F492555

General Info

Members Datasets Scaffolds Average Seq Length
1283 542 2566 112

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0730883|Ga0466965_0730883_154_522
Length 109
Sequence LVVTPWRRVDMKLITAIVKPFTLDDVKTSLEEAGVLGMTVSEVQGYGRQKGHTEVYRGAEYSVEFVPKVRIEVVVRAARTGKIGDGKVWVSPVETVVRVRTGERGPDAL

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
220 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
221 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
225 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
226 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
227 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
228 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
229 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
230 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
231 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
246 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
247 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
248 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
254 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
262 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
263 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
269 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
270 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
271 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
272 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
285 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
290 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
291 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
292 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
293 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
300 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
308 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
311 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
312 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
313 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
316 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
317 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
318 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
319 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
320 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
321 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
322 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
323 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
324 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
325 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
326 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
327 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
328 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
329 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
334 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
335 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
342 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
348 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
349 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
350 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
351 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
352 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
389 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
390 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
391 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
392 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
428 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
429 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
430 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
431 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
432 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
433 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
434 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
435 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
436 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
437 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
438 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
439 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
440 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
457 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
458 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
463 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
464 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
465 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
466 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
467 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
468 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
469 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
470 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
471 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
472 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
473 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
474 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
475 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
476 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
477 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
478 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
479 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
482 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
491 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
492 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
493 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
494 2547132424 Nocardia nova SH22a Isolate Unclassified
495 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
496 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
497 2643221561 Nocardioides sp. Root151 Isolate Unclassified
498 2643221576 Nocardioides sp. Root614 Isolate Unclassified
499 2643221590 Nocardioides sp. Root682 Isolate Unclassified
500 2643221604 Nocardioides sp. Root190 Isolate Unclassified
501 2643221641 Nocardioides sp. Root122 Isolate Unclassified
502 2643221696 Nocardioides sp. Root140 Isolate Unclassified
503 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
504 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
505 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
506 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
507 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
508 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
509 2739367653 Kocuria sp. OV113 Isolate Unclassified
510 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
511 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
512 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
513 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
514 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
515 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
516 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
517 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
518 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
519 2857727296 Kocuria sp. R-72562 Isolate Unclassified
520 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
521 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
522 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
523 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
524 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
525 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
526 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
527 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
528 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
529 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
530 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
531 2922554459 Rhodococcus sp. 66b Isolate Unclassified
532 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
533 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
534 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
535 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
536 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
537 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
538 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
539 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
540 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
541 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
542 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.3
Metatranscriptomes 2.65
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 5.77
Nodule 0
Rhizoplane 5.53
Rhizosphere 79.58
Stem 0
Stem Tuber 0.16
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0730883 3300044683 Bacteria 570
2 MBSR1b_contig_13805831 2162886012 Bacteria 1919
3 LJQas_1036547 3300000549 Bacteria 578
4 LJQas_1046351 3300000549 Bacteria 518
5 JGI24737J22298_10192071 3300001990 Bacteria 603
6 JGI24735J21928_10219037 3300002067 Bacteria 553
7 JGI24745J21846_1050926 3300002073 Bacteria 525
8 JGI24738J21930_10007846 3300002075 Bacteria 2447
9 JGI24744J21845_10004671 3300002077 Bacteria 2831
10 JGI25406J46586_10000557 3300003203 Bacteria 17606
11 JGI25404J52841_10117817 3300003659 Bacteria 559
12 Ga0032354_1059068 3300003693 Bacteria 568
13 JGI25405J52794_10122767 3300003911 Bacteria 586
14 JGI25405J52794_10127411 3300003911 Bacteria 575
15 Ga0058861_10062782 3300004800 Bacteria 677
16 Ga0065715_10107560 3300005293 Bacteria 2765
17 Ga0070658_10002468 3300005327 Bacteria 15449
18 Ga0070658_10043582 3300005327 Bacteria 3624
19 Ga0070658_10109830 3300005327 Bacteria 2284
20 Ga0070683_100107447 3300005329 Bacteria 2631
21 Ga0070683_100820770 3300005329 Bacteria 892
22 Ga0070683_100969589 3300005329 Bacteria 816
23 Ga0070683_101124831 3300005329 Bacteria 754
24 Ga0070683_101747337 3300005329 Bacteria 598
25 Ga0070683_101811745 3300005329 Bacteria 587
26 Ga0070690_100193406 3300005330 Bacteria 1412
27 Ga0070670_100088299 3300005331 Bacteria 2665
28 Ga0070670_100923993 3300005331 Bacteria 792
29 Ga0070677_10030834 3300005333 Bacteria 2044
30 Ga0068869_100137882 3300005334 Bacteria 1881
31 Ga0068869_100277018 3300005334 Bacteria 1348
32 Ga0070666_10060982 3300005335 Bacteria 2553
33 Ga0070666_11502518 3300005335 Bacteria 504
34 Ga0070680_100092789 3300005336 Bacteria 2500
35 Ga0070680_100335651 3300005336 Bacteria 1284
36 Ga0070680_100997479 3300005336 Bacteria 723
37 Ga0070682_100022697 3300005337 Bacteria 3719
38 Ga0070682_100038748 3300005337 Bacteria 2925
39 Ga0070682_101319965 3300005337 Bacteria 614
40 Ga0070682_101940647 3300005337 Bacteria 517
41 Ga0068868_100005750 3300005338 Bacteria 8729
42 Ga0068868_100048391 3300005338 Bacteria 3335
43 Ga0068868_100100866 3300005338 Bacteria 2336
44 Ga0070660_100840550 3300005339 Bacteria 773
45 Ga0070687_100055582 3300005343 Bacteria 2068
46 Ga0070661_100002837 3300005344 Bacteria 11909
47 Ga0070661_100063531 3300005344 Bacteria 2712
48 Ga0070692_10040065 3300005345 Bacteria 2394
49 Ga0070692_10328616 3300005345 Bacteria 943
50 Ga0070668_100014673 3300005347 Bacteria 5854
51 Ga0070668_100544140 3300005347 Bacteria 1010
52 Ga0070668_100568207 3300005347 Bacteria 989
53 Ga0070668_101101810 3300005347 Bacteria 717
54 Ga0070669_100032308 3300005353 Bacteria 3781
55 Ga0070669_100593025 3300005353 Bacteria 928
56 Ga0070675_100008970 3300005354 Bacteria 7769
57 Ga0070675_100116574 3300005354 Bacteria 2266
58 Ga0070671_100009707 3300005355 Bacteria 7733
59 Ga0070671_100059001 3300005355 Bacteria 3193
60 Ga0070674_100016409 3300005356 Bacteria 4640
61 Ga0070674_100112789 3300005356 Bacteria 1999
62 Ga0070673_100038671 3300005364 Bacteria 3645
63 Ga0070673_100106514 3300005364 Bacteria 2318
64 Ga0070688_100457717 3300005365 Bacteria 955
65 Ga0070659_100003049 3300005366 Bacteria 11910
66 Ga0070659_100138579 3300005366 Bacteria 1980
67 Ga0070659_101135028 3300005366 Bacteria 690
68 Ga0070667_100002382 3300005367 Bacteria 16463
69 Ga0070667_101023389 3300005367 Bacteria 771
70 Ga0070667_102240508 3300005367 Bacteria 515
71 Ga0070709_10004981 3300005434 Bacteria 7175
72 Ga0070709_10488370 3300005434 Bacteria 934
73 Ga0070714_100003983 3300005435 Bacteria 11105
74 Ga0070714_100342641 3300005435 Bacteria 1402
75 Ga0070714_100467228 3300005435 Bacteria 1200
76 Ga0070714_101186435 3300005435 Bacteria 744
77 Ga0070714_101283910 3300005435 Bacteria 714
78 Ga0070714_101286937 3300005435 Bacteria 714
79 Ga0070714_101324811 3300005435 Bacteria 703
80 Ga0070714_101404150 3300005435 Bacteria 682
81 Ga0070713_100011881 3300005436 Bacteria 6364
82 Ga0070713_100017433 3300005436 Bacteria 5431
83 Ga0070713_100048887 3300005436 Bacteria 3486
84 Ga0070713_100353447 3300005436 Bacteria 1364
85 Ga0070710_11311151 3300005437 Bacteria 539
86 Ga0070701_10239923 3300005438 Bacteria 1090
87 Ga0070711_100094253 3300005439 Bacteria 2164
88 Ga0070711_100393065 3300005439 Bacteria 1124
89 Ga0070705_100062276 3300005440 Bacteria 2221
90 Ga0070705_100144281 3300005440 Bacteria 1571
91 Ga0070705_100241026 3300005440 Bacteria 1263
92 Ga0070700_100000496 3300005441 Bacteria 19728
93 Ga0070700_101016083 3300005441 Bacteria 682
94 Ga0070700_101048998 3300005441 Bacteria 673
95 Ga0070694_101037677 3300005444 Bacteria 682
96 Ga0070708_100005249 3300005445 Bacteria 10254
97 Ga0070708_100096059 3300005445 Bacteria 2707
98 Ga0070708_100247871 3300005445 Bacteria 1673
99 Ga0070708_100264011 3300005445 Bacteria 1619
100 Ga0070708_100308219 3300005445 Bacteria 1491
101 Ga0070708_102151090 3300005445 Bacteria 516
102 Ga0070663_100983908 3300005455 Bacteria 733
103 Ga0070663_101150253 3300005455 Bacteria 680
104 Ga0070678_100975708 3300005456 Bacteria 778
105 Ga0070662_100006929 3300005457 Bacteria 7337
106 Ga0070662_100748197 3300005457 Bacteria 829
107 Ga0070681_10043185 3300005458 Bacteria 4517
108 Ga0070681_10105264 3300005458 Bacteria 2763
109 Ga0070681_10506869 3300005458 Bacteria 1120
110 Ga0068867_100032224 3300005459 Bacteria 3789
111 Ga0070685_10580833 3300005466 Bacteria 804
112 Ga0070706_100010863 3300005467 Bacteria 8452
113 Ga0070706_100020839 3300005467 Bacteria 6036
114 Ga0070706_100111106 3300005467 Bacteria 2551
115 Ga0070706_100123859 3300005467 Bacteria 2410
116 Ga0070706_100254659 3300005467 Bacteria 1639
117 Ga0070706_100395776 3300005467 Bacteria 1286
118 Ga0070706_100431228 3300005467 Bacteria 1227
119 Ga0070706_100510977 3300005467 Bacteria 1118
120 Ga0070706_100923094 3300005467 Bacteria 806
121 Ga0070706_101289851 3300005467 Bacteria 670
122 Ga0070707_100026702 3300005468 Bacteria 5485
123 Ga0070707_100036027 3300005468 Bacteria 4720
124 Ga0070707_100053090 3300005468 Bacteria 3885
125 Ga0070707_100597833 3300005468 Bacteria 1066
126 Ga0070707_100648085 3300005468 Bacteria 1019
127 Ga0070707_100752743 3300005468 Bacteria 938
128 Ga0070698_100010804 3300005471 Bacteria 9716
129 Ga0070698_100026804 3300005471 Bacteria 5994
130 Ga0070698_100636328 3300005471 Bacteria 1008
131 Ga0070698_101187327 3300005471 Bacteria 712
132 Ga0070698_101953425 3300005471 Bacteria 540
133 Ga0070699_100142129 3300005518 Bacteria 2120
134 Ga0070699_100279351 3300005518 Bacteria 1496
135 Ga0070699_100852791 3300005518 Bacteria 834
136 Ga0070679_100020333 3300005530 Bacteria 6470
137 Ga0070679_100268044 3300005530 Bacteria 1662
138 Ga0070679_100473434 3300005530 Bacteria 1197
139 Ga0070679_101455580 3300005530 Bacteria 632
140 Ga0070679_101722982 3300005530 Bacteria 575
141 Ga0070684_100034430 3300005535 Bacteria 4331
142 Ga0070684_100098733 3300005535 Bacteria 2605
143 Ga0070684_100240053 3300005535 Bacteria 1656
144 Ga0070684_100750930 3300005535 Bacteria 911
145 Ga0070684_100784902 3300005535 Bacteria 890
146 Ga0070684_101139896 3300005535 Bacteria 733
147 Ga0070684_101552384 3300005535 Bacteria 624
148 Ga0070684_101642613 3300005535 Bacteria 606
149 Ga0070684_101647483 3300005535 Bacteria 605
150 Ga0070684_101831130 3300005535 Bacteria 573
151 Ga0070697_100076709 3300005536 Bacteria 2748
152 Ga0070697_100309081 3300005536 Bacteria 1360
153 Ga0070697_100343878 3300005536 Bacteria 1287
154 Ga0068853_101645086 3300005539 Bacteria 622
155 Ga0070672_100003015 3300005543 Bacteria 10850
156 Ga0070672_100023529 3300005543 Bacteria 4542
157 Ga0070672_101403547 3300005543 Bacteria 625
158 Ga0070686_101842284 3300005544 Bacteria 516
159 Ga0070695_100002318 3300005545 Bacteria 10917
160 Ga0070696_100013997 3300005546 Bacteria 5386
161 Ga0070696_101562685 3300005546 Bacteria 566
162 Ga0070693_101476577 3300005547 Bacteria 531
163 Ga0070665_100343871 3300005548 Bacteria 1497
164 Ga0070665_100396861 3300005548 Bacteria 1387
165 Ga0070665_100999683 3300005548 Bacteria 849
166 Ga0070665_101652289 3300005548 Bacteria 648
167 Ga0070665_101749318 3300005548 Bacteria 629
168 Ga0070704_100069626 3300005549 Bacteria 2550
169 Ga0070704_100130951 3300005549 Bacteria 1944
170 Ga0068855_100400976 3300005563 Bacteria 1503
171 Ga0070664_100010679 3300005564 Bacteria 7444
172 Ga0070664_100405112 3300005564 Bacteria 1248
173 Ga0070664_100945411 3300005564 Bacteria 809
174 Ga0068857_100085936 3300005577 Bacteria 2812
175 Ga0068857_100425411 3300005577 Bacteria 1239
176 Ga0068857_101468536 3300005577 Bacteria 664
177 Ga0068857_101582244 3300005577 Bacteria 640
178 Ga0068854_100554433 3300005578 Bacteria 975
179 Ga0068854_100557693 3300005578 Bacteria 973
180 Ga0068854_101360254 3300005578 Bacteria 641
181 Ga0068856_100006013 3300005614 Bacteria 11943
182 Ga0068856_100575722 3300005614 Bacteria 1147
183 Ga0068856_100736820 3300005614 Bacteria 1006
184 Ga0068856_100845803 3300005614 Bacteria 934
185 Ga0068856_101045040 3300005614 Bacteria 835
186 Ga0068856_102544859 3300005614 Bacteria 518
187 Ga0070702_100008637 3300005615 Bacteria 4945
188 Ga0070702_100875171 3300005615 Bacteria 701
189 Ga0068852_100283388 3300005616 Bacteria 1598
190 Ga0068852_100464557 3300005616 Bacteria 1255
191 Ga0068852_100673797 3300005616 Bacteria 1043
192 Ga0068859_102043802 3300005617 Bacteria 633
193 Ga0068859_102087715 3300005617 Bacteria 626
194 Ga0068864_100019997 3300005618 Bacteria 5598
195 Ga0068864_100156166 3300005618 Bacteria 2071
196 Ga0068864_101198524 3300005618 Bacteria 758
197 Ga0068861_100012401 3300005719 Bacteria 5943
198 Ga0068851_10053954 3300005834 Bacteria 2047
199 Ga0068870_10002986 3300005840 Bacteria 7122
200 Ga0068870_10298767 3300005840 Bacteria 1016
201 Ga0068863_100003819 3300005841 Bacteria 14893
202 Ga0068863_100343770 3300005841 Bacteria 1452
203 Ga0068858_101070606 3300005842 Bacteria 791
204 Ga0068860_102061356 3300005843 Bacteria 592
205 Ga0068862_101061002 3300005844 Bacteria 804
206 Ga0068862_102392078 3300005844 Bacteria 540
207 Ga0081455_10000011 3300005937 Bacteria 203132
208 Ga0081455_10000146 3300005937 Bacteria 83878
209 Ga0081455_10060369 3300005937 Bacteria 3197
210 Ga0081455_10207048 3300005937 Bacteria 1464
211 Ga0081455_10592939 3300005937 Bacteria 724
212 Ga0081455_10886914 3300005937 Bacteria 555
213 Ga0081538_10113978 3300005981 Bacteria 1318
214 Ga0081540_1005748 3300005983 Bacteria 9187
215 Ga0081540_1012491 3300005983 Bacteria 5584
216 Ga0081540_1184034 3300005983 Bacteria 778
217 Ga0081539_10000680 3300005985 Bacteria 68157
218 Ga0081539_10008252 3300005985 Bacteria 9150
219 Ga0081539_10012205 3300005985 Bacteria 6666
220 Ga0081539_10110850 3300005985 Bacteria 1381
221 Ga0070717_10516064 3300006028 Bacteria 1081
222 Ga0075365_10022436 3300006038 Bacteria 3955
223 Ga0075365_10135314 3300006038 Bacteria 1708
224 Ga0075365_10457265 3300006038 Bacteria 901
225 Ga0075365_10883836 3300006038 Bacteria 630
226 Ga0075368_10198448 3300006042 Bacteria 849
227 Ga0075363_100225157 3300006048 Bacteria 1076
228 Ga0075363_100239534 3300006048 Bacteria 1043
229 Ga0075363_100322303 3300006048 Bacteria 899
230 Ga0075363_100374463 3300006048 Bacteria 834
231 Ga0075363_100799460 3300006048 Bacteria 574
232 Ga0075364_10001970 3300006051 Bacteria 11437
233 Ga0075364_10046982 3300006051 Bacteria 2811
234 Ga0075364_10079296 3300006051 Bacteria 2170
235 Ga0075364_10291890 3300006051 Bacteria 1110
236 Ga0075364_10519831 3300006051 Bacteria 814
237 Ga0075364_10744395 3300006051 Bacteria 669
238 Ga0070712_100099237 3300006175 Bacteria 2149
239 Ga0070712_100123350 3300006175 Bacteria 1953
240 Ga0070712_100172158 3300006175 Bacteria 1681
241 Ga0075362_10051899 3300006177 Bacteria 1836
242 Ga0075367_10231875 3300006178 Bacteria 1156
243 Ga0075367_10351188 3300006178 Bacteria 931
244 Ga0075367_11134290 3300006178 Bacteria 500
245 Ga0075369_10002158 3300006186 Bacteria 6951
246 Ga0075369_10029977 3300006186 Bacteria 2289
247 Ga0075369_10047735 3300006186 Bacteria 1846
248 Ga0075369_10108859 3300006186 Bacteria 1248
249 Ga0075369_10381764 3300006186 Bacteria 663
250 Ga0075370_10060732 3300006353 Bacteria 2153
251 Ga0075370_10308899 3300006353 Bacteria 941
252 Ga0075428_100005376 3300006844 Bacteria 14240
253 Ga0075428_100101616 3300006844 Bacteria 3134
254 Ga0075428_100132135 3300006844 Bacteria 2715
255 Ga0075428_100148020 3300006844 Bacteria 2552
256 Ga0075428_100305488 3300006844 Bacteria 1710
257 Ga0075428_102101881 3300006844 Bacteria 584
258 Ga0075428_102128485 3300006844 Bacteria 580
259 Ga0075430_100020264 3300006846 Bacteria 5659
260 Ga0075430_100039113 3300006846 Bacteria 4017
261 Ga0075430_100056359 3300006846 Bacteria 3304
262 Ga0075430_100466811 3300006846 Bacteria 1042
263 Ga0075430_100666913 3300006846 Bacteria 858
264 Ga0075430_101182232 3300006846 Bacteria 630
265 Ga0075430_101514131 3300006846 Bacteria 551
266 Ga0075431_100024151 3300006847 Bacteria 6224
267 Ga0075431_100058242 3300006847 Bacteria 3986
268 Ga0075431_100325399 3300006847 Bacteria 1549
269 Ga0075431_100397141 3300006847 Bacteria 1380
270 Ga0075433_10001247 3300006852 Bacteria 18559
271 Ga0075433_11702713 3300006852 Bacteria 543
272 Ga0075434_100012123 3300006871 Bacteria 8162
273 Ga0075429_100008749 3300006880 Bacteria 8805
274 Ga0075429_100030849 3300006880 Bacteria 4658
275 Ga0075429_100157500 3300006880 Bacteria 1989
276 Ga0075429_101651734 3300006880 Bacteria 557
277 Ga0068865_100017855 3300006881 Bacteria 4568
278 Ga0068865_100453135 3300006881 Bacteria 1061
279 Ga0068865_101762633 3300006881 Bacteria 559
280 Ga0075436_100007862 3300006914 Bacteria 7296
281 Ga0075436_100458466 3300006914 Bacteria 929
282 Ga0097620_102043915 3300006931 Bacteria 633
283 Ga0097620_102087836 3300006931 Bacteria 626
284 Ga0075435_100007473 3300007076 Bacteria 7791
285 Ga0105250_10554690 3300009092 Bacteria 527
286 Ga0105240_12307560 3300009093 Bacteria 557
287 Ga0111539_10002357 3300009094 Bacteria 25105
288 Ga0111539_10224514 3300009094 Bacteria 2188
289 Ga0111539_10315643 3300009094 Bacteria 1819
290 Ga0111539_10722001 3300009094 Bacteria 1160
291 Ga0111539_10902671 3300009094 Bacteria 1028
292 Ga0105245_10017895 3300009098 Bacteria 6188
293 Ga0105245_10033741 3300009098 Bacteria 4536
294 Ga0105245_10192653 3300009098 Bacteria 1953
295 Ga0105245_10599460 3300009098 Bacteria 1128
296 Ga0105245_10981512 3300009098 Bacteria 889
297 Ga0105247_10956556 3300009101 Bacteria 665
298 Ga0114129_10029661 3300009147 Bacteria 7747
299 Ga0114129_10046672 3300009147 Bacteria 6087
300 Ga0114129_10414997 3300009147 Bacteria 1772
301 Ga0114129_10530242 3300009147 Bacteria 1534
302 Ga0114129_10550483 3300009147 Bacteria 1500
303 Ga0114129_10965093 3300009147 Bacteria 1076
304 Ga0114129_11349640 3300009147 Bacteria 882
305 Ga0114129_12836769 3300009147 Bacteria 575
306 Ga0114129_13046711 3300009147 Bacteria 549
307 Ga0105243_10004734 3300009148 Bacteria 10703
308 Ga0105243_11683948 3300009148 Bacteria 663
309 Ga0105241_10521708 3300009174 Bacteria 1062
310 Ga0105241_11984814 3300009174 Bacteria 572
311 Ga0105242_10360774 3300009176 Bacteria 1345
312 Ga0105242_10493056 3300009176 Bacteria 1164
313 Ga0105242_12610326 3300009176 Bacteria 554
314 Ga0105248_10002978 3300009177 Bacteria 18772
315 Ga0105248_10519552 3300009177 Bacteria 1342
316 Ga0105237_10380647 3300009545 Bacteria 1416
317 Ga0105237_10478802 3300009545 Bacteria 1251
318 Ga0105238_10379370 3300009551 Bacteria 1405
319 Ga0105238_10529754 3300009551 Bacteria 1181
320 Ga0105238_11006104 3300009551 Bacteria 854
321 Ga0105249_10015360 3300009553 Bacteria 6775
322 Ga0105249_10824157 3300009553 Bacteria 992
323 Ga0105035_118861 3300009988 Bacteria 650
324 Ga0105239_10180706 3300010375 Bacteria 2360
325 Ga0105239_10448944 3300010375 Bacteria 1463
326 Ga0105239_10647011 3300010375 Bacteria 1207
327 Ga0105239_10681292 3300010375 Bacteria 1175
328 Ga0105239_11577761 3300010375 Bacteria 759
329 Ga0105246_10753942 3300011119 Bacteria 859
330 Ga0157371_10222559 3300013102 Bacteria 1355
331 Ga0157369_10217259 3300013105 Bacteria 2002
332 Ga0157369_10236958 3300013105 Bacteria 1906
333 Ga0157369_10616586 3300013105 Bacteria 1119
334 Ga0157369_10973712 3300013105 Bacteria 869
335 Ga0157369_11896490 3300013105 Bacteria 605
336 Ga0157369_12131692 3300013105 Bacteria 568
337 Ga0157374_10674288 3300013296 Bacteria 1046
338 Ga0157374_10688828 3300013296 Bacteria 1035
339 Ga0157374_10730838 3300013296 Bacteria 1004
340 Ga0157378_10052428 3300013297 Bacteria 3630
341 Ga0157378_11781487 3300013297 Bacteria 664
342 Ga0163162_10572328 3300013306 Bacteria 1257
343 Ga0163162_11978618 3300013306 Bacteria 668
344 Ga0157372_10311882 3300013307 Bacteria 1831
345 Ga0157372_12500509 3300013307 Bacteria 593
346 Ga0157375_10026663 3300013308 Bacteria 5391
347 Ga0157375_10546546 3300013308 Bacteria 1320
348 Ga0157375_10713901 3300013308 Bacteria 1156
349 Ga0163163_10251580 3300014325 Bacteria 1817
350 Ga0163163_10522777 3300014325 Bacteria 1249
351 Ga0163163_10595621 3300014325 Bacteria 1169
352 Ga0163163_11045321 3300014325 Bacteria 880
353 Ga0163163_11144669 3300014325 Bacteria 841
354 Ga0163163_11443746 3300014325 Bacteria 749
355 Ga0163163_12183434 3300014325 Bacteria 613
356 Ga0163163_12707929 3300014325 Bacteria 553
357 Ga0157380_10036095 3300014326 Bacteria 3823
358 Ga0157380_11505212 3300014326 Bacteria 726
359 Ga0157380_12720055 3300014326 Bacteria 561
360 Ga0157380_13337032 3300014326 Bacteria 513
361 Ga0182008_10392954 3300014497 Bacteria 743
362 Ga0182008_10459175 3300014497 Bacteria 694
363 Ga0157377_11500419 3300014745 Bacteria 536
364 Ga0157379_10031926 3300014968 Bacteria 4692
365 Ga0157379_10625741 3300014968 Bacteria 1006
366 Ga0157379_11677156 3300014968 Bacteria 622
367 Ga0157376_10182380 3300014969 Bacteria 1920
368 Ga0157376_11584268 3300014969 Bacteria 689
369 Ga0157376_12053295 3300014969 Bacteria 610
370 Ga0157376_13092230 3300014969 Bacteria 504
371 Ga0163161_10467329 3300017792 Bacteria 1022
372 Ga0163161_11007107 3300017792 Bacteria 711
373 Ga0163161_11202371 3300017792 Bacteria 655
374 Ga0163161_11775857 3300017792 Bacteria 548
375 Ga0197907_10146932 3300020069 Bacteria 901
376 Ga0197907_11131751 3300020069 Bacteria 911
377 Ga0206356_10738473 3300020070 Bacteria 2399
378 Ga0206349_1135760 3300020075 Bacteria 1051
379 Ga0206355_1430210 3300020076 Bacteria 508
380 Ga0206351_10859302 3300020077 Bacteria 661
381 Ga0206352_10875590 3300020078 Bacteria 1333
382 Ga0206350_10076879 3300020080 Bacteria 846
383 Ga0206354_10429281 3300020081 Bacteria 1086
384 Ga0206354_10768390 3300020081 Bacteria 1222
385 Ga0206354_11604246 3300020081 Bacteria 973
386 Ga0206353_10238432 3300020082 Bacteria 1339
387 Ga0206353_10596355 3300020082 Bacteria 1747
388 Ga0213874_10036632 3300021377 Bacteria 1447
389 Ga0213874_10046654 3300021377 Bacteria 1316
390 Ga0213876_10009652 3300021384 Bacteria 5193
391 Ga0213876_10018841 3300021384 Bacteria 3645
392 Ga0213876_10641434 3300021384 Bacteria 565
393 Ga0213875_10000073 3300021388 Bacteria 119027
394 Ga0213875_10045780 3300021388 Bacteria 2054
395 Ga0224712_10094121 3300022467 Bacteria 1260
396 Ga0224572_1063462 3300024225 Bacteria 683
397 Ga0209051_1022107 3300025303 Bacteria 2687
398 Ga0209051_1060753 3300025303 Bacteria 1191
399 Ga0207682_10051233 3300025893 Bacteria 1709
400 Ga0207692_10844259 3300025898 Bacteria 601
401 Ga0207642_10214254 3300025899 Bacteria 1072
402 Ga0207642_10233058 3300025899 Bacteria 1035
403 Ga0207688_10025811 3300025901 Bacteria 3229
404 Ga0207680_10104393 3300025903 Bacteria 1827
405 Ga0207680_10280405 3300025903 Bacteria 1158
406 Ga0207680_10603768 3300025903 Bacteria 785
407 Ga0207647_10073923 3300025904 Bacteria 2054
408 Ga0207647_10509330 3300025904 Bacteria 670
409 Ga0207645_11026122 3300025907 Bacteria 558
410 Ga0207643_10001705 3300025908 Bacteria 12334
411 Ga0207643_10131982 3300025908 Bacteria 1487
412 Ga0207705_10074685 3300025909 Bacteria 2461
413 Ga0207705_10155879 3300025909 Bacteria 1713
414 Ga0207705_10195407 3300025909 Bacteria 1531
415 Ga0207705_11177134 3300025909 Bacteria 589
416 Ga0207684_10007698 3300025910 Bacteria 9657
417 Ga0207684_10121331 3300025910 Archaea 2241
418 Ga0207684_10168881 3300025910 Bacteria 1885
419 Ga0207684_10197399 3300025910 Bacteria 1736
420 Ga0207684_10306887 3300025910 Bacteria 1368
421 Ga0207684_10315895 3300025910 Bacteria 1347
422 Ga0207684_10479521 3300025910 Bacteria 1067
423 Ga0207684_10518360 3300025910 Bacteria 1021
424 Ga0207684_11039932 3300025910 Bacteria 684
425 Ga0207684_11246656 3300025910 Bacteria 614
426 Ga0207707_10014387 3300025912 Bacteria 6892
427 Ga0207707_10076608 3300025912 Bacteria 2919
428 Ga0207707_10440818 3300025912 Bacteria 1115
429 Ga0207693_10093591 3300025915 Bacteria 2356
430 Ga0207693_10235745 3300025915 Bacteria 1437
431 Ga0207663_10022011 3300025916 Bacteria 3637
432 Ga0207663_10430123 3300025916 Bacteria 1015
433 Ga0207663_10452826 3300025916 Bacteria 990
434 Ga0207660_10042355 3300025917 Bacteria 3195
435 Ga0207662_10054240 3300025918 Bacteria 2390
436 Ga0207657_10084430 3300025919 Bacteria 2661
437 Ga0207649_10019634 3300025920 Bacteria 3866
438 Ga0207649_10064996 3300025920 Bacteria 2308
439 Ga0207652_10056899 3300025921 Bacteria 3367
440 Ga0207652_10219506 3300025921 Bacteria 1713
441 Ga0207652_10220028 3300025921 Bacteria 1711
442 Ga0207652_10747316 3300025921 Bacteria 871
443 Ga0207652_10874837 3300025921 Bacteria 795
444 Ga0207652_11710239 3300025921 Bacteria 534
445 Ga0207646_10194944 3300025922 Bacteria 1829
446 Ga0207646_10199317 3300025922 Bacteria 1808
447 Ga0207646_10205026 3300025922 Bacteria 1781
448 Ga0207646_10208990 3300025922 Bacteria 1763
449 Ga0207646_10265832 3300025922 Bacteria 1550
450 Ga0207681_10538998 3300025923 Bacteria 959
451 Ga0207694_10236073 3300025924 Bacteria 1494
452 Ga0207694_11597694 3300025924 Bacteria 549
453 Ga0207650_10032101 3300025925 Bacteria 3798
454 Ga0207650_11133731 3300025925 Bacteria 666
455 Ga0207659_10003563 3300025926 Bacteria 9370
456 Ga0207659_10201165 3300025926 Bacteria 1591
457 Ga0207687_10012641 3300025927 Bacteria 5515
458 Ga0207687_10098228 3300025927 Bacteria 2149
459 Ga0207687_10230900 3300025927 Bacteria 1461
460 Ga0207687_10310594 3300025927 Bacteria 1273
461 Ga0207687_10562014 3300025927 Bacteria 958
462 Ga0207687_11232516 3300025927 Bacteria 643
463 Ga0207700_10004768 3300025928 Bacteria 8043
464 Ga0207700_10016883 3300025928 Bacteria 4861
465 Ga0207700_10044626 3300025928 Bacteria 3265
466 Ga0207700_10465789 3300025928 Bacteria 1115
467 Ga0207700_11706065 3300025928 Bacteria 555
468 Ga0207664_10016747 3300025929 Bacteria 5354
469 Ga0207664_10042520 3300025929 Bacteria 3547
470 Ga0207664_10062808 3300025929 Bacteria 2967
471 Ga0207664_10271596 3300025929 Bacteria 1485
472 Ga0207664_10407736 3300025929 Bacteria 1209
473 Ga0207664_11295428 3300025929 Bacteria 648
474 Ga0207644_10047477 3300025931 Bacteria 3064
475 Ga0207644_10209092 3300025931 Bacteria 1542
476 Ga0207690_10000157 3300025932 Bacteria 53457
477 Ga0207690_11759524 3300025932 Bacteria 518
478 Ga0207690_11823740 3300025932 Bacteria 508
479 Ga0207706_10003191 3300025933 Bacteria 15738
480 Ga0207706_11052251 3300025933 Bacteria 682
481 Ga0207686_10010391 3300025934 Bacteria 5070
482 Ga0207686_10119645 3300025934 Bacteria 1790
483 Ga0207686_10261264 3300025934 Bacteria 1270
484 Ga0207709_10012216 3300025935 Bacteria 4731
485 Ga0207670_10117933 3300025936 Bacteria 1924
486 Ga0207670_11494449 3300025936 Bacteria 574
487 Ga0207669_10055082 3300025937 Bacteria 2406
488 Ga0207669_10404449 3300025937 Bacteria 1070
489 Ga0207704_10249612 3300025938 Bacteria 1331
490 Ga0207665_10479130 3300025939 Bacteria 958
491 Ga0207665_11195206 3300025939 Bacteria 607
492 Ga0207691_10001940 3300025940 Bacteria 20185
493 Ga0207691_10007065 3300025940 Bacteria 10833
494 Ga0207691_10846018 3300025940 Bacteria 767
495 Ga0207691_11571290 3300025940 Bacteria 536
496 Ga0207711_10003778 3300025941 Bacteria 13042
497 Ga0207711_10045400 3300025941 Bacteria 3755
498 Ga0207711_11576202 3300025941 Bacteria 600
499 Ga0207689_10150275 3300025942 Bacteria 1920
500 Ga0207661_10001620 3300025944 Bacteria 15317
501 Ga0207661_10145504 3300025944 Bacteria 2044
502 Ga0207661_10579811 3300025944 Bacteria 1029
503 Ga0207679_10124492 3300025945 Bacteria 2058
504 Ga0207679_11385578 3300025945 Bacteria 645
505 Ga0207667_10245366 3300025949 Bacteria 1832
506 Ga0207667_11786390 3300025949 Bacteria 579
507 Ga0207651_10011023 3300025960 Bacteria 5039
508 Ga0207712_10068908 3300025961 Bacteria 2537
509 Ga0207668_10036956 3300025972 Bacteria 3264
510 Ga0207668_10441199 3300025972 Bacteria 1109
511 Ga0207668_10442547 3300025972 Bacteria 1107
512 Ga0207668_10701443 3300025972 Bacteria 890
513 Ga0207668_12032070 3300025972 Bacteria 518
514 Ga0207640_10427601 3300025981 Bacteria 1085
515 Ga0207640_11276319 3300025981 Bacteria 655
516 Ga0207658_10025871 3300025986 Bacteria 4111
517 Ga0207658_10048109 3300025986 Bacteria 3125
518 Ga0207677_10012793 3300026023 Bacteria 4842
519 Ga0207677_10235345 3300026023 Bacteria 1478
520 Ga0207677_10246468 3300026023 Bacteria 1448
521 Ga0207703_10008492 3300026035 Bacteria 8115
522 Ga0207703_11935869 3300026035 Bacteria 566
523 Ga0207639_10085927 3300026041 Bacteria 2503
524 Ga0207678_10506323 3300026067 Bacteria 1053
525 Ga0207678_11004621 3300026067 Bacteria 738
526 Ga0207708_10845520 3300026075 Bacteria 790
527 Ga0207702_10005382 3300026078 Bacteria 11211
528 Ga0207702_10678870 3300026078 Bacteria 1014
529 Ga0207702_11930168 3300026078 Bacteria 581
530 Ga0207702_12228601 3300026078 Bacteria 536
531 Ga0207641_10001754 3300026088 Bacteria 20888
532 Ga0207648_10002197 3300026089 Bacteria 21185
533 Ga0207648_11444177 3300026089 Bacteria 647
534 Ga0207648_11668048 3300026089 Bacteria 599
535 Ga0207676_10938684 3300026095 Bacteria 850
536 Ga0207674_10029816 3300026116 Bacteria 5740
537 Ga0207674_10050383 3300026116 Bacteria 4254
538 Ga0207674_11964347 3300026116 Bacteria 550
539 Ga0207675_100001152 3300026118 Bacteria 26247
540 Ga0207675_101982188 3300026118 Bacteria 600
541 Ga0207683_10460357 3300026121 Bacteria 1173
542 Ga0207683_10749163 3300026121 Bacteria 906
543 Ga0207698_10379534 3300026142 Bacteria 1344
544 Ga0207698_10445369 3300026142 Bacteria 1249
545 Ga0207698_10640965 3300026142 Bacteria 1051
546 Ga0207698_10934363 3300026142 Bacteria 876
547 Ga0207698_11146580 3300026142 Bacteria 791
548 Ga0209998_10024421 3300027717 Bacteria 1311
549 Ga0209813_10302357 3300027866 Bacteria 622
550 Ga0207428_10010302 3300027907 Bacteria 8355
551 Ga0207428_10078479 3300027907 Bacteria 2583
552 Ga0207428_10162625 3300027907 Bacteria 1694
553 Ga0207428_10258173 3300027907 Bacteria 1298
554 Ga0268266_10263390 3300028379 Bacteria 1598
555 Ga0268266_10277584 3300028379 Bacteria 1557
556 Ga0268266_10349932 3300028379 Bacteria 1388
557 Ga0268266_12295889 3300028379 Bacteria 511
558 Ga0268265_10128980 3300028380 Bacteria 2098
559 Ga0268265_11889270 3300028380 Bacteria 604
560 Ga0268264_10697552 3300028381 Bacteria 1008
561 Ga0268264_10947087 3300028381 Bacteria 866
562 Ga0265326_10027348 3300028558 Bacteria 1626
563 Ga0265326_10094489 3300028558 Bacteria 847
564 Ga0265319_1162847 3300028563 Bacteria 689
565 Ga0265336_10006446 3300028666 Bacteria 4227
566 Ga0265336_10192348 3300028666 Bacteria 606
567 Ga0307515_10607596 3300028794 Bacteria 704
568 Ga0265338_10009713 3300028800 Bacteria 11414
569 Ga0265338_10034430 3300028800 Bacteria 4895
570 Ga0265338_10501904 3300028800 Bacteria 854
571 Ga0265338_10521919 3300028800 Bacteria 834
572 Ga0307511_10062279 3300030521 Bacteria 2833
573 Ga0307511_10096193 3300030521 Bacteria 1974
574 Ga0316177_1207210 3300030731 Bacteria 2041
575 Ga0316176_1186483 3300030732 Bacteria 1325
576 Ga0316179_1088487 3300030734 Bacteria 1332
577 Ga0316178_1070530 3300030735 Bacteria 1781
578 Ga0316180_1064925 3300030736 Bacteria 957
579 Ga0316180_1121429 3300030736 Bacteria 1608
580 Ga0316182_1127369 3300030745 Bacteria 585
581 Ga0265766_1020627 3300030863 Bacteria 541
582 Ga0265330_10223224 3300031235 Bacteria 795
583 Ga0265320_10140667 3300031240 Bacteria 1093
584 Ga0265325_10019205 3300031241 Bacteria 3782
585 Ga0265329_10212143 3300031242 Bacteria 639
586 Ga0265340_10001402 3300031247 Bacteria 13830
587 Ga0265339_10091701 3300031249 Bacteria 1592
588 Ga0265327_10000134 3300031251 Bacteria 163243
589 Ga0265327_10001291 3300031251 Bacteria 32872
590 Ga0265327_10036187 3300031251 Bacteria 2717
591 Ga0265327_10344898 3300031251 Bacteria 651
592 Ga0265327_10479132 3300031251 Bacteria 537
593 Ga0307513_10007005 3300031456 Bacteria 14667
594 Ga0307513_10024102 3300031456 Bacteria 7087
595 Ga0307509_10199798 3300031507 Bacteria 1838
596 Ga0265313_10012099 3300031595 Bacteria 5311
597 Ga0310107_108231 3300031615 Bacteria 1379
598 Ga0307508_10017109 3300031616 Bacteria 6594
599 Ga0307514_10374863 3300031649 Bacteria 743
600 Ga0316575_10000833 3300031665 Bacteria 9406
601 Ga0316579_10004180 3300031691 Bacteria 5707
602 Ga0265314_10047326 3300031711 Bacteria 3027
603 Ga0265314_10068252 3300031711 Bacteria 2391
604 Ga0316576_10000924 3300031727 Bacteria 15000
605 Ga0316576_10001581 3300031727 Bacteria 12384
606 Ga0316576_10002702 3300031727 Bacteria 10144
607 Ga0316578_10000378 3300031728 Bacteria 14221
608 Ga0316578_10019860 3300031728 Bacteria 3706
609 Ga0316578_10020313 3300031728 Bacteria 3668
610 Ga0316578_10174439 3300031728 Bacteria 1296
611 Ga0316577_10139428 3300031733 Bacteria 1366
612 Ga0316577_10236000 3300031733 Bacteria 1034
613 Ga0316577_10390646 3300031733 Bacteria 790
614 Ga0316045_127936 3300031815 Bacteria 501
615 Ga0307413_10077997 3300031824 Bacteria 2112
616 Ga0307413_10574101 3300031824 Bacteria 919
617 Ga0316043_124307 3300031828 Bacteria 643
618 Ga0307518_10000495 3300031838 Bacteria 30033
619 Ga0307410_10016672 3300031852 Bacteria 4390
620 Ga0307410_12087229 3300031852 Bacteria 507
621 Ga0307407_10002033 3300031903 Bacteria 7716
622 Ga0307409_100001791 3300031995 Bacteria 10858
623 Ga0307409_100051098 3300031995 Bacteria 3161
624 Ga0307409_101125357 3300031995 Bacteria 807
625 Ga0307409_101142625 3300031995 Bacteria 801
626 Ga0307416_100052932 3300032002 Bacteria 3253
627 Ga0307416_100512522 3300032002 Bacteria 1266
628 Ga0307416_102027330 3300032002 Bacteria 678
629 Ga0307414_10085339 3300032004 Bacteria 2326
630 Ga0307415_100009069 3300032126 Bacteria 5554
631 Ga0307415_100019420 3300032126 Bacteria 4126
632 Ga0307415_100063419 3300032126 Bacteria 2568
633 Ga0307415_100949789 3300032126 Bacteria 796
634 Ga0307415_101507838 3300032126 Bacteria 643
635 Ga0316583_10012637 3300032133 Bacteria 3047
636 Ga0316585_10018701 3300032137 Bacteria 2105
637 Ga0316580_10253060 3300032139 Bacteria 545
638 Ga0307507_10000001 3300033179 Bacteria 417520
639 Ga0307507_10012252 3300033179 Bacteria 10635
640 Ga0307507_10044503 3300033179 Bacteria 4385
641 Ga0307510_10148106 3300033180 Bacteria 1974
642 Ga0307510_10327193 3300033180 Bacteria 988
643 Ga0316588_1118344 3300033528 Bacteria 669
644 Ga0316596_1016657 3300033541 Bacteria 1842
645 Ga0316596_1060649 3300033541 Bacteria 1009
646 Ga0373930_0132872 3300034816 Bacteria 614
647 Ga0373950_0010883 3300034818 Bacteria 1477
648 Ga0373958_0049757 3300034819 Bacteria 882
649 Ga0373959_0176490 3300034820 Bacteria 553
650 Ga0373926_0253025 3300035083 Bacteria 683
651 Ga0373940_0045253 3300035088 Bacteria 1221
652 Ga0373940_0126257 3300035088 Bacteria 798
653 Ga0373944_0355567 3300035089 Bacteria 558
654 Ga0373951_0000004 3300035091 Bacteria 95240
655 Ga0373951_0197155 3300035091 Bacteria 585
656 Ga0373936_0223761 3300035113 Bacteria 835
657 Ga0373939_0076060 3300035114 Bacteria 1105
658 Ga0373945_0027344 3300035116 Bacteria 1992
659 Ga0373945_0490341 3300035116 Bacteria 547
660 Ga0373954_0368528 3300035118 Bacteria 710
661 Ga0373960_0266727 3300035121 Bacteria 627
662 Ga0373943_0034594 3300035170 Bacteria 2411
663 Ga0373943_0041257 3300035170 Bacteria 2231
664 Ga0373943_0151836 3300035170 Bacteria 1255
665 Ga0373943_0206913 3300035170 Bacteria 1088
666 Ga0373943_0408884 3300035170 Bacteria 784
667 Ga0373946_0128159 3300035171 Bacteria 1165
668 Ga0373942_0001416 3300035207 Bacteria 6191
669 Ga0373962_0021659 3300035242 Bacteria 1697
670 Ga0316574_0004904 3300035398 Bacteria 7086
671 Ga0316574_0009181 3300035398 Bacteria 5527
672 Ga0316574_0055013 3300035398 Bacteria 2486
673 Ga0316574_0154897 3300035398 Bacteria 1476
674 Ga0373931_0000708 3300035691 Bacteria 13798
675 Ga0373931_0085006 3300035691 Bacteria 1753
676 Ga0373931_0122100 3300035691 Bacteria 1490
677 Ga0373935_0193872 3300035692 Bacteria 1401
678 Ga0373935_0932899 3300035692 Bacteria 644
679 Ga0373927_0001612 3300035695 Bacteria 16932
680 Ga0373927_0439545 3300035695 Bacteria 861
681 Ga0373927_0876185 3300035695 Bacteria 593
682 Ga0373933_0515289 3300035724 Bacteria 784
683 Ga0373947_0001991 3300035725 Bacteria 12489
684 Ga0373947_0029591 3300035725 Bacteria 3214
685 Ga0310112_039424 3300036458 Bacteria 643
686 Ga0316582_0049283 3300036647 Bacteria 2664
687 Ga0316582_0326338 3300036647 Bacteria 1055
688 Ga0316582_1226179 3300036647 Bacteria 510
689 Ga0316584_0003193 3300036712 Bacteria 10609
690 Ga0316584_0030695 3300036712 Bacteria 3970
691 Ga0316584_0114290 3300036712 Bacteria 2019
692 Ga0316584_0197305 3300036712 Bacteria 1486
693 Ga0316584_0613837 3300036712 Bacteria 753
694 Ga0373925_0012483 3300037068 Bacteria 6154
695 Ga0373925_0018669 3300037068 Bacteria 5041
696 Ga0395899_0044073 3300037312 Bacteria 3325
697 Ga0395900_0169902 3300037418 Bacteria 2220
698 Ga0395900_0498233 3300037418 Bacteria 1169
699 Ga0395898_0017644 3300037466 Bacteria 7286
700 Ga0395898_0722459 3300037466 Bacteria 938
701 Ga0395898_1547428 3300037466 Bacteria 588
702 Ga0395905_0487987 3300037471 Bacteria 1132
703 Ga0316581_0285264 3300037588 Bacteria 507
704 Ga0436364_0290389 3300037853 Bacteria 159315
705 Ga0436364_0296264 3300037853 Bacteria 555
706 Ga0436364_0565800 3300037853 Bacteria 515
707 Ga0436364_0768457 3300037853 Bacteria 965
708 Ga0436364_1321893 3300037853 Bacteria 1491
709 Ga0436364_1429963 3300037853 Bacteria 1187
710 Ga0436364_1492983 3300037853 Bacteria 717
711 Ga0436364_1521400 3300037853 Bacteria 1399
712 Ga0395901_0101187 3300038443 Bacteria 3024
713 Ga0395901_0107170 3300038443 Bacteria 2933
714 Ga0400485_18564 3300038735 Bacteria 1608
715 Ga0436365_0003307 3300039437 Bacteria 7073
716 Ga0436365_0449497 3300039437 Bacteria 32186
717 Ga0436365_0462769 3300039437 Bacteria 1402
718 Ga0436365_1217858 3300039437 Bacteria 9623
719 Ga0436365_1253726 3300039437 Bacteria 22924
720 Ga0436365_1524289 3300039437 Bacteria 766
721 Ga0436360_0109533 3300039438 Bacteria 757
722 Ga0436360_0684506 3300039438 Bacteria 746
723 Ga0436360_1032373 3300039438 Bacteria 667
724 Ga0436363_0085556 3300039450 Bacteria 1384
725 Ga0436363_0099586 3300039450 Bacteria 3801
726 Ga0436363_0569828 3300039450 Bacteria 1157
727 Ga0436363_1175061 3300039450 Bacteria 975
728 Ga0436363_1304752 3300039450 Bacteria 1578
729 Ga0436363_1327049 3300039450 Bacteria 645
730 Ga0436363_1427735 3300039450 Bacteria 867
731 Ga0436362_0197429 3300039453 Bacteria 857
732 Ga0436362_0947276 3300039453 Bacteria 719
733 Ga0439436_0119779 3300041404 Bacteria 736
734 Ga0439447_133552 3300041407 Bacteria 570
735 Ga0439465_0017188 3300041413 Bacteria 2257
736 Ga0439465_0096795 3300041413 Bacteria 1015
737 Ga0451787_254251 3300041441 Bacteria 630
738 Ga0451789_0759111 3300041443 Bacteria 3096
739 Ga0451794_23908 3300041446 Bacteria 574
740 Ga0451791_0237211 3300041451 Bacteria 1118
741 Ga0451791_0634074 3300041451 Bacteria 676
742 Ga0451793_1849706 3300041452 Bacteria 754
743 Ga0451797_0351315 3300041453 Bacteria 680
744 Ga0451797_0543649 3300041453 Bacteria 761
745 Ga0451797_0712560 3300041453 Bacteria 762
746 Ga0451797_0713983 3300041453 Bacteria 1045
747 Ga0451798_0088207 3300041458 Bacteria 541
748 Ga0451800_0058067 3300041459 Bacteria 629
749 Ga0451800_1614935 3300041459 Bacteria 793
750 Ga0451807_2763054 3300041486 Bacteria 584
751 Ga0451835_0289975 3300041492 Bacteria 879
752 Ga0451835_0659062 3300041492 Bacteria 759
753 Ga0451837_1396023 3300041494 Bacteria 1239
754 Ga0451839_0406728 3300041496 Bacteria 1297
755 Ga0451839_0556732 3300041496 Bacteria 634
756 Ga0451839_0791953 3300041496 Bacteria 500
757 Ga0451845_0064425 3300041501 Bacteria 769
758 Ga0451843_0892349 3300041509 Bacteria 1434
759 Ga0451843_0903008 3300041509 Bacteria 1066
760 Ga0451853_0228029 3300041512 Bacteria 6420
761 Ga0451853_0661484 3300041512 Bacteria 1018
762 Ga0451853_0851186 3300041512 Bacteria 739
763 Ga0451853_1040312 3300041512 Bacteria 691
764 Ga0451853_3439965 3300041512 Bacteria 763
765 Ga0439462_0071088 3300042015 Bacteria 945
766 Ga0439446_0036812 3300042156 Bacteria 1431
767 Ga0450909_087655 3300042185 Bacteria 508
768 Ga0439434_0126880 3300042435 Bacteria 835
769 Ga0466969_0015431 3300044656 Bacteria 4004
770 Ga0466969_0024429 3300044656 Bacteria 3108
771 Ga0466969_0026927 3300044656 Bacteria 2947
772 Ga0466969_0242959 3300044656 Bacteria 817
773 Ga0466969_0251140 3300044656 Bacteria 802
774 Ga0466969_0460786 3300044656 Bacteria 579
775 Ga0466972_0002336 3300044658 Bacteria 9344
776 Ga0466972_0010323 3300044658 Bacteria 4689
777 Ga0466972_0042792 3300044658 Bacteria 2201
778 Ga0466972_0118158 3300044658 Bacteria 1251
779 Ga0466972_0198748 3300044658 Bacteria 939
780 Ga0466965_0000846 3300044683 Bacteria 11604
781 Ga0466965_0010879 3300044683 Bacteria 4257
782 Ga0466965_0024738 3300044683 Bacteria 2905
783 Ga0466965_0036823 3300044683 Bacteria 2401
784 Ga0466965_0164050 3300044683 Bacteria 1166
785 Ga0466966_0001132 3300044684 Bacteria 17127
786 Ga0466966_0008129 3300044684 Bacteria 6954
787 Ga0466966_0018725 3300044684 Bacteria 4562
788 Ga0466966_0142541 3300044684 Bacteria 1464
789 Ga0466966_0213262 3300044684 Bacteria 1166
790 Ga0466961_0046824 3300044693 Bacteria 2765
791 Ga0466961_0072562 3300044693 Bacteria 2183
792 Ga0466961_0352819 3300044693 Bacteria 895
793 Ga0466961_0466497 3300044693 Bacteria 764
794 Ga0466961_0532275 3300044693 Bacteria 708
795 Ga0466963_0000174 3300044694 Bacteria 26596
796 Ga0466963_0243947 3300044694 Bacteria 1260
797 Ga0466963_0816621 3300044694 Bacteria 657
798 Ga0466964_0156931 3300044706 Bacteria 1060
799 Ga0466964_0221856 3300044706 Bacteria 918
800 Ga0466964_0293273 3300044706 Bacteria 817
801 Ga0466964_0344677 3300044706 Bacteria 764
802 Ga0466971_0011918 3300044719 Bacteria 3809
803 Ga0466971_0180758 3300044719 Bacteria 991
804 Ga0466971_0187931 3300044719 Bacteria 973
805 Ga0466971_0208209 3300044719 Bacteria 924
806 Ga0466971_0300662 3300044719 Bacteria 770
807 Ga0466971_0538213 3300044719 Bacteria 579
808 Ga0466968_0000527 3300044735 Bacteria 12977
809 Ga0466968_0063776 3300044735 Bacteria 1593
810 Ga0466968_0092801 3300044735 Bacteria 1340
811 Ga0466968_0099217 3300044735 Bacteria 1298
812 Ga0466968_0147905 3300044735 Bacteria 1078
813 Ga0466968_0347022 3300044735 Bacteria 721
814 Ga0466970_0010331 3300044765 Bacteria 4737
815 Ga0466970_0016476 3300044765 Bacteria 3812
816 Ga0466970_0019534 3300044765 Bacteria 3514
817 Ga0466970_0041431 3300044765 Bacteria 2447
818 Ga0466970_0204576 3300044765 Bacteria 1099
819 Ga0466970_0734851 3300044765 Bacteria 576
820 Ga0466957_0008885 3300044842 Bacteria 5724
821 Ga0466957_0023018 3300044842 Bacteria 3678
822 Ga0466957_0161967 3300044842 Bacteria 1453
823 Ga0466957_0381679 3300044842 Bacteria 961
824 Ga0466957_0443625 3300044842 Bacteria 893
825 Ga0466960_0000116 3300044901 Bacteria 26505
826 Ga0466960_0002137 3300044901 Bacteria 7365
827 Ga0466960_0273133 3300044901 Bacteria 945
828 Ga0466960_0299091 3300044901 Bacteria 906
829 Ga0466960_0336351 3300044901 Bacteria 858
830 Ga0466959_0003504 3300045049 Bacteria 10289
831 Ga0466959_0027386 3300045049 Bacteria 4229
832 Ga0466959_0051985 3300045049 Bacteria 3002
833 Ga0466959_0369371 3300045049 Bacteria 977
834 Ga0466959_0934322 3300045049 Bacteria 578
835 Ga0466958_0000322 3300045836 Bacteria 19046
836 Ga0466958_0002942 3300045836 Bacteria 8714
837 Ga0466958_0023911 3300045836 Bacteria 3592
838 Ga0466958_0097020 3300045836 Bacteria 1829
839 Ga0466958_0242394 3300045836 Bacteria 1152
840 Ga0466958_0912675 3300045836 Bacteria 573
841 Ga0466967_0008845 3300045976 Bacteria 7424
842 Ga0466967_0090607 3300045976 Bacteria 2778
843 Ga0466967_0099719 3300045976 Bacteria 2653
844 Ga0466967_0113895 3300045976 Bacteria 2489
845 Ga0466967_0123042 3300045976 Bacteria 2400
846 Ga0466967_0289247 3300045976 Bacteria 1574
847 Ga0466967_0580652 3300045976 Bacteria 1105
848 Ga0466967_0651543 3300045976 Bacteria 1041
849 Ga0466967_0858070 3300045976 Bacteria 902
850 Ga0466967_1914486 3300045976 Bacteria 590
851 Ga0466967_2478163 3300045976 Bacteria 514
852 Ga0495592_0346114 3300046454 Bacteria 954
853 Ga0495592_0376669 3300046454 Bacteria 904
854 Ga0495592_0473122 3300046454 Bacteria 782
855 Ga0495592_0787020 3300046454 Bacteria 566
856 Ga0495603_0076600 3300046455 Bacteria 1963
857 Ga0495629_0001838 3300046459 Bacteria 16612
858 Ga0495629_0141521 3300046459 Bacteria 1674
859 Ga0495629_1091064 3300046459 Bacteria 516
860 Ga0495638_0006715 3300046460 Bacteria 8337
861 Ga0495651_0779054 3300046462 Bacteria 591
862 Ga0495651_0981367 3300046462 Bacteria 513
863 Ga0495653_0647968 3300046463 Bacteria 645
864 Ga0495650_0018822 3300046471 Bacteria 3422
865 Ga0495582_0001304 3300046473 Bacteria 13997
866 Ga0495582_0056891 3300046473 Bacteria 2156
867 Ga0495582_0362623 3300046473 Bacteria 835
868 Ga0495639_0005528 3300046475 Bacteria 5440
869 Ga0495639_0701418 3300046475 Bacteria 523
870 Ga0495662_0104829 3300046476 Bacteria 1384
871 Ga0495662_0172347 3300046476 Bacteria 1066
872 Ga0495594_0793832 3300046499 Bacteria 534
873 Ga0495583_0314171 3300046506 Bacteria 621
874 Ga0495608_0038811 3300046511 Bacteria 3196
875 Ga0495608_0550015 3300046511 Bacteria 696
876 Ga0495608_0815748 3300046511 Bacteria 550
877 Ga0495618_0015734 3300046514 Bacteria 4617
878 Ga0495618_0038022 3300046514 Bacteria 3024
879 Ga0495618_0102733 3300046514 Bacteria 1830
880 Ga0495618_0314568 3300046514 Bacteria 971
881 Ga0495628_0079638 3300046516 Bacteria 2547
882 Ga0495628_0321668 3300046516 Bacteria 1141
883 Ga0495630_0091160 3300046517 Bacteria 2303
884 Ga0495630_0096646 3300046517 Bacteria 2233
885 Ga0495630_0120107 3300046517 Bacteria 1994
886 Ga0495630_0217144 3300046517 Bacteria 1460
887 Ga0495630_0716575 3300046517 Bacteria 765
888 Ga0495666_0050318 3300046526 Bacteria 2003
889 Ga0495642_0271245 3300046528 Bacteria 743
890 Ga0495652_0125261 3300046529 Bacteria 2042
891 Ga0495665_0042811 3300046531 Bacteria 2409
892 Ga0495665_0194589 3300046531 Bacteria 1052
893 Ga0495640_0039098 3300046533 Bacteria 3332
894 Ga0495640_0254665 3300046533 Bacteria 1098
895 Ga0495640_0435772 3300046533 Bacteria 802
896 Ga0495586_0183392 3300046535 Bacteria 1184
897 Ga0495586_0231452 3300046535 Bacteria 1052
898 Ga0495587_0194466 3300046536 Bacteria 1148
899 Ga0495587_0422261 3300046536 Bacteria 740
900 Ga0495587_0668710 3300046536 Bacteria 570
901 Ga0495621_0019060 3300046539 Bacteria 2236
902 Ga0495645_0315030 3300046543 Bacteria 1018
903 Ga0495667_0258363 3300046559 Bacteria 1108
904 Ga0495668_0282129 3300046616 Bacteria 910
905 Ga0495634_0010302 3300046642 Bacteria 6851
906 Ga0495635_0354004 3300046663 Bacteria 979
907 Ga0495635_0445034 3300046663 Bacteria 857
908 Ga0495659_0091905 3300046664 Bacteria 1166
909 Ga0495659_0198722 3300046664 Bacteria 822
910 Ga0495661_0560434 3300046665 Bacteria 540
911 Ga0495657_0134477 3300046675 Bacteria 1546
912 Ga0495657_0271256 3300046675 Bacteria 1017
913 Ga0495657_0428954 3300046675 Bacteria 776
914 Ga0495646_0588312 3300046680 Bacteria 566
915 Ga0495647_0027634 3300046681 Bacteria 2086
916 Ga0495658_0000768 3300046683 Bacteria 17344
917 Ga0495658_0137927 3300046683 Bacteria 1490
918 Ga0495658_0341428 3300046683 Bacteria 951
919 Ga0495613_0002016 3300046689 Bacteria 15414
920 Ga0495613_0003428 3300046689 Bacteria 11851
921 Ga0495613_0237959 3300046689 Bacteria 1274
922 Ga0495613_0318066 3300046689 Bacteria 1075
923 Ga0495624_0218937 3300046690 Bacteria 1155
924 Ga0495589_0430283 3300046794 Bacteria 605
925 Ga0495581_0031890 3300047315 Bacteria 3053
926 Ga0495604_0234770 3300047317 Bacteria 1257
927 Ga0495604_0289817 3300047317 Bacteria 1103
928 Ga0495604_0519320 3300047317 Bacteria 771
929 Ga0495674_0897481 3300047319 Bacteria 684
930 Ga0495674_0982650 3300047319 Bacteria 648
931 Ga0495676_0243792 3300047321 Bacteria 1229
932 Ga0495680_0041638 3300047322 Bacteria 3651
933 Ga0495680_0293959 3300047322 Bacteria 1142
934 Ga0495680_0363713 3300047322 Bacteria 1005
935 Ga0495684_0352604 3300047471 Bacteria 1044
936 Ga0495684_0424595 3300047471 Bacteria 929
937 Ga0495684_0646642 3300047471 Bacteria 708
938 Ga0495684_0856590 3300047471 Bacteria 589
939 Ga0496100_0039461 3300048903 Bacteria 2999
940 Ga0496100_0370788 3300048903 Bacteria 1085
941 Ga0496100_0529349 3300048903 Bacteria 910
942 Ga0496101_0010834 3300048904 Bacteria 6031
943 Ga0496101_0383109 3300048904 Bacteria 1106
944 Ga0496101_0626458 3300048904 Bacteria 850
945 Ga0496101_1296569 3300048904 Bacteria 569
946 Ga0496102_0000042 3300048905 Bacteria 196538
947 Ga0496102_0032418 3300048905 Bacteria 4692
948 Ga0496102_0910601 3300048905 Bacteria 801
949 Ga0496102_1834448 3300048905 Bacteria 523
950 Ga0496103_0000441 3300048906 Bacteria 35759
951 Ga0496103_0540423 3300048906 Bacteria 744
952 Ga0496104_0043998 3300048907 Bacteria 4195
953 Ga0496104_0095666 3300048907 Bacteria 2841
954 Ga0496104_0307004 3300048907 Bacteria 1499
955 Ga0496105_0032456 3300048908 Bacteria 4285
956 Ga0496105_0074710 3300048908 Bacteria 2800
957 Ga0496105_0232888 3300048908 Bacteria 1496
958 Ga0496106_0593638 3300048909 Bacteria 887
959 Ga0496106_1156452 3300048909 Bacteria 605
960 Ga0496107_0402990 3300048910 Bacteria 1017
961 Ga0496107_0418534 3300048910 Bacteria 996
962 Ga0496108_0096033 3300048911 Bacteria 2524
963 Ga0496108_0108578 3300048911 Bacteria 2371
964 Ga0496109_0014217 3300048912 Bacteria 6924
965 Ga0496109_0055655 3300048912 Bacteria 3609
966 Ga0496109_0164002 3300048912 Bacteria 2083
967 Ga0496109_0316088 3300048912 Bacteria 1473
968 Ga0496109_0519440 3300048912 Bacteria 1124
969 Ga0496109_0694656 3300048912 Bacteria 955
970 Ga0496109_2021775 3300048912 Bacteria 508
971 Ga0496110_0001134 3300048913 Bacteria 18834
972 Ga0496110_0114379 3300048913 Bacteria 2428
973 Ga0496110_0759497 3300048913 Bacteria 873
974 Ga0496110_0809841 3300048913 Bacteria 841
975 Ga0496110_0862406 3300048913 Bacteria 811
976 Ga0496110_1061719 3300048913 Bacteria 718
977 Ga0496111_0004889 3300048914 Bacteria 8510
978 Ga0496111_0116350 3300048914 Bacteria 1972
979 Ga0496111_0221314 3300048914 Bacteria 1406
980 Ga0496112_0360731 3300048915 Bacteria 1395
981 Ga0496112_0430486 3300048915 Bacteria 1258
982 Ga0496112_0512479 3300048915 Bacteria 1135
983 Ga0496113_0609708 3300048916 Bacteria 874
984 Ga0496113_0631226 3300048916 Bacteria 857
985 Ga0496113_0699773 3300048916 Bacteria 809
986 Ga0496114_0020577 3300048917 Bacteria 5355
987 Ga0496114_0026409 3300048917 Bacteria 4754
988 Ga0496114_0249952 3300048917 Bacteria 1560
989 Ga0496114_0250078 3300048917 Bacteria 1560
990 Ga0496114_0422616 3300048917 Bacteria 1181
991 Ga0496114_0621637 3300048917 Bacteria 952
992 Ga0496115_0001342 3300048918 Bacteria 17547
993 Ga0496115_0427445 3300048918 Bacteria 1072
994 Ga0496115_0533782 3300048918 Bacteria 939
995 Ga0496115_0684151 3300048918 Bacteria 808
996 Ga0496116_0000945 3300048919 Bacteria 35787
997 Ga0496117_0000339 3300048920 Bacteria 82597
998 Ga0496118_0000241 3300048921 Bacteria 96484
999 Ga0496119_0000974 3300048922 Bacteria 36779
1000 Ga0496119_0005030 3300048922 Bacteria 12856
1001 Ga0496121_0015684 3300048924 Bacteria 7905
1002 Ga0496122_0203487 3300048925 Bacteria 1155
1003 Ga0496124_0011730 3300048927 Bacteria 8741
1004 Ga0496124_0774809 3300048927 Bacteria 598
1005 Ga0496124_0888484 3300048927 Bacteria 542
1006 Ga0496125_0065774 3300048928 Bacteria 2869
1007 Ga0496125_0081564 3300048928 Bacteria 2470
1008 Ga0496125_0269517 3300048928 Bacteria 1062
1009 Ga0496126_0000048 3300048929 Bacteria 317977
1010 Ga0496126_0001023 3300048929 Bacteria 47541
1011 Ga0496126_0014903 3300048929 Bacteria 7840
1012 Ga0496126_0258942 3300048929 Bacteria 1447
1013 Ga0501031_0148729 3300049568 Bacteria 1530
1014 Ga0501031_0221855 3300049568 Bacteria 1231
1015 Ga0501032_0021055 3300049569 Bacteria 4536
1016 Ga0501032_0028980 3300049569 Bacteria 3801
1017 Ga0501032_0769258 3300049569 Bacteria 609
1018 Ga0501033_0019417 3300049570 Bacteria 5140
1019 Ga0501033_0097637 3300049570 Bacteria 2146
1020 Ga0501033_0171727 3300049570 Bacteria 1557
1021 Ga0501033_0205131 3300049570 Bacteria 1407
1022 Ga0501033_0217938 3300049570 Bacteria 1359
1023 Ga0501033_0739794 3300049570 Bacteria 667
1024 Ga0501034_0054766 3300049571 Bacteria 4015
1025 Ga0501036_0059238 3300049572 Bacteria 3245
1026 Ga0501036_0074935 3300049572 Bacteria 2862
1027 Ga0501036_0114848 3300049572 Bacteria 2275
1028 Ga0501036_0261029 3300049572 Bacteria 1451
1029 Ga0501037_0126700 3300049573 Bacteria 1833
1030 Ga0501037_0293618 3300049573 Bacteria 1130
1031 Ga0501037_0348555 3300049573 Bacteria 1022
1032 Ga0501038_0065354 3300049574 Bacteria 3099
1033 Ga0501038_0245596 3300049574 Bacteria 1420
1034 Ga0501038_0381482 3300049574 Bacteria 1093
1035 Ga0501038_0890690 3300049574 Bacteria 657
1036 Ga0501039_0105439 3300049575 Bacteria 2201
1037 Ga0501040_0045950 3300049576 Bacteria 2980
1038 Ga0501041_0037890 3300049577 Bacteria 2923
1039 Ga0501041_0325914 3300049577 Bacteria 969
1040 Ga0501041_0656819 3300049577 Bacteria 670
1041 Ga0501041_0675703 3300049577 Bacteria 660
1042 Ga0501042_0419113 3300049578 Bacteria 970
1043 Ga0501042_0568807 3300049578 Bacteria 824
1044 Ga0501043_0125103 3300049579 Bacteria 2016
1045 Ga0501043_0162604 3300049579 Bacteria 1744
1046 Ga0501046_0045701 3300049580 Bacteria 3478
1047 Ga0501046_0344406 3300049580 Bacteria 1083
1048 Ga0501046_0814615 3300049580 Bacteria 654
1049 Ga0501047_0003711 3300049581 Bacteria 14377
1050 Ga0501047_0004314 3300049581 Bacteria 13385
1051 Ga0501047_0195962 3300049581 Bacteria 1882
1052 Ga0501047_0638941 3300049581 Bacteria 884
1053 Ga0501048_0092335 3300049582 Bacteria 2135
1054 Ga0501048_0168535 3300049582 Bacteria 1551
1055 Ga0501067_0032242 3300049583 Bacteria 2908
1056 Ga0501067_0249101 3300049583 Bacteria 989
1057 Ga0501068_0013339 3300049584 Bacteria 4674
1058 Ga0501068_0023389 3300049584 Bacteria 3621
1059 Ga0501068_0624585 3300049584 Bacteria 703
1060 Ga0501069_0016892 3300049585 Bacteria 3921
1061 Ga0501069_0113838 3300049585 Bacteria 1542
1062 Ga0501069_0644075 3300049585 Bacteria 637
1063 Ga0501070_0157431 3300049586 Bacteria 1873
1064 Ga0501070_0305514 3300049586 Bacteria 1295
1065 Ga0501071_0018841 3300049587 Bacteria 4786
1066 Ga0501071_0097881 3300049587 Bacteria 2160
1067 Ga0501071_0317829 3300049587 Bacteria 1182
1068 Ga0501071_1051222 3300049587 Bacteria 629
1069 Ga0501071_1095691 3300049587 Bacteria 615
1070 Ga0501072_0060638 3300049588 Bacteria 2983
1071 Ga0501072_0260015 3300049588 Bacteria 1382
1072 Ga0501072_0348966 3300049588 Bacteria 1175
1073 Ga0501072_0525669 3300049588 Bacteria 935
1074 Ga0501072_1544388 3300049588 Bacteria 512
1075 Ga0501072_1578694 3300049588 Bacteria 506
1076 Ga0501073_0024330 3300049589 Bacteria 4348
1077 Ga0501073_0303073 3300049589 Bacteria 1102
1078 Ga0501073_0748604 3300049589 Bacteria 674
1079 Ga0501074_0029881 3300049590 Bacteria 3949
1080 Ga0501074_0049524 3300049590 Bacteria 3033
1081 Ga0501074_0249189 3300049590 Bacteria 1263
1082 Ga0501075_0095056 3300049591 Bacteria 2262
1083 Ga0501075_0100288 3300049591 Bacteria 2199
1084 Ga0501075_0159627 3300049591 Bacteria 1720
1085 Ga0501075_0231282 3300049591 Bacteria 1410
1086 Ga0501076_0146917 3300049592 Bacteria 1917
1087 Ga0501076_1276291 3300049592 Bacteria 604
1088 Ga0501076_1371378 3300049592 Bacteria 581
1089 Ga0501076_1422952 3300049592 Bacteria 569
1090 Ga0501076_1787528 3300049592 Bacteria 504
1091 Ga0501077_0238703 3300049593 Bacteria 1155
1092 Ga0501079_0027399 3300049741 Bacteria 4369
1093 Ga0501079_0111396 3300049741 Bacteria 2127
1094 Ga0501079_0479934 3300049741 Bacteria 977
1095 Ga0501079_0696520 3300049741 Bacteria 800
1096 Ga0501079_1168956 3300049741 Bacteria 606
1097 Ga0501079_1420197 3300049741 Bacteria 546
1098 Ga0501080_0068596 3300049742 Bacteria 3298
1099 Ga0501080_0198111 3300049742 Bacteria 1844
1100 Ga0501080_1034684 3300049742 Bacteria 711
1101 Ga0501081_0021156 3300049743 Bacteria 4341
1102 Ga0501081_1489333 3300049743 Bacteria 514
1103 Ga0501083_0009415 3300049744 Bacteria 6900
1104 Ga0501083_0041629 3300049744 Bacteria 3115
1105 Ga0501083_0145642 3300049744 Bacteria 1551
1106 Ga0501035_0000344 3300049822 Bacteria 53753
1107 Ga0501035_1008386 3300049822 Bacteria 654
1108 Ga0501044_0000789 3300049823 Bacteria 38288
1109 Ga0501044_0076018 3300049823 Bacteria 3410
1110 Ga0501044_0472153 3300049823 Bacteria 1158
1111 Ga0501044_1040950 3300049823 Bacteria 689
1112 Ga0501044_1086291 3300049823 Bacteria 670
1113 Ga0501045_0016156 3300049824 Bacteria 5297
1114 Ga0501045_0024119 3300049824 Bacteria 4366
1115 nmdc:mga03683_46440_c1 3300050489 Bacteria 1800
1116 nmdc:mga03n38_445026_c1 3300050490 Bacteria 720
1117 nmdc:mga03n38_78883_c1 3300050490 Bacteria 1542
1118 nmdc:mga03n38_981545_c1 3300050490 Bacteria 500
1119 nmdc:mga00v17_22968_c1 3300050491 Bacteria 3605
1120 nmdc:mga00v17_234672_c1 3300050491 Bacteria 1189
1121 nmdc:mga00v17_344259_c1 3300050491 Bacteria 969
1122 nmdc:mga00v17_48954_c1 3300050491 Bacteria 2562
1123 nmdc:mga00v17_499671_c1 3300050491 Bacteria 788
1124 nmdc:mga0yw44_1192224_c1 3300050492 Bacteria 514
1125 nmdc:mga0yw44_1216824_c1 3300050492 Bacteria 508
1126 nmdc:mga0yw44_17771_c1 3300050492 Bacteria 3879
1127 nmdc:mga0yw44_456736_c1 3300050492 Bacteria 866
1128 nmdc:mga0yw44_629209_c1 3300050492 Bacteria 729
1129 nmdc:mga0yw44_75634_c1 3300050492 Bacteria 2100
1130 nmdc:mga0yw44_8942_c1 3300050492 Bacteria 5026
1131 nmdc:mga0yw44_931202_c1 3300050492 Bacteria 589
1132 nmdc:mga06z11_198439_c1 3300050494 Bacteria 1164
1133 nmdc:mga06z11_28989_c1 3300050494 Bacteria 2662
1134 nmdc:mga07m45_226378_c1 3300050496 Bacteria 1088
1135 nmdc:mga07m45_58458_c1 3300050496 Bacteria 2181
1136 nmdc:mga05p37_130623_c1 3300050507 Bacteria 3082
1137 nmdc:mga05p37_1518642_c1 3300050507 Bacteria 666
1138 nmdc:mga05p37_1910250_c1 3300050507 Bacteria 566
1139 nmdc:mga05p37_2241226_c1 3300050507 Bacteria 505
1140 nmdc:mga05p37_2278178_c1 3300050507 Bacteria 500
1141 nmdc:mga05p37_235867_c1 3300050507 Bacteria 2202
1142 nmdc:mga05p37_340652_c1 3300050507 Bacteria 1450
1143 nmdc:mga05p37_490988_c1 3300050507 Bacteria 1412
1144 nmdc:mga05p37_498037_c1 3300050507 Bacteria 1399
1145 nmdc:mga09592_508628_c1 3300050508 Bacteria 1037
1146 nmdc:mga09592_568420_c1 3300050508 Bacteria 973
1147 nmdc:mga09592_678165_c1 3300050508 Bacteria 878
1148 nmdc:mga09592_915146_c1 3300050508 Bacteria 737
1149 nmdc:mga0qj67_1050245_c1 3300050509 Bacteria 638
1150 nmdc:mga0qj67_1443945_c1 3300050509 Bacteria 530
1151 nmdc:mga0qj67_152952_c1 3300050509 Bacteria 1872
1152 nmdc:mga0qj67_304993_c1 3300050509 Bacteria 1290
1153 nmdc:mga0qj67_33373_c1 3300050509 Bacteria 4016
1154 nmdc:mga0qj67_4267_c1 3300050509 Bacteria 10358
1155 nmdc:mga0qj67_899361_c1 3300050509 Bacteria 698
1156 nmdc:mga06r32_103139_c1 3300050510 Bacteria 2801
1157 nmdc:mga06r32_117_c4 3300050510 Bacteria 9813
1158 nmdc:mga06r32_231251_c1 3300050510 Bacteria 1837
1159 nmdc:mga06r32_686023_c1 3300050510 Bacteria 991
1160 nmdc:mga06r32_725520_c1 3300050510 Bacteria 958
1161 nmdc:mga08y16_21097_c1 3300050511 Bacteria 6878
1162 nmdc:mga08y16_25971_c1 3300050511 Bacteria 6179
1163 nmdc:mga08y16_336157_c1 3300050511 Bacteria 1553
1164 nmdc:mga08y16_407831_c1 3300050511 Bacteria 1390
1165 nmdc:mga08y16_905083_c1 3300050511 Bacteria 868
1166 nmdc:mga0n895_928384_c1 3300050512 Bacteria 855
1167 nmdc:mga0rr50_1099115_c1 3300050513 Bacteria 676
1168 nmdc:mga0rr50_113441_c1 3300050513 Bacteria 2148
1169 nmdc:mga08x19_17051_c1 3300050514 Bacteria 4439
1170 nmdc:mga0a205_1207_c1 3300050515 Bacteria 21618
1171 nmdc:mga0sz30_1847_c1 3300050516 Bacteria 7539
1172 nmdc:mga0sz30_2249_c1 3300050516 Bacteria 6906
1173 nmdc:mga0sz30_56369_c1 3300050516 Bacteria 1673
1174 nmdc:mga0sz30_576174_c1 3300050516 Bacteria 509
1175 nmdc:mga0sz30_95838_c1 3300050516 Bacteria 1294
1176 Ga0495601_0015238 3300053077 Bacteria 4644
1177 Ga0495601_0276100 3300053077 Bacteria 1096
1178 Ga0495601_0958461 3300053077 Bacteria 539
1179 Ga0500635_0006210 3300053080 Bacteria 3180
1180 Ga0495595_0006436 3300053084 Bacteria 4791
1181 Ga0495619_0022565 3300053085 Bacteria 4030
1182 Ga0495619_0031947 3300053085 Bacteria 3413
1183 Ga0495619_0054547 3300053085 Bacteria 2646
1184 Ga0495619_0238864 3300053085 Bacteria 1259
1185 Ga0495619_0596517 3300053085 Bacteria 756
1186 Ga0495619_0624243 3300053085 Bacteria 736
1187 Ga0495619_0998847 3300053085 Bacteria 560
1188 Ga0500578_0342863 3300053086 Bacteria 875
1189 Ga0500643_015055 3300053087 Bacteria 2664
1190 Ga0500566_0067062 3300053094 Bacteria 2021
1191 Ga0500650_0369329 3300053098 Bacteria 625
1192 Ga0500555_150328 3300053103 Bacteria 571
1193 Ga0500557_190273 3300053105 Bacteria 664
1194 Ga0500642_0105452 3300053130 Bacteria 1313
1195 Ga0500652_023340 3300053131 Bacteria 2352
1196 Ga0500652_027596 3300053131 Bacteria 2196
1197 Ga0500655_022521 3300053133 Bacteria 1186
1198 Ga0500658_0328287 3300053134 Bacteria 703
1199 Ga0500559_0037276 3300053136 Bacteria 2107
1200 Ga0500568_0125094 3300053139 Bacteria 957
1201 Ga0500622_0001519 3300053156 Bacteria 18396
1202 Ga0500627_0033786 3300053158 Bacteria 2164
1203 Ga0500645_000668 3300053730 Bacteria 21553
1204 Ga0500645_021063 3300053730 Bacteria 2014
1205 Ga0501084_0006042 3300054114 Bacteria 9958
1206 Ga0501084_0027890 3300054114 Bacteria 4718
1207 Ga0501084_0107170 3300054114 Bacteria 2348
1208 Ga0501084_0492915 3300054114 Bacteria 1035
1209 Ga0501084_0591747 3300054114 Bacteria 937
1210 Ga0590075_214203 3300059424 Bacteria 510
1211 Ga0587080_068695 3300059503 Bacteria 705
1212 Ga0587082_014570 3300059504 Bacteria 1201
1213 Ga0587083_0065564 3300059505 Bacteria 830
1214 Ga0587086_107206 3300059507 Bacteria 521
1215 Ga0587088_004267 3300059508 Bacteria 1796
1216 Ga0587067_185259 3300059640 Bacteria 545
1217 Ga0587067_199682 3300059640 Bacteria 531
1218 Ga0587107_064061 3300059652 Bacteria 655
1219 Ga0587071_103876 3300060344 Bacteria 661
1220 Ga0501082_0150225 3300060353 Bacteria 2023
1221 Ga0501082_0287765 3300060353 Bacteria 1430
1222 Ga0501082_0700477 3300060353 Bacteria 886
1223 Ga0501082_1121244 3300060353 Bacteria 688
1224 Ga0466962_0011220 3300061719 Bacteria 4315
1225 Ga0466962_0094980 3300061719 Bacteria 1429
1226 Ga0466962_0348148 3300061719 Bacteria 738
1227 Ga0466962_0708448 3300061719 Bacteria 517
1228 Ga0466962_0709072 3300061719 Bacteria 516
1229 Ga0530510_0311667 3300061734 Bacteria 1179
1230 Ga0530510_0393618 3300061734 Bacteria 1044
1231 Ga0530510_0516374 3300061734 Bacteria 906
1232 2523385284 2523231044 Bacteria 6434991
1233 2548697871 2547132424 Bacteria 8348532
1234 2566993091 2565956761 Bacteria 6601618
1235 2586059296 2585427649 Bacteria 9053857
1236 2643825374 2643221561 Bacteria 4984412
1237 2643893151 2643221576 Bacteria 5214352
1238 2643961790 2643221590 Bacteria 5214697
1239 2644034122 2643221604 Bacteria 5014917
1240 2644229104 2643221641 Bacteria 4490190
1241 2644531368 2643221696 Bacteria 5431823
1242 2676486393 2675903059 Bacteria 8644972
1243 2738706070 2738541274 Bacteria 6909446
1244 2738889946 2738541308 Bacteria 7020677
1245 2739203266 2738543005 Bacteria 5278128
1246 2739238710 2738543011 Bacteria 5731169
1247 2739333030 2738543028 Bacteria 6917070
1248 2739602534 2739367653 Bacteria 2780952
1249 2744955924 2744054611 Bacteria 5611514
1250 2753035260 2751185725 Bacteria 5740550
1251 2753323777 2751185792 Bacteria 5739090
1252 2809591942 2808606522 Bacteria 9488490
1253 2812333812 2811994874 Bacteria 5367947
1254 2816504661 2816332139 Bacteria 9138787
1255 2817508954 2816332305 Bacteria 2697803
1256 2842891788 2842888712 Bacteria 4279094
1257 2855387606 2855386786 Bacteria 4752232
1258 2857729785 2857727296 Bacteria 2745552
1259 2866616840 2866612099 Bacteria 7543886
1260 2889300983 2889300758 Bacteria 5690814
1261 2891327581 2891326441 Bacteria 6439512
1262 2893686738 2893684298 Bacteria 2897960
1263 2899364124 2899359706 Bacteria 10940472
1264 2899373294 2899370129 Bacteria 6781179
1265 2899374248 2899370129 Bacteria 6781179
1266 2902801632 2902799365 Bacteria 5419524
1267 2904538915 2904535858 Bacteria 6308016
1268 2915774013 2915768154 Bacteria 8424322
1269 2917736543 2917736166 Bacteria 9690793
1270 2917738923 2917736166 Bacteria 9690793
1271 2919715954 2919713450 Bacteria 7431245
1272 2922556787 2922554459 Bacteria 6683962
1273 2928142509 2928142448 Bacteria 5288925
1274 2929214799 2929212328 Bacteria 7708288
1275 2939744502 2939743619 Bacteria 5762299
1276 2956940453 2956939328 Bacteria 3474458
1277 2974317246 2974315732 Bacteria 4602776
1278 2984525451 2984523437 Bacteria 4508481
1279 3001121878 3001119090 Bacteria 3449530
1280 3001890948 3001889506 Bacteria 2975194
1281 8047718024 8047710418 Bacteria 11023148
1282 8054474306 8054472261 Bacteria 7464355
1283 8056211997 8056207758 Bacteria 8639239
1284 Ga0466965_0730883
1285 MBSR1b_contig_13805831
1286 LJQas_1036547
1287 LJQas_1046351
1288 JGI24737J22298_10192071
1289 JGI24735J21928_10219037
1290 JGI24745J21846_1050926
1291 JGI24738J21930_10007846
1292 JGI24744J21845_10004671
1293 JGI25406J46586_10000557
1294 JGI25404J52841_10117817
1295 Ga0032354_1059068
1296 JGI25405J52794_10122767
1297 JGI25405J52794_10127411
1298 Ga0058861_10062782
1299 Ga0065715_10107560
1300 Ga0070658_10002468
1301 Ga0070658_10043582
1302 Ga0070658_10109830
1303 Ga0070683_100107447
1304 Ga0070683_100820770
1305 Ga0070683_100969589
1306 Ga0070683_101124831
1307 Ga0070683_101747337
1308 Ga0070683_101811745
1309 Ga0070690_100193406
1310 Ga0070670_100088299
1311 Ga0070670_100923993
1312 Ga0070677_10030834
1313 Ga0068869_100137882
1314 Ga0068869_100277018
1315 Ga0070666_10060982
1316 Ga0070666_11502518
1317 Ga0070680_100092789
1318 Ga0070680_100335651
1319 Ga0070680_100997479
1320 Ga0070682_100022697
1321 Ga0070682_100038748
1322 Ga0070682_101319965
1323 Ga0070682_101940647
1324 Ga0068868_100005750
1325 Ga0068868_100048391
1326 Ga0068868_100100866
1327 Ga0070660_100840550
1328 Ga0070687_100055582
1329 Ga0070661_100002837
1330 Ga0070661_100063531
1331 Ga0070692_10040065
1332 Ga0070692_10328616
1333 Ga0070668_100014673
1334 Ga0070668_100544140
1335 Ga0070668_100568207
1336 Ga0070668_101101810
1337 Ga0070669_100032308
1338 Ga0070669_100593025
1339 Ga0070675_100008970
1340 Ga0070675_100116574
1341 Ga0070671_100009707
1342 Ga0070671_100059001
1343 Ga0070674_100016409
1344 Ga0070674_100112789
1345 Ga0070673_100038671
1346 Ga0070673_100106514
1347 Ga0070688_100457717
1348 Ga0070659_100003049
1349 Ga0070659_100138579
1350 Ga0070659_101135028
1351 Ga0070667_100002382
1352 Ga0070667_101023389
1353 Ga0070667_102240508
1354 Ga0070709_10004981
1355 Ga0070709_10488370
1356 Ga0070714_100003983
1357 Ga0070714_100342641
1358 Ga0070714_100467228
1359 Ga0070714_101186435
1360 Ga0070714_101283910
1361 Ga0070714_101286937
1362 Ga0070714_101324811
1363 Ga0070714_101404150
1364 Ga0070713_100011881
1365 Ga0070713_100017433
1366 Ga0070713_100048887
1367 Ga0070713_100353447
1368 Ga0070710_11311151
1369 Ga0070701_10239923
1370 Ga0070711_100094253
1371 Ga0070711_100393065
1372 Ga0070705_100062276
1373 Ga0070705_100144281
1374 Ga0070705_100241026
1375 Ga0070700_100000496
1376 Ga0070700_101016083
1377 Ga0070700_101048998
1378 Ga0070694_101037677
1379 Ga0070708_100005249
1380 Ga0070708_100096059
1381 Ga0070708_100247871
1382 Ga0070708_100264011
1383 Ga0070708_100308219
1384 Ga0070708_102151090
1385 Ga0070663_100983908
1386 Ga0070663_101150253
1387 Ga0070678_100975708
1388 Ga0070662_100006929
1389 Ga0070662_100748197
1390 Ga0070681_10043185
1391 Ga0070681_10105264
1392 Ga0070681_10506869
1393 Ga0068867_100032224
1394 Ga0070685_10580833
1395 Ga0070706_100010863
1396 Ga0070706_100020839
1397 Ga0070706_100111106
1398 Ga0070706_100123859
1399 Ga0070706_100254659
1400 Ga0070706_100395776
1401 Ga0070706_100431228
1402 Ga0070706_100510977
1403 Ga0070706_100923094
1404 Ga0070706_101289851
1405 Ga0070707_100026702
1406 Ga0070707_100036027
1407 Ga0070707_100053090
1408 Ga0070707_100597833
1409 Ga0070707_100648085
1410 Ga0070707_100752743
1411 Ga0070698_100010804
1412 Ga0070698_100026804
1413 Ga0070698_100636328
1414 Ga0070698_101187327
1415 Ga0070698_101953425
1416 Ga0070699_100142129
1417 Ga0070699_100279351
1418 Ga0070699_100852791
1419 Ga0070679_100020333
1420 Ga0070679_100268044
1421 Ga0070679_100473434
1422 Ga0070679_101455580
1423 Ga0070679_101722982
1424 Ga0070684_100034430
1425 Ga0070684_100098733
1426 Ga0070684_100240053
1427 Ga0070684_100750930
1428 Ga0070684_100784902
1429 Ga0070684_101139896
1430 Ga0070684_101552384
1431 Ga0070684_101642613
1432 Ga0070684_101647483
1433 Ga0070684_101831130
1434 Ga0070697_100076709
1435 Ga0070697_100309081
1436 Ga0070697_100343878
1437 Ga0068853_101645086
1438 Ga0070672_100003015
1439 Ga0070672_100023529
1440 Ga0070672_101403547
1441 Ga0070686_101842284
1442 Ga0070695_100002318
1443 Ga0070696_100013997
1444 Ga0070696_101562685
1445 Ga0070693_101476577
1446 Ga0070665_100343871
1447 Ga0070665_100396861
1448 Ga0070665_100999683
1449 Ga0070665_101652289
1450 Ga0070665_101749318
1451 Ga0070704_100069626
1452 Ga0070704_100130951
1453 Ga0068855_100400976
1454 Ga0070664_100010679
1455 Ga0070664_100405112
1456 Ga0070664_100945411
1457 Ga0068857_100085936
1458 Ga0068857_100425411
1459 Ga0068857_101468536
1460 Ga0068857_101582244
1461 Ga0068854_100554433
1462 Ga0068854_100557693
1463 Ga0068854_101360254
1464 Ga0068856_100006013
1465 Ga0068856_100575722
1466 Ga0068856_100736820
1467 Ga0068856_100845803
1468 Ga0068856_101045040
1469 Ga0068856_102544859
1470 Ga0070702_100008637
1471 Ga0070702_100875171
1472 Ga0068852_100283388
1473 Ga0068852_100464557
1474 Ga0068852_100673797
1475 Ga0068859_102043802
1476 Ga0068859_102087715
1477 Ga0068864_100019997
1478 Ga0068864_100156166
1479 Ga0068864_101198524
1480 Ga0068861_100012401
1481 Ga0068851_10053954
1482 Ga0068870_10002986
1483 Ga0068870_10298767
1484 Ga0068863_100003819
1485 Ga0068863_100343770
1486 Ga0068858_101070606
1487 Ga0068860_102061356
1488 Ga0068862_101061002
1489 Ga0068862_102392078
1490 Ga0081455_10000011
1491 Ga0081455_10000146
1492 Ga0081455_10060369
1493 Ga0081455_10207048
1494 Ga0081455_10592939
1495 Ga0081455_10886914
1496 Ga0081538_10113978
1497 Ga0081540_1005748
1498 Ga0081540_1012491
1499 Ga0081540_1184034
1500 Ga0081539_10000680
1501 Ga0081539_10008252
1502 Ga0081539_10012205
1503 Ga0081539_10110850
1504 Ga0070717_10516064
1505 Ga0075365_10022436
1506 Ga0075365_10135314
1507 Ga0075365_10457265
1508 Ga0075365_10883836
1509 Ga0075368_10198448
1510 Ga0075363_100225157
1511 Ga0075363_100239534
1512 Ga0075363_100322303
1513 Ga0075363_100374463
1514 Ga0075363_100799460
1515 Ga0075364_10001970
1516 Ga0075364_10046982
1517 Ga0075364_10079296
1518 Ga0075364_10291890
1519 Ga0075364_10519831
1520 Ga0075364_10744395
1521 Ga0070712_100099237
1522 Ga0070712_100123350
1523 Ga0070712_100172158
1524 Ga0075362_10051899
1525 Ga0075367_10231875
1526 Ga0075367_10351188
1527 Ga0075367_11134290
1528 Ga0075369_10002158
1529 Ga0075369_10029977
1530 Ga0075369_10047735
1531 Ga0075369_10108859
1532 Ga0075369_10381764
1533 Ga0075370_10060732
1534 Ga0075370_10308899
1535 Ga0075428_100005376
1536 Ga0075428_100101616
1537 Ga0075428_100132135
1538 Ga0075428_100148020
1539 Ga0075428_100305488
1540 Ga0075428_102101881
1541 Ga0075428_102128485
1542 Ga0075430_100020264
1543 Ga0075430_100039113
1544 Ga0075430_100056359
1545 Ga0075430_100466811
1546 Ga0075430_100666913
1547 Ga0075430_101182232
1548 Ga0075430_101514131
1549 Ga0075431_100024151
1550 Ga0075431_100058242
1551 Ga0075431_100325399
1552 Ga0075431_100397141
1553 Ga0075433_10001247
1554 Ga0075433_11702713
1555 Ga0075434_100012123
1556 Ga0075429_100008749
1557 Ga0075429_100030849
1558 Ga0075429_100157500
1559 Ga0075429_101651734
1560 Ga0068865_100017855
1561 Ga0068865_100453135
1562 Ga0068865_101762633
1563 Ga0075436_100007862
1564 Ga0075436_100458466
1565 Ga0097620_102043915
1566 Ga0097620_102087836
1567 Ga0075435_100007473
1568 Ga0105250_10554690
1569 Ga0105240_12307560
1570 Ga0111539_10002357
1571 Ga0111539_10224514
1572 Ga0111539_10315643
1573 Ga0111539_10722001
1574 Ga0111539_10902671
1575 Ga0105245_10017895
1576 Ga0105245_10033741
1577 Ga0105245_10192653
1578 Ga0105245_10599460
1579 Ga0105245_10981512
1580 Ga0105247_10956556
1581 Ga0114129_10029661
1582 Ga0114129_10046672
1583 Ga0114129_10414997
1584 Ga0114129_10530242
1585 Ga0114129_10550483
1586 Ga0114129_10965093
1587 Ga0114129_11349640
1588 Ga0114129_12836769
1589 Ga0114129_13046711
1590 Ga0105243_10004734
1591 Ga0105243_11683948
1592 Ga0105241_10521708
1593 Ga0105241_11984814
1594 Ga0105242_10360774
1595 Ga0105242_10493056
1596 Ga0105242_12610326
1597 Ga0105248_10002978
1598 Ga0105248_10519552
1599 Ga0105237_10380647
1600 Ga0105237_10478802
1601 Ga0105238_10379370
1602 Ga0105238_10529754
1603 Ga0105238_11006104
1604 Ga0105249_10015360
1605 Ga0105249_10824157
1606 Ga0105035_118861
1607 Ga0105239_10180706
1608 Ga0105239_10448944
1609 Ga0105239_10647011
1610 Ga0105239_10681292
1611 Ga0105239_11577761
1612 Ga0105246_10753942
1613 Ga0157371_10222559
1614 Ga0157369_10217259
1615 Ga0157369_10236958
1616 Ga0157369_10616586
1617 Ga0157369_10973712
1618 Ga0157369_11896490
1619 Ga0157369_12131692
1620 Ga0157374_10674288
1621 Ga0157374_10688828
1622 Ga0157374_10730838
1623 Ga0157378_10052428
1624 Ga0157378_11781487
1625 Ga0163162_10572328
1626 Ga0163162_11978618
1627 Ga0157372_10311882
1628 Ga0157372_12500509
1629 Ga0157375_10026663
1630 Ga0157375_10546546
1631 Ga0157375_10713901
1632 Ga0163163_10251580
1633 Ga0163163_10522777
1634 Ga0163163_10595621
1635 Ga0163163_11045321
1636 Ga0163163_11144669
1637 Ga0163163_11443746
1638 Ga0163163_12183434
1639 Ga0163163_12707929
1640 Ga0157380_10036095
1641 Ga0157380_11505212
1642 Ga0157380_12720055
1643 Ga0157380_13337032
1644 Ga0182008_10392954
1645 Ga0182008_10459175
1646 Ga0157377_11500419
1647 Ga0157379_10031926
1648 Ga0157379_10625741
1649 Ga0157379_11677156
1650 Ga0157376_10182380
1651 Ga0157376_11584268
1652 Ga0157376_12053295
1653 Ga0157376_13092230
1654 Ga0163161_10467329
1655 Ga0163161_11007107
1656 Ga0163161_11202371
1657 Ga0163161_11775857
1658 Ga0197907_10146932
1659 Ga0197907_11131751
1660 Ga0206356_10738473
1661 Ga0206349_1135760
1662 Ga0206355_1430210
1663 Ga0206351_10859302
1664 Ga0206352_10875590
1665 Ga0206350_10076879
1666 Ga0206354_10429281
1667 Ga0206354_10768390
1668 Ga0206354_11604246
1669 Ga0206353_10238432
1670 Ga0206353_10596355
1671 Ga0213874_10036632
1672 Ga0213874_10046654
1673 Ga0213876_10009652
1674 Ga0213876_10018841
1675 Ga0213876_10641434
1676 Ga0213875_10000073
1677 Ga0213875_10045780
1678 Ga0224712_10094121
1679 Ga0224572_1063462
1680 Ga0209051_1022107
1681 Ga0209051_1060753
1682 Ga0207682_10051233
1683 Ga0207692_10844259
1684 Ga0207642_10214254
1685 Ga0207642_10233058
1686 Ga0207688_10025811
1687 Ga0207680_10104393
1688 Ga0207680_10280405
1689 Ga0207680_10603768
1690 Ga0207647_10073923
1691 Ga0207647_10509330
1692 Ga0207645_11026122
1693 Ga0207643_10001705
1694 Ga0207643_10131982
1695 Ga0207705_10074685
1696 Ga0207705_10155879
1697 Ga0207705_10195407
1698 Ga0207705_11177134
1699 Ga0207684_10007698
1700 Ga0207684_10121331
1701 Ga0207684_10168881
1702 Ga0207684_10197399
1703 Ga0207684_10306887
1704 Ga0207684_10315895
1705 Ga0207684_10479521
1706 Ga0207684_10518360
1707 Ga0207684_11039932
1708 Ga0207684_11246656
1709 Ga0207707_10014387
1710 Ga0207707_10076608
1711 Ga0207707_10440818
1712 Ga0207693_10093591
1713 Ga0207693_10235745
1714 Ga0207663_10022011
1715 Ga0207663_10430123
1716 Ga0207663_10452826
1717 Ga0207660_10042355
1718 Ga0207662_10054240
1719 Ga0207657_10084430
1720 Ga0207649_10019634
1721 Ga0207649_10064996
1722 Ga0207652_10056899
1723 Ga0207652_10219506
1724 Ga0207652_10220028
1725 Ga0207652_10747316
1726 Ga0207652_10874837
1727 Ga0207652_11710239
1728 Ga0207646_10194944
1729 Ga0207646_10199317
1730 Ga0207646_10205026
1731 Ga0207646_10208990
1732 Ga0207646_10265832
1733 Ga0207681_10538998
1734 Ga0207694_10236073
1735 Ga0207694_11597694
1736 Ga0207650_10032101
1737 Ga0207650_11133731
1738 Ga0207659_10003563
1739 Ga0207659_10201165
1740 Ga0207687_10012641
1741 Ga0207687_10098228
1742 Ga0207687_10230900
1743 Ga0207687_10310594
1744 Ga0207687_10562014
1745 Ga0207687_11232516
1746 Ga0207700_10004768
1747 Ga0207700_10016883
1748 Ga0207700_10044626
1749 Ga0207700_10465789
1750 Ga0207700_11706065
1751 Ga0207664_10016747
1752 Ga0207664_10042520
1753 Ga0207664_10062808
1754 Ga0207664_10271596
1755 Ga0207664_10407736
1756 Ga0207664_11295428
1757 Ga0207644_10047477
1758 Ga0207644_10209092
1759 Ga0207690_10000157
1760 Ga0207690_11759524
1761 Ga0207690_11823740
1762 Ga0207706_10003191
1763 Ga0207706_11052251
1764 Ga0207686_10010391
1765 Ga0207686_10119645
1766 Ga0207686_10261264
1767 Ga0207709_10012216
1768 Ga0207670_10117933
1769 Ga0207670_11494449
1770 Ga0207669_10055082
1771 Ga0207669_10404449
1772 Ga0207704_10249612
1773 Ga0207665_10479130
1774 Ga0207665_11195206
1775 Ga0207691_10001940
1776 Ga0207691_10007065
1777 Ga0207691_10846018
1778 Ga0207691_11571290
1779 Ga0207711_10003778
1780 Ga0207711_10045400
1781 Ga0207711_11576202
1782 Ga0207689_10150275
1783 Ga0207661_10001620
1784 Ga0207661_10145504
1785 Ga0207661_10579811
1786 Ga0207679_10124492
1787 Ga0207679_11385578
1788 Ga0207667_10245366
1789 Ga0207667_11786390
1790 Ga0207651_10011023
1791 Ga0207712_10068908
1792 Ga0207668_10036956
1793 Ga0207668_10441199
1794 Ga0207668_10442547
1795 Ga0207668_10701443
1796 Ga0207668_12032070
1797 Ga0207640_10427601
1798 Ga0207640_11276319
1799 Ga0207658_10025871
1800 Ga0207658_10048109
1801 Ga0207677_10012793
1802 Ga0207677_10235345
1803 Ga0207677_10246468
1804 Ga0207703_10008492
1805 Ga0207703_11935869
1806 Ga0207639_10085927
1807 Ga0207678_10506323
1808 Ga0207678_11004621
1809 Ga0207708_10845520
1810 Ga0207702_10005382
1811 Ga0207702_10678870
1812 Ga0207702_11930168
1813 Ga0207702_12228601
1814 Ga0207641_10001754
1815 Ga0207648_10002197
1816 Ga0207648_11444177
1817 Ga0207648_11668048
1818 Ga0207676_10938684
1819 Ga0207674_10029816
1820 Ga0207674_10050383
1821 Ga0207674_11964347
1822 Ga0207675_100001152
1823 Ga0207675_101982188
1824 Ga0207683_10460357
1825 Ga0207683_10749163
1826 Ga0207698_10379534
1827 Ga0207698_10445369
1828 Ga0207698_10640965
1829 Ga0207698_10934363
1830 Ga0207698_11146580
1831 Ga0209998_10024421
1832 Ga0209813_10302357
1833 Ga0207428_10010302
1834 Ga0207428_10078479
1835 Ga0207428_10162625
1836 Ga0207428_10258173
1837 Ga0268266_10263390
1838 Ga0268266_10277584
1839 Ga0268266_10349932
1840 Ga0268266_12295889
1841 Ga0268265_10128980
1842 Ga0268265_11889270
1843 Ga0268264_10697552
1844 Ga0268264_10947087
1845 Ga0265326_10027348
1846 Ga0265326_10094489
1847 Ga0265319_1162847
1848 Ga0265336_10006446
1849 Ga0265336_10192348
1850 Ga0307515_10607596
1851 Ga0265338_10009713
1852 Ga0265338_10034430
1853 Ga0265338_10501904
1854 Ga0265338_10521919
1855 Ga0307511_10062279
1856 Ga0307511_10096193
1857 Ga0316177_1207210
1858 Ga0316176_1186483
1859 Ga0316179_1088487
1860 Ga0316178_1070530
1861 Ga0316180_1064925
1862 Ga0316180_1121429
1863 Ga0316182_1127369
1864 Ga0265766_1020627
1865 Ga0265330_10223224
1866 Ga0265320_10140667
1867 Ga0265325_10019205
1868 Ga0265329_10212143
1869 Ga0265340_10001402
1870 Ga0265339_10091701
1871 Ga0265327_10000134
1872 Ga0265327_10001291
1873 Ga0265327_10036187
1874 Ga0265327_10344898
1875 Ga0265327_10479132
1876 Ga0307513_10007005
1877 Ga0307513_10024102
1878 Ga0307509_10199798
1879 Ga0265313_10012099
1880 Ga0310107_108231
1881 Ga0307508_10017109
1882 Ga0307514_10374863
1883 Ga0316575_10000833
1884 Ga0316579_10004180
1885 Ga0265314_10047326
1886 Ga0265314_10068252
1887 Ga0316576_10000924
1888 Ga0316576_10001581
1889 Ga0316576_10002702
1890 Ga0316578_10000378
1891 Ga0316578_10019860
1892 Ga0316578_10020313
1893 Ga0316578_10174439
1894 Ga0316577_10139428
1895 Ga0316577_10236000
1896 Ga0316577_10390646
1897 Ga0316045_127936
1898 Ga0307413_10077997
1899 Ga0307413_10574101
1900 Ga0316043_124307
1901 Ga0307518_10000495
1902 Ga0307410_10016672
1903 Ga0307410_12087229
1904 Ga0307407_10002033
1905 Ga0307409_100001791
1906 Ga0307409_100051098
1907 Ga0307409_101125357
1908 Ga0307409_101142625
1909 Ga0307416_100052932
1910 Ga0307416_100512522
1911 Ga0307416_102027330
1912 Ga0307414_10085339
1913 Ga0307415_100009069
1914 Ga0307415_100019420
1915 Ga0307415_100063419
1916 Ga0307415_100949789
1917 Ga0307415_101507838
1918 Ga0316583_10012637
1919 Ga0316585_10018701
1920 Ga0316580_10253060
1921 Ga0307507_10000001
1922 Ga0307507_10012252
1923 Ga0307507_10044503
1924 Ga0307510_10148106
1925 Ga0307510_10327193
1926 Ga0316588_1118344
1927 Ga0316596_1016657
1928 Ga0316596_1060649
1929 Ga0373930_0132872
1930 Ga0373950_0010883
1931 Ga0373958_0049757
1932 Ga0373959_0176490
1933 Ga0373926_0253025
1934 Ga0373940_0045253
1935 Ga0373940_0126257
1936 Ga0373944_0355567
1937 Ga0373951_0000004
1938 Ga0373951_0197155
1939 Ga0373936_0223761
1940 Ga0373939_0076060
1941 Ga0373945_0027344
1942 Ga0373945_0490341
1943 Ga0373954_0368528
1944 Ga0373960_0266727
1945 Ga0373943_0034594
1946 Ga0373943_0041257
1947 Ga0373943_0151836
1948 Ga0373943_0206913
1949 Ga0373943_0408884
1950 Ga0373946_0128159
1951 Ga0373942_0001416
1952 Ga0373962_0021659
1953 Ga0316574_0004904
1954 Ga0316574_0009181
1955 Ga0316574_0055013
1956 Ga0316574_0154897
1957 Ga0373931_0000708
1958 Ga0373931_0085006
1959 Ga0373931_0122100
1960 Ga0373935_0193872
1961 Ga0373935_0932899
1962 Ga0373927_0001612
1963 Ga0373927_0439545
1964 Ga0373927_0876185
1965 Ga0373933_0515289
1966 Ga0373947_0001991
1967 Ga0373947_0029591
1968 Ga0310112_039424
1969 Ga0316582_0049283
1970 Ga0316582_0326338
1971 Ga0316582_1226179
1972 Ga0316584_0003193
1973 Ga0316584_0030695
1974 Ga0316584_0114290
1975 Ga0316584_0197305
1976 Ga0316584_0613837
1977 Ga0373925_0012483
1978 Ga0373925_0018669
1979 Ga0395899_0044073
1980 Ga0395900_0169902
1981 Ga0395900_0498233
1982 Ga0395898_0017644
1983 Ga0395898_0722459
1984 Ga0395898_1547428
1985 Ga0395905_0487987
1986 Ga0316581_0285264
1987 Ga0436364_0290389
1988 Ga0436364_0296264
1989 Ga0436364_0565800
1990 Ga0436364_0768457
1991 Ga0436364_1321893
1992 Ga0436364_1429963
1993 Ga0436364_1492983
1994 Ga0436364_1521400
1995 Ga0395901_0101187
1996 Ga0395901_0107170
1997 Ga0400485_18564
1998 Ga0436365_0003307
1999 Ga0436365_0449497
2000 Ga0436365_0462769
2001 Ga0436365_1217858
2002 Ga0436365_1253726
2003 Ga0436365_1524289
2004 Ga0436360_0109533
2005 Ga0436360_0684506
2006 Ga0436360_1032373
2007 Ga0436363_0085556
2008 Ga0436363_0099586
2009 Ga0436363_0569828
2010 Ga0436363_1175061
2011 Ga0436363_1304752
2012 Ga0436363_1327049
2013 Ga0436363_1427735
2014 Ga0436362_0197429
2015 Ga0436362_0947276
2016 Ga0439436_0119779
2017 Ga0439447_133552
2018 Ga0439465_0017188
2019 Ga0439465_0096795
2020 Ga0451787_254251
2021 Ga0451789_0759111
2022 Ga0451794_23908
2023 Ga0451791_0237211
2024 Ga0451791_0634074
2025 Ga0451793_1849706
2026 Ga0451797_0351315
2027 Ga0451797_0543649
2028 Ga0451797_0712560
2029 Ga0451797_0713983
2030 Ga0451798_0088207
2031 Ga0451800_0058067
2032 Ga0451800_1614935
2033 Ga0451807_2763054
2034 Ga0451835_0289975
2035 Ga0451835_0659062
2036 Ga0451837_1396023
2037 Ga0451839_0406728
2038 Ga0451839_0556732
2039 Ga0451839_0791953
2040 Ga0451845_0064425
2041 Ga0451843_0892349
2042 Ga0451843_0903008
2043 Ga0451853_0228029
2044 Ga0451853_0661484
2045 Ga0451853_0851186
2046 Ga0451853_1040312
2047 Ga0451853_3439965
2048 Ga0439462_0071088
2049 Ga0439446_0036812
2050 Ga0450909_087655
2051 Ga0439434_0126880
2052 Ga0466969_0015431
2053 Ga0466969_0024429
2054 Ga0466969_0026927
2055 Ga0466969_0242959
2056 Ga0466969_0251140
2057 Ga0466969_0460786
2058 Ga0466972_0002336
2059 Ga0466972_0010323
2060 Ga0466972_0042792
2061 Ga0466972_0118158
2062 Ga0466972_0198748
2063 Ga0466965_0000846
2064 Ga0466965_0010879
2065 Ga0466965_0024738
2066 Ga0466965_0036823
2067 Ga0466965_0164050
2068 Ga0466966_0001132
2069 Ga0466966_0008129
2070 Ga0466966_0018725
2071 Ga0466966_0142541
2072 Ga0466966_0213262
2073 Ga0466961_0046824
2074 Ga0466961_0072562
2075 Ga0466961_0352819
2076 Ga0466961_0466497
2077 Ga0466961_0532275
2078 Ga0466963_0000174
2079 Ga0466963_0243947
2080 Ga0466963_0816621
2081 Ga0466964_0156931
2082 Ga0466964_0221856
2083 Ga0466964_0293273
2084 Ga0466964_0344677
2085 Ga0466971_0011918
2086 Ga0466971_0180758
2087 Ga0466971_0187931
2088 Ga0466971_0208209
2089 Ga0466971_0300662
2090 Ga0466971_0538213
2091 Ga0466968_0000527
2092 Ga0466968_0063776
2093 Ga0466968_0092801
2094 Ga0466968_0099217
2095 Ga0466968_0147905
2096 Ga0466968_0347022
2097 Ga0466970_0010331
2098 Ga0466970_0016476
2099 Ga0466970_0019534
2100 Ga0466970_0041431
2101 Ga0466970_0204576
2102 Ga0466970_0734851
2103 Ga0466957_0008885
2104 Ga0466957_0023018
2105 Ga0466957_0161967
2106 Ga0466957_0381679
2107 Ga0466957_0443625
2108 Ga0466960_0000116
2109 Ga0466960_0002137
2110 Ga0466960_0273133
2111 Ga0466960_0299091
2112 Ga0466960_0336351
2113 Ga0466959_0003504
2114 Ga0466959_0027386
2115 Ga0466959_0051985
2116 Ga0466959_0369371
2117 Ga0466959_0934322
2118 Ga0466958_0000322
2119 Ga0466958_0002942
2120 Ga0466958_0023911
2121 Ga0466958_0097020
2122 Ga0466958_0242394
2123 Ga0466958_0912675
2124 Ga0466967_0008845
2125 Ga0466967_0090607
2126 Ga0466967_0099719
2127 Ga0466967_0113895
2128 Ga0466967_0123042
2129 Ga0466967_0289247
2130 Ga0466967_0580652
2131 Ga0466967_0651543
2132 Ga0466967_0858070
2133 Ga0466967_1914486
2134 Ga0466967_2478163
2135 Ga0495592_0346114
2136 Ga0495592_0376669
2137 Ga0495592_0473122
2138 Ga0495592_0787020
2139 Ga0495603_0076600
2140 Ga0495629_0001838
2141 Ga0495629_0141521
2142 Ga0495629_1091064
2143 Ga0495638_0006715
2144 Ga0495651_0779054
2145 Ga0495651_0981367
2146 Ga0495653_0647968
2147 Ga0495650_0018822
2148 Ga0495582_0001304
2149 Ga0495582_0056891
2150 Ga0495582_0362623
2151 Ga0495639_0005528
2152 Ga0495639_0701418
2153 Ga0495662_0104829
2154 Ga0495662_0172347
2155 Ga0495594_0793832
2156 Ga0495583_0314171
2157 Ga0495608_0038811
2158 Ga0495608_0550015
2159 Ga0495608_0815748
2160 Ga0495618_0015734
2161 Ga0495618_0038022
2162 Ga0495618_0102733
2163 Ga0495618_0314568
2164 Ga0495628_0079638
2165 Ga0495628_0321668
2166 Ga0495630_0091160
2167 Ga0495630_0096646
2168 Ga0495630_0120107
2169 Ga0495630_0217144
2170 Ga0495630_0716575
2171 Ga0495666_0050318
2172 Ga0495642_0271245
2173 Ga0495652_0125261
2174 Ga0495665_0042811
2175 Ga0495665_0194589
2176 Ga0495640_0039098
2177 Ga0495640_0254665
2178 Ga0495640_0435772
2179 Ga0495586_0183392
2180 Ga0495586_0231452
2181 Ga0495587_0194466
2182 Ga0495587_0422261
2183 Ga0495587_0668710
2184 Ga0495621_0019060
2185 Ga0495645_0315030
2186 Ga0495667_0258363
2187 Ga0495668_0282129
2188 Ga0495634_0010302
2189 Ga0495635_0354004
2190 Ga0495635_0445034
2191 Ga0495659_0091905
2192 Ga0495659_0198722
2193 Ga0495661_0560434
2194 Ga0495657_0134477
2195 Ga0495657_0271256
2196 Ga0495657_0428954
2197 Ga0495646_0588312
2198 Ga0495647_0027634
2199 Ga0495658_0000768
2200 Ga0495658_0137927
2201 Ga0495658_0341428
2202 Ga0495613_0002016
2203 Ga0495613_0003428
2204 Ga0495613_0237959
2205 Ga0495613_0318066
2206 Ga0495624_0218937
2207 Ga0495589_0430283
2208 Ga0495581_0031890
2209 Ga0495604_0234770
2210 Ga0495604_0289817
2211 Ga0495604_0519320
2212 Ga0495674_0897481
2213 Ga0495674_0982650
2214 Ga0495676_0243792
2215 Ga0495680_0041638
2216 Ga0495680_0293959
2217 Ga0495680_0363713
2218 Ga0495684_0352604
2219 Ga0495684_0424595
2220 Ga0495684_0646642
2221 Ga0495684_0856590
2222 Ga0496100_0039461
2223 Ga0496100_0370788
2224 Ga0496100_0529349
2225 Ga0496101_0010834
2226 Ga0496101_0383109
2227 Ga0496101_0626458
2228 Ga0496101_1296569
2229 Ga0496102_0000042
2230 Ga0496102_0032418
2231 Ga0496102_0910601
2232 Ga0496102_1834448
2233 Ga0496103_0000441
2234 Ga0496103_0540423
2235 Ga0496104_0043998
2236 Ga0496104_0095666
2237 Ga0496104_0307004
2238 Ga0496105_0032456
2239 Ga0496105_0074710
2240 Ga0496105_0232888
2241 Ga0496106_0593638
2242 Ga0496106_1156452
2243 Ga0496107_0402990
2244 Ga0496107_0418534
2245 Ga0496108_0096033
2246 Ga0496108_0108578
2247 Ga0496109_0014217
2248 Ga0496109_0055655
2249 Ga0496109_0164002
2250 Ga0496109_0316088
2251 Ga0496109_0519440
2252 Ga0496109_0694656
2253 Ga0496109_2021775
2254 Ga0496110_0001134
2255 Ga0496110_0114379
2256 Ga0496110_0759497
2257 Ga0496110_0809841
2258 Ga0496110_0862406
2259 Ga0496110_1061719
2260 Ga0496111_0004889
2261 Ga0496111_0116350
2262 Ga0496111_0221314
2263 Ga0496112_0360731
2264 Ga0496112_0430486
2265 Ga0496112_0512479
2266 Ga0496113_0609708
2267 Ga0496113_0631226
2268 Ga0496113_0699773
2269 Ga0496114_0020577
2270 Ga0496114_0026409
2271 Ga0496114_0249952
2272 Ga0496114_0250078
2273 Ga0496114_0422616
2274 Ga0496114_0621637
2275 Ga0496115_0001342
2276 Ga0496115_0427445
2277 Ga0496115_0533782
2278 Ga0496115_0684151
2279 Ga0496116_0000945
2280 Ga0496117_0000339
2281 Ga0496118_0000241
2282 Ga0496119_0000974
2283 Ga0496119_0005030
2284 Ga0496121_0015684
2285 Ga0496122_0203487
2286 Ga0496124_0011730
2287 Ga0496124_0774809
2288 Ga0496124_0888484
2289 Ga0496125_0065774
2290 Ga0496125_0081564
2291 Ga0496125_0269517
2292 Ga0496126_0000048
2293 Ga0496126_0001023
2294 Ga0496126_0014903
2295 Ga0496126_0258942
2296 Ga0501031_0148729
2297 Ga0501031_0221855
2298 Ga0501032_0021055
2299 Ga0501032_0028980
2300 Ga0501032_0769258
2301 Ga0501033_0019417
2302 Ga0501033_0097637
2303 Ga0501033_0171727
2304 Ga0501033_0205131
2305 Ga0501033_0217938
2306 Ga0501033_0739794
2307 Ga0501034_0054766
2308 Ga0501036_0059238
2309 Ga0501036_0074935
2310 Ga0501036_0114848
2311 Ga0501036_0261029
2312 Ga0501037_0126700
2313 Ga0501037_0293618
2314 Ga0501037_0348555
2315 Ga0501038_0065354
2316 Ga0501038_0245596
2317 Ga0501038_0381482
2318 Ga0501038_0890690
2319 Ga0501039_0105439
2320 Ga0501040_0045950
2321 Ga0501041_0037890
2322 Ga0501041_0325914
2323 Ga0501041_0656819
2324 Ga0501041_0675703
2325 Ga0501042_0419113
2326 Ga0501042_0568807
2327 Ga0501043_0125103
2328 Ga0501043_0162604
2329 Ga0501046_0045701
2330 Ga0501046_0344406
2331 Ga0501046_0814615
2332 Ga0501047_0003711
2333 Ga0501047_0004314
2334 Ga0501047_0195962
2335 Ga0501047_0638941
2336 Ga0501048_0092335
2337 Ga0501048_0168535
2338 Ga0501067_0032242
2339 Ga0501067_0249101
2340 Ga0501068_0013339
2341 Ga0501068_0023389
2342 Ga0501068_0624585
2343 Ga0501069_0016892
2344 Ga0501069_0113838
2345 Ga0501069_0644075
2346 Ga0501070_0157431
2347 Ga0501070_0305514
2348 Ga0501071_0018841
2349 Ga0501071_0097881
2350 Ga0501071_0317829
2351 Ga0501071_1051222
2352 Ga0501071_1095691
2353 Ga0501072_0060638
2354 Ga0501072_0260015
2355 Ga0501072_0348966
2356 Ga0501072_0525669
2357 Ga0501072_1544388
2358 Ga0501072_1578694
2359 Ga0501073_0024330
2360 Ga0501073_0303073
2361 Ga0501073_0748604
2362 Ga0501074_0029881
2363 Ga0501074_0049524
2364 Ga0501074_0249189
2365 Ga0501075_0095056
2366 Ga0501075_0100288
2367 Ga0501075_0159627
2368 Ga0501075_0231282
2369 Ga0501076_0146917
2370 Ga0501076_1276291
2371 Ga0501076_1371378
2372 Ga0501076_1422952
2373 Ga0501076_1787528
2374 Ga0501077_0238703
2375 Ga0501079_0027399
2376 Ga0501079_0111396
2377 Ga0501079_0479934
2378 Ga0501079_0696520
2379 Ga0501079_1168956
2380 Ga0501079_1420197
2381 Ga0501080_0068596
2382 Ga0501080_0198111
2383 Ga0501080_1034684
2384 Ga0501081_0021156
2385 Ga0501081_1489333
2386 Ga0501083_0009415
2387 Ga0501083_0041629
2388 Ga0501083_0145642
2389 Ga0501035_0000344
2390 Ga0501035_1008386
2391 Ga0501044_0000789
2392 Ga0501044_0076018
2393 Ga0501044_0472153
2394 Ga0501044_1040950
2395 Ga0501044_1086291
2396 Ga0501045_0016156
2397 Ga0501045_0024119
2398 nmdc:mga03683_46440_c1
2399 nmdc:mga03n38_445026_c1
2400 nmdc:mga03n38_78883_c1
2401 nmdc:mga03n38_981545_c1
2402 nmdc:mga00v17_22968_c1
2403 nmdc:mga00v17_234672_c1
2404 nmdc:mga00v17_344259_c1
2405 nmdc:mga00v17_48954_c1
2406 nmdc:mga00v17_499671_c1
2407 nmdc:mga0yw44_1192224_c1
2408 nmdc:mga0yw44_1216824_c1
2409 nmdc:mga0yw44_17771_c1
2410 nmdc:mga0yw44_456736_c1
2411 nmdc:mga0yw44_629209_c1
2412 nmdc:mga0yw44_75634_c1
2413 nmdc:mga0yw44_8942_c1
2414 nmdc:mga0yw44_931202_c1
2415 nmdc:mga06z11_198439_c1
2416 nmdc:mga06z11_28989_c1
2417 nmdc:mga07m45_226378_c1
2418 nmdc:mga07m45_58458_c1
2419 nmdc:mga05p37_130623_c1
2420 nmdc:mga05p37_1518642_c1
2421 nmdc:mga05p37_1910250_c1
2422 nmdc:mga05p37_2241226_c1
2423 nmdc:mga05p37_2278178_c1
2424 nmdc:mga05p37_235867_c1
2425 nmdc:mga05p37_340652_c1
2426 nmdc:mga05p37_490988_c1
2427 nmdc:mga05p37_498037_c1
2428 nmdc:mga09592_508628_c1
2429 nmdc:mga09592_568420_c1
2430 nmdc:mga09592_678165_c1
2431 nmdc:mga09592_915146_c1
2432 nmdc:mga0qj67_1050245_c1
2433 nmdc:mga0qj67_1443945_c1
2434 nmdc:mga0qj67_152952_c1
2435 nmdc:mga0qj67_304993_c1
2436 nmdc:mga0qj67_33373_c1
2437 nmdc:mga0qj67_4267_c1
2438 nmdc:mga0qj67_899361_c1
2439 nmdc:mga06r32_103139_c1
2440 nmdc:mga06r32_117_c4
2441 nmdc:mga06r32_231251_c1
2442 nmdc:mga06r32_686023_c1
2443 nmdc:mga06r32_725520_c1
2444 nmdc:mga08y16_21097_c1
2445 nmdc:mga08y16_25971_c1
2446 nmdc:mga08y16_336157_c1
2447 nmdc:mga08y16_407831_c1
2448 nmdc:mga08y16_905083_c1
2449 nmdc:mga0n895_928384_c1
2450 nmdc:mga0rr50_1099115_c1
2451 nmdc:mga0rr50_113441_c1
2452 nmdc:mga08x19_17051_c1
2453 nmdc:mga0a205_1207_c1
2454 nmdc:mga0sz30_1847_c1
2455 nmdc:mga0sz30_2249_c1
2456 nmdc:mga0sz30_56369_c1
2457 nmdc:mga0sz30_576174_c1
2458 nmdc:mga0sz30_95838_c1
2459 Ga0495601_0015238
2460 Ga0495601_0276100
2461 Ga0495601_0958461
2462 Ga0500635_0006210
2463 Ga0495595_0006436
2464 Ga0495619_0022565
2465 Ga0495619_0031947
2466 Ga0495619_0054547
2467 Ga0495619_0238864
2468 Ga0495619_0596517
2469 Ga0495619_0624243
2470 Ga0495619_0998847
2471 Ga0500578_0342863
2472 Ga0500643_015055
2473 Ga0500566_0067062
2474 Ga0500650_0369329
2475 Ga0500555_150328
2476 Ga0500557_190273
2477 Ga0500642_0105452
2478 Ga0500652_023340
2479 Ga0500652_027596
2480 Ga0500655_022521
2481 Ga0500658_0328287
2482 Ga0500559_0037276
2483 Ga0500568_0125094
2484 Ga0500622_0001519
2485 Ga0500627_0033786
2486 Ga0500645_000668
2487 Ga0500645_021063
2488 Ga0501084_0006042
2489 Ga0501084_0027890
2490 Ga0501084_0107170
2491 Ga0501084_0492915
2492 Ga0501084_0591747
2493 Ga0590075_214203
2494 Ga0587080_068695
2495 Ga0587082_014570
2496 Ga0587083_0065564
2497 Ga0587086_107206
2498 Ga0587088_004267
2499 Ga0587067_185259
2500 Ga0587067_199682
2501 Ga0587107_064061
2502 Ga0587071_103876
2503 Ga0501082_0150225
2504 Ga0501082_0287765
2505 Ga0501082_0700477
2506 Ga0501082_1121244
2507 Ga0466962_0011220
2508 Ga0466962_0094980
2509 Ga0466962_0348148
2510 Ga0466962_0708448
2511 Ga0466962_0709072
2512 Ga0530510_0311667
2513 Ga0530510_0393618
2514 Ga0530510_0516374
2515 2523385284
2516 2548697871
2517 2566993091
2518 2586059296
2519 2643825374
2520 2643893151
2521 2643961790
2522 2644034122
2523 2644229104
2524 2644531368
2525 2676486393
2526 2738706070
2527 2738889946
2528 2739203266
2529 2739238710
2530 2739333030
2531 2739602534
2532 2744955924
2533 2753035260
2534 2753323777
2535 2809591942
2536 2812333812
2537 2816504661
2538 2817508954
2539 2842891788
2540 2855387606
2541 2857729785
2542 2866616840
2543 2889300983
2544 2891327581
2545 2893686738
2546 2899364124
2547 2899373294
2548 2899374248
2549 2902801632
2550 2904538915
2551 2915774013
2552 2917736543
2553 2917738923
2554 2919715954
2555 2922556787
2556 2928142509
2557 2929214799
2558 2939744502
2559 2956940453
2560 2974317246
2561 2984525451
2562 3001121878
2563 3001890948
2564 8047718024
2565 8054474306
2566 8056211997

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

11

103

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9908 2 112
3t9z-assembly1.cif.gz_B a. fulgidus glnk3, ligand-free 0.9898 1 108
3t9z-assembly2.cif.gz_E a. fulgidus glnk3, ligand-free 0.9889 1 108
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9881 1 112
3t9z-assembly1.cif.gz_A a. fulgidus glnk3, ligand-free 0.9877 1 108
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9665 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.96 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9567 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9494 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9396 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9624 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A2U1T6E6-F1-model_v4 P-II family nitrogen regulator 0.9561 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.953 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F7F2C5-F1-model_v4 Transcriptional regulator 0.9443 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A517TUK5-F1-model_v4 Nitrogen regulatory protein P-II 0.9401 1 107 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map