 664 | Ga0373943_0151836 | 3300035170 | Bacteria | 1255 |
| 665 | Ga0373943_0206913 | 3300035170 | Bacteria | 1088 |
| 666 | Ga0373943_0408884 | 3300035170 | Bacteria | 784 |
| 667 | Ga0373946_0128159 | 3300035171 | Bacteria | 1165 |
| 668 | Ga0373942_0001416 | 3300035207 | Bacteria | 6191 |
| 669 | Ga0373962_0021659 | 3300035242 | Bacteria | 1697 |
| 670 | Ga0316574_0004904 | 3300035398 | Bacteria | 7086 |
| 671 | Ga0316574_0009181 | 3300035398 | Bacteria | 5527 |
| 672 | Ga0316574_0055013 | 3300035398 | Bacteria | 2486 |
| 673 | Ga0316574_0154897 | 3300035398 | Bacteria | 1476 |
| 674 | Ga0373931_0000708 | 3300035691 | Bacteria | 13798 |
| 675 | Ga0373931_0085006 | 3300035691 | Bacteria | 1753 |
| 676 | Ga0373931_0122100 | 3300035691 | Bacteria | 1490 |
| 677 | Ga0373935_0193872 | 3300035692 | Bacteria | 1401 |
| 678 | Ga0373935_0932899 | 3300035692 | Bacteria | 644 |
| 679 | Ga0373927_0001612 | 3300035695 | Bacteria | 16932 |
| 680 | Ga0373927_0439545 | 3300035695 | Bacteria | 861 |
| 681 | Ga0373927_0876185 | 3300035695 | Bacteria | 593 |
| 682 | Ga0373933_0515289 | 3300035724 | Bacteria | 784 |
| 683 | Ga0373947_0001991 | 3300035725 | Bacteria | 12489 |
| 684 | Ga0373947_0029591 | 3300035725 | Bacteria | 3214 |
| 685 | Ga0310112_039424 | 3300036458 | Bacteria | 643 |
| 686 | Ga0316582_0049283 | 3300036647 | Bacteria | 2664 |
| 687 | Ga0316582_0326338 | 3300036647 | Bacteria | 1055 |
| 688 | Ga0316582_1226179 | 3300036647 | Bacteria | 510 |
| 689 | Ga0316584_0003193 | 3300036712 | Bacteria | 10609 |
| 690 | Ga0316584_0030695 | 3300036712 | Bacteria | 3970 |
| 691 | Ga0316584_0114290 | 3300036712 | Bacteria | 2019 |
| 692 | Ga0316584_0197305 | 3300036712 | Bacteria | 1486 |
| 693 | Ga0316584_0613837 | 3300036712 | Bacteria | 753 |
| 694 | Ga0373925_0012483 | 3300037068 | Bacteria | 6154 |
| 695 | Ga0373925_0018669 | 3300037068 | Bacteria | 5041 |
| 696 | Ga0395899_0044073 | 3300037312 | Bacteria | 3325 |
| 697 | Ga0395900_0169902 | 3300037418 | Bacteria | 2220 |
| 698 | Ga0395900_0498233 | 3300037418 | Bacteria | 1169 |
| 699 | Ga0395898_0017644 | 3300037466 | Bacteria | 7286 |
| 700 | Ga0395898_0722459 | 3300037466 | Bacteria | 938 |
| 701 | Ga0395898_1547428 | 3300037466 | Bacteria | 588 |
| 702 | Ga0395905_0487987 | 3300037471 | Bacteria | 1132 |
| 703 | Ga0316581_0285264 | 3300037588 | Bacteria | 507 |
| 704 | Ga0436364_0290389 | 3300037853 | Bacteria | 159315 |
| 705 | Ga0436364_0296264 | 3300037853 | Bacteria | 555 |
| 706 | Ga0436364_0565800 | 3300037853 | Bacteria | 515 |
| 707 | Ga0436364_0768457 | 3300037853 | Bacteria | 965 |
| 708 | Ga0436364_1321893 | 3300037853 | Bacteria | 1491 |
| 709 | Ga0436364_1429963 | 3300037853 | Bacteria | 1187 |
| 710 | Ga0436364_1492983 | 3300037853 | Bacteria | 717 |
| 711 | Ga0436364_1521400 | 3300037853 | Bacteria | 1399 |
| 712 | Ga0395901_0101187 | 3300038443 | Bacteria | 3024 |
| 713 | Ga0395901_0107170 | 3300038443 | Bacteria | 2933 |
| 714 | Ga0400485_18564 | 3300038735 | Bacteria | 1608 |
| 715 | Ga0436365_0003307 | 3300039437 | Bacteria | 7073 |
| 716 | Ga0436365_0449497 | 3300039437 | Bacteria | 32186 |
| 717 | Ga0436365_0462769 | 3300039437 | Bacteria | 1402 |
| 718 | Ga0436365_1217858 | 3300039437 | Bacteria | 9623 |
| 719 | Ga0436365_1253726 | 3300039437 | Bacteria | 22924 |
| 720 | Ga0436365_1524289 | 3300039437 | Bacteria | 766 |
| 721 | Ga0436360_0109533 | 3300039438 | Bacteria | 757 |
| 722 | Ga0436360_0684506 | 3300039438 | Bacteria | 746 |
| 723 | Ga0436360_1032373 | 3300039438 | Bacteria | 667 |
| 724 | Ga0436363_0085556 | 3300039450 | Bacteria | 1384 |
| 725 | Ga0436363_0099586 | 3300039450 | Bacteria | 3801 |
| 726 | Ga0436363_0569828 | 3300039450 | Bacteria | 1157 |
| 727 | Ga0436363_1175061 | 3300039450 | Bacteria | 975 |
| 728 | Ga0436363_1304752 | 3300039450 | Bacteria | 1578 |
| 729 | Ga0436363_1327049 | 3300039450 | Bacteria | 645 |
| 730 | Ga0436363_1427735 | 3300039450 | Bacteria | 867 |
| 731 | Ga0436362_0197429 | 3300039453 | Bacteria | 857 |
| 732 | Ga0436362_0947276 | 3300039453 | Bacteria | 719 |
| 733 | Ga0439436_0119779 | 3300041404 | Bacteria | 736 |
| 734 | Ga0439447_133552 | 3300041407 | Bacteria | 570 |
| 735 | Ga0439465_0017188 | 3300041413 | Bacteria | 2257 |
| 736 | Ga0439465_0096795 | 3300041413 | Bacteria | 1015 |
| 737 | Ga0451787_254251 | 3300041441 | Bacteria | 630 |
| 738 | Ga0451789_0759111 | 3300041443 | Bacteria | 3096 |
| 739 | Ga0451794_23908 | 3300041446 | Bacteria | 574 |
| 740 | Ga0451791_0237211 | 3300041451 | Bacteria | 1118 |
| 741 | Ga0451791_0634074 | 3300041451 | Bacteria | 676 |
| 742 | Ga0451793_1849706 | 3300041452 | Bacteria | 754 |
| 743 | Ga0451797_0351315 | 3300041453 | Bacteria | 680 |
| 744 | Ga0451797_0543649 | 3300041453 | Bacteria | 761 |
| 745 | Ga0451797_0712560 | 3300041453 | Bacteria | 762 |
| 746 | Ga0451797_0713983 | 3300041453 | Bacteria | 1045 |
| 747 | Ga0451798_0088207 | 3300041458 | Bacteria | 541 |
| 748 | Ga0451800_0058067 | 3300041459 | Bacteria | 629 |
| 749 | Ga0451800_1614935 | 3300041459 | Bacteria | 793 |
| 750 | Ga0451807_2763054 | 3300041486 | Bacteria | 584 |
| 751 | Ga0451835_0289975 | 3300041492 | Bacteria | 879 |
| 752 | Ga0451835_0659062 | 3300041492 | Bacteria | 759 |
| 753 | Ga0451837_1396023 | 3300041494 | Bacteria | 1239 |
| 754 | Ga0451839_0406728 | 3300041496 | Bacteria | 1297 |
| 755 | Ga0451839_0556732 | 3300041496 | Bacteria | 634 |
| 756 | Ga0451839_0791953 | 3300041496 | Bacteria | 500 |
| 757 | Ga0451845_0064425 | 3300041501 | Bacteria | 769 |
| 758 | Ga0451843_0892349 | 3300041509 | Bacteria | 1434 |
| 759 | Ga0451843_0903008 | 3300041509 | Bacteria | 1066 |
| 760 | Ga0451853_0228029 | 3300041512 | Bacteria | 6420 |
| 761 | Ga0451853_0661484 | 3300041512 | Bacteria | 1018 |
| 762 | Ga0451853_0851186 | 3300041512 | Bacteria | 739 |
| 763 | Ga0451853_1040312 | 3300041512 | Bacteria | 691 |
| 764 | Ga0451853_3439965 | 3300041512 | Bacteria | 763 |
| 765 | Ga0439462_0071088 | 3300042015 | Bacteria | 945 |
| 766 | Ga0439446_0036812 | 3300042156 | Bacteria | 1431 |
| 767 | Ga0450909_087655 | 3300042185 | Bacteria | 508 |
| 768 | Ga0439434_0126880 | 3300042435 | Bacteria | 835 |
| 769 | Ga0466969_0015431 | 3300044656 | Bacteria | 4004 |
| 770 | Ga0466969_0024429 | 3300044656 | Bacteria | 3108 |
| 771 | Ga0466969_0026927 | 3300044656 | Bacteria | 2947 |
| 772 | Ga0466969_0242959 | 3300044656 | Bacteria | 817 |
| 773 | Ga0466969_0251140 | 3300044656 | Bacteria | 802 |
| 774 | Ga0466969_0460786 | 3300044656 | Bacteria | 579 |
| 775 | Ga0466972_0002336 | 3300044658 | Bacteria | 9344 |
| 776 | Ga0466972_0010323 | 3300044658 | Bacteria | 4689 |
| 777 | Ga0466972_0042792 | 3300044658 | Bacteria | 2201 |
| 778 | Ga0466972_0118158 | 3300044658 | Bacteria | 1251 |
| 779 | Ga0466972_0198748 | 3300044658 | Bacteria | 939 |
| 780 | Ga0466965_0000846 | 3300044683 | Bacteria | 11604 |
| 781 | Ga0466965_0010879 | 3300044683 | Bacteria | 4257 |
| 782 | Ga0466965_0024738 | 3300044683 | Bacteria | 2905 |
| 783 | Ga0466965_0036823 | 3300044683 | Bacteria | 2401 |
| 784 | Ga0466965_0164050 | 3300044683 | Bacteria | 1166 |
| 785 | Ga0466966_0001132 | 3300044684 | Bacteria | 17127 |
| 786 | Ga0466966_0008129 | 3300044684 | Bacteria | 6954 |
| 787 | Ga0466966_0018725 | 3300044684 | Bacteria | 4562 |
| 788 | Ga0466966_0142541 | 3300044684 | Bacteria | 1464 |
| 789 | Ga0466966_0213262 | 3300044684 | Bacteria | 1166 |
| 790 | Ga0466961_0046824 | 3300044693 | Bacteria | 2765 |
| 791 | Ga0466961_0072562 | 3300044693 | Bacteria | 2183 |
| 792 | Ga0466961_0352819 | 3300044693 | Bacteria | 895 |
| 793 | Ga0466961_0466497 | 3300044693 | Bacteria | 764 |
| 794 | Ga0466961_0532275 | 3300044693 | Bacteria | 708 |
| 795 | Ga0466963_0000174 | 3300044694 | Bacteria | 26596 |
| 796 | Ga0466963_0243947 | 3300044694 | Bacteria | 1260 |
| 797 | Ga0466963_0816621 | 3300044694 | Bacteria | 657 |
| 798 | Ga0466964_0156931 | 3300044706 | Bacteria | 1060 |
| 799 | Ga0466964_0221856 | 3300044706 | Bacteria | 918 |
| 800 | Ga0466964_0293273 | 3300044706 | Bacteria | 817 |
| 801 | Ga0466964_0344677 | 3300044706 | Bacteria | 764 |
| 802 | Ga0466971_0011918 | 3300044719 | Bacteria | 3809 |
| 803 | Ga0466971_0180758 | 3300044719 | Bacteria | 991 |
| 804 | Ga0466971_0187931 | 3300044719 | Bacteria | 973 |
| 805 | Ga0466971_0208209 | 3300044719 | Bacteria | 924 |
| 806 | Ga0466971_0300662 | 3300044719 | Bacteria | 770 |
| 807 | Ga0466971_0538213 | 3300044719 | Bacteria | 579 |
| 808 | Ga0466968_0000527 | 3300044735 | Bacteria | 12977 |
| 809 | Ga0466968_0063776 | 3300044735 | Bacteria | 1593 |
| 810 | Ga0466968_0092801 | 3300044735 | Bacteria | 1340 |
| 811 | Ga0466968_0099217 | 3300044735 | Bacteria | 1298 |
| 812 | Ga0466968_0147905 | 3300044735 | Bacteria | 1078 |
| 813 | Ga0466968_0347022 | 3300044735 | Bacteria | 721 |
| 814 | Ga0466970_0010331 | 3300044765 | Bacteria | 4737 |
| 815 | Ga0466970_0016476 | 3300044765 | Bacteria | 3812 |
| 816 | Ga0466970_0019534 | 3300044765 | Bacteria | 3514 |
| 817 | Ga0466970_0041431 | 3300044765 | Bacteria | 2447 |
| 818 | Ga0466970_0204576 | 3300044765 | Bacteria | 1099 |
| 819 | Ga0466970_0734851 | 3300044765 | Bacteria | 576 |
| 820 | Ga0466957_0008885 | 3300044842 | Bacteria | 5724 |
| 821 | Ga0466957_0023018 | 3300044842 | Bacteria | 3678 |
| 822 | Ga0466957_0161967 | 3300044842 | Bacteria | 1453 |
| 823 | Ga0466957_0381679 | 3300044842 | Bacteria | 961 |
| 824 | Ga0466957_0443625 | 3300044842 | Bacteria | 893 |
| 825 | Ga0466960_0000116 | 3300044901 | Bacteria | 26505 |
| 826 | Ga0466960_0002137 | 3300044901 | Bacteria | 7365 |
| 827 | Ga0466960_0273133 | 3300044901 | Bacteria | 945 |
| 828 | Ga0466960_0299091 | 3300044901 | Bacteria | 906 |
| 829 | Ga0466960_0336351 | 3300044901 | Bacteria | 858 |
| 830 | Ga0466959_0003504 | 3300045049 | Bacteria | 10289 |
| 831 | Ga0466959_0027386 | 3300045049 | Bacteria | 4229 |
| 832 | Ga0466959_0051985 | 3300045049 | Bacteria | 3002 |
| 833 | Ga0466959_0369371 | 3300045049 | Bacteria | 977 |
| 834 | Ga0466959_0934322 | 3300045049 | Bacteria | 578 |
| 835 | Ga0466958_0000322 | 3300045836 | Bacteria | 19046 |
| 836 | Ga0466958_0002942 | 3300045836 | Bacteria | 8714 |
| 837 | Ga0466958_0023911 | 3300045836 | Bacteria | 3592 |
| 838 | Ga0466958_0097020 | 3300045836 | Bacteria | 1829 |
| 839 | Ga0466958_0242394 | 3300045836 | Bacteria | 1152 |
| 840 | Ga0466958_0912675 | 3300045836 | Bacteria | 573 |
| 841 | Ga0466967_0008845 | 3300045976 | Bacteria | 7424 |
| 842 | Ga0466967_0090607 | 3300045976 | Bacteria | 2778 |
| 843 | Ga0466967_0099719 | 3300045976 | Bacteria | 2653 |
| 844 | Ga0466967_0113895 | 3300045976 | Bacteria | 2489 |
| 845 | Ga0466967_0123042 | 3300045976 | Bacteria | 2400 |
| 846 | Ga0466967_0289247 | 3300045976 | Bacteria | 1574 |
| 847 | Ga0466967_0580652 | 3300045976 | Bacteria | 1105 |
| 848 | Ga0466967_0651543 | 3300045976 | Bacteria | 1041 |
| 849 | Ga0466967_0858070 | 3300045976 | Bacteria | 902 |
| 850 | Ga0466967_1914486 | 3300045976 | Bacteria | 590 |
| 851 | Ga0466967_2478163 | 3300045976 | Bacteria | 514 |
| 852 | Ga0495592_0346114 | 3300046454 | Bacteria | 954 |
| 853 | Ga0495592_0376669 | 3300046454 | Bacteria | 904 |
| 854 | Ga0495592_0473122 | 3300046454 | Bacteria | 782 |
| 855 | Ga0495592_0787020 | 3300046454 | Bacteria | 566 |
| 856 | Ga0495603_0076600 | 3300046455 | Bacteria | 1963 |
| 857 | Ga0495629_0001838 | 3300046459 | Bacteria | 16612 |
| 858 | Ga0495629_0141521 | 3300046459 | Bacteria | 1674 |
| 859 | Ga0495629_1091064 | 3300046459 | Bacteria | 516 |
| 860 | Ga0495638_0006715 | 3300046460 | Bacteria | 8337 |
| 861 | Ga0495651_0779054 | 3300046462 | Bacteria | 591 |
| 862 | Ga0495651_0981367 | 3300046462 | Bacteria | 513 |
| 863 | Ga0495653_0647968 | 3300046463 | Bacteria | 645 |
| 864 | Ga0495650_0018822 | 3300046471 | Bacteria | 3422 |
| 865 | Ga0495582_0001304 | 3300046473 | Bacteria | 13997 |
| 866 | Ga0495582_0056891 | 3300046473 | Bacteria | 2156 |
| 867 | Ga0495582_0362623 | 3300046473 | Bacteria | 835 |
| 868 | Ga0495639_0005528 | 3300046475 | Bacteria | 5440 |
| 869 | Ga0495639_0701418 | 3300046475 | Bacteria | 523 |
| 870 | Ga0495662_0104829 | 3300046476 | Bacteria | 1384 |
| 871 | Ga0495662_0172347 | 3300046476 | Bacteria | 1066 |
| 872 | Ga0495594_0793832 | 3300046499 | Bacteria | 534 |
| 873 | Ga0495583_0314171 | 3300046506 | Bacteria | 621 |
| 874 | Ga0495608_0038811 | 3300046511 | Bacteria | 3196 |
| 875 | Ga0495608_0550015 | 3300046511 | Bacteria | 696 |
| 876 | Ga0495608_0815748 | 3300046511 | Bacteria | 550 |
| 877 | Ga0495618_0015734 | 3300046514 | Bacteria | 4617 |
| 878 | Ga0495618_0038022 | 3300046514 | Bacteria | 3024 |
| 879 | Ga0495618_0102733 | 3300046514 | Bacteria | 1830 |
| 880 | Ga0495618_0314568 | 3300046514 | Bacteria | 971 |
| 881 | Ga0495628_0079638 | 3300046516 | Bacteria | 2547 |
| 882 | Ga0495628_0321668 | 3300046516 | Bacteria | 1141 |
| 883 | Ga0495630_0091160 | 3300046517 | Bacteria | 2303 |
| 884 | Ga0495630_0096646 | 3300046517 | Bacteria | 2233 |
| 885 | Ga0495630_0120107 | 3300046517 | Bacteria | 1994 |
| 886 | Ga0495630_0217144 | 3300046517 | Bacteria | 1460 |
| 887 | Ga0495630_0716575 | 3300046517 | Bacteria | 765 |
| 888 | Ga0495666_0050318 | 3300046526 | Bacteria | 2003 |
| 889 | Ga0495642_0271245 | 3300046528 | Bacteria | 743 |
| 890 | Ga0495652_0125261 | 3300046529 | Bacteria | 2042 |
| 891 | Ga0495665_0042811 | 3300046531 | Bacteria | 2409 |
| 892 | Ga0495665_0194589 | 3300046531 | Bacteria | 1052 |
| 893 | Ga0495640_0039098 | 3300046533 | Bacteria | 3332 |
| 894 | Ga0495640_0254665 | 3300046533 | Bacteria | 1098 |
| 895 | Ga0495640_0435772 | 3300046533 | Bacteria | 802 |
| 896 | Ga0495586_0183392 | 3300046535 | Bacteria | 1184 |
| 897 | Ga0495586_0231452 | 3300046535 | Bacteria | 1052 |
| 898 | Ga0495587_0194466 | 3300046536 | Bacteria | 1148 |
| 899 | Ga0495587_0422261 | 3300046536 | Bacteria | 740 |
| 900 | Ga0495587_0668710 | 3300046536 | Bacteria | 570 |
| 901 | Ga0495621_0019060 | 3300046539 | Bacteria | 2236 |
| 902 | Ga0495645_0315030 | 3300046543 | Bacteria | 1018 |
| 903 | Ga0495667_0258363 | 3300046559 | Bacteria | 1108 |
| 904 | Ga0495668_0282129 | 3300046616 | Bacteria | 910 |
| 905 | Ga0495634_0010302 | 3300046642 | Bacteria | 6851 |
| 906 | Ga0495635_0354004 | 3300046663 | Bacteria | 979 |
| 907 | Ga0495635_0445034 | 3300046663 | Bacteria | 857 |
| 908 | Ga0495659_0091905 | 3300046664 | Bacteria | 1166 |
| 909 | Ga0495659_0198722 | 3300046664 | Bacteria | 822 |
| 910 | Ga0495661_0560434 | 3300046665 | Bacteria | 540 |
| 911 | Ga0495657_0134477 | 3300046675 | Bacteria | 1546 |
| 912 | Ga0495657_0271256 | 3300046675 | Bacteria | 1017 |
| 913 | Ga0495657_0428954 | 3300046675 | Bacteria | 776 |
| 914 | Ga0495646_0588312 | 3300046680 | Bacteria | 566 |
| 915 | Ga0495647_0027634 | 3300046681 | Bacteria | 2086 |
| 916 | Ga0495658_0000768 | 3300046683 | Bacteria | 17344 |
| 917 | Ga0495658_0137927 | 3300046683 | Bacteria | 1490 |
| 918 | Ga0495658_0341428 | 3300046683 | Bacteria | 951 |
| 919 | Ga0495613_0002016 | 3300046689 | Bacteria | 15414 |
| 920 | Ga0495613_0003428 | 3300046689 | Bacteria | 11851 |
| 921 | Ga0495613_0237959 | 3300046689 | Bacteria | 1274 |
| 922 | Ga0495613_0318066 | 3300046689 | Bacteria | 1075 |
| 923 | Ga0495624_0218937 | 3300046690 | Bacteria | 1155 |
| 924 | Ga0495589_0430283 | 3300046794 | Bacteria | 605 |
| 925 | Ga0495581_0031890 | 3300047315 | Bacteria | 3053 |
| 926 | Ga0495604_0234770 | 3300047317 | Bacteria | 1257 |
| 927 | Ga0495604_0289817 | 3300047317 | Bacteria | 1103 |
| 928 | Ga0495604_0519320 | 3300047317 | Bacteria | 771 |
| 929 | Ga0495674_0897481 | 3300047319 | Bacteria | 684 |
| 930 | Ga0495674_0982650 | 3300047319 | Bacteria | 648 |
| 931 | Ga0495676_0243792 | 3300047321 | Bacteria | 1229 |
| 932 | Ga0495680_0041638 | 3300047322 | Bacteria | 3651 |
| 933 | Ga0495680_0293959 | 3300047322 | Bacteria | 1142 |
| 934 | Ga0495680_0363713 | 3300047322 | Bacteria | 1005 |
| 935 | Ga0495684_0352604 | 3300047471 | Bacteria | 1044 |
| 936 | Ga0495684_0424595 | 3300047471 | Bacteria | 929 |
| 937 | Ga0495684_0646642 | 3300047471 | Bacteria | 708 |
| 938 | Ga0495684_0856590 | 3300047471 | Bacteria | 589 |
| 939 | Ga0496100_0039461 | 3300048903 | Bacteria | 2999 |
| 940 | Ga0496100_0370788 | 3300048903 | Bacteria | 1085 |
| 941 | Ga0496100_0529349 | 3300048903 | Bacteria | 910 |
| 942 | Ga0496101_0010834 | 3300048904 | Bacteria | 6031 |
| 943 | Ga0496101_0383109 | 3300048904 | Bacteria | 1106 |
| 944 | Ga0496101_0626458 | 3300048904 | Bacteria | 850 |
| 945 | Ga0496101_1296569 | 3300048904 | Bacteria | 569 |
| 946 | Ga0496102_0000042 | 3300048905 | Bacteria | 196538 |
| 947 | Ga0496102_0032418 | 3300048905 | Bacteria | 4692 |
| 948 | Ga0496102_0910601 | 3300048905 | Bacteria | 801 |
| 949 | Ga0496102_1834448 | 3300048905 | Bacteria | 523 |
| 950 | Ga0496103_0000441 | 3300048906 | Bacteria | 35759 |
| 951 | Ga0496103_0540423 | 3300048906 | Bacteria | 744 |
| 952 | Ga0496104_0043998 | 3300048907 | Bacteria | 4195 |
| 953 | Ga0496104_0095666 | 3300048907 | Bacteria | 2841 |
| 954 | Ga0496104_0307004 | 3300048907 | Bacteria | 1499 |
| 955 | Ga0496105_0032456 | 3300048908 | Bacteria | 4285 |
| 956 | Ga0496105_0074710 | 3300048908 | Bacteria | 2800 |
| 957 | Ga0496105_0232888 | 3300048908 | Bacteria | 1496 |
| 958 | Ga0496106_0593638 | 3300048909 | Bacteria | 887 |
| 959 | Ga0496106_1156452 | 3300048909 | Bacteria | 605 |
| 960 | Ga0496107_0402990 | 3300048910 | Bacteria | 1017 |
| 961 | Ga0496107_0418534 | 3300048910 | Bacteria | 996 |
| 962 | Ga0496108_0096033 | 3300048911 | Bacteria | 2524 |
| 963 | Ga0496108_0108578 | 3300048911 | Bacteria | 2371 |
| 964 | Ga0496109_0014217 | 3300048912 | Bacteria | 6924 |
| 965 | Ga0496109_0055655 | 3300048912 | Bacteria | 3609 |
| 966 | Ga0496109_0164002 | 3300048912 | Bacteria | 2083 |
| 967 | Ga0496109_0316088 | 3300048912 | Bacteria | 1473 |
| 968 | Ga0496109_0519440 | 3300048912 | Bacteria | 1124 |
| 969 | Ga0496109_0694656 | 3300048912 | Bacteria | 955 |
| 970 | Ga0496109_2021775 | 3300048912 | Bacteria | 508 |
| 971 | Ga0496110_0001134 | 3300048913 | Bacteria | 18834 |
| 972 | Ga0496110_0114379 | 3300048913 | Bacteria | 2428 |
| 973 | Ga0496110_0759497 | 3300048913 | Bacteria | 873 |
| 974 | Ga0496110_0809841 | 3300048913 | Bacteria | 841 |
| 975 | Ga0496110_0862406 | 3300048913 | Bacteria | 811 |
| 976 | Ga0496110_1061719 | 3300048913 | Bacteria | 718 |
| 977 | Ga0496111_0004889 | 3300048914 | Bacteria | 8510 |
| 978 | Ga0496111_0116350 | 3300048914 | Bacteria | 1972 |
| 979 | Ga0496111_0221314 | 3300048914 | Bacteria | 1406 |
| 980 | Ga0496112_0360731 | 3300048915 | Bacteria | 1395 |
| 981 | Ga0496112_0430486 | 3300048915 | Bacteria | 1258 |
| 982 | Ga0496112_0512479 | 3300048915 | Bacteria | 1135 |
| 983 | Ga0496113_0609708 | 3300048916 | Bacteria | 874 |
| 984 | Ga0496113_0631226 | 3300048916 | Bacteria | 857 |
| 985 | Ga0496113_0699773 | 3300048916 | Bacteria | 809 |
| 986 | Ga0496114_0020577 | 3300048917 | Bacteria | 5355 |
| 987 | Ga0496114_0026409 | 3300048917 | Bacteria | 4754 |
| 988 | Ga0496114_0249952 | 3300048917 | Bacteria | 1560 |
| 989 | Ga0496114_0250078 | 3300048917 | Bacteria | 1560 |
| 990 | Ga0496114_0422616 | 3300048917 | Bacteria | 1181 |
| 991 | Ga0496114_0621637 | 3300048917 | Bacteria | 952 |
| 992 | Ga0496115_0001342 | 3300048918 | Bacteria | 17547 |
| 993 | Ga0496115_0427445 | 3300048918 | Bacteria | 1072 |
| 994 | Ga0496115_0533782 | 3300048918 | Bacteria | 939 |
| 995 | Ga0496115_0684151 | 3300048918 | Bacteria | 808 |
| 996 | Ga0496116_0000945 | 3300048919 | Bacteria | 35787 |
| 997 | Ga0496117_0000339 | 3300048920 | Bacteria | 82597 |
| 998 | Ga0496118_0000241 | 3300048921 | Bacteria | 96484 |
| 999 | Ga0496119_0000974 | 3300048922 | Bacteria | 36779 |
| 1000 | Ga0496119_0005030 | 3300048922 | Bacteria | 12856 |
| 1001 | Ga0496121_0015684 | 3300048924 | Bacteria | 7905 |
| 1002 | Ga0496122_0203487 | 3300048925 | Bacteria | 1155 |
| 1003 | Ga0496124_0011730 | 3300048927 | Bacteria | 8741 |
| 1004 | Ga0496124_0774809 | 3300048927 | Bacteria | 598 |
| 1005 | Ga0496124_0888484 | 3300048927 | Bacteria | 542 |
| 1006 | Ga0496125_0065774 | 3300048928 | Bacteria | 2869 |
| 1007 | Ga0496125_0081564 | 3300048928 | Bacteria | 2470 |
| 1008 | Ga0496125_0269517 | 3300048928 | Bacteria | 1062 |
| 1009 | Ga0496126_0000048 | 3300048929 | Bacteria | 317977 |
| 1010 | Ga0496126_0001023 | 3300048929 | Bacteria | 47541 |
| 1011 | Ga0496126_0014903 | 3300048929 | Bacteria | 7840 |
| 1012 | Ga0496126_0258942 | 3300048929 | Bacteria | 1447 |
| 1013 | Ga0501031_0148729 | 3300049568 | Bacteria | 1530 |
| 1014 | Ga0501031_0221855 | 3300049568 | Bacteria | 1231 |
| 1015 | Ga0501032_0021055 | 3300049569 | Bacteria | 4536 |
| 1016 | Ga0501032_0028980 | 3300049569 | Bacteria | 3801 |
| 1017 | Ga0501032_0769258 | 3300049569 | Bacteria | 609 |
| 1018 | Ga0501033_0019417 | 3300049570 | Bacteria | 5140 |
| 1019 | Ga0501033_0097637 | 3300049570 | Bacteria | 2146 |
| 1020 | Ga0501033_0171727 | 3300049570 | Bacteria | 1557 |
| 1021 | Ga0501033_0205131 | 3300049570 | Bacteria | 1407 |
| 1022 | Ga0501033_0217938 | 3300049570 | Bacteria | 1359 |
| 1023 | Ga0501033_0739794 | 3300049570 | Bacteria | 667 |
| 1024 | Ga0501034_0054766 | 3300049571 | Bacteria | 4015 |
| 1025 | Ga0501036_0059238 | 3300049572 | Bacteria | 3245 |
| 1026 | Ga0501036_0074935 | 3300049572 | Bacteria | 2862 |
| 1027 | Ga0501036_0114848 | 3300049572 | Bacteria | 2275 |
| 1028 | Ga0501036_0261029 | 3300049572 | Bacteria | 1451 |
| 1029 | Ga0501037_0126700 | 3300049573 | Bacteria | 1833 |
| 1030 | Ga0501037_0293618 | 3300049573 | Bacteria | 1130 |
| 1031 | Ga0501037_0348555 | 3300049573 | Bacteria | 1022 |
| 1032 | Ga0501038_0065354 | 3300049574 | Bacteria | 3099 |
| 1033 | Ga0501038_0245596 | 3300049574 | Bacteria | 1420 |
| 1034 | Ga0501038_0381482 | 3300049574 | Bacteria | 1093 |
| 1035 | Ga0501038_0890690 | 3300049574 | Bacteria | 657 |
| 1036 | Ga0501039_0105439 | 3300049575 | Bacteria | 2201 |
| 1037 | Ga0501040_0045950 | 3300049576 | Bacteria | 2980 |
| 1038 | Ga0501041_0037890 | 3300049577 | Bacteria | 2923 |
| 1039 | Ga0501041_0325914 | 3300049577 | Bacteria | 969 |
| 1040 | Ga0501041_0656819 | 3300049577 | Bacteria | 670 |
| 1041 | Ga0501041_0675703 | 3300049577 | Bacteria | 660 |
| 1042 | Ga0501042_0419113 | 3300049578 | Bacteria | 970 |
| 1043 | Ga0501042_0568807 | 3300049578 | Bacteria | 824 |
| 1044 | Ga0501043_0125103 | 3300049579 | Bacteria | 2016 |
| 1045 | Ga0501043_0162604 | 3300049579 | Bacteria | 1744 |
| 1046 | Ga0501046_0045701 | 3300049580 | Bacteria | 3478 |
| 1047 | Ga0501046_0344406 | 3300049580 | Bacteria | 1083 |
| 1048 | Ga0501046_0814615 | 3300049580 | Bacteria | 654 |
| 1049 | Ga0501047_0003711 | 3300049581 | Bacteria | 14377 |
| 1050 | Ga0501047_0004314 | 3300049581 | Bacteria | 13385 |
| 1051 | Ga0501047_0195962 | 3300049581 | Bacteria | 1882 |
| 1052 | Ga0501047_0638941 | 3300049581 | Bacteria | 884 |
| 1053 | Ga0501048_0092335 | 3300049582 | Bacteria | 2135 |
| 1054 | Ga0501048_0168535 | 3300049582 | Bacteria | 1551 |
| 1055 | Ga0501067_0032242 | 3300049583 | Bacteria | 2908 |
| 1056 | Ga0501067_0249101 | 3300049583 | Bacteria | 989 |
| 1057 | Ga0501068_0013339 | 3300049584 | Bacteria | 4674 |
| 1058 | Ga0501068_0023389 | 3300049584 | Bacteria | 3621 |
| 1059 | Ga0501068_0624585 | 3300049584 | Bacteria | 703 |
| 1060 | Ga0501069_0016892 | 3300049585 | Bacteria | 3921 |
| 1061 | Ga0501069_0113838 | 3300049585 | Bacteria | 1542 |
| 1062 | Ga0501069_0644075 | 3300049585 | Bacteria | 637 |
| 1063 | Ga0501070_0157431 | 3300049586 | Bacteria | 1873 |
| 1064 | Ga0501070_0305514 | 3300049586 | Bacteria | 1295 |
| 1065 | Ga0501071_0018841 | 3300049587 | Bacteria | 4786 |
| 1066 | Ga0501071_0097881 | 3300049587 | Bacteria | 2160 |
| 1067 | Ga0501071_0317829 | 3300049587 | Bacteria | 1182 |
| 1068 | Ga0501071_1051222 | 3300049587 | Bacteria | 629 |
| 1069 | Ga0501071_1095691 | 3300049587 | Bacteria | 615 |
| 1070 | Ga0501072_0060638 | 3300049588 | Bacteria | 2983 |
| 1071 | Ga0501072_0260015 | 3300049588 | Bacteria | 1382 |
| 1072 | Ga0501072_0348966 | 3300049588 | Bacteria | 1175 |
| 1073 | Ga0501072_0525669 | 3300049588 | Bacteria | 935 |
| 1074 | Ga0501072_1544388 | 3300049588 | Bacteria | 512 |
| 1075 | Ga0501072_1578694 | 3300049588 | Bacteria | 506 |
| 1076 | Ga0501073_0024330 | 3300049589 | Bacteria | 4348 |
| 1077 | Ga0501073_0303073 | 3300049589 | Bacteria | 1102 |
| 1078 | Ga0501073_0748604 | 3300049589 | Bacteria | 674 |
| 1079 | Ga0501074_0029881 | 3300049590 | Bacteria | 3949 |
| 1080 | Ga0501074_0049524 | 3300049590 | Bacteria | 3033 |
| 1081 | Ga0501074_0249189 | 3300049590 | Bacteria | 1263 |
| 1082 | Ga0501075_0095056 | 3300049591 | Bacteria | 2262 |
| 1083 | Ga0501075_0100288 | 3300049591 | Bacteria | 2199 |
| 1084 | Ga0501075_0159627 | 3300049591 | Bacteria | 1720 |
| 1085 | Ga0501075_0231282 | 3300049591 | Bacteria | 1410 |
| 1086 | Ga0501076_0146917 | 3300049592 | Bacteria | 1917 |
| 1087 | Ga0501076_1276291 | 3300049592 | Bacteria | 604 |
| 1088 | Ga0501076_1371378 | 3300049592 | Bacteria | 581 |
| 1089 | Ga0501076_1422952 | 3300049592 | Bacteria | 569 |
| 1090 | Ga0501076_1787528 | 3300049592 | Bacteria | 504 |
| 1091 | Ga0501077_0238703 | 3300049593 | Bacteria | 1155 |
| 1092 | Ga0501079_0027399 | 3300049741 | Bacteria | 4369 |
| 1093 | Ga0501079_0111396 | 3300049741 | Bacteria | 2127 |
| 1094 | Ga0501079_0479934 | 3300049741 | Bacteria | 977 |
| 1095 | Ga0501079_0696520 | 3300049741 | Bacteria | 800 |
| 1096 | Ga0501079_1168956 | 3300049741 | Bacteria | 606 |
| 1097 | Ga0501079_1420197 | 3300049741 | Bacteria | 546 |
| 1098 | Ga0501080_0068596 | 3300049742 | Bacteria | 3298 |
| 1099 | Ga0501080_0198111 | 3300049742 | Bacteria | 1844 |
| 1100 | Ga0501080_1034684 | 3300049742 | Bacteria | 711 |
| 1101 | Ga0501081_0021156 | 3300049743 | Bacteria | 4341 |
| 1102 | Ga0501081_1489333 | 3300049743 | Bacteria | 514 |
| 1103 | Ga0501083_0009415 | 3300049744 | Bacteria | 6900 |
| 1104 | Ga0501083_0041629 | 3300049744 | Bacteria | 3115 |
| 1105 | Ga0501083_0145642 | 3300049744 | Bacteria | 1551 |
| 1106 | Ga0501035_0000344 | 3300049822 | Bacteria | 53753 |
| 1107 | Ga0501035_1008386 | 3300049822 | Bacteria | 654 |
| 1108 | Ga0501044_0000789 | 3300049823 | Bacteria | 38288 |
| 1109 | Ga0501044_0076018 | 3300049823 | Bacteria | 3410 |
| 1110 | Ga0501044_0472153 | 3300049823 | Bacteria | 1158 |
| 1111 | Ga0501044_1040950 | 3300049823 | Bacteria | 689 |
| 1112 | Ga0501044_1086291 | 3300049823 | Bacteria | 670 |
| 1113 | Ga0501045_0016156 | 3300049824 | Bacteria | 5297 |
| 1114 | Ga0501045_0024119 | 3300049824 | Bacteria | 4366 |
| 1115 | nmdc:mga03683_46440_c1 | 3300050489 | Bacteria | 1800 |
| 1116 | nmdc:mga03n38_445026_c1 | 3300050490 | Bacteria | 720 |
| 1117 | nmdc:mga03n38_78883_c1 | 3300050490 | Bacteria | 1542 |
| 1118 | nmdc:mga03n38_981545_c1 | 3300050490 | Bacteria | 500 |
| 1119 | nmdc:mga00v17_22968_c1 | 3300050491 | Bacteria | 3605 |
| 1120 | nmdc:mga00v17_234672_c1 | 3300050491 | Bacteria | 1189 |
| 1121 | nmdc:mga00v17_344259_c1 | 3300050491 | Bacteria | 969 |
| 1122 | nmdc:mga00v17_48954_c1 | 3300050491 | Bacteria | 2562 |
| 1123 | nmdc:mga00v17_499671_c1 | 3300050491 | Bacteria | 788 |
| 1124 | nmdc:mga0yw44_1192224_c1 | 3300050492 | Bacteria | 514 |
| 1125 | nmdc:mga0yw44_1216824_c1 | 3300050492 | Bacteria | 508 |
| 1126 | nmdc:mga0yw44_17771_c1 | 3300050492 | Bacteria | 3879 |
| 1127 | nmdc:mga0yw44_456736_c1 | 3300050492 | Bacteria | 866 |
| 1128 | nmdc:mga0yw44_629209_c1 | 3300050492 | Bacteria | 729 |
| 1129 | nmdc:mga0yw44_75634_c1 | 3300050492 | Bacteria | 2100 |
| 1130 | nmdc:mga0yw44_8942_c1 | 3300050492 | Bacteria | 5026 |
| 1131 | nmdc:mga0yw44_931202_c1 | 3300050492 | Bacteria | 589 |
| 1132 | nmdc:mga06z11_198439_c1 | 3300050494 | Bacteria | 1164 |
| 1133 | nmdc:mga06z11_28989_c1 | 3300050494 | Bacteria | 2662 |
| 1134 | nmdc:mga07m45_226378_c1 | 3300050496 | Bacteria | 1088 |
| 1135 | nmdc:mga07m45_58458_c1 | 3300050496 | Bacteria | 2181 |
| 1136 | nmdc:mga05p37_130623_c1 | 3300050507 | Bacteria | 3082 |
| 1137 | nmdc:mga05p37_1518642_c1 | 3300050507 | Bacteria | 666 |
| 1138 | nmdc:mga05p37_1910250_c1 | 3300050507 | Bacteria | 566 |
| 1139 | nmdc:mga05p37_2241226_c1 | 3300050507 | Bacteria | 505 |
| 1140 | nmdc:mga05p37_2278178_c1 | 3300050507 | Bacteria | 500 |
| 1141 | nmdc:mga05p37_235867_c1 | 3300050507 | Bacteria | 2202 |
| 1142 | nmdc:mga05p37_340652_c1 | 3300050507 | Bacteria | 1450 |
| 1143 | nmdc:mga05p37_490988_c1 | 3300050507 | Bacteria | 1412 |
| 1144 | nmdc:mga05p37_498037_c1 | 3300050507 | Bacteria | 1399 |
| 1145 | nmdc:mga09592_508628_c1 | 3300050508 | Bacteria | 1037 |
| 1146 | nmdc:mga09592_568420_c1 | 3300050508 | Bacteria | 973 |
| 1147 | nmdc:mga09592_678165_c1 | 3300050508 | Bacteria | 878 |
| 1148 | nmdc:mga09592_915146_c1 | 3300050508 | Bacteria | 737 |
| 1149 | nmdc:mga0qj67_1050245_c1 | 3300050509 | Bacteria | 638 |
| 1150 | nmdc:mga0qj67_1443945_c1 | 3300050509 | Bacteria | 530 |
| 1151 | nmdc:mga0qj67_152952_c1 | 3300050509 | Bacteria | 1872 |
| 1152 | nmdc:mga0qj67_304993_c1 | 3300050509 | Bacteria | 1290 |
| 1153 | nmdc:mga0qj67_33373_c1 | 3300050509 | Bacteria | 4016 |
| 1154 | nmdc:mga0qj67_4267_c1 | 3300050509 | Bacteria | 10358 |
| 1155 | nmdc:mga0qj67_899361_c1 | 3300050509 | Bacteria | 698 |
| 1156 | nmdc:mga06r32_103139_c1 | 3300050510 | Bacteria | 2801 |
| 1157 | nmdc:mga06r32_117_c4 | 3300050510 | Bacteria | 9813 |
| 1158 | nmdc:mga06r32_231251_c1 | 3300050510 | Bacteria | 1837 |
| 1159 | nmdc:mga06r32_686023_c1 | 3300050510 | Bacteria | 991 |
| 1160 | nmdc:mga06r32_725520_c1 | 3300050510 | Bacteria | 958 |
| 1161 | nmdc:mga08y16_21097_c1 | 3300050511 | Bacteria | 6878 |
| 1162 | nmdc:mga08y16_25971_c1 | 3300050511 | Bacteria | 6179 |
| 1163 | nmdc:mga08y16_336157_c1 | 3300050511 | Bacteria | 1553 |
| 1164 | nmdc:mga08y16_407831_c1 | 3300050511 | Bacteria | 1390 |
| 1165 | nmdc:mga08y16_905083_c1 | 3300050511 | Bacteria | 868 |
| 1166 | nmdc:mga0n895_928384_c1 | 3300050512 | Bacteria | 855 |
| 1167 | nmdc:mga0rr50_1099115_c1 | 3300050513 | Bacteria | 676 |
| 1168 | nmdc:mga0rr50_113441_c1 | 3300050513 | Bacteria | 2148 |
| 1169 | nmdc:mga08x19_17051_c1 | 3300050514 | Bacteria | 4439 |
| 1170 | nmdc:mga0a205_1207_c1 | 3300050515 | Bacteria | 21618 |
| 1171 | nmdc:mga0sz30_1847_c1 | 3300050516 | Bacteria | 7539 |
| 1172 | nmdc:mga0sz30_2249_c1 | 3300050516 | Bacteria | 6906 |
| 1173 | nmdc:mga0sz30_56369_c1 | 3300050516 | Bacteria | 1673 |
| 1174 | nmdc:mga0sz30_576174_c1 | 3300050516 | Bacteria | 509 |
| 1175 | nmdc:mga0sz30_95838_c1 | 3300050516 | Bacteria | 1294 |
| 1176 | Ga0495601_0015238 | 3300053077 | Bacteria | 4644 |
| 1177 | Ga0495601_0276100 | 3300053077 | Bacteria | 1096 |
| 1178 | Ga0495601_0958461 | 3300053077 | Bacteria | 539 |
| 1179 | Ga0500635_0006210 | 3300053080 | Bacteria | 3180 |
| 1180 | Ga0495595_0006436 | 3300053084 | Bacteria | 4791 |
| 1181 | Ga0495619_0022565 | 3300053085 | Bacteria | 4030 |
| 1182 | Ga0495619_0031947 | 3300053085 | Bacteria | 3413 |
| 1183 | Ga0495619_0054547 | 3300053085 | Bacteria | 2646 |
| 1184 | Ga0495619_0238864 | 3300053085 | Bacteria | 1259 |
| 1185 | Ga0495619_0596517 | 3300053085 | Bacteria | 756 |
| 1186 | Ga0495619_0624243 | 3300053085 | Bacteria | 736 |
| 1187 | Ga0495619_0998847 | 3300053085 | Bacteria | 560 |
| 1188 | Ga0500578_0342863 | 3300053086 | Bacteria | 875 |
| 1189 | Ga0500643_015055 | 3300053087 | Bacteria | 2664 |
| 1190 | Ga0500566_0067062 | 3300053094 | Bacteria | 2021 |
| 1191 | Ga0500650_0369329 | 3300053098 | Bacteria | 625 |
| 1192 | Ga0500555_150328 | 3300053103 | Bacteria | 571 |
| 1193 | Ga0500557_190273 | 3300053105 | Bacteria | 664 |
| 1194 | Ga0500642_0105452 | 3300053130 | Bacteria | 1313 |
| 1195 | Ga0500652_023340 | 3300053131 | Bacteria | 2352 |
| 1196 | Ga0500652_027596 | 3300053131 | Bacteria | 2196 |
| 1197 | Ga0500655_022521 | 3300053133 | Bacteria | 1186 |
| 1198 | Ga0500658_0328287 | 3300053134 | Bacteria | 703 |
| 1199 | Ga0500559_0037276 | 3300053136 | Bacteria | 2107 |
| 1200 | Ga0500568_0125094 | 3300053139 | Bacteria | 957 |
| 1201 | Ga0500622_0001519 | 3300053156 | Bacteria | 18396 |
| 1202 | Ga0500627_0033786 | 3300053158 | Bacteria | 2164 |
| 1203 | Ga0500645_000668 | 3300053730 | Bacteria | 21553 |
| 1204 | Ga0500645_021063 | 3300053730 | Bacteria | 2014 |
| 1205 | Ga0501084_0006042 | 3300054114 | Bacteria | 9958 |
| 1206 | Ga0501084_0027890 | 3300054114 | Bacteria | 4718 |
| 1207 | Ga0501084_0107170 | 3300054114 | Bacteria | 2348 |
| 1208 | Ga0501084_0492915 | 3300054114 | Bacteria | 1035 |
| 1209 | Ga0501084_0591747 | 3300054114 | Bacteria | 937 |
| 1210 | Ga0590075_214203 | 3300059424 | Bacteria | 510 |
| 1211 | Ga0587080_068695 | 3300059503 | Bacteria | 705 |
| 1212 | Ga0587082_014570 | 3300059504 | Bacteria | 1201 |
| 1213 | Ga0587083_0065564 | 3300059505 | Bacteria | 830 |
| 1214 | Ga0587086_107206 | 3300059507 | Bacteria | 521 |
| 1215 | Ga0587088_004267 | 3300059508 | Bacteria | 1796 |
| 1216 | Ga0587067_185259 | 3300059640 | Bacteria | 545 |
| 1217 | Ga0587067_199682 | 3300059640 | Bacteria | 531 |
| 1218 | Ga0587107_064061 | 3300059652 | Bacteria | 655 |
| 1219 | Ga0587071_103876 | 3300060344 | Bacteria | 661 |
| 1220 | Ga0501082_0150225 | 3300060353 | Bacteria | 2023 |
| 1221 | Ga0501082_0287765 | 3300060353 | Bacteria | 1430 |
| 1222 | Ga0501082_0700477 | 3300060353 | Bacteria | 886 |
| 1223 | Ga0501082_1121244 | 3300060353 | Bacteria | 688 |
| 1224 | Ga0466962_0011220 | 3300061719 | Bacteria | 4315 |
| 1225 | Ga0466962_0094980 | 3300061719 | Bacteria | 1429 |
| 1226 | Ga0466962_0348148 | 3300061719 | Bacteria | 738 |
| 1227 | Ga0466962_0708448 | 3300061719 | Bacteria | 517 |
| 1228 | Ga0466962_0709072 | 3300061719 | Bacteria | 516 |
| 1229 | Ga0530510_0311667 | 3300061734 | Bacteria | 1179 |
| 1230 | Ga0530510_0393618 | 3300061734 | Bacteria | 1044 |
| 1231 | Ga0530510_0516374 | 3300061734 | Bacteria | 906 |
| 1232 | 2523385284 | 2523231044 | Bacteria | 6434991 |
| 1233 | 2548697871 | 2547132424 | Bacteria | 8348532 |
| 1234 | 2566993091 | 2565956761 | Bacteria | 6601618 |
| 1235 | 2586059296 | 2585427649 | Bacteria | 9053857 |
| 1236 | 2643825374 | 2643221561 | Bacteria | 4984412 |
| 1237 | 2643893151 | 2643221576 | Bacteria | 5214352 |
| 1238 | 2643961790 | 2643221590 | Bacteria | 5214697 |
| 1239 | 2644034122 | 2643221604 | Bacteria | 5014917 |
| 1240 | 2644229104 | 2643221641 | Bacteria | 4490190 |
| 1241 | 2644531368 | 2643221696 | Bacteria | 5431823 |
| 1242 | 2676486393 | 2675903059 | Bacteria | 8644972 |
| 1243 | 2738706070 | 2738541274 | Bacteria | 6909446 |
| 1244 | 2738889946 | 2738541308 | Bacteria | 7020677 |
| 1245 | 2739203266 | 2738543005 | Bacteria | 5278128 |
| 1246 | 2739238710 | 2738543011 | Bacteria | 5731169 |
| 1247 | 2739333030 | 2738543028 | Bacteria | 6917070 |
| 1248 | 2739602534 | 2739367653 | Bacteria | 2780952 |
| 1249 | 2744955924 | 2744054611 | Bacteria | 5611514 |
| 1250 | 2753035260 | 2751185725 | Bacteria | 5740550 |
| 1251 | 2753323777 | 2751185792 | Bacteria | 5739090 |
| 1252 | 2809591942 | 2808606522 | Bacteria | 9488490 |
| 1253 | 2812333812 | 2811994874 | Bacteria | 5367947 |
| 1254 | 2816504661 | 2816332139 | Bacteria | 9138787 |
| 1255 | 2817508954 | 2816332305 | Bacteria | 2697803 |
| 1256 | 2842891788 | 2842888712 | Bacteria | 4279094 |
| 1257 | 2855387606 | 2855386786 | Bacteria | 4752232 |
| 1258 | 2857729785 | 2857727296 | Bacteria | 2745552 |
| 1259 | 2866616840 | 2866612099 | Bacteria | 7543886 |
| 1260 | 2889300983 | 2889300758 | Bacteria | 5690814 |
| 1261 | 2891327581 | 2891326441 | Bacteria | 6439512 |
| 1262 | 2893686738 | 2893684298 | Bacteria | 2897960 |
| 1263 | 2899364124 | 2899359706 | Bacteria | 10940472 |
| 1264 | 2899373294 | 2899370129 | Bacteria | 6781179 |
| 1265 | 2899374248 | 2899370129 | Bacteria | 6781179 |
| 1266 | 2902801632 | 2902799365 | Bacteria | 5419524 |
| 1267 | 2904538915 | 2904535858 | Bacteria | 6308016 |
| 1268 | 2915774013 | 2915768154 | Bacteria | 8424322 |
| 1269 | 2917736543 | 2917736166 | Bacteria | 9690793 |
| 1270 | 2917738923 | 2917736166 | Bacteria | 9690793 |
| 1271 | 2919715954 | 2919713450 | Bacteria | 7431245 |
| 1272 | 2922556787 | 2922554459 | Bacteria | 6683962 |
| 1273 | 2928142509 | 2928142448 | Bacteria | 5288925 |
| 1274 | 2929214799 | 2929212328 | Bacteria | 7708288 |
| 1275 | 2939744502 | 2939743619 | Bacteria | 5762299 |
| 1276 | 2956940453 | 2956939328 | Bacteria | 3474458 |
| 1277 | 2974317246 | 2974315732 | Bacteria | 4602776 |
| 1278 | 2984525451 | 2984523437 | Bacteria | 4508481 |
| 1279 | 3001121878 | 3001119090 | Bacteria | 3449530 |
| 1280 | 3001890948 | 3001889506 | Bacteria | 2975194 |
| 1281 | 8047718024 | 8047710418 | Bacteria | 11023148 |
| 1282 | 8054474306 | 8054472261 | Bacteria | 7464355 |
| 1283 | 8056211997 | 8056207758 | Bacteria | 8639239 |
| 1284 | Ga0466965_0730883 | |||
| 1285 | MBSR1b_contig_13805831 | |||
| 1286 | LJQas_1036547 | |||
| 1287 | LJQas_1046351 | |||
| 1288 | JGI24737J22298_10192071 | |||
| 1289 | JGI24735J21928_10219037 | |||
| 1290 | JGI24745J21846_1050926 | |||
| 1291 | JGI24738J21930_10007846 | |||
| 1292 | JGI24744J21845_10004671 | |||
| 1293 | JGI25406J46586_10000557 | |||
| 1294 | JGI25404J52841_10117817 | |||
| 1295 | Ga0032354_1059068 | |||
| 1296 | JGI25405J52794_10122767 | |||
| 1297 | JGI25405J52794_10127411 | |||
| 1298 | Ga0058861_10062782 | |||
| 1299 | Ga0065715_10107560 | |||
| 1300 | Ga0070658_10002468 | |||
| 1301 | Ga0070658_10043582 | |||
| 1302 | Ga0070658_10109830 | |||
| 1303 | Ga0070683_100107447 | |||
| 1304 | Ga0070683_100820770 | |||
| 1305 | Ga0070683_100969589 | |||
| 1306 | Ga0070683_101124831 | |||
| 1307 | Ga0070683_101747337 | |||
| 1308 | Ga0070683_101811745 | |||
| 1309 | Ga0070690_100193406 | |||
| 1310 | Ga0070670_100088299 | |||
| 1311 | Ga0070670_100923993 | |||
| 1312 | Ga0070677_10030834 | |||
| 1313 | Ga0068869_100137882 | |||
| 1314 | Ga0068869_100277018 | |||
| 1315 | Ga0070666_10060982 | |||
| 1316 | Ga0070666_11502518 | |||
| 1317 | Ga0070680_100092789 | |||
| 1318 | Ga0070680_100335651 | |||
| 1319 | Ga0070680_100997479 | |||
| 1320 | Ga0070682_100022697 | |||
| 1321 | Ga0070682_100038748 | |||
| 1322 | Ga0070682_101319965 | |||
| 1323 | Ga0070682_101940647 | |||
| 1324 | Ga0068868_100005750 | |||
| 1325 | Ga0068868_100048391 | |||
| 1326 | Ga0068868_100100866 | |||
| 1327 | Ga0070660_100840550 | |||
| 1328 | Ga0070687_100055582 | |||
| 1329 | Ga0070661_100002837 | |||
| 1330 | Ga0070661_100063531 | |||
| 1331 | Ga0070692_10040065 | |||
| 1332 | Ga0070692_10328616 | |||
| 1333 | Ga0070668_100014673 | |||
| 1334 | Ga0070668_100544140 | |||
| 1335 | Ga0070668_100568207 | |||
| 1336 | Ga0070668_101101810 | |||
| 1337 | Ga0070669_100032308 | |||
| 1338 | Ga0070669_100593025 | |||
| 1339 | Ga0070675_100008970 | |||
| 1340 | Ga0070675_100116574 | |||
| 1341 | Ga0070671_100009707 | |||
| 1342 | Ga0070671_100059001 | |||
| 1343 | Ga0070674_100016409 | |||
| 1344 | Ga0070674_100112789 | |||
| 1345 | Ga0070673_100038671 | |||
| 1346 | Ga0070673_100106514 | |||
| 1347 | Ga0070688_100457717 | |||
| 1348 | Ga0070659_100003049 | |||
| 1349 | Ga0070659_100138579 | |||
| 1350 | Ga0070659_101135028 | |||
| 1351 | Ga0070667_100002382 | |||
| 1352 | Ga0070667_101023389 | |||
| 1353 | Ga0070667_102240508 | |||
| 1354 | Ga0070709_10004981 | |||
| 1355 | Ga0070709_10488370 | |||
| 1356 | Ga0070714_100003983 | |||
| 1357 | Ga0070714_100342641 | |||
| 1358 | Ga0070714_100467228 | |||
| 1359 | Ga0070714_101186435 | |||
| 1360 | Ga0070714_101283910 | |||
| 1361 | Ga0070714_101286937 | |||
| 1362 | Ga0070714_101324811 | |||
| 1363 | Ga0070714_101404150 | |||
| 1364 | Ga0070713_100011881 | |||
| 1365 | Ga0070713_100017433 | |||
| 1366 | Ga0070713_100048887 | |||
| 1367 | Ga0070713_100353447 | |||
| 1368 | Ga0070710_11311151 | |||
| 1369 | Ga0070701_10239923 | |||
| 1370 | Ga0070711_100094253 | |||
| 1371 | Ga0070711_100393065 | |||
| 1372 | Ga0070705_100062276 | |||
| 1373 | Ga0070705_100144281 | |||
| 1374 | Ga0070705_100241026 | |||
| 1375 | Ga0070700_100000496 | |||
| 1376 | Ga0070700_101016083 | |||
| 1377 | Ga0070700_101048998 | |||
| 1378 | Ga0070694_101037677 | |||
| 1379 | Ga0070708_100005249 | |||
| 1380 | Ga0070708_100096059 | |||
| 1381 | Ga0070708_100247871 | |||
| 1382 | Ga0070708_100264011 | |||
| 1383 | Ga0070708_100308219 | |||
| 1384 | Ga0070708_102151090 | |||
| 1385 | Ga0070663_100983908 | |||
| 1386 | Ga0070663_101150253 | |||
| 1387 | Ga0070678_100975708 | |||
| 1388 | Ga0070662_100006929 | |||
| 1389 | Ga0070662_100748197 | |||
| 1390 | Ga0070681_10043185 | |||
| 1391 | Ga0070681_10105264 | |||
| 1392 | Ga0070681_10506869 | |||
| 1393 | Ga0068867_100032224 | |||
| 1394 | Ga0070685_10580833 | |||
| 1395 | Ga0070706_100010863 | |||
| 1396 | Ga0070706_100020839 | |||
| 1397 | Ga0070706_100111106 | |||
| 1398 | Ga0070706_100123859 | |||
| 1399 | Ga0070706_100254659 | |||
| 1400 | Ga0070706_100395776 | |||
| 1401 | Ga0070706_100431228 | |||
| 1402 | Ga0070706_100510977 | |||
| 1403 | Ga0070706_100923094 | |||
| 1404 | Ga0070706_101289851 | |||
| 1405 | Ga0070707_100026702 | |||
| 1406 | Ga0070707_100036027 | |||
| 1407 | Ga0070707_100053090 | |||
| 1408 | Ga0070707_100597833 | |||
| 1409 | Ga0070707_100648085 | |||
| 1410 | Ga0070707_100752743 | |||
| 1411 | Ga0070698_100010804 | |||
| 1412 | Ga0070698_100026804 | |||
| 1413 | Ga0070698_100636328 | |||
| 1414 | Ga0070698_101187327 | |||
| 1415 | Ga0070698_101953425 | |||
| 1416 | Ga0070699_100142129 | |||
| 1417 | Ga0070699_100279351 | |||
| 1418 | Ga0070699_100852791 | |||
| 1419 | Ga0070679_100020333 | |||
| 1420 | Ga0070679_100268044 | |||
| 1421 | Ga0070679_100473434 | |||
| 1422 | Ga0070679_101455580 | |||
| 1423 | Ga0070679_101722982 | |||
| 1424 | Ga0070684_100034430 | |||
| 1425 | Ga0070684_100098733 | |||
| 1426 | Ga0070684_100240053 | |||
| 1427 | Ga0070684_100750930 | |||
| 1428 | Ga0070684_100784902 | |||
| 1429 | Ga0070684_101139896 | |||
| 1430 | Ga0070684_101552384 | |||
| 1431 | Ga0070684_101642613 | |||
| 1432 | Ga0070684_101647483 | |||
| 1433 | Ga0070684_101831130 | |||
| 1434 | Ga0070697_100076709 | |||
| 1435 | Ga0070697_100309081 | |||
| 1436 | Ga0070697_100343878 | |||
| 1437 | Ga0068853_101645086 | |||
| 1438 | Ga0070672_100003015 | |||
| 1439 | Ga0070672_100023529 | |||
| 1440 | Ga0070672_101403547 | |||
| 1441 | Ga0070686_101842284 | |||
| 1442 | Ga0070695_100002318 | |||
| 1443 | Ga0070696_100013997 | |||
| 1444 | Ga0070696_101562685 | |||
| 1445 | Ga0070693_101476577 | |||
| 1446 | Ga0070665_100343871 | |||
| 1447 | Ga0070665_100396861 | |||
| 1448 | Ga0070665_100999683 | |||
| 1449 | Ga0070665_101652289 | |||
| 1450 | Ga0070665_101749318 | |||
| 1451 | Ga0070704_100069626 | |||
| 1452 | Ga0070704_100130951 | |||
| 1453 | Ga0068855_100400976 | |||
| 1454 | Ga0070664_100010679 | |||
| 1455 | Ga0070664_100405112 | |||
| 1456 | Ga0070664_100945411 | |||
| 1457 | Ga0068857_100085936 | |||
| 1458 | Ga0068857_100425411 | |||
| 1459 | Ga0068857_101468536 | |||
| 1460 | Ga0068857_101582244 | |||
| 1461 | Ga0068854_100554433 | |||
| 1462 | Ga0068854_100557693 | |||
| 1463 | Ga0068854_101360254 | |||
| 1464 | Ga0068856_100006013 | |||
| 1465 | Ga0068856_100575722 | |||
| 1466 | Ga0068856_100736820 | |||
| 1467 | Ga0068856_100845803 | |||
| 1468 | Ga0068856_101045040 | |||
| 1469 | Ga0068856_102544859 | |||
| 1470 | Ga0070702_100008637 | |||
| 1471 | Ga0070702_100875171 | |||
| 1472 | Ga0068852_100283388 | |||
| 1473 | Ga0068852_100464557 | |||
| 1474 | Ga0068852_100673797 | |||
| 1475 | Ga0068859_102043802 | |||
| 1476 | Ga0068859_102087715 | |||
| 1477 | Ga0068864_100019997 | |||
| 1478 | Ga0068864_100156166 | |||
| 1479 | Ga0068864_101198524 | |||
| 1480 | Ga0068861_100012401 | |||
| 1481 | Ga0068851_10053954 | |||
| 1482 | Ga0068870_10002986 | |||
| 1483 | Ga0068870_10298767 | |||
| 1484 | Ga0068863_100003819 | |||
| 1485 | Ga0068863_100343770 | |||
| 1486 | Ga0068858_101070606 | |||
| 1487 | Ga0068860_102061356 | |||
| 1488 | Ga0068862_101061002 | |||
| 1489 | Ga0068862_102392078 | |||
| 1490 | Ga0081455_10000011 | |||
| 1491 | Ga0081455_10000146 | |||
| 1492 | Ga0081455_10060369 | |||
| 1493 | Ga0081455_10207048 | |||
| 1494 | Ga0081455_10592939 | |||
| 1495 | Ga0081455_10886914 | |||
| 1496 | Ga0081538_10113978 | |||
| 1497 | Ga0081540_1005748 | |||
| 1498 | Ga0081540_1012491 | |||
| 1499 | Ga0081540_1184034 | |||
| 1500 | Ga0081539_10000680 | |||
| 1501 | Ga0081539_10008252 | |||
| 1502 | Ga0081539_10012205 | |||
| 1503 | Ga0081539_10110850 | |||
| 1504 | Ga0070717_10516064 | |||
| 1505 | Ga0075365_10022436 | |||
| 1506 | Ga0075365_10135314 | |||
| 1507 | Ga0075365_10457265 | |||
| 1508 | Ga0075365_10883836 | |||
| 1509 | Ga0075368_10198448 | |||
| 1510 | Ga0075363_100225157 | |||
| 1511 | Ga0075363_100239534 | |||
| 1512 | Ga0075363_100322303 | |||
| 1513 | Ga0075363_100374463 | |||
| 1514 | Ga0075363_100799460 | |||
| 1515 | Ga0075364_10001970 | |||
| 1516 | Ga0075364_10046982 | |||
| 1517 | Ga0075364_10079296 | |||
| 1518 | Ga0075364_10291890 | |||
| 1519 | Ga0075364_10519831 | |||
| 1520 | Ga0075364_10744395 | |||
| 1521 | Ga0070712_100099237 | |||
| 1522 | Ga0070712_100123350 | |||
| 1523 | Ga0070712_100172158 | |||
| 1524 | Ga0075362_10051899 | |||
| 1525 | Ga0075367_10231875 | |||
| 1526 | Ga0075367_10351188 | |||
| 1527 | Ga0075367_11134290 | |||
| 1528 | Ga0075369_10002158 | |||
| 1529 | Ga0075369_10029977 | |||
| 1530 | Ga0075369_10047735 | |||
| 1531 | Ga0075369_10108859 | |||
| 1532 | Ga0075369_10381764 | |||
| 1533 | Ga0075370_10060732 | |||
| 1534 | Ga0075370_10308899 | |||
| 1535 | Ga0075428_100005376 | |||
| 1536 | Ga0075428_100101616 | |||
| 1537 | Ga0075428_100132135 | |||
| 1538 | Ga0075428_100148020 | |||
| 1539 | Ga0075428_100305488 | |||
| 1540 | Ga0075428_102101881 | |||
| 1541 | Ga0075428_102128485 | |||
| 1542 | Ga0075430_100020264 | |||
| 1543 | Ga0075430_100039113 | |||
| 1544 | Ga0075430_100056359 | |||
| 1545 | Ga0075430_100466811 | |||
| 1546 | Ga0075430_100666913 | |||
| 1547 | Ga0075430_101182232 | |||
| 1548 | Ga0075430_101514131 | |||
| 1549 | Ga0075431_100024151 | |||
| 1550 | Ga0075431_100058242 | |||
| 1551 | Ga0075431_100325399 | |||
| 1552 | Ga0075431_100397141 | |||
| 1553 | Ga0075433_10001247 | |||
| 1554 | Ga0075433_11702713 | |||
| 1555 | Ga0075434_100012123 | |||
| 1556 | Ga0075429_100008749 | |||
| 1557 | Ga0075429_100030849 | |||
| 1558 | Ga0075429_100157500 | |||
| 1559 | Ga0075429_101651734 | |||
| 1560 | Ga0068865_100017855 | |||
| 1561 | Ga0068865_100453135 | |||
| 1562 | Ga0068865_101762633 | |||
| 1563 | Ga0075436_100007862 | |||
| 1564 | Ga0075436_100458466 | |||
| 1565 | Ga0097620_102043915 | |||
| 1566 | Ga0097620_102087836 | |||
| 1567 | Ga0075435_100007473 | |||
| 1568 | Ga0105250_10554690 | |||
| 1569 | Ga0105240_12307560 | |||
| 1570 | Ga0111539_10002357 | |||
| 1571 | Ga0111539_10224514 | |||
| 1572 | Ga0111539_10315643 | |||
| 1573 | Ga0111539_10722001 | |||
| 1574 | Ga0111539_10902671 | |||
| 1575 | Ga0105245_10017895 | |||
| 1576 | Ga0105245_10033741 | |||
| 1577 | Ga0105245_10192653 | |||
| 1578 | Ga0105245_10599460 | |||
| 1579 | Ga0105245_10981512 | |||
| 1580 | Ga0105247_10956556 | |||
| 1581 | Ga0114129_10029661 | |||
| 1582 | Ga0114129_10046672 | |||
| 1583 | Ga0114129_10414997 | |||
| 1584 | Ga0114129_10530242 | |||
| 1585 | Ga0114129_10550483 | |||
| 1586 | Ga0114129_10965093 | |||
| 1587 | Ga0114129_11349640 | |||
| 1588 | Ga0114129_12836769 | |||
| 1589 | Ga0114129_13046711 | |||
| 1590 | Ga0105243_10004734 | |||
| 1591 | Ga0105243_11683948 | |||
| 1592 | Ga0105241_10521708 | |||
| 1593 | Ga0105241_11984814 | |||
| 1594 | Ga0105242_10360774 | |||
| 1595 | Ga0105242_10493056 | |||
| 1596 | Ga0105242_12610326 | |||
| 1597 | Ga0105248_10002978 | |||
| 1598 | Ga0105248_10519552 | |||
| 1599 | Ga0105237_10380647 | |||
| 1600 | Ga0105237_10478802 | |||
| 1601 | Ga0105238_10379370 | |||
| 1602 | Ga0105238_10529754 | |||
| 1603 | Ga0105238_11006104 | |||
| 1604 | Ga0105249_10015360 | |||
| 1605 | Ga0105249_10824157 | |||
| 1606 | Ga0105035_118861 | |||
| 1607 | Ga0105239_10180706 | |||
| 1608 | Ga0105239_10448944 | |||
| 1609 | Ga0105239_10647011 | |||
| 1610 | Ga0105239_10681292 | |||
| 1611 | Ga0105239_11577761 | |||
| 1612 | Ga0105246_10753942 | |||
| 1613 | Ga0157371_10222559 | |||
| 1614 | Ga0157369_10217259 | |||
| 1615 | Ga0157369_10236958 | |||
| 1616 | Ga0157369_10616586 | |||
| 1617 | Ga0157369_10973712 | |||
| 1618 | Ga0157369_11896490 | |||
| 1619 | Ga0157369_12131692 | |||
| 1620 | Ga0157374_10674288 | |||
| 1621 | Ga0157374_10688828 | |||
| 1622 | Ga0157374_10730838 | |||
| 1623 | Ga0157378_10052428 | |||
| 1624 | Ga0157378_11781487 | |||
| 1625 | Ga0163162_10572328 | |||
| 1626 | Ga0163162_11978618 | |||
| 1627 | Ga0157372_10311882 | |||
| 1628 | Ga0157372_12500509 | |||
| 1629 | Ga0157375_10026663 | |||
| 1630 | Ga0157375_10546546 | |||
| 1631 | Ga0157375_10713901 | |||
| 1632 | Ga0163163_10251580 | |||
| 1633 | Ga0163163_10522777 | |||
| 1634 | Ga0163163_10595621 | |||
| 1635 | Ga0163163_11045321 | |||
| 1636 | Ga0163163_11144669 | |||
| 1637 | Ga0163163_11443746 | |||
| 1638 | Ga0163163_12183434 | |||
| 1639 | Ga0163163_12707929 | |||
| 1640 | Ga0157380_10036095 | |||
| 1641 | Ga0157380_11505212 | |||
| 1642 | Ga0157380_12720055 | |||
| 1643 | Ga0157380_13337032 | |||
| 1644 | Ga0182008_10392954 | |||
| 1645 | Ga0182008_10459175 | |||
| 1646 | Ga0157377_11500419 | |||
| 1647 | Ga0157379_10031926 | |||
| 1648 | Ga0157379_10625741 | |||
| 1649 | Ga0157379_11677156 | |||
| 1650 | Ga0157376_10182380 | |||
| 1651 | Ga0157376_11584268 | |||
| 1652 | Ga0157376_12053295 | |||
| 1653 | Ga0157376_13092230 | |||
| 1654 | Ga0163161_10467329 | |||
| 1655 | Ga0163161_11007107 | |||
| 1656 | Ga0163161_11202371 | |||
| 1657 | Ga0163161_11775857 | |||
| 1658 | Ga0197907_10146932 | |||
| 1659 | Ga0197907_11131751 | |||
| 1660 | Ga0206356_10738473 | |||
| 1661 | Ga0206349_1135760 | |||
| 1662 | Ga0206355_1430210 | |||
| 1663 | Ga0206351_10859302 | |||
| 1664 | Ga0206352_10875590 | |||
| 1665 | Ga0206350_10076879 | |||
| 1666 | Ga0206354_10429281 | |||
| 1667 | Ga0206354_10768390 | |||
| 1668 | Ga0206354_11604246 | |||
| 1669 | Ga0206353_10238432 | |||
| 1670 | Ga0206353_10596355 | |||
| 1671 | Ga0213874_10036632 | |||
| 1672 | Ga0213874_10046654 | |||
| 1673 | Ga0213876_10009652 | |||
| 1674 | Ga0213876_10018841 | |||
| 1675 | Ga0213876_10641434 | |||
| 1676 | Ga0213875_10000073 | |||
| 1677 | Ga0213875_10045780 | |||
| 1678 | Ga0224712_10094121 | |||
| 1679 | Ga0224572_1063462 | |||
| 1680 | Ga0209051_1022107 | |||
| 1681 | Ga0209051_1060753 | |||
| 1682 | Ga0207682_10051233 | |||
| 1683 | Ga0207692_10844259 | |||
| 1684 | Ga0207642_10214254 | |||
| 1685 | Ga0207642_10233058 | |||
| 1686 | Ga0207688_10025811 | |||
| 1687 | Ga0207680_10104393 | |||
| 1688 | Ga0207680_10280405 | |||
| 1689 | Ga0207680_10603768 | |||
| 1690 | Ga0207647_10073923 | |||
| 1691 | Ga0207647_10509330 | |||
| 1692 | Ga0207645_11026122 | |||
| 1693 | Ga0207643_10001705 | |||
| 1694 | Ga0207643_10131982 | |||
| 1695 | Ga0207705_10074685 | |||
| 1696 | Ga0207705_10155879 | |||
| 1697 | Ga0207705_10195407 | |||
| 1698 | Ga0207705_11177134 | |||
| 1699 | Ga0207684_10007698 | |||
| 1700 | Ga0207684_10121331 | |||
| 1701 | Ga0207684_10168881 | |||
| 1702 | Ga0207684_10197399 | |||
| 1703 | Ga0207684_10306887 | |||
| 1704 | Ga0207684_10315895 | |||
| 1705 | Ga0207684_10479521 | |||
| 1706 | Ga0207684_10518360 | |||
| 1707 | Ga0207684_11039932 | |||
| 1708 | Ga0207684_11246656 | |||
| 1709 | Ga0207707_10014387 | |||
| 1710 | Ga0207707_10076608 | |||
| 1711 | Ga0207707_10440818 | |||
| 1712 | Ga0207693_10093591 | |||
| 1713 | Ga0207693_10235745 | |||
| 1714 | Ga0207663_10022011 | |||
| 1715 | Ga0207663_10430123 | |||
| 1716 | Ga0207663_10452826 | |||
| 1717 | Ga0207660_10042355 | |||
| 1718 | Ga0207662_10054240 | |||
| 1719 | Ga0207657_10084430 | |||
| 1720 | Ga0207649_10019634 | |||
| 1721 | Ga0207649_10064996 | |||
| 1722 | Ga0207652_10056899 | |||
| 1723 | Ga0207652_10219506 | |||
| 1724 | Ga0207652_10220028 | |||
| 1725 | Ga0207652_10747316 | |||
| 1726 | Ga0207652_10874837 | |||
| 1727 | Ga0207652_11710239 | |||
| 1728 | Ga0207646_10194944 | |||
| 1729 | Ga0207646_10199317 | |||
| 1730 | Ga0207646_10205026 | |||
| 1731 | Ga0207646_10208990 | |||
| 1732 | Ga0207646_10265832 | |||
| 1733 | Ga0207681_10538998 | |||
| 1734 | Ga0207694_10236073 | |||
| 1735 | Ga0207694_11597694 | |||
| 1736 | Ga0207650_10032101 | |||
| 1737 | Ga0207650_11133731 | |||
| 1738 | Ga0207659_10003563 | |||
| 1739 | Ga0207659_10201165 | |||
| 1740 | Ga0207687_10012641 | |||
| 1741 | Ga0207687_10098228 | |||
| 1742 | Ga0207687_10230900 | |||
| 1743 | Ga0207687_10310594 | |||
| 1744 | Ga0207687_10562014 | |||
| 1745 | Ga0207687_11232516 | |||
| 1746 | Ga0207700_10004768 | |||
| 1747 | Ga0207700_10016883 | |||
| 1748 | Ga0207700_10044626 | |||
| 1749 | Ga0207700_10465789 | |||
| 1750 | Ga0207700_11706065 | |||
| 1751 | Ga0207664_10016747 | |||
| 1752 | Ga0207664_10042520 | |||
| 1753 | Ga0207664_10062808 | |||
| 1754 | Ga0207664_10271596 | |||
| 1755 | Ga0207664_10407736 | |||
| 1756 | Ga0207664_11295428 | |||
| 1757 | Ga0207644_10047477 | |||
| 1758 | Ga0207644_10209092 | |||
| 1759 | Ga0207690_10000157 | |||
| 1760 | Ga0207690_11759524 | |||
| 1761 | Ga0207690_11823740 | |||
| 1762 | Ga0207706_10003191 | |||
| 1763 | Ga0207706_11052251 | |||
| 1764 | Ga0207686_10010391 | |||
| 1765 | Ga0207686_10119645 | |||
| 1766 | Ga0207686_10261264 | |||
| 1767 | Ga0207709_10012216 | |||
| 1768 | Ga0207670_10117933 | |||
| 1769 | Ga0207670_11494449 | |||
| 1770 | Ga0207669_10055082 | |||
| 1771 | Ga0207669_10404449 | |||
| 1772 | Ga0207704_10249612 | |||
| 1773 | Ga0207665_10479130 | |||
| 1774 | Ga0207665_11195206 | |||
| 1775 | Ga0207691_10001940 | |||
| 1776 | Ga0207691_10007065 | |||
| 1777 | Ga0207691_10846018 | |||
| 1778 | Ga0207691_11571290 | |||
| 1779 | Ga0207711_10003778 | |||
| 1780 | Ga0207711_10045400 | |||
| 1781 | Ga0207711_11576202 | |||
| 1782 | Ga0207689_10150275 | |||
| 1783 | Ga0207661_10001620 | |||
| 1784 | Ga0207661_10145504 | |||
| 1785 | Ga0207661_10579811 | |||
| 1786 | Ga0207679_10124492 | |||
| 1787 | Ga0207679_11385578 | |||
| 1788 | Ga0207667_10245366 | |||
| 1789 | Ga0207667_11786390 | |||
| 1790 | Ga0207651_10011023 | |||
| 1791 | Ga0207712_10068908 | |||
| 1792 | Ga0207668_10036956 | |||
| 1793 | Ga0207668_10441199 | |||
| 1794 | Ga0207668_10442547 | |||
| 1795 | Ga0207668_10701443 | |||
| 1796 | Ga0207668_12032070 | |||
| 1797 | Ga0207640_10427601 | |||
| 1798 | Ga0207640_11276319 | |||
| 1799 | Ga0207658_10025871 | |||
| 1800 | Ga0207658_10048109 | |||
| 1801 | Ga0207677_10012793 | |||
| 1802 | Ga0207677_10235345 | |||
| 1803 | Ga0207677_10246468 | |||
| 1804 | Ga0207703_10008492 | |||
| 1805 | Ga0207703_11935869 | |||
| 1806 | Ga0207639_10085927 | |||
| 1807 | Ga0207678_10506323 | |||
| 1808 | Ga0207678_11004621 | |||
| 1809 | Ga0207708_10845520 | |||
| 1810 | Ga0207702_10005382 | |||
| 1811 | Ga0207702_10678870 | |||
| 1812 | Ga0207702_11930168 | |||
| 1813 | Ga0207702_12228601 | |||
| 1814 | Ga0207641_10001754 | |||
| 1815 | Ga0207648_10002197 | |||
| 1816 | Ga0207648_11444177 | |||
| 1817 | Ga0207648_11668048 | |||
| 1818 | Ga0207676_10938684 | |||
| 1819 | Ga0207674_10029816 | |||
| 1820 | Ga0207674_10050383 | |||
| 1821 | Ga0207674_11964347 | |||
| 1822 | Ga0207675_100001152 | |||
| 1823 | Ga0207675_101982188 | |||
| 1824 | Ga0207683_10460357 | |||
| 1825 | Ga0207683_10749163 | |||
| 1826 | Ga0207698_10379534 | |||
| 1827 | Ga0207698_10445369 | |||
| 1828 | Ga0207698_10640965 | |||
| 1829 | Ga0207698_10934363 | |||
| 1830 | Ga0207698_11146580 | |||
| 1831 | Ga0209998_10024421 | |||
| 1832 | Ga0209813_10302357 | |||
| 1833 | Ga0207428_10010302 | |||
| 1834 | Ga0207428_10078479 | |||
| 1835 | Ga0207428_10162625 | |||
| 1836 | Ga0207428_10258173 | |||
| 1837 | Ga0268266_10263390 | |||
| 1838 | Ga0268266_10277584 | |||
| 1839 | Ga0268266_10349932 | |||
| 1840 | Ga0268266_12295889 | |||
| 1841 | Ga0268265_10128980 | |||
| 1842 | Ga0268265_11889270 | |||
| 1843 | Ga0268264_10697552 | |||
| 1844 | Ga0268264_10947087 | |||
| 1845 | Ga0265326_10027348 | |||
| 1846 | Ga0265326_10094489 | |||
| 1847 | Ga0265319_1162847 | |||
| 1848 | Ga0265336_10006446 | |||
| 1849 | Ga0265336_10192348 | |||
| 1850 | Ga0307515_10607596 | |||
| 1851 | Ga0265338_10009713 | |||
| 1852 | Ga0265338_10034430 | |||
| 1853 | Ga0265338_10501904 | |||
| 1854 | Ga0265338_10521919 | |||
| 1855 | Ga0307511_10062279 | |||
| 1856 | Ga0307511_10096193 | |||
| 1857 | Ga0316177_1207210 | |||
| 1858 | Ga0316176_1186483 | |||
| 1859 | Ga0316179_1088487 | |||
| 1860 | Ga0316178_1070530 | |||
| 1861 | Ga0316180_1064925 | |||
| 1862 | Ga0316180_1121429 | |||
| 1863 | Ga0316182_1127369 | |||
| 1864 | Ga0265766_1020627 | |||
| 1865 | Ga0265330_10223224 | |||
| 1866 | Ga0265320_10140667 | |||
| 1867 | Ga0265325_10019205 | |||
| 1868 | Ga0265329_10212143 | |||
| 1869 | Ga0265340_10001402 | |||
| 1870 | Ga0265339_10091701 | |||
| 1871 | Ga0265327_10000134 | |||
| 1872 | Ga0265327_10001291 | |||
| 1873 | Ga0265327_10036187 | |||
| 1874 | Ga0265327_10344898 | |||
| 1875 | Ga0265327_10479132 | |||
| 1876 | Ga0307513_10007005 | |||
| 1877 | Ga0307513_10024102 | |||
| 1878 | Ga0307509_10199798 | |||
| 1879 | Ga0265313_10012099 | |||
| 1880 | Ga0310107_108231 | |||
| 1881 | Ga0307508_10017109 | |||
| 1882 | Ga0307514_10374863 | |||
| 1883 | Ga0316575_10000833 | |||
| 1884 | Ga0316579_10004180 | |||
| 1885 | Ga0265314_10047326 | |||
| 1886 | Ga0265314_10068252 | |||
| 1887 | Ga0316576_10000924 | |||
| 1888 | Ga0316576_10001581 | |||
| 1889 | Ga0316576_10002702 | |||
| 1890 | Ga0316578_10000378 | |||
| 1891 | Ga0316578_10019860 | |||
| 1892 | Ga0316578_10020313 | |||
| 1893 | Ga0316578_10174439 | |||
| 1894 | Ga0316577_10139428 | |||
| 1895 | Ga0316577_10236000 | |||
| 1896 | Ga0316577_10390646 | |||
| 1897 | Ga0316045_127936 | |||
| 1898 | Ga0307413_10077997 | |||
| 1899 | Ga0307413_10574101 | |||
| 1900 | Ga0316043_124307 | |||
| 1901 | Ga0307518_10000495 | |||
| 1902 | Ga0307410_10016672 | |||
| 1903 | Ga0307410_12087229 | |||
| 1904 | Ga0307407_10002033 | |||
| 1905 | Ga0307409_100001791 | |||
| 1906 | Ga0307409_100051098 | |||
| 1907 | Ga0307409_101125357 | |||
| 1908 | Ga0307409_101142625 | |||
| 1909 | Ga0307416_100052932 | |||
| 1910 | Ga0307416_100512522 | |||
| 1911 | Ga0307416_102027330 | |||
| 1912 | Ga0307414_10085339 | |||
| 1913 | Ga0307415_100009069 | |||
| 1914 | Ga0307415_100019420 | |||
| 1915 | Ga0307415_100063419 | |||
| 1916 | Ga0307415_100949789 | |||
| 1917 | Ga0307415_101507838 | |||
| 1918 | Ga0316583_10012637 | |||
| 1919 | Ga0316585_10018701 | |||
| 1920 | Ga0316580_10253060 | |||
| 1921 | Ga0307507_10000001 | |||
| 1922 | Ga0307507_10012252 | |||
| 1923 | Ga0307507_10044503 | |||
| 1924 | Ga0307510_10148106 | |||
| 1925 | Ga0307510_10327193 | |||
| 1926 | Ga0316588_1118344 | |||
| 1927 | Ga0316596_1016657 | |||
| 1928 | Ga0316596_1060649 | |||
| 1929 | Ga0373930_0132872 | |||
| 1930 | Ga0373950_0010883 | |||
| 1931 | Ga0373958_0049757 | |||
| 1932 | Ga0373959_0176490 | |||
| 1933 | Ga0373926_0253025 | |||
| 1934 | Ga0373940_0045253 | |||
| 1935 | Ga0373940_0126257 | |||
| 1936 | Ga0373944_0355567 | |||
| 1937 | Ga0373951_0000004 | |||
| 1938 | Ga0373951_0197155 | |||
| 1939 | Ga0373936_0223761 | |||
| 1940 | Ga0373939_0076060 | |||
| 1941 | Ga0373945_0027344 | |||
| 1942 | Ga0373945_0490341 | |||
| 1943 | Ga0373954_0368528 | |||
| 1944 | Ga0373960_0266727 | |||
| 1945 | Ga0373943_0034594 | |||
| 1946 | Ga0373943_0041257 | |||
| 1947 | Ga0373943_0151836 | |||
| 1948 | Ga0373943_0206913 | |||
| 1949 | Ga0373943_0408884 | |||
| 1950 | Ga0373946_0128159 | |||
| 1951 | Ga0373942_0001416 | |||
| 1952 | Ga0373962_0021659 | |||
| 1953 | Ga0316574_0004904 | |||
| 1954 | Ga0316574_0009181 | |||
| 1955 | Ga0316574_0055013 | |||
| 1956 | Ga0316574_0154897 | |||
| 1957 | Ga0373931_0000708 | |||
| 1958 | Ga0373931_0085006 | |||
| 1959 | Ga0373931_0122100 | |||
| 1960 | Ga0373935_0193872 | |||
| 1961 | Ga0373935_0932899 | |||
| 1962 | Ga0373927_0001612 | |||
| 1963 | Ga0373927_0439545 | |||
| 1964 | Ga0373927_0876185 | |||
| 1965 | Ga0373933_0515289 | |||
| 1966 | Ga0373947_0001991 | |||
| 1967 | Ga0373947_0029591 | |||
| 1968 | Ga0310112_039424 | |||
| 1969 | Ga0316582_0049283 | |||
| 1970 | Ga0316582_0326338 | |||
| 1971 | Ga0316582_1226179 | |||
| 1972 | Ga0316584_0003193 | |||
| 1973 | Ga0316584_0030695 | |||
| 1974 | Ga0316584_0114290 | |||
| 1975 | Ga0316584_0197305 | |||
| 1976 | Ga0316584_0613837 | |||
| 1977 | Ga0373925_0012483 | |||
| 1978 | Ga0373925_0018669 | |||
| 1979 | Ga0395899_0044073 | |||
| 1980 | Ga0395900_0169902 | |||
| 1981 | Ga0395900_0498233 | |||
| 1982 | Ga0395898_0017644 | |||
| 1983 | Ga0395898_0722459 | |||
| 1984 | Ga0395898_1547428 | |||
| 1985 | Ga0395905_0487987 | |||
| 1986 | Ga0316581_0285264 | |||
| 1987 | Ga0436364_0290389 | |||
| 1988 | Ga0436364_0296264 | |||
| 1989 | Ga0436364_0565800 | |||
| 1990 | Ga0436364_0768457 | |||
| 1991 | Ga0436364_1321893 | |||
| 1992 | Ga0436364_1429963 | |||
| 1993 | Ga0436364_1492983 | |||
| 1994 | Ga0436364_1521400 | |||
| 1995 | Ga0395901_0101187 | |||
| 1996 | Ga0395901_0107170 | |||
| 1997 | Ga0400485_18564 | |||
| 1998 | Ga0436365_0003307 | |||
| 1999 | Ga0436365_0449497 | |||
| 2000 | Ga0436365_0462769 | |||
| 2001 | Ga0436365_1217858 | |||
| 2002 | Ga0436365_1253726 | |||
| 2003 | Ga0436365_1524289 | |||
| 2004 | Ga0436360_0109533 | |||
| 2005 | Ga0436360_0684506 | |||
| 2006 | Ga0436360_1032373 | |||
| 2007 | Ga0436363_0085556 | |||
| 2008 | Ga0436363_0099586 | |||
| 2009 | Ga0436363_0569828 | |||
| 2010 | Ga0436363_1175061 | |||
| 2011 | Ga0436363_1304752 | |||
| 2012 | Ga0436363_1327049 | |||
| 2013 | Ga0436363_1427735 | |||
| 2014 | Ga0436362_0197429 | |||
| 2015 | Ga0436362_0947276 | |||
| 2016 | Ga0439436_0119779 | |||
| 2017 | Ga0439447_133552 | |||
| 2018 | Ga0439465_0017188 | |||
| 2019 | Ga0439465_0096795 | |||
| 2020 | Ga0451787_254251 | |||
| 2021 | Ga0451789_0759111 | |||
| 2022 | Ga0451794_23908 | |||
| 2023 | Ga0451791_0237211 | |||
| 2024 | Ga0451791_0634074 | |||
| 2025 | Ga0451793_1849706 | |||
| 2026 | Ga0451797_0351315 | |||
| 2027 | Ga0451797_0543649 | |||
| 2028 | Ga0451797_0712560 | |||
| 2029 | Ga0451797_0713983 | |||
| 2030 | Ga0451798_0088207 | |||
| 2031 | Ga0451800_0058067 | |||
| 2032 | Ga0451800_1614935 | |||
| 2033 | Ga0451807_2763054 | |||
| 2034 | Ga0451835_0289975 | |||
| 2035 | Ga0451835_0659062 | |||
| 2036 | Ga0451837_1396023 | |||
| 2037 | Ga0451839_0406728 | |||
| 2038 | Ga0451839_0556732 | |||
| 2039 | Ga0451839_0791953 | |||
| 2040 | Ga0451845_0064425 | |||
| 2041 | Ga0451843_0892349 | |||
| 2042 | Ga0451843_0903008 | |||
| 2043 | Ga0451853_0228029 | |||
| 2044 | Ga0451853_0661484 | |||
| 2045 | Ga0451853_0851186 | |||
| 2046 | Ga0451853_1040312 | |||
| 2047 | Ga0451853_3439965 | |||
| 2048 | Ga0439462_0071088 | |||
| 2049 | Ga0439446_0036812 | |||
| 2050 | Ga0450909_087655 | |||
| 2051 | Ga0439434_0126880 | |||
| 2052 | Ga0466969_0015431 | |||
| 2053 | Ga0466969_0024429 | |||
| 2054 | Ga0466969_0026927 | |||
| 2055 | Ga0466969_0242959 | |||
| 2056 | Ga0466969_0251140 | |||
| 2057 | Ga0466969_0460786 | |||
| 2058 | Ga0466972_0002336 | |||
| 2059 | Ga0466972_0010323 | |||
| 2060 | Ga0466972_0042792 | |||
| 2061 | Ga0466972_0118158 | |||
| 2062 | Ga0466972_0198748 | |||
| 2063 | Ga0466965_0000846 | |||
| 2064 | Ga0466965_0010879 | |||
| 2065 | Ga0466965_0024738 | |||
| 2066 | Ga0466965_0036823 | |||
| 2067 | Ga0466965_0164050 | |||
| 2068 | Ga0466966_0001132 | |||
| 2069 | Ga0466966_0008129 | |||
| 2070 | Ga0466966_0018725 | |||
| 2071 | Ga0466966_0142541 | |||
| 2072 | Ga0466966_0213262 | |||
| 2073 | Ga0466961_0046824 | |||
| 2074 | Ga0466961_0072562 | |||
| 2075 | Ga0466961_0352819 | |||
| 2076 | Ga0466961_0466497 | |||
| 2077 | Ga0466961_0532275 | |||
| 2078 | Ga0466963_0000174 | |||
| 2079 | Ga0466963_0243947 | |||
| 2080 | Ga0466963_0816621 | |||
| 2081 | Ga0466964_0156931 | |||
| 2082 | Ga0466964_0221856 | |||
| 2083 | Ga0466964_0293273 | |||
| 2084 | Ga0466964_0344677 | |||
| 2085 | Ga0466971_0011918 | |||
| 2086 | Ga0466971_0180758 | |||
| 2087 | Ga0466971_0187931 | |||
| 2088 | Ga0466971_0208209 | |||
| 2089 | Ga0466971_0300662 | |||
| 2090 | Ga0466971_0538213 | |||
| 2091 | Ga0466968_0000527 | |||
| 2092 | Ga0466968_0063776 | |||
| 2093 | Ga0466968_0092801 | |||
| 2094 | Ga0466968_0099217 | |||
| 2095 | Ga0466968_0147905 | |||
| 2096 | Ga0466968_0347022 | |||
| 2097 | Ga0466970_0010331 | |||
| 2098 | Ga0466970_0016476 | |||
| 2099 | Ga0466970_0019534 | |||
| 2100 | Ga0466970_0041431 | |||
| 2101 | Ga0466970_0204576 | |||
| 2102 | Ga0466970_0734851 | |||
| 2103 | Ga0466957_0008885 | |||
| 2104 | Ga0466957_0023018 | |||
| 2105 | Ga0466957_0161967 | |||
| 2106 | Ga0466957_0381679 | |||
| 2107 | Ga0466957_0443625 | |||
| 2108 | Ga0466960_0000116 | |||
| 2109 | Ga0466960_0002137 | |||
| 2110 | Ga0466960_0273133 | |||
| 2111 | Ga0466960_0299091 | |||
| 2112 | Ga0466960_0336351 | |||
| 2113 | Ga0466959_0003504 | |||
| 2114 | Ga0466959_0027386 | |||
| 2115 | Ga0466959_0051985 | |||
| 2116 | Ga0466959_0369371 | |||
| 2117 | Ga0466959_0934322 | |||
| 2118 | Ga0466958_0000322 | |||
| 2119 | Ga0466958_0002942 | |||
| 2120 | Ga0466958_0023911 | |||
| 2121 | Ga0466958_0097020 | |||
| 2122 | Ga0466958_0242394 | |||
| 2123 | Ga0466958_0912675 | |||
| 2124 | Ga0466967_0008845 | |||
| 2125 | Ga0466967_0090607 | |||
| 2126 | Ga0466967_0099719 | |||
| 2127 | Ga0466967_0113895 | |||
| 2128 | Ga0466967_0123042 | |||
| 2129 | Ga0466967_0289247 | |||
| 2130 | Ga0466967_0580652 | |||
| 2131 | Ga0466967_0651543 | |||
| 2132 | Ga0466967_0858070 | |||
| 2133 | Ga0466967_1914486 | |||
| 2134 | Ga0466967_2478163 | |||
| 2135 | Ga0495592_0346114 | |||
| 2136 | Ga0495592_0376669 | |||
| 2137 | Ga0495592_0473122 | |||
| 2138 | Ga0495592_0787020 | |||
| 2139 | Ga0495603_0076600 | |||
| 2140 | Ga0495629_0001838 | |||
| 2141 | Ga0495629_0141521 | |||
| 2142 | Ga0495629_1091064 | |||
| 2143 | Ga0495638_0006715 | |||
| 2144 | Ga0495651_0779054 | |||
| 2145 | Ga0495651_0981367 | |||
| 2146 | Ga0495653_0647968 | |||
| 2147 | Ga0495650_0018822 | |||
| 2148 | Ga0495582_0001304 | |||
| 2149 | Ga0495582_0056891 | |||
| 2150 | Ga0495582_0362623 | |||
| 2151 | Ga0495639_0005528 | |||
| 2152 | Ga0495639_0701418 | |||
| 2153 | Ga0495662_0104829 | |||
| 2154 | Ga0495662_0172347 | |||
| 2155 | Ga0495594_0793832 | |||
| 2156 | Ga0495583_0314171 | |||
| 2157 | Ga0495608_0038811 | |||
| 2158 | Ga0495608_0550015 | |||
| 2159 | Ga0495608_0815748 | |||
| 2160 | Ga0495618_0015734 | |||
| 2161 | Ga0495618_0038022 | |||
| 2162 | Ga0495618_0102733 | |||
| 2163 | Ga0495618_0314568 | |||
| 2164 | Ga0495628_0079638 | |||
| 2165 | Ga0495628_0321668 | |||
| 2166 | Ga0495630_0091160 | |||
| 2167 | Ga0495630_0096646 | |||
| 2168 | Ga0495630_0120107 | |||
| 2169 | Ga0495630_0217144 | |||
| 2170 | Ga0495630_0716575 | |||
| 2171 | Ga0495666_0050318 | |||
| 2172 | Ga0495642_0271245 | |||
| 2173 | Ga0495652_0125261 | |||
| 2174 | Ga0495665_0042811 | |||
| 2175 | Ga0495665_0194589 | |||
| 2176 | Ga0495640_0039098 | |||
| 2177 | Ga0495640_0254665 | |||
| 2178 | Ga0495640_0435772 | |||
| 2179 | Ga0495586_0183392 | |||
| 2180 | Ga0495586_0231452 | |||
| 2181 | Ga0495587_0194466 | |||
| 2182 | Ga0495587_0422261 | |||
| 2183 | Ga0495587_0668710 | |||
| 2184 | Ga0495621_0019060 | |||
| 2185 | Ga0495645_0315030 | |||
| 2186 | Ga0495667_0258363 | |||
| 2187 | Ga0495668_0282129 | |||
| 2188 | Ga0495634_0010302 | |||
| 2189 | Ga0495635_0354004 | |||
| 2190 | Ga0495635_0445034 | |||
| 2191 | Ga0495659_0091905 | |||
| 2192 | Ga0495659_0198722 | |||
| 2193 | Ga0495661_0560434 | |||
| 2194 | Ga0495657_0134477 | |||
| 2195 | Ga0495657_0271256 | |||
| 2196 | Ga0495657_0428954 | |||
| 2197 | Ga0495646_0588312 | |||
| 2198 | Ga0495647_0027634 | |||
| 2199 | Ga0495658_0000768 | |||
| 2200 | Ga0495658_0137927 | |||
| 2201 | Ga0495658_0341428 | |||
| 2202 | Ga0495613_0002016 | |||
| 2203 | Ga0495613_0003428 | |||
| 2204 | Ga0495613_0237959 | |||
| 2205 | Ga0495613_0318066 | |||
| 2206 | Ga0495624_0218937 | |||
| 2207 | Ga0495589_0430283 | |||
| 2208 | Ga0495581_0031890 | |||
| 2209 | Ga0495604_0234770 | |||
| 2210 | Ga0495604_0289817 | |||
| 2211 | Ga0495604_0519320 | |||
| 2212 | Ga0495674_0897481 | |||
| 2213 | Ga0495674_0982650 | |||
| 2214 | Ga0495676_0243792 | |||
| 2215 | Ga0495680_0041638 | |||
| 2216 | Ga0495680_0293959 | |||
| 2217 | Ga0495680_0363713 | |||
| 2218 | Ga0495684_0352604 | |||
| 2219 | Ga0495684_0424595 | |||
| 2220 | Ga0495684_0646642 | |||
| 2221 | Ga0495684_0856590 | |||
| 2222 | Ga0496100_0039461 | |||
| 2223 | Ga0496100_0370788 | |||
| 2224 | Ga0496100_0529349 | |||
| 2225 | Ga0496101_0010834 | |||
| 2226 | Ga0496101_0383109 | |||
| 2227 | Ga0496101_0626458 | |||
| 2228 | Ga0496101_1296569 | |||
| 2229 | Ga0496102_0000042 | |||
| 2230 | Ga0496102_0032418 | |||
| 2231 | Ga0496102_0910601 | |||
| 2232 | Ga0496102_1834448 | |||
| 2233 | Ga0496103_0000441 | |||
| 2234 | Ga0496103_0540423 | |||
| 2235 | Ga0496104_0043998 | |||
| 2236 | Ga0496104_0095666 | |||
| 2237 | Ga0496104_0307004 | |||
| 2238 | Ga0496105_0032456 | |||
| 2239 | Ga0496105_0074710 | |||
| 2240 | Ga0496105_0232888 | |||
| 2241 | Ga0496106_0593638 | |||
| 2242 | Ga0496106_1156452 | |||
| 2243 | Ga0496107_0402990 | |||
| 2244 | Ga0496107_0418534 | |||
| 2245 | Ga0496108_0096033 | |||
| 2246 | Ga0496108_0108578 | |||
| 2247 | Ga0496109_0014217 | |||
| 2248 | Ga0496109_0055655 | |||
| 2249 | Ga0496109_0164002 | |||
| 2250 | Ga0496109_0316088 | |||
| 2251 | Ga0496109_0519440 | |||
| 2252 | Ga0496109_0694656 | |||
| 2253 | Ga0496109_2021775 | |||
| 2254 | Ga0496110_0001134 | |||
| 2255 | Ga0496110_0114379 | |||
| 2256 | Ga0496110_0759497 | |||
| 2257 | Ga0496110_0809841 | |||
| 2258 | Ga0496110_0862406 | |||
| 2259 | Ga0496110_1061719 | |||
| 2260 | Ga0496111_0004889 | |||
| 2261 | Ga0496111_0116350 | |||
| 2262 | Ga0496111_0221314 | |||
| 2263 | Ga0496112_0360731 | |||
| 2264 | Ga0496112_0430486 | |||
| 2265 | Ga0496112_0512479 | |||
| 2266 | Ga0496113_0609708 | |||
| 2267 | Ga0496113_0631226 | |||
| 2268 | Ga0496113_0699773 | |||
| 2269 | Ga0496114_0020577 | |||
| 2270 | Ga0496114_0026409 | |||
| 2271 | Ga0496114_0249952 | |||
| 2272 | Ga0496114_0250078 | |||
| 2273 | Ga0496114_0422616 | |||
| 2274 | Ga0496114_0621637 | |||
| 2275 | Ga0496115_0001342 | |||
| 2276 | Ga0496115_0427445 | |||
| 2277 | Ga0496115_0533782 | |||
| 2278 | Ga0496115_0684151 | |||
| 2279 | Ga0496116_0000945 | |||
| 2280 | Ga0496117_0000339 | |||
| 2281 | Ga0496118_0000241 | |||
| 2282 | Ga0496119_0000974 | |||
| 2283 | Ga0496119_0005030 | |||
| 2284 | Ga0496121_0015684 | |||
| 2285 | Ga0496122_0203487 | |||
| 2286 | Ga0496124_0011730 | |||
| 2287 | Ga0496124_0774809 | |||
| 2288 | Ga0496124_0888484 | |||
| 2289 | Ga0496125_0065774 | |||
| 2290 | Ga0496125_0081564 | |||
| 2291 | Ga0496125_0269517 | |||
| 2292 | Ga0496126_0000048 | |||
| 2293 | Ga0496126_0001023 | |||
| 2294 | Ga0496126_0014903 | |||
| 2295 | Ga0496126_0258942 | |||
| 2296 | Ga0501031_0148729 | |||
| 2297 | Ga0501031_0221855 | |||
| 2298 | Ga0501032_0021055 | |||
| 2299 | Ga0501032_0028980 | |||
| 2300 | Ga0501032_0769258 | |||
| 2301 | Ga0501033_0019417 | |||
| 2302 | Ga0501033_0097637 | |||
| 2303 | Ga0501033_0171727 | |||
| 2304 | Ga0501033_0205131 | |||
| 2305 | Ga0501033_0217938 | |||
| 2306 | Ga0501033_0739794 | |||
| 2307 | Ga0501034_0054766 | |||
| 2308 | Ga0501036_0059238 | |||
| 2309 | Ga0501036_0074935 | |||
| 2310 | Ga0501036_0114848 | |||
| 2311 | Ga0501036_0261029 | |||
| 2312 | Ga0501037_0126700 | |||
| 2313 | Ga0501037_0293618 | |||
| 2314 | Ga0501037_0348555 | |||
| 2315 | Ga0501038_0065354 | |||
| 2316 | Ga0501038_0245596 | |||
| 2317 | Ga0501038_0381482 | |||
| 2318 | Ga0501038_0890690 | |||
| 2319 | Ga0501039_0105439 | |||
| 2320 | Ga0501040_0045950 | |||
| 2321 | Ga0501041_0037890 | |||
| 2322 | Ga0501041_0325914 | |||
| 2323 | Ga0501041_0656819 | |||
| 2324 | Ga0501041_0675703 | |||
| 2325 | Ga0501042_0419113 | |||
| 2326 | Ga0501042_0568807 | |||
| 2327 | Ga0501043_0125103 | |||
| 2328 | Ga0501043_0162604 | |||
| 2329 | Ga0501046_0045701 | |||
| 2330 | Ga0501046_0344406 | |||
| 2331 | Ga0501046_0814615 | |||
| 2332 | Ga0501047_0003711 | |||
| 2333 | Ga0501047_0004314 | |||
| 2334 | Ga0501047_0195962 | |||
| 2335 | Ga0501047_0638941 | |||
| 2336 | Ga0501048_0092335 | |||
| 2337 | Ga0501048_0168535 | |||
| 2338 | Ga0501067_0032242 | |||
| 2339 | Ga0501067_0249101 | |||
| 2340 | Ga0501068_0013339 | |||
| 2341 | Ga0501068_0023389 | |||
| 2342 | Ga0501068_0624585 | |||
| 2343 | Ga0501069_0016892 | |||
| 2344 | Ga0501069_0113838 | |||
| 2345 | Ga0501069_0644075 | |||
| 2346 | Ga0501070_0157431 | |||
| 2347 | Ga0501070_0305514 | |||
| 2348 | Ga0501071_0018841 | |||
| 2349 | Ga0501071_0097881 | |||
| 2350 | Ga0501071_0317829 | |||
| 2351 | Ga0501071_1051222 | |||
| 2352 | Ga0501071_1095691 | |||
| 2353 | Ga0501072_0060638 | |||
| 2354 | Ga0501072_0260015 | |||
| 2355 | Ga0501072_0348966 | |||
| 2356 | Ga0501072_0525669 | |||
| 2357 | Ga0501072_1544388 | |||
| 2358 | Ga0501072_1578694 | |||
| 2359 | Ga0501073_0024330 | |||
| 2360 | Ga0501073_0303073 | |||
| 2361 | Ga0501073_0748604 | |||
| 2362 | Ga0501074_0029881 | |||
| 2363 | Ga0501074_0049524 | |||
| 2364 | Ga0501074_0249189 | |||
| 2365 | Ga0501075_0095056 | |||
| 2366 | Ga0501075_0100288 | |||
| 2367 | Ga0501075_0159627 | |||
| 2368 | Ga0501075_0231282 | |||
| 2369 | Ga0501076_0146917 | |||
| 2370 | Ga0501076_1276291 | |||
| 2371 | Ga0501076_1371378 | |||
| 2372 | Ga0501076_1422952 | |||
| 2373 | Ga0501076_1787528 | |||
| 2374 | Ga0501077_0238703 | |||
| 2375 | Ga0501079_0027399 | |||
| 2376 | Ga0501079_0111396 | |||
| 2377 | Ga0501079_0479934 | |||
| 2378 | Ga0501079_0696520 | |||
| 2379 | Ga0501079_1168956 | |||
| 2380 | Ga0501079_1420197 | |||
| 2381 | Ga0501080_0068596 | |||
| 2382 | Ga0501080_0198111 | |||
| 2383 | Ga0501080_1034684 | |||
| 2384 | Ga0501081_0021156 | |||
| 2385 | Ga0501081_1489333 | |||
| 2386 | Ga0501083_0009415 | |||
| 2387 | Ga0501083_0041629 | |||
| 2388 | Ga0501083_0145642 | |||
| 2389 | Ga0501035_0000344 | |||
| 2390 | Ga0501035_1008386 | |||
| 2391 | Ga0501044_0000789 | |||
| 2392 | Ga0501044_0076018 | |||
| 2393 | Ga0501044_0472153 | |||
| 2394 | Ga0501044_1040950 | |||
| 2395 | Ga0501044_1086291 | |||
| 2396 | Ga0501045_0016156 | |||
| 2397 | Ga0501045_0024119 | |||
| 2398 | nmdc:mga03683_46440_c1 | |||
| 2399 | nmdc:mga03n38_445026_c1 | |||
| 2400 | nmdc:mga03n38_78883_c1 | |||
| 2401 | nmdc:mga03n38_981545_c1 | |||
| 2402 | nmdc:mga00v17_22968_c1 | |||
| 2403 | nmdc:mga00v17_234672_c1 | |||
| 2404 | nmdc:mga00v17_344259_c1 | |||
| 2405 | nmdc:mga00v17_48954_c1 | |||
| 2406 | nmdc:mga00v17_499671_c1 | |||
| 2407 | nmdc:mga0yw44_1192224_c1 | |||
| 2408 | nmdc:mga0yw44_1216824_c1 | |||
| 2409 | nmdc:mga0yw44_17771_c1 | |||
| 2410 | nmdc:mga0yw44_456736_c1 | |||
| 2411 | nmdc:mga0yw44_629209_c1 | |||
| 2412 | nmdc:mga0yw44_75634_c1 | |||
| 2413 | nmdc:mga0yw44_8942_c1 | |||
| 2414 | nmdc:mga0yw44_931202_c1 | |||
| 2415 | nmdc:mga06z11_198439_c1 | |||
| 2416 | nmdc:mga06z11_28989_c1 | |||
| 2417 | nmdc:mga07m45_226378_c1 | |||
| 2418 | nmdc:mga07m45_58458_c1 | |||
| 2419 | nmdc:mga05p37_130623_c1 | |||
| 2420 | nmdc:mga05p37_1518642_c1 | |||
| 2421 | nmdc:mga05p37_1910250_c1 | |||
| 2422 | nmdc:mga05p37_2241226_c1 | |||
| 2423 | nmdc:mga05p37_2278178_c1 | |||
| 2424 | nmdc:mga05p37_235867_c1 | |||
| 2425 | nmdc:mga05p37_340652_c1 | |||
| 2426 | nmdc:mga05p37_490988_c1 | |||
| 2427 | nmdc:mga05p37_498037_c1 | |||
| 2428 | nmdc:mga09592_508628_c1 | |||
| 2429 | nmdc:mga09592_568420_c1 | |||
| 2430 | nmdc:mga09592_678165_c1 | |||
| 2431 | nmdc:mga09592_915146_c1 | |||
| 2432 | nmdc:mga0qj67_1050245_c1 | |||
| 2433 | nmdc:mga0qj67_1443945_c1 | |||
| 2434 | nmdc:mga0qj67_152952_c1 | |||
| 2435 | nmdc:mga0qj67_304993_c1 | |||
| 2436 | nmdc:mga0qj67_33373_c1 | |||
| 2437 | nmdc:mga0qj67_4267_c1 | |||
| 2438 | nmdc:mga0qj67_899361_c1 | |||
| 2439 | nmdc:mga06r32_103139_c1 | |||
| 2440 | nmdc:mga06r32_117_c4 | |||
| 2441 | nmdc:mga06r32_231251_c1 | |||
| 2442 | nmdc:mga06r32_686023_c1 | |||
| 2443 | nmdc:mga06r32_725520_c1 | |||
| 2444 | nmdc:mga08y16_21097_c1 | |||
| 2445 | nmdc:mga08y16_25971_c1 | |||
| 2446 | nmdc:mga08y16_336157_c1 | |||
| 2447 | nmdc:mga08y16_407831_c1 | |||
| 2448 | nmdc:mga08y16_905083_c1 | |||
| 2449 | nmdc:mga0n895_928384_c1 | |||
| 2450 | nmdc:mga0rr50_1099115_c1 | |||
| 2451 | nmdc:mga0rr50_113441_c1 | |||
| 2452 | nmdc:mga08x19_17051_c1 | |||
| 2453 | nmdc:mga0a205_1207_c1 | |||
| 2454 | nmdc:mga0sz30_1847_c1 | |||
| 2455 | nmdc:mga0sz30_2249_c1 | |||
| 2456 | nmdc:mga0sz30_56369_c1 | |||
| 2457 | nmdc:mga0sz30_576174_c1 | |||
| 2458 | nmdc:mga0sz30_95838_c1 | |||
| 2459 | Ga0495601_0015238 | |||
| 2460 | Ga0495601_0276100 | |||
| 2461 | Ga0495601_0958461 | |||
| 2462 | Ga0500635_0006210 | |||
| 2463 | Ga0495595_0006436 | |||
| 2464 | Ga0495619_0022565 | |||
| 2465 | Ga0495619_0031947 | |||
| 2466 | Ga0495619_0054547 | |||
| 2467 | Ga0495619_0238864 | |||
| 2468 | Ga0495619_0596517 | |||
| 2469 | Ga0495619_0624243 | |||
| 2470 | Ga0495619_0998847 | |||
| 2471 | Ga0500578_0342863 | |||
| 2472 | Ga0500643_015055 | |||
| 2473 | Ga0500566_0067062 | |||
| 2474 | Ga0500650_0369329 | |||
| 2475 | Ga0500555_150328 | |||
| 2476 | Ga0500557_190273 | |||
| 2477 | Ga0500642_0105452 | |||
| 2478 | Ga0500652_023340 | |||
| 2479 | Ga0500652_027596 | |||
| 2480 | Ga0500655_022521 | |||
| 2481 | Ga0500658_0328287 | |||
| 2482 | Ga0500559_0037276 | |||
| 2483 | Ga0500568_0125094 | |||
| 2484 | Ga0500622_0001519 | |||
| 2485 | Ga0500627_0033786 | |||
| 2486 | Ga0500645_000668 | |||
| 2487 | Ga0500645_021063 | |||
| 2488 | Ga0501084_0006042 | |||
| 2489 | Ga0501084_0027890 | |||
| 2490 | Ga0501084_0107170 | |||
| 2491 | Ga0501084_0492915 | |||
| 2492 | Ga0501084_0591747 | |||
| 2493 | Ga0590075_214203 | |||
| 2494 | Ga0587080_068695 | |||
| 2495 | Ga0587082_014570 | |||
| 2496 | Ga0587083_0065564 | |||
| 2497 | Ga0587086_107206 | |||
| 2498 | Ga0587088_004267 | |||
| 2499 | Ga0587067_185259 | |||
| 2500 | Ga0587067_199682 | |||
| 2501 | Ga0587107_064061 | |||
| 2502 | Ga0587071_103876 | |||
| 2503 | Ga0501082_0150225 | |||
| 2504 | Ga0501082_0287765 | |||
| 2505 | Ga0501082_0700477 | |||
| 2506 | Ga0501082_1121244 | |||
| 2507 | Ga0466962_0011220 | |||
| 2508 | Ga0466962_0094980 | |||
| 2509 | Ga0466962_0348148 | |||
| 2510 | Ga0466962_0708448 | |||
| 2511 | Ga0466962_0709072 | |||
| 2512 | Ga0530510_0311667 | |||
| 2513 | Ga0530510_0393618 | |||
| 2514 | Ga0530510_0516374 | |||
| 2515 | 2523385284 | |||
| 2516 | 2548697871 | |||
| 2517 | 2566993091 | |||
| 2518 | 2586059296 | |||
| 2519 | 2643825374 | |||
| 2520 | 2643893151 | |||
| 2521 | 2643961790 | |||
| 2522 | 2644034122 | |||
| 2523 | 2644229104 | |||
| 2524 | 2644531368 | |||
| 2525 | 2676486393 | |||
| 2526 | 2738706070 | |||
| 2527 | 2738889946 | |||
| 2528 | 2739203266 | |||
| 2529 | 2739238710 | |||
| 2530 | 2739333030 | |||
| 2531 | 2739602534 | |||
| 2532 | 2744955924 | |||
| 2533 | 2753035260 | |||
| 2534 | 2753323777 | |||
| 2535 | 2809591942 | |||
| 2536 | 2812333812 | |||
| 2537 | 2816504661 | |||
| 2538 | 2817508954 | |||
| 2539 | 2842891788 | |||
| 2540 | 2855387606 | |||
| 2541 | 2857729785 | |||
| 2542 | 2866616840 | |||
| 2543 | 2889300983 | |||
| 2544 | 2891327581 | |||
| 2545 | 2893686738 | |||
| 2546 | 2899364124 | |||
| 2547 | 2899373294 | |||
| 2548 | 2899374248 | |||
| 2549 | 2902801632 | |||
| 2550 | 2904538915 | |||
| 2551 | 2915774013 | |||
| 2552 | 2917736543 | |||
| 2553 | 2917738923 | |||
| 2554 | 2919715954 | |||
| 2555 | 2922556787 | |||
| 2556 | 2928142509 | |||
| 2557 | 2929214799 | |||
| 2558 | 2939744502 | |||
| 2559 | 2956940453 | |||
| 2560 | 2974317246 | |||
| 2561 | 2984525451 | |||
| 2562 | 3001121878 | |||
| 2563 | 3001890948 | |||
| 2564 | 8047718024 | |||
| 2565 | 8054474306 | |||
| 2566 | 8056211997 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p4y-assembly4.cif.gz_K | glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a | 0.9908 | 2 | 112 |
| 3t9z-assembly1.cif.gz_B | a. fulgidus glnk3, ligand-free | 0.9898 | 1 | 108 |
| 3t9z-assembly2.cif.gz_E | a. fulgidus glnk3, ligand-free | 0.9889 | 1 | 108 |
| 2eg1-assembly1.cif.gz_A | the crystal structure of pii protein | 0.9881 | 1 | 112 |
| 3t9z-assembly1.cif.gz_A | a. fulgidus glnk3, ligand-free | 0.9877 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9665 | 1 | 111 | 3.30.70.120 |
| 2o66C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.96 | 2 | 111 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9567 | 1 | 111 | 3.30.70.120 |
| 4oznB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9494 | 2 | 112 | 3.30.70.120 |
| 4usiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9396 | 2 | 108 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357BKJ3-F1-model_v4 | P-II family nitrogen regulator | 0.9624 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A2U1T6E6-F1-model_v4 | P-II family nitrogen regulator | 0.9561 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A357BKJ3-F1-model_v4 | P-II family nitrogen regulator | 0.953 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A1F7F2C5-F1-model_v4 | Transcriptional regulator | 0.9443 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A517TUK5-F1-model_v4 | Nitrogen regulatory protein P-II | 0.9401 | 1 | 107 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |