F492445
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1274 | 753 | 1001 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300002239|JGI24034J26672_10002598|JGI24034J26672_100025981 |
| Length | 107 |
| Sequence | MARSVWKGPFVDGYLLXKAEASRXSGRHEMIRIWSRRSTILPQFVGLTFGVYNGQKHIPVLVTEEMVGHKFGEFAPTRTFYGHSSDRKAKRSSGPATASAGASGGSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 9 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 10 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 11 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 12 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 13 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 14 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 15 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 16 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 17 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 18 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 19 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 20 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 21 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 22 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 23 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 24 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 25 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 26 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 27 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 28 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 29 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 30 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 31 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 32 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 33 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 34 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 35 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 36 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 37 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 38 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 39 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 40 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 41 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 42 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 43 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 44 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 45 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 46 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 47 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 48 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 49 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 50 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 51 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 52 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 53 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 54 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 55 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 56 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 57 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 58 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 59 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 60 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 61 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 62 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 63 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 64 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 65 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 66 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 67 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 68 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 69 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 70 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 71 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 72 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 73 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 74 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 75 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 76 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 77 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 78 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 79 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 80 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 81 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 82 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 83 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 84 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 85 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 86 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 87 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 88 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 89 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 90 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 91 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 92 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 93 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 94 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 95 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 96 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 97 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 98 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 99 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 100 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 101 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 102 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 103 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 104 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 105 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 106 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 107 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 108 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 109 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 110 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 111 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 112 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 113 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 114 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 115 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 116 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 117 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 118 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 119 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 120 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 121 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 122 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 123 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 124 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 125 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 126 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 127 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 128 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 129 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 130 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 131 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 132 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 133 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 134 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 135 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 136 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 137 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 138 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 139 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 140 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 141 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 142 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 143 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 144 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 145 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 146 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 147 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 148 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 149 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 150 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 151 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 152 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 153 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 154 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 155 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 156 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 157 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 158 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 159 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 160 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 161 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 162 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 163 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 164 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 165 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 166 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 167 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 168 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 169 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 170 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 171 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 172 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 173 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 174 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 175 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 176 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 177 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 178 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 179 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 180 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 181 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 182 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 183 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 184 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 185 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 186 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 187 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 188 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 189 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 190 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 191 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 192 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 193 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 194 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 195 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 196 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 197 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 198 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 199 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 200 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 201 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 202 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 203 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 204 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 205 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 206 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 207 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 208 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 209 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 210 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 211 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 212 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 213 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 214 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 215 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 216 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 217 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 218 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 219 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 220 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 221 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 222 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 223 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 224 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 225 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 226 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 227 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 228 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 229 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 230 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 231 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 232 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 233 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 234 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 235 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 236 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 237 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 238 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 239 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 240 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 241 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 242 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 243 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 244 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 245 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 246 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 247 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 248 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 249 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 250 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 251 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 252 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 253 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 254 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 255 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 256 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 257 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 258 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 259 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 260 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 261 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 262 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 263 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 264 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 267 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 268 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 270 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 271 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 273 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 274 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 275 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 277 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 281 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 285 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 288 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 289 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 293 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 294 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 295 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 296 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 297 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 298 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 300 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 301 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 302 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 304 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 305 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 309 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 311 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 312 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 313 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 314 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 315 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 316 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 317 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 318 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 319 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 320 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 321 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 322 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 323 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 324 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 325 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 326 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 328 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 329 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 330 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 331 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 332 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 333 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 335 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 336 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 337 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 338 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 339 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 340 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 341 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 342 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 343 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 344 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 346 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 347 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 352 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 353 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 355 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 356 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 357 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 358 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 361 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 362 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 363 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 364 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 365 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 366 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 367 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 368 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 369 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 370 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 371 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 372 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 373 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 374 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 375 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 376 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 379 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 380 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 381 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 383 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 384 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 385 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 386 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 387 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 388 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 389 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 390 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 391 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 392 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 393 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 394 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 396 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 446 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 448 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 452 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 453 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 454 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 455 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 458 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 459 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 460 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 461 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 462 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 463 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 464 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 465 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 466 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 467 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 468 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 469 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 470 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 471 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 472 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 473 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 474 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 475 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 476 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 480 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 481 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 482 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 483 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 484 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 485 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 486 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 487 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 488 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 489 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 490 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 491 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 492 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 493 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 494 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 495 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 496 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 497 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 498 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 499 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 500 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 501 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 502 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 503 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 504 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 505 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 506 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 507 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 508 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 509 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 510 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 511 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 512 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 513 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 514 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 515 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 516 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 517 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 518 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 519 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 520 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 521 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 522 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 523 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 524 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 525 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 526 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 527 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 528 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 529 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 530 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 531 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 532 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 533 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 534 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 535 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 536 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 537 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 538 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 539 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 540 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 541 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 542 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 543 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 544 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 545 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 546 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 547 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 548 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 549 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 550 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 551 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 552 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 553 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 554 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 555 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 556 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 557 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 607 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 608 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 609 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 610 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 611 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 612 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 613 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 614 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 615 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 616 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 617 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 618 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 619 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 620 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 621 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 622 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 623 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 624 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 625 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 626 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 627 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 628 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 629 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 630 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 631 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 632 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 633 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 634 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 635 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 636 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 638 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 639 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 643 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 644 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 645 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 646 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 647 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 648 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 654 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 655 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 657 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 658 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 659 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 660 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 662 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 663 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 664 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 665 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 666 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 669 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 670 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 671 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 674 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 675 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 676 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 677 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 679 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 680 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 681 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 682 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 683 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 684 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 685 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 686 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 687 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 688 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 689 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 690 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 691 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 695 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 696 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 697 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 698 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 699 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 700 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 701 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 702 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 703 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 704 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 705 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 706 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 707 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 708 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 709 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 710 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 712 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 713 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 714 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 715 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 716 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 717 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 718 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 719 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 720 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 721 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 722 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 723 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 724 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 725 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 726 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 727 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 728 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 729 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 730 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 731 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 732 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 733 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 734 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 735 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 736 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 737 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 738 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 739 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 740 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 741 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 742 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 743 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 744 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 745 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 746 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 747 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 748 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 749 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 750 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 751 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 752 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 753 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.7 |
| Metatranscriptomes | 4.87 |
| Isolates | 21.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.47 |
| Nodule | 17.58 |
| Rhizoplane | 3.69 |
| Rhizosphere | 68.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10002598 | 3300002239 | Bacteria | 2485 |
| 2 | JGI24742J22300_10073186 | 3300002244 | Bacteria | 641 |
| 3 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 4 | JGI25153J46596_10008996 | 3300003215 | Bacteria | 4702 |
| 5 | JGI25153J46596_10017054 | 3300003215 | Bacteria | 2878 |
| 6 | JGI26145J50221_1022307 | 3300003371 | Bacteria | 617 |
| 7 | JGI25404J52841_10036354 | 3300003659 | Bacteria | 1048 |
| 8 | JGI25405J52794_10035110 | 3300003911 | Bacteria | 1049 |
| 9 | Ga0070658_10369759 | 3300005327 | Bacteria | 1229 |
| 10 | Ga0070676_10314514 | 3300005328 | Bacteria | 1066 |
| 11 | Ga0070683_100053275 | 3300005329 | Bacteria | 3749 |
| 12 | Ga0070683_100307635 | 3300005329 | Bacteria | 1508 |
| 13 | Ga0070683_100604505 | 3300005329 | Bacteria | 1049 |
| 14 | Ga0070683_101385591 | 3300005329 | Bacteria | 676 |
| 15 | Ga0070683_102230844 | 3300005329 | Bacteria | 525 |
| 16 | Ga0070690_100506659 | 3300005330 | Bacteria | 904 |
| 17 | Ga0070670_101643710 | 3300005331 | Bacteria | 591 |
| 18 | Ga0070680_100099273 | 3300005336 | Bacteria | 2416 |
| 19 | Ga0070680_101502044 | 3300005336 | Bacteria | 583 |
| 20 | Ga0070680_101895307 | 3300005336 | Bacteria | 517 |
| 21 | Ga0068868_100586001 | 3300005338 | Bacteria | 986 |
| 22 | Ga0068868_101793280 | 3300005338 | Bacteria | 580 |
| 23 | Ga0070660_100002390 | 3300005339 | Bacteria | 12895 |
| 24 | Ga0070660_100549482 | 3300005339 | Bacteria | 963 |
| 25 | Ga0070660_100878404 | 3300005339 | Bacteria | 755 |
| 26 | Ga0070689_100820848 | 3300005340 | Bacteria | 819 |
| 27 | Ga0070689_100829538 | 3300005340 | Bacteria | 815 |
| 28 | Ga0070691_10194117 | 3300005341 | Bacteria | 1063 |
| 29 | Ga0070691_10481719 | 3300005341 | Bacteria | 714 |
| 30 | Ga0070687_101399756 | 3300005343 | Bacteria | 523 |
| 31 | Ga0070661_100005946 | 3300005344 | Bacteria | 8403 |
| 32 | Ga0070661_100362416 | 3300005344 | Bacteria | 1139 |
| 33 | Ga0070692_10999567 | 3300005345 | Bacteria | 585 |
| 34 | Ga0070692_11426567 | 3300005345 | Bacteria | 501 |
| 35 | Ga0070675_101376318 | 3300005354 | Bacteria | 651 |
| 36 | Ga0070671_100907260 | 3300005355 | Bacteria | 770 |
| 37 | Ga0070674_102188399 | 3300005356 | Bacteria | 505 |
| 38 | Ga0070688_100032863 | 3300005365 | Bacteria | 3133 |
| 39 | Ga0070659_100438067 | 3300005366 | Bacteria | 1107 |
| 40 | Ga0070659_100449747 | 3300005366 | Bacteria | 1092 |
| 41 | Ga0070659_100521477 | 3300005366 | Bacteria | 1014 |
| 42 | Ga0070659_101645469 | 3300005366 | Bacteria | 574 |
| 43 | Ga0070667_100463754 | 3300005367 | Bacteria | 1158 |
| 44 | Ga0070714_100488863 | 3300005435 | Bacteria | 1173 |
| 45 | Ga0070714_100858022 | 3300005435 | Bacteria | 881 |
| 46 | Ga0070713_100070192 | 3300005436 | Bacteria | 2957 |
| 47 | Ga0070713_100094598 | 3300005436 | Bacteria | 2576 |
| 48 | Ga0070711_100455858 | 3300005439 | Bacteria | 1047 |
| 49 | Ga0070705_100060632 | 3300005440 | Bacteria | 2245 |
| 50 | Ga0070700_100410419 | 3300005441 | Bacteria | 1021 |
| 51 | Ga0070700_101507759 | 3300005441 | Bacteria | 572 |
| 52 | Ga0070694_100087577 | 3300005444 | Bacteria | 2179 |
| 53 | Ga0070663_100231407 | 3300005455 | Bacteria | 1455 |
| 54 | Ga0070678_100573140 | 3300005456 | Bacteria | 1005 |
| 55 | Ga0070678_100610737 | 3300005456 | Bacteria | 975 |
| 56 | Ga0070662_100090344 | 3300005457 | Bacteria | 2298 |
| 57 | Ga0070662_100797369 | 3300005457 | Bacteria | 803 |
| 58 | Ga0070681_10501507 | 3300005458 | Bacteria | 1127 |
| 59 | Ga0070681_10671287 | 3300005458 | Bacteria | 951 |
| 60 | Ga0070681_10783235 | 3300005458 | Bacteria | 870 |
| 61 | Ga0068867_100104315 | 3300005459 | Bacteria | 2170 |
| 62 | Ga0068867_100140882 | 3300005459 | Bacteria | 1885 |
| 63 | Ga0068867_100604780 | 3300005459 | Bacteria | 957 |
| 64 | Ga0068867_101189746 | 3300005459 | Bacteria | 700 |
| 65 | Ga0068867_101427148 | 3300005459 | Bacteria | 643 |
| 66 | Ga0070685_10055693 | 3300005466 | Bacteria | 2298 |
| 67 | Ga0070706_101619094 | 3300005467 | Bacteria | 590 |
| 68 | Ga0070707_100449824 | 3300005468 | Bacteria | 1249 |
| 69 | Ga0070698_100014515 | 3300005471 | Bacteria | 8316 |
| 70 | Ga0070698_101240397 | 3300005471 | Bacteria | 695 |
| 71 | Ga0070698_101367130 | 3300005471 | Bacteria | 659 |
| 72 | Ga0070699_100042312 | 3300005518 | Bacteria | 3942 |
| 73 | Ga0070679_100088987 | 3300005530 | Bacteria | 3074 |
| 74 | Ga0070679_100617320 | 3300005530 | Bacteria | 1027 |
| 75 | Ga0070679_100669570 | 3300005530 | Bacteria | 980 |
| 76 | Ga0070679_101376566 | 3300005530 | Bacteria | 652 |
| 77 | Ga0070679_101423462 | 3300005530 | Bacteria | 640 |
| 78 | Ga0070684_100052119 | 3300005535 | Bacteria | 3557 |
| 79 | Ga0070684_100099335 | 3300005535 | Bacteria | 2597 |
| 80 | Ga0070684_100535134 | 3300005535 | Bacteria | 1086 |
| 81 | Ga0068853_100013375 | 3300005539 | Bacteria | 6698 |
| 82 | Ga0068853_100440329 | 3300005539 | Bacteria | 1224 |
| 83 | Ga0068853_100893954 | 3300005539 | Bacteria | 853 |
| 84 | Ga0070672_100594160 | 3300005543 | Bacteria | 964 |
| 85 | Ga0070686_100449857 | 3300005544 | Bacteria | 990 |
| 86 | Ga0070695_100034730 | 3300005545 | Bacteria | 3163 |
| 87 | Ga0070695_100387782 | 3300005545 | Bacteria | 1056 |
| 88 | Ga0070696_100017763 | 3300005546 | Bacteria | 4802 |
| 89 | Ga0070693_100093838 | 3300005547 | Bacteria | 1815 |
| 90 | Ga0070693_100200155 | 3300005547 | Bacteria | 1297 |
| 91 | Ga0070693_100234644 | 3300005547 | Bacteria | 1209 |
| 92 | Ga0070693_100702385 | 3300005547 | Bacteria | 741 |
| 93 | Ga0070665_100109440 | 3300005548 | Bacteria | 2765 |
| 94 | Ga0070665_102408002 | 3300005548 | Bacteria | 529 |
| 95 | Ga0068855_100006773 | 3300005563 | Bacteria | 13899 |
| 96 | Ga0068855_100169574 | 3300005563 | Bacteria | 2472 |
| 97 | Ga0068855_101431147 | 3300005563 | Bacteria | 711 |
| 98 | Ga0070664_100191442 | 3300005564 | Bacteria | 1822 |
| 99 | Ga0070664_100210188 | 3300005564 | Bacteria | 1739 |
| 100 | Ga0070664_100677457 | 3300005564 | Bacteria | 959 |
| 101 | Ga0070664_101783881 | 3300005564 | Bacteria | 584 |
| 102 | Ga0068857_100043062 | 3300005577 | Bacteria | 4005 |
| 103 | Ga0068857_100403312 | 3300005577 | Bacteria | 1272 |
| 104 | Ga0068857_102476524 | 3300005577 | Bacteria | 509 |
| 105 | Ga0068854_100126535 | 3300005578 | Bacteria | 1947 |
| 106 | Ga0068854_100384219 | 3300005578 | Bacteria | 1158 |
| 107 | Ga0068856_100158389 | 3300005614 | Bacteria | 2274 |
| 108 | Ga0068856_100161436 | 3300005614 | Bacteria | 2251 |
| 109 | Ga0068856_100173262 | 3300005614 | Bacteria | 2170 |
| 110 | Ga0068856_100448749 | 3300005614 | Bacteria | 1310 |
| 111 | Ga0068856_100629195 | 3300005614 | Bacteria | 1094 |
| 112 | Ga0068856_101236971 | 3300005614 | Bacteria | 763 |
| 113 | Ga0068856_101246424 | 3300005614 | Bacteria | 759 |
| 114 | Ga0068852_100790803 | 3300005616 | Bacteria | 962 |
| 115 | Ga0068852_101228875 | 3300005616 | Bacteria | 770 |
| 116 | Ga0068852_101354444 | 3300005616 | Bacteria | 734 |
| 117 | Ga0068852_102728273 | 3300005616 | Bacteria | 513 |
| 118 | Ga0068859_100316849 | 3300005617 | Bacteria | 1653 |
| 119 | Ga0068859_101099278 | 3300005617 | Bacteria | 874 |
| 120 | Ga0068859_101470644 | 3300005617 | Bacteria | 752 |
| 121 | Ga0068864_101459685 | 3300005618 | Bacteria | 686 |
| 122 | Ga0068866_10482550 | 3300005718 | Bacteria | 817 |
| 123 | Ga0068861_100962324 | 3300005719 | Bacteria | 812 |
| 124 | Ga0068861_101696751 | 3300005719 | Bacteria | 624 |
| 125 | Ga0068851_10272997 | 3300005834 | Bacteria | 965 |
| 126 | Ga0068863_100175261 | 3300005841 | Bacteria | 2058 |
| 127 | Ga0068858_100681127 | 3300005842 | Bacteria | 1000 |
| 128 | Ga0068858_101397477 | 3300005842 | Bacteria | 689 |
| 129 | Ga0068860_100151341 | 3300005843 | Bacteria | 2234 |
| 130 | Ga0068860_100845551 | 3300005843 | Bacteria | 930 |
| 131 | Ga0068860_102399265 | 3300005843 | Bacteria | 547 |
| 132 | Ga0068862_100208344 | 3300005844 | Bacteria | 1766 |
| 133 | Ga0068862_100466502 | 3300005844 | Bacteria | 1193 |
| 134 | Ga0068862_101106375 | 3300005844 | Bacteria | 788 |
| 135 | Ga0068862_101423902 | 3300005844 | Bacteria | 697 |
| 136 | Ga0081455_10011198 | 3300005937 | Bacteria | 9024 |
| 137 | Ga0081455_10061752 | 3300005937 | Bacteria | 3152 |
| 138 | Ga0081455_10204364 | 3300005937 | Bacteria | 1477 |
| 139 | Ga0081455_10305810 | 3300005937 | Bacteria | 1139 |
| 140 | Ga0081538_10137999 | 3300005981 | Bacteria | 1131 |
| 141 | Ga0081540_1004248 | 3300005983 | Bacteria | 10995 |
| 142 | Ga0081540_1008438 | 3300005983 | Bacteria | 7199 |
| 143 | Ga0081540_1030792 | 3300005983 | Bacteria | 2965 |
| 144 | Ga0081540_1032087 | 3300005983 | Bacteria | 2874 |
| 145 | Ga0070717_12111438 | 3300006028 | Bacteria | 507 |
| 146 | Ga0075363_100004858 | 3300006048 | Bacteria | 5938 |
| 147 | Ga0075363_100942991 | 3300006048 | Bacteria | 530 |
| 148 | Ga0075364_10052785 | 3300006051 | Bacteria | 2657 |
| 149 | Ga0075364_10095261 | 3300006051 | Bacteria | 1979 |
| 150 | Ga0075364_10216020 | 3300006051 | Bacteria | 1300 |
| 151 | Ga0070716_101275562 | 3300006173 | Bacteria | 593 |
| 152 | Ga0070712_100149925 | 3300006175 | Bacteria | 1789 |
| 153 | Ga0070712_100954403 | 3300006175 | Bacteria | 741 |
| 154 | Ga0075362_10015125 | 3300006177 | Bacteria | 3133 |
| 155 | Ga0075362_10035975 | 3300006177 | Bacteria | 2164 |
| 156 | Ga0075362_10418025 | 3300006177 | Bacteria | 678 |
| 157 | Ga0075367_10201217 | 3300006178 | Bacteria | 1244 |
| 158 | Ga0097621_100585112 | 3300006237 | Bacteria | 1019 |
| 159 | Ga0075370_10003104 | 3300006353 | Bacteria | 7840 |
| 160 | Ga0068871_100063920 | 3300006358 | Bacteria | 3011 |
| 161 | Ga0068871_100502548 | 3300006358 | Bacteria | 1093 |
| 162 | Ga0068871_100548815 | 3300006358 | Bacteria | 1046 |
| 163 | Ga0075428_100038388 | 3300006844 | Bacteria | 5270 |
| 164 | Ga0075428_100712737 | 3300006844 | Bacteria | 1069 |
| 165 | Ga0075428_100958316 | 3300006844 | Bacteria | 906 |
| 166 | Ga0075428_102694369 | 3300006844 | Bacteria | 507 |
| 167 | Ga0075430_100038858 | 3300006846 | Bacteria | 4030 |
| 168 | Ga0075430_100662420 | 3300006846 | Bacteria | 861 |
| 169 | Ga0075430_101286480 | 3300006846 | Bacteria | 602 |
| 170 | Ga0075431_100120442 | 3300006847 | Bacteria | 2708 |
| 171 | Ga0075431_100227691 | 3300006847 | Bacteria | 1900 |
| 172 | Ga0075431_101065795 | 3300006847 | Bacteria | 774 |
| 173 | Ga0075433_10068755 | 3300006852 | Bacteria | 3110 |
| 174 | Ga0075433_10670941 | 3300006852 | Bacteria | 909 |
| 175 | Ga0075433_11115434 | 3300006852 | Bacteria | 686 |
| 176 | Ga0075434_100155197 | 3300006871 | Bacteria | 2309 |
| 177 | Ga0075434_100299829 | 3300006871 | Bacteria | 1628 |
| 178 | Ga0075434_102440008 | 3300006871 | Bacteria | 525 |
| 179 | Ga0075429_100205004 | 3300006880 | Bacteria | 1728 |
| 180 | Ga0075429_100218905 | 3300006880 | Bacteria | 1668 |
| 181 | Ga0075429_100497999 | 3300006880 | Bacteria | 1068 |
| 182 | Ga0068865_100058757 | 3300006881 | Bacteria | 2687 |
| 183 | Ga0068865_100170832 | 3300006881 | Bacteria | 1666 |
| 184 | Ga0075436_100560062 | 3300006914 | Bacteria | 840 |
| 185 | Ga0075436_100922743 | 3300006914 | Bacteria | 654 |
| 186 | Ga0097620_100316858 | 3300006931 | Bacteria | 1653 |
| 187 | Ga0097620_101099276 | 3300006931 | Bacteria | 874 |
| 188 | Ga0097620_101470637 | 3300006931 | Bacteria | 752 |
| 189 | Ga0075435_100257087 | 3300007076 | Bacteria | 1487 |
| 190 | Ga0075435_101173984 | 3300007076 | Bacteria | 672 |
| 191 | Ga0075435_101266269 | 3300007076 | Bacteria | 646 |
| 192 | Ga0075435_101323175 | 3300007076 | Bacteria | 631 |
| 193 | Ga0105240_10598473 | 3300009093 | Bacteria | 1214 |
| 194 | Ga0111539_10060664 | 3300009094 | Bacteria | 4482 |
| 195 | Ga0111539_10079410 | 3300009094 | Bacteria | 3860 |
| 196 | Ga0111539_10146569 | 3300009094 | Bacteria | 2764 |
| 197 | Ga0111539_10851327 | 3300009094 | Bacteria | 1061 |
| 198 | Ga0111539_11186742 | 3300009094 | Bacteria | 887 |
| 199 | Ga0105245_10195049 | 3300009098 | Bacteria | 1942 |
| 200 | Ga0105245_10411966 | 3300009098 | Bacteria | 1353 |
| 201 | Ga0105245_10432327 | 3300009098 | Bacteria | 1321 |
| 202 | Ga0105245_12703522 | 3300009098 | Bacteria | 549 |
| 203 | Ga0105245_12794392 | 3300009098 | Bacteria | 541 |
| 204 | Ga0105245_13151583 | 3300009098 | Bacteria | 511 |
| 205 | Ga0105247_10739742 | 3300009101 | Bacteria | 744 |
| 206 | Ga0114129_10005890 | 3300009147 | Bacteria | 17359 |
| 207 | Ga0114129_10076149 | 3300009147 | Bacteria | 4671 |
| 208 | Ga0114129_10185815 | 3300009147 | Bacteria | 2825 |
| 209 | Ga0114129_10282465 | 3300009147 | Bacteria | 2217 |
| 210 | Ga0114129_10396737 | 3300009147 | Bacteria | 1819 |
| 211 | Ga0105243_10122511 | 3300009148 | Bacteria | 2195 |
| 212 | Ga0105243_10411685 | 3300009148 | Bacteria | 1258 |
| 213 | Ga0105243_10578929 | 3300009148 | Bacteria | 1077 |
| 214 | Ga0105243_10590318 | 3300009148 | Bacteria | 1068 |
| 215 | Ga0105243_10669595 | 3300009148 | Bacteria | 1008 |
| 216 | Ga0105241_10017868 | 3300009174 | Bacteria | 5216 |
| 217 | Ga0105241_10655747 | 3300009174 | Bacteria | 954 |
| 218 | Ga0105242_11117859 | 3300009176 | Bacteria | 803 |
| 219 | Ga0105242_11560480 | 3300009176 | Bacteria | 693 |
| 220 | Ga0105242_11591591 | 3300009176 | Bacteria | 687 |
| 221 | Ga0105248_10140985 | 3300009177 | Bacteria | 2719 |
| 222 | Ga0105248_10284388 | 3300009177 | Bacteria | 1862 |
| 223 | Ga0105248_13286726 | 3300009177 | Bacteria | 514 |
| 224 | Ga0105237_10002619 | 3300009545 | Bacteria | 22167 |
| 225 | Ga0105237_10047955 | 3300009545 | Bacteria | 4295 |
| 226 | Ga0105237_10471743 | 3300009545 | Bacteria | 1261 |
| 227 | Ga0105238_11661901 | 3300009551 | Bacteria | 669 |
| 228 | Ga0105249_11346463 | 3300009553 | Bacteria | 786 |
| 229 | Ga0105239_10102043 | 3300010375 | Bacteria | 3175 |
| 230 | Ga0105239_10291478 | 3300010375 | Bacteria | 1838 |
| 231 | Ga0105239_10541023 | 3300010375 | Bacteria | 1326 |
| 232 | Ga0105239_10658354 | 3300010375 | Bacteria | 1196 |
| 233 | Ga0105239_11736225 | 3300010375 | Bacteria | 723 |
| 234 | Ga0105246_10525059 | 3300011119 | Bacteria | 1010 |
| 235 | Ga0157320_1011992 | 3300012481 | Bacteria | 691 |
| 236 | Ga0157343_1003739 | 3300012488 | Bacteria | 909 |
| 237 | Ga0157322_1029946 | 3300012490 | Bacteria | 575 |
| 238 | Ga0157319_1018783 | 3300012497 | Bacteria | 651 |
| 239 | Ga0157342_1061653 | 3300012507 | Bacteria | 552 |
| 240 | Ga0157327_1009341 | 3300012512 | Bacteria | 901 |
| 241 | Ga0157373_10685601 | 3300013100 | Bacteria | 750 |
| 242 | Ga0157371_10605938 | 3300013102 | Bacteria | 815 |
| 243 | Ga0157370_10422380 | 3300013104 | Bacteria | 1226 |
| 244 | Ga0157370_10601969 | 3300013104 | Bacteria | 1006 |
| 245 | Ga0157369_10124513 | 3300013105 | Bacteria | 2733 |
| 246 | Ga0157369_10675688 | 3300013105 | Bacteria | 1064 |
| 247 | Ga0157374_10218485 | 3300013296 | Bacteria | 1870 |
| 248 | Ga0157374_10368360 | 3300013296 | Bacteria | 1430 |
| 249 | Ga0157374_12710550 | 3300013296 | Bacteria | 523 |
| 250 | Ga0157378_10456063 | 3300013297 | Bacteria | 1270 |
| 251 | Ga0157378_12233764 | 3300013297 | Bacteria | 598 |
| 252 | Ga0157378_12824613 | 3300013297 | Bacteria | 538 |
| 253 | Ga0163162_13074766 | 3300013306 | Bacteria | 536 |
| 254 | Ga0157372_10968208 | 3300013307 | Bacteria | 986 |
| 255 | Ga0157372_11586586 | 3300013307 | Bacteria | 753 |
| 256 | Ga0157375_10288130 | 3300013308 | Bacteria | 1805 |
| 257 | Ga0157375_10321513 | 3300013308 | Bacteria | 1712 |
| 258 | Ga0157375_11633331 | 3300013308 | Bacteria | 762 |
| 259 | Ga0157375_13821583 | 3300013308 | Bacteria | 500 |
| 260 | Ga0157380_11066332 | 3300014326 | Bacteria | 845 |
| 261 | Ga0157380_11336915 | 3300014326 | Bacteria | 765 |
| 262 | Ga0157380_12206039 | 3300014326 | Bacteria | 615 |
| 263 | Ga0157379_11386180 | 3300014968 | Bacteria | 681 |
| 264 | Ga0157376_10180451 | 3300014969 | Bacteria | 1929 |
| 265 | Ga0157376_10223096 | 3300014969 | Bacteria | 1747 |
| 266 | Ga0157376_10770891 | 3300014969 | Bacteria | 972 |
| 267 | Ga0157376_11978993 | 3300014969 | Bacteria | 620 |
| 268 | Ga0182005_1006944 | 3300015265 | Bacteria | 3424 |
| 269 | Ga0182005_1115342 | 3300015265 | Bacteria | 761 |
| 270 | Ga0163161_11989211 | 3300017792 | Bacteria | 517 |
| 271 | Ga0206351_10012725 | 3300020077 | Bacteria | 1017 |
| 272 | Ga0154015_1181558 | 3300020610 | Bacteria | 1459 |
| 273 | Ga0213873_10071188 | 3300021358 | Bacteria | 959 |
| 274 | Ga0213872_10049267 | 3300021361 | Bacteria | 1913 |
| 275 | Ga0213874_10309410 | 3300021377 | Bacteria | 596 |
| 276 | Ga0213876_10112449 | 3300021384 | Bacteria | 1445 |
| 277 | Ga0213875_10000089 | 3300021388 | Bacteria | 105772 |
| 278 | Ga0213875_10376426 | 3300021388 | Bacteria | 676 |
| 279 | Ga0213871_10018399 | 3300021441 | Bacteria | 1709 |
| 280 | Ga0213871_10224361 | 3300021441 | Bacteria | 591 |
| 281 | Ga0224572_1089236 | 3300024225 | Bacteria | 569 |
| 282 | Ga0228598_1072408 | 3300024227 | Bacteria | 689 |
| 283 | Ga0207427_101449 | 3300025231 | Bacteria | 8554 |
| 284 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 285 | Ga0209025_1126623 | 3300025294 | Bacteria | 751 |
| 286 | Ga0209758_1000548 | 3300025297 | Bacteria | 59657 |
| 287 | Ga0207426_1073154 | 3300025302 | Bacteria | 949 |
| 288 | Ga0209051_1102276 | 3300025303 | Bacteria | 767 |
| 289 | Ga0207656_10327467 | 3300025321 | Bacteria | 762 |
| 290 | Ga0207688_10905613 | 3300025901 | Bacteria | 558 |
| 291 | Ga0207688_11011188 | 3300025901 | Bacteria | 525 |
| 292 | Ga0207647_10063680 | 3300025904 | Bacteria | 2242 |
| 293 | Ga0207699_10295384 | 3300025906 | Bacteria | 1130 |
| 294 | Ga0207645_10347630 | 3300025907 | Bacteria | 992 |
| 295 | Ga0207705_10001453 | 3300025909 | Bacteria | 18913 |
| 296 | Ga0207705_10359009 | 3300025909 | Bacteria | 1123 |
| 297 | Ga0207705_10563534 | 3300025909 | Bacteria | 886 |
| 298 | Ga0207705_10799814 | 3300025909 | Bacteria | 732 |
| 299 | Ga0207705_10974227 | 3300025909 | Bacteria | 656 |
| 300 | Ga0207684_10588933 | 3300025910 | Bacteria | 950 |
| 301 | Ga0207654_10091223 | 3300025911 | Bacteria | 1858 |
| 302 | Ga0207654_11071908 | 3300025911 | Bacteria | 587 |
| 303 | Ga0207707_10065034 | 3300025912 | Bacteria | 3176 |
| 304 | Ga0207707_10150230 | 3300025912 | Bacteria | 2037 |
| 305 | Ga0207695_10150035 | 3300025913 | Bacteria | 2271 |
| 306 | Ga0207671_10001074 | 3300025914 | Bacteria | 33173 |
| 307 | Ga0207671_10987266 | 3300025914 | Bacteria | 664 |
| 308 | Ga0207663_10419978 | 3300025916 | Bacteria | 1026 |
| 309 | Ga0207663_10808044 | 3300025916 | Bacteria | 747 |
| 310 | Ga0207660_10127508 | 3300025917 | Bacteria | 1934 |
| 311 | Ga0207660_10769704 | 3300025917 | Bacteria | 786 |
| 312 | Ga0207660_11040210 | 3300025917 | Bacteria | 668 |
| 313 | Ga0207660_11161181 | 3300025917 | Bacteria | 629 |
| 314 | Ga0207657_10006791 | 3300025919 | Bacteria | 11813 |
| 315 | Ga0207657_10050665 | 3300025919 | Bacteria | 3613 |
| 316 | Ga0207657_10114000 | 3300025919 | Bacteria | 2230 |
| 317 | Ga0207649_10000194 | 3300025920 | Bacteria | 50112 |
| 318 | Ga0207649_10292325 | 3300025920 | Bacteria | 1188 |
| 319 | Ga0207652_10077820 | 3300025921 | Bacteria | 2895 |
| 320 | Ga0207652_10176407 | 3300025921 | Bacteria | 1919 |
| 321 | Ga0207652_10402790 | 3300025921 | Bacteria | 1234 |
| 322 | Ga0207652_10649732 | 3300025921 | Bacteria | 943 |
| 323 | Ga0207646_10164402 | 3300025922 | Bacteria | 2003 |
| 324 | Ga0207694_10304721 | 3300025924 | Bacteria | 1312 |
| 325 | Ga0207694_10806853 | 3300025924 | Bacteria | 793 |
| 326 | Ga0207650_10445007 | 3300025925 | Bacteria | 1078 |
| 327 | Ga0207659_10653137 | 3300025926 | Bacteria | 899 |
| 328 | Ga0207687_10966340 | 3300025927 | Bacteria | 730 |
| 329 | Ga0207700_10214806 | 3300025928 | Bacteria | 1628 |
| 330 | Ga0207664_10597443 | 3300025929 | Bacteria | 991 |
| 331 | Ga0207664_10629612 | 3300025929 | Bacteria | 964 |
| 332 | Ga0207644_10326829 | 3300025931 | Bacteria | 1241 |
| 333 | Ga0207644_11808892 | 3300025931 | Bacteria | 511 |
| 334 | Ga0207690_10221657 | 3300025932 | Bacteria | 1447 |
| 335 | Ga0207690_10349373 | 3300025932 | Bacteria | 1169 |
| 336 | Ga0207690_10551152 | 3300025932 | Bacteria | 937 |
| 337 | Ga0207706_10083691 | 3300025933 | Bacteria | 2805 |
| 338 | Ga0207709_10062259 | 3300025935 | Bacteria | 2335 |
| 339 | Ga0207670_10386673 | 3300025936 | Bacteria | 1116 |
| 340 | Ga0207670_10584286 | 3300025936 | Bacteria | 916 |
| 341 | Ga0207670_10973312 | 3300025936 | Bacteria | 713 |
| 342 | Ga0207669_10286618 | 3300025937 | Bacteria | 1245 |
| 343 | Ga0207704_10234376 | 3300025938 | Bacteria | 1367 |
| 344 | Ga0207691_11470465 | 3300025940 | Bacteria | 558 |
| 345 | Ga0207711_10432077 | 3300025941 | Bacteria | 1225 |
| 346 | Ga0207711_10501217 | 3300025941 | Bacteria | 1132 |
| 347 | Ga0207661_10061857 | 3300025944 | Bacteria | 3026 |
| 348 | Ga0207661_10242014 | 3300025944 | Bacteria | 1601 |
| 349 | Ga0207661_10281722 | 3300025944 | Bacteria | 1486 |
| 350 | Ga0207679_10330417 | 3300025945 | Bacteria | 1323 |
| 351 | Ga0207679_11336920 | 3300025945 | Bacteria | 657 |
| 352 | Ga0207667_10002756 | 3300025949 | Bacteria | 21724 |
| 353 | Ga0207667_10215153 | 3300025949 | Bacteria | 1969 |
| 354 | Ga0207667_10261322 | 3300025949 | Bacteria | 1770 |
| 355 | Ga0207667_11247038 | 3300025949 | Bacteria | 721 |
| 356 | Ga0207651_10263706 | 3300025960 | Bacteria | 1416 |
| 357 | Ga0207668_10414281 | 3300025972 | Bacteria | 1142 |
| 358 | Ga0207668_11046118 | 3300025972 | Bacteria | 731 |
| 359 | Ga0207640_10107100 | 3300025981 | Bacteria | 1973 |
| 360 | Ga0207640_11565908 | 3300025981 | Bacteria | 593 |
| 361 | Ga0207677_10379112 | 3300026023 | Bacteria | 1193 |
| 362 | Ga0207703_10057141 | 3300026035 | Bacteria | 3180 |
| 363 | Ga0207703_11317563 | 3300026035 | Bacteria | 695 |
| 364 | Ga0207703_11618103 | 3300026035 | Bacteria | 623 |
| 365 | Ga0207639_10009890 | 3300026041 | Bacteria | 6587 |
| 366 | Ga0207639_10121098 | 3300026041 | Bacteria | 2150 |
| 367 | Ga0207678_10022593 | 3300026067 | Bacteria | 5509 |
| 368 | Ga0207708_10110240 | 3300026075 | Bacteria | 2136 |
| 369 | Ga0207708_10554491 | 3300026075 | Bacteria | 969 |
| 370 | Ga0207708_11610985 | 3300026075 | Bacteria | 570 |
| 371 | Ga0207702_10030901 | 3300026078 | Bacteria | 4463 |
| 372 | Ga0207702_10073915 | 3300026078 | Bacteria | 2940 |
| 373 | Ga0207702_10769845 | 3300026078 | Bacteria | 951 |
| 374 | Ga0207702_10997846 | 3300026078 | Bacteria | 830 |
| 375 | Ga0207702_11609110 | 3300026078 | Bacteria | 643 |
| 376 | Ga0207641_10154200 | 3300026088 | Bacteria | 2083 |
| 377 | Ga0207641_10307914 | 3300026088 | Bacteria | 1498 |
| 378 | Ga0207648_10130957 | 3300026089 | Bacteria | 2208 |
| 379 | Ga0207648_10210247 | 3300026089 | Bacteria | 1727 |
| 380 | Ga0207648_10568390 | 3300026089 | Bacteria | 1043 |
| 381 | Ga0207674_10013836 | 3300026116 | Bacteria | 8927 |
| 382 | Ga0207674_10101849 | 3300026116 | Bacteria | 2852 |
| 383 | Ga0207675_100213567 | 3300026118 | Bacteria | 1857 |
| 384 | Ga0207675_101130887 | 3300026118 | Bacteria | 803 |
| 385 | Ga0207675_102476482 | 3300026118 | Bacteria | 530 |
| 386 | Ga0207683_10085243 | 3300026121 | Bacteria | 2808 |
| 387 | Ga0207683_10270036 | 3300026121 | Bacteria | 1554 |
| 388 | Ga0207683_10619623 | 3300026121 | Bacteria | 1002 |
| 389 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 390 | Ga0209974_10012559 | 3300027876 | Bacteria | 2830 |
| 391 | Ga0207428_10704774 | 3300027907 | Bacteria | 722 |
| 392 | Ga0268266_10000321 | 3300028379 | Bacteria | 75565 |
| 393 | Ga0268266_10179973 | 3300028379 | Bacteria | 1924 |
| 394 | Ga0268265_10162575 | 3300028380 | Bacteria | 1899 |
| 395 | Ga0268265_10864402 | 3300028380 | Bacteria | 886 |
| 396 | Ga0268265_10951628 | 3300028380 | Bacteria | 846 |
| 397 | Ga0268264_10857827 | 3300028381 | Bacteria | 910 |
| 398 | Ga0265318_10000037 | 3300028577 | Bacteria | 138223 |
| 399 | Ga0307517_10115379 | 3300028786 | Bacteria | 2016 |
| 400 | Ga0265324_10000500 | 3300029957 | Bacteria | 27131 |
| 401 | Ga0307512_10457118 | 3300030522 | Bacteria | 513 |
| 402 | Ga0265762_1174339 | 3300030760 | Bacteria | 526 |
| 403 | Ga0265766_1024028 | 3300030863 | Bacteria | 516 |
| 404 | Ga0265325_10000449 | 3300031241 | Bacteria | 29667 |
| 405 | Ga0265325_10131935 | 3300031241 | Bacteria | 1195 |
| 406 | Ga0265331_10002092 | 3300031250 | Bacteria | 13775 |
| 407 | Ga0265331_10107041 | 3300031250 | Bacteria | 1284 |
| 408 | Ga0265327_10071532 | 3300031251 | Bacteria | 1735 |
| 409 | Ga0265327_10413512 | 3300031251 | Bacteria | 585 |
| 410 | Ga0265316_10040773 | 3300031344 | Bacteria | 3721 |
| 411 | Ga0265316_10316460 | 3300031344 | Bacteria | 1134 |
| 412 | Ga0265316_10497629 | 3300031344 | Bacteria | 871 |
| 413 | Ga0307408_100361446 | 3300031548 | Bacteria | 1235 |
| 414 | Ga0316579_10010091 | 3300031691 | Bacteria | 3985 |
| 415 | Ga0265314_10001521 | 3300031711 | Bacteria | 25613 |
| 416 | Ga0265342_10369250 | 3300031712 | Bacteria | 745 |
| 417 | Ga0307516_10000048 | 3300031730 | Bacteria | 130378 |
| 418 | Ga0307405_10304730 | 3300031731 | Bacteria | 1210 |
| 419 | Ga0307405_10993751 | 3300031731 | Bacteria | 715 |
| 420 | Ga0307405_11571875 | 3300031731 | Bacteria | 580 |
| 421 | Ga0307413_10153805 | 3300031824 | Bacteria | 1606 |
| 422 | Ga0307413_10456558 | 3300031824 | Bacteria | 1015 |
| 423 | Ga0307410_10554150 | 3300031852 | Bacteria | 953 |
| 424 | Ga0307410_10679249 | 3300031852 | Bacteria | 866 |
| 425 | Ga0307410_10722459 | 3300031852 | Bacteria | 841 |
| 426 | Ga0307410_10753272 | 3300031852 | Bacteria | 825 |
| 427 | Ga0307407_10307945 | 3300031903 | Bacteria | 1107 |
| 428 | Ga0307412_10487792 | 3300031911 | Bacteria | 1023 |
| 429 | Ga0307412_11557027 | 3300031911 | Bacteria | 602 |
| 430 | Ga0307416_101573201 | 3300032002 | Bacteria | 763 |
| 431 | Ga0307416_102429323 | 3300032002 | Bacteria | 623 |
| 432 | Ga0307416_102929555 | 3300032002 | Bacteria | 571 |
| 433 | Ga0307414_10123159 | 3300032004 | Bacteria | 1997 |
| 434 | Ga0307414_10324126 | 3300032004 | Bacteria | 1312 |
| 435 | Ga0307414_11146249 | 3300032004 | Bacteria | 719 |
| 436 | Ga0307411_10410308 | 3300032005 | Bacteria | 1122 |
| 437 | Ga0307415_100427324 | 3300032126 | Bacteria | 1139 |
| 438 | Ga0307415_100793929 | 3300032126 | Bacteria | 863 |
| 439 | Ga0307415_100936080 | 3300032126 | Bacteria | 801 |
| 440 | Ga0316583_10116423 | 3300032133 | Bacteria | 932 |
| 441 | Ga0316583_10317123 | 3300032133 | Bacteria | 539 |
| 442 | Ga0316593_10020888 | 3300032168 | Bacteria | 2042 |
| 443 | Ga0316593_10043962 | 3300032168 | Bacteria | 1494 |
| 444 | Ga0316593_10063317 | 3300032168 | Bacteria | 1268 |
| 445 | Ga0316593_10091179 | 3300032168 | Bacteria | 1073 |
| 446 | Ga0316593_10128486 | 3300032168 | Bacteria | 913 |
| 447 | Ga0316593_10164792 | 3300032168 | Bacteria | 811 |
| 448 | Ga0316593_10401167 | 3300032168 | Bacteria | 530 |
| 449 | Ga0316587_1087875 | 3300033529 | Bacteria | 591 |
| 450 | Ga0316596_1042721 | 3300033541 | Bacteria | 1193 |
| 451 | Ga0373928_0041260 | 3300035084 | Bacteria | 1060 |
| 452 | Ga0373928_0214495 | 3300035084 | Bacteria | 560 |
| 453 | Ga0373929_0027794 | 3300035085 | Bacteria | 1191 |
| 454 | Ga0373934_0166095 | 3300035086 | Bacteria | 906 |
| 455 | Ga0373940_0047019 | 3300035088 | Bacteria | 1202 |
| 456 | Ga0373949_0063774 | 3300035090 | Bacteria | 953 |
| 457 | Ga0373951_0059414 | 3300035091 | Bacteria | 955 |
| 458 | Ga0373932_0045214 | 3300035112 | Bacteria | 1287 |
| 459 | Ga0373941_0063200 | 3300035115 | Bacteria | 1210 |
| 460 | Ga0373945_0156320 | 3300035116 | Bacteria | 927 |
| 461 | Ga0373945_0393499 | 3300035116 | Bacteria | 606 |
| 462 | Ga0373960_0004525 | 3300035121 | Bacteria | 3192 |
| 463 | Ga0373943_0005741 | 3300035170 | Bacteria | 5569 |
| 464 | Ga0373943_0966778 | 3300035170 | Bacteria | 510 |
| 465 | Ga0373946_0116740 | 3300035171 | Bacteria | 1214 |
| 466 | Ga0373955_0396895 | 3300035172 | Bacteria | 838 |
| 467 | Ga0373961_0060924 | 3300035241 | Bacteria | 1145 |
| 468 | Ga0316574_0385368 | 3300035398 | Bacteria | 884 |
| 469 | Ga0373931_0028558 | 3300035691 | Bacteria | 2857 |
| 470 | Ga0373931_0198449 | 3300035691 | Bacteria | 1197 |
| 471 | Ga0373931_0205613 | 3300035691 | Bacteria | 1178 |
| 472 | Ga0373931_0395018 | 3300035691 | Bacteria | 874 |
| 473 | Ga0373935_0066301 | 3300035692 | Bacteria | 2319 |
| 474 | Ga0373935_0238773 | 3300035692 | Bacteria | 1268 |
| 475 | Ga0373927_0029560 | 3300035695 | Bacteria | 3572 |
| 476 | Ga0373927_0370766 | 3300035695 | Bacteria | 944 |
| 477 | Ga0373927_0575874 | 3300035695 | Bacteria | 744 |
| 478 | Ga0373927_0711762 | 3300035695 | Bacteria | 663 |
| 479 | Ga0373933_0622290 | 3300035724 | Bacteria | 709 |
| 480 | Ga0373933_0928256 | 3300035724 | Bacteria | 573 |
| 481 | Ga0373947_0093943 | 3300035725 | Bacteria | 1875 |
| 482 | Ga0373947_0271981 | 3300035725 | Bacteria | 1125 |
| 483 | Ga0373947_0556276 | 3300035725 | Bacteria | 781 |
| 484 | Ga0373937_0524014 | 3300036401 | Bacteria | 1126 |
| 485 | Ga0373937_1327369 | 3300036401 | Bacteria | 667 |
| 486 | Ga0316582_0264236 | 3300036647 | Bacteria | 1180 |
| 487 | Ga0316584_0213436 | 3300036712 | Bacteria | 1420 |
| 488 | Ga0316584_0237850 | 3300036712 | Bacteria | 1334 |
| 489 | Ga0373925_0059917 | 3300037068 | Bacteria | 2857 |
| 490 | Ga0373925_0184455 | 3300037068 | Bacteria | 1653 |
| 491 | Ga0395899_0009289 | 3300037312 | Bacteria | 7550 |
| 492 | Ga0395899_0010562 | 3300037312 | Bacteria | 7074 |
| 493 | Ga0395899_0048114 | 3300037312 | Bacteria | 3174 |
| 494 | Ga0395899_0383044 | 3300037312 | Bacteria | 934 |
| 495 | Ga0395900_0009123 | 3300037418 | Bacteria | 10158 |
| 496 | Ga0395900_0025293 | 3300037418 | Bacteria | 6078 |
| 497 | Ga0395900_0079088 | 3300037418 | Bacteria | 3378 |
| 498 | Ga0395900_0088998 | 3300037418 | Bacteria | 3174 |
| 499 | Ga0395900_0168314 | 3300037418 | Bacteria | 2232 |
| 500 | Ga0395900_0187406 | 3300037418 | Bacteria | 2100 |
| 501 | Ga0395900_0237666 | 3300037418 | Bacteria | 1829 |
| 502 | Ga0395900_1299754 | 3300037418 | Bacteria | 641 |
| 503 | Ga0395898_0009501 | 3300037466 | Bacteria | 10210 |
| 504 | Ga0395898_0012796 | 3300037466 | Bacteria | 8662 |
| 505 | Ga0395898_0053632 | 3300037466 | Bacteria | 3938 |
| 506 | Ga0395898_0062833 | 3300037466 | Bacteria | 3605 |
| 507 | Ga0395898_0123226 | 3300037466 | Bacteria | 2484 |
| 508 | Ga0395898_0162999 | 3300037466 | Bacteria | 2132 |
| 509 | Ga0395898_0196913 | 3300037466 | Bacteria | 1924 |
| 510 | Ga0395898_0210988 | 3300037466 | Bacteria | 1852 |
| 511 | Ga0395905_0007439 | 3300037471 | Bacteria | 10890 |
| 512 | Ga0395905_0022623 | 3300037471 | Bacteria | 5942 |
| 513 | Ga0395905_0187513 | 3300037471 | Bacteria | 1941 |
| 514 | Ga0395905_0509100 | 3300037471 | Bacteria | 1104 |
| 515 | Ga0395905_0537049 | 3300037471 | Bacteria | 1070 |
| 516 | Ga0436364_0154708 | 3300037853 | Bacteria | 1303 |
| 517 | Ga0436364_0333324 | 3300037853 | Bacteria | 10396 |
| 518 | Ga0436364_0387099 | 3300037853 | Bacteria | 834 |
| 519 | Ga0436364_1329342 | 3300037853 | Bacteria | 1548 |
| 520 | Ga0395901_0016098 | 3300038443 | Bacteria | 7618 |
| 521 | Ga0395901_0022055 | 3300038443 | Bacteria | 6527 |
| 522 | Ga0395901_0029226 | 3300038443 | Bacteria | 5672 |
| 523 | Ga0395901_0061803 | 3300038443 | Bacteria | 3897 |
| 524 | Ga0395901_0132861 | 3300038443 | Bacteria | 2615 |
| 525 | Ga0395901_1087593 | 3300038443 | Bacteria | 771 |
| 526 | Ga0400483_065380 | 3300039062 | Bacteria | 1297 |
| 527 | Ga0400483_074646 | 3300039062 | Bacteria | 2528 |
| 528 | Ga0400483_079140 | 3300039062 | Bacteria | 6427 |
| 529 | Ga0400483_191914 | 3300039062 | Bacteria | 2021 |
| 530 | Ga0400483_212486 | 3300039062 | Bacteria | 1025 |
| 531 | Ga0436365_0104312 | 3300039437 | Bacteria | 1783 |
| 532 | Ga0436365_0383888 | 3300039437 | Bacteria | 1668 |
| 533 | Ga0436365_0998743 | 3300039437 | Bacteria | 1694 |
| 534 | Ga0436365_1100019 | 3300039437 | Bacteria | 628 |
| 535 | Ga0436365_1356266 | 3300039437 | Bacteria | 540 |
| 536 | Ga0436365_1600671 | 3300039437 | Bacteria | 631 |
| 537 | Ga0436360_0558978 | 3300039438 | Bacteria | 2949 |
| 538 | Ga0436360_1138201 | 3300039438 | Bacteria | 879 |
| 539 | Ga0436360_1332781 | 3300039438 | Bacteria | 3795 |
| 540 | Ga0436361_0316570 | 3300039447 | Bacteria | 12614 |
| 541 | Ga0436361_0700032 | 3300039447 | Bacteria | 1014 |
| 542 | Ga0436363_1628752 | 3300039450 | Bacteria | 719 |
| 543 | Ga0436363_1676224 | 3300039450 | Bacteria | 658 |
| 544 | Ga0436362_0281584 | 3300039453 | Bacteria | 569 |
| 545 | Ga0436362_0377953 | 3300039453 | Bacteria | 1179 |
| 546 | Ga0436362_1042172 | 3300039453 | Bacteria | 843 |
| 547 | Ga0439465_0172218 | 3300041413 | Bacteria | 780 |
| 548 | Ga0451787_362070 | 3300041441 | Bacteria | 617 |
| 549 | Ga0451787_425155 | 3300041441 | Bacteria | 541 |
| 550 | Ga0451793_1804433 | 3300041452 | Bacteria | 518 |
| 551 | Ga0451797_0747974 | 3300041453 | Bacteria | 670 |
| 552 | Ga0451799_09344 | 3300041454 | Bacteria | 930 |
| 553 | Ga0451801_35813 | 3300041455 | Bacteria | 1345 |
| 554 | Ga0451803_08367 | 3300041457 | Bacteria | 864 |
| 555 | Ga0451798_0617325 | 3300041458 | Bacteria | 515 |
| 556 | Ga0451802_1537885 | 3300041460 | Bacteria | 955 |
| 557 | Ga0451805_061040 | 3300041461 | Bacteria | 1639 |
| 558 | Ga0451808_30401 | 3300041464 | Bacteria | 588 |
| 559 | Ga0451839_0695104 | 3300041496 | Bacteria | 510 |
| 560 | Ga0451839_0847847 | 3300041496 | Bacteria | 587 |
| 561 | Ga0451839_1229688 | 3300041496 | Bacteria | 678 |
| 562 | Ga0451843_0055671 | 3300041509 | Bacteria | 741 |
| 563 | Ga0451843_1768234 | 3300041509 | Bacteria | 671 |
| 564 | Ga0439431_0149718 | 3300041997 | Bacteria | 663 |
| 565 | Ga0439431_0173237 | 3300041997 | Bacteria | 621 |
| 566 | Ga0439445_0023544 | 3300042004 | Bacteria | 1560 |
| 567 | Ga0439432_110799 | 3300042006 | Bacteria | 817 |
| 568 | Ga0439449_0108023 | 3300042007 | Bacteria | 1030 |
| 569 | Ga0439452_055235 | 3300042010 | Bacteria | 900 |
| 570 | Ga0439455_0168740 | 3300042012 | Bacteria | 628 |
| 571 | Ga0450914_001376 | 3300042118 | Bacteria | 1509 |
| 572 | Ga0450895_020207 | 3300042132 | Bacteria | 615 |
| 573 | Ga0450905_012598 | 3300042142 | Bacteria | 1191 |
| 574 | Ga0450906_109365 | 3300042145 | Bacteria | 507 |
| 575 | Ga0439446_0054400 | 3300042156 | Bacteria | 1200 |
| 576 | Ga0439459_0073839 | 3300042438 | Bacteria | 794 |
| 577 | Ga0439459_0208381 | 3300042438 | Bacteria | 537 |
| 578 | Ga0439460_0220407 | 3300042461 | Bacteria | 650 |
| 579 | Ga0450893_0021936 | 3300042532 | Bacteria | 1104 |
| 580 | Ga0451577_0018151 | 3300042876 | Bacteria | 6483 |
| 581 | Ga0451577_0761776 | 3300042876 | Bacteria | 875 |
| 582 | Ga0439440_0089182 | 3300042993 | Bacteria | 825 |
| 583 | Ga0453683_0103988 | 3300044673 | Bacteria | 1784 |
| 584 | Ga0453683_0452538 | 3300044673 | Bacteria | 830 |
| 585 | Ga0466965_0331637 | 3300044683 | Bacteria | 830 |
| 586 | Ga0466965_0442654 | 3300044683 | Bacteria | 723 |
| 587 | Ga0466966_0759665 | 3300044684 | Bacteria | 584 |
| 588 | Ga0466964_0239149 | 3300044706 | Bacteria | 890 |
| 589 | Ga0453684_0007381 | 3300044712 | Bacteria | 20256 |
| 590 | Ga0453684_1356476 | 3300044712 | Bacteria | 739 |
| 591 | Ga0466971_0452486 | 3300044719 | Bacteria | 630 |
| 592 | Ga0466968_0056953 | 3300044735 | Bacteria | 1679 |
| 593 | Ga0466970_0371334 | 3300044765 | Bacteria | 813 |
| 594 | Ga0466970_0471772 | 3300044765 | Bacteria | 721 |
| 595 | Ga0466957_0902304 | 3300044842 | Bacteria | 632 |
| 596 | Ga0466960_0051465 | 3300044901 | Bacteria | 1990 |
| 597 | Ga0466960_0079876 | 3300044901 | Bacteria | 1646 |
| 598 | Ga0466960_0410521 | 3300044901 | Bacteria | 781 |
| 599 | Ga0451576_0003979 | 3300045051 | Bacteria | 19673 |
| 600 | Ga0451576_0049923 | 3300045051 | Bacteria | 4390 |
| 601 | Ga0451576_0212441 | 3300045051 | Bacteria | 2020 |
| 602 | Ga0451576_0799428 | 3300045051 | Bacteria | 990 |
| 603 | Ga0466958_0827902 | 3300045836 | Bacteria | 604 |
| 604 | Ga0466967_1475832 | 3300045976 | Bacteria | 677 |
| 605 | Ga0466967_1794277 | 3300045976 | Bacteria | 611 |
| 606 | Ga0466967_1971071 | 3300045976 | Bacteria | 581 |
| 607 | Ga0495617_170429 | 3300046452 | Bacteria | 688 |
| 608 | Ga0495603_0029274 | 3300046455 | Bacteria | 3321 |
| 609 | Ga0495603_0176416 | 3300046455 | Bacteria | 1237 |
| 610 | Ga0495590_0018187 | 3300046457 | Bacteria | 2519 |
| 611 | Ga0495638_0209432 | 3300046460 | Bacteria | 1096 |
| 612 | Ga0495638_0478707 | 3300046460 | Bacteria | 631 |
| 613 | Ga0495641_0039986 | 3300046461 | Bacteria | 2183 |
| 614 | Ga0495580_0315331 | 3300046472 | Bacteria | 1063 |
| 615 | Ga0495580_0587980 | 3300046472 | Bacteria | 736 |
| 616 | Ga0495582_0013538 | 3300046473 | Bacteria | 4492 |
| 617 | Ga0495582_0229562 | 3300046473 | Bacteria | 1063 |
| 618 | Ga0495582_0324047 | 3300046473 | Bacteria | 886 |
| 619 | Ga0495582_0447538 | 3300046473 | Bacteria | 746 |
| 620 | Ga0495582_0550981 | 3300046473 | Bacteria | 667 |
| 621 | Ga0495605_0036527 | 3300046474 | Bacteria | 2477 |
| 622 | Ga0495639_0067778 | 3300046475 | Bacteria | 1644 |
| 623 | Ga0495662_0528191 | 3300046476 | Bacteria | 578 |
| 624 | Ga0495584_0079201 | 3300046491 | Bacteria | 1653 |
| 625 | Ga0495584_0372397 | 3300046491 | Bacteria | 725 |
| 626 | Ga0495584_0515047 | 3300046491 | Bacteria | 609 |
| 627 | Ga0495594_0218487 | 3300046499 | Bacteria | 1087 |
| 628 | Ga0495594_0520465 | 3300046499 | Bacteria | 675 |
| 629 | Ga0495596_0317432 | 3300046500 | Bacteria | 606 |
| 630 | Ga0495616_0100407 | 3300046513 | Bacteria | 1358 |
| 631 | Ga0495630_0196254 | 3300046517 | Bacteria | 1540 |
| 632 | Ga0495630_0405713 | 3300046517 | Bacteria | 1044 |
| 633 | Ga0495631_0252621 | 3300046518 | Bacteria | 751 |
| 634 | Ga0495632_0494389 | 3300046519 | Bacteria | 528 |
| 635 | Ga0495663_0034649 | 3300046525 | Bacteria | 1513 |
| 636 | Ga0495642_0373751 | 3300046528 | Bacteria | 627 |
| 637 | Ga0495642_0412170 | 3300046528 | Bacteria | 596 |
| 638 | Ga0495642_0444367 | 3300046528 | Bacteria | 573 |
| 639 | Ga0495665_0058685 | 3300046531 | Bacteria | 2032 |
| 640 | Ga0495665_0160378 | 3300046531 | Bacteria | 1172 |
| 641 | Ga0495665_0204499 | 3300046531 | Bacteria | 1023 |
| 642 | Ga0495665_0539679 | 3300046531 | Bacteria | 586 |
| 643 | Ga0495586_0053697 | 3300046535 | Bacteria | 2183 |
| 644 | Ga0495609_0091258 | 3300046538 | Bacteria | 1325 |
| 645 | Ga0495597_0068974 | 3300046542 | Bacteria | 1527 |
| 646 | Ga0495597_0079257 | 3300046542 | Bacteria | 1407 |
| 647 | Ga0495622_0237134 | 3300046557 | Bacteria | 805 |
| 648 | Ga0495633_0353752 | 3300046558 | Bacteria | 665 |
| 649 | Ga0495656_0077328 | 3300046615 | Bacteria | 1493 |
| 650 | Ga0495656_0555594 | 3300046615 | Bacteria | 612 |
| 651 | Ga0495656_0754794 | 3300046615 | Bacteria | 525 |
| 652 | Ga0495668_0095498 | 3300046616 | Bacteria | 1627 |
| 653 | Ga0495625_0482409 | 3300046660 | Bacteria | 761 |
| 654 | Ga0495625_0842533 | 3300046660 | Bacteria | 530 |
| 655 | Ga0495659_0059455 | 3300046664 | Bacteria | 1408 |
| 656 | Ga0495659_0376048 | 3300046664 | Bacteria | 610 |
| 657 | Ga0495661_0263467 | 3300046665 | Bacteria | 875 |
| 658 | Ga0495623_0639075 | 3300046679 | Bacteria | 550 |
| 659 | Ga0495647_0146014 | 3300046681 | Bacteria | 1011 |
| 660 | Ga0495658_0015745 | 3300046683 | Bacteria | 3883 |
| 661 | Ga0495658_0258897 | 3300046683 | Bacteria | 1095 |
| 662 | Ga0495669_0133842 | 3300046684 | Bacteria | 1168 |
| 663 | Ga0495613_0169344 | 3300046689 | Bacteria | 1551 |
| 664 | Ga0495613_0821789 | 3300046689 | Bacteria | 605 |
| 665 | Ga0495624_0544032 | 3300046690 | Bacteria | 693 |
| 666 | Ga0495670_0214308 | 3300046691 | Bacteria | 1022 |
| 667 | Ga0495670_0246030 | 3300046691 | Bacteria | 953 |
| 668 | Ga0495671_0356069 | 3300046692 | Bacteria | 702 |
| 669 | Ga0495589_0034414 | 3300046794 | Bacteria | 2544 |
| 670 | Ga0495589_0384693 | 3300046794 | Bacteria | 645 |
| 671 | Ga0495660_0177699 | 3300046810 | Bacteria | 1032 |
| 672 | Ga0495581_0101344 | 3300047315 | Bacteria | 1673 |
| 673 | Ga0495581_0116374 | 3300047315 | Bacteria | 1554 |
| 674 | Ga0495636_0295753 | 3300047318 | Bacteria | 757 |
| 675 | Ga0495672_0102786 | 3300047320 | Bacteria | 1547 |
| 676 | Ga0495672_0158321 | 3300047320 | Bacteria | 1167 |
| 677 | Ga0495676_0344460 | 3300047321 | Bacteria | 997 |
| 678 | Ga0495676_0792558 | 3300047321 | Bacteria | 610 |
| 679 | Ga0495675_0396115 | 3300047444 | Bacteria | 806 |
| 680 | Ga0495677_0380161 | 3300047445 | Bacteria | 558 |
| 681 | Ga0495677_0429704 | 3300047445 | Bacteria | 523 |
| 682 | Ga0495679_051517 | 3300047446 | Bacteria | 1234 |
| 683 | Ga0495684_0112941 | 3300047471 | Bacteria | 2048 |
| 684 | Ga0495626_0036606 | 3300048091 | Bacteria | 2337 |
| 685 | Ga0496100_0300013 | 3300048903 | Bacteria | 1202 |
| 686 | Ga0496100_0952312 | 3300048903 | Bacteria | 675 |
| 687 | Ga0496100_1249570 | 3300048903 | Bacteria | 586 |
| 688 | Ga0496101_0080044 | 3300048904 | Bacteria | 2413 |
| 689 | Ga0496101_0125826 | 3300048904 | Bacteria | 1942 |
| 690 | Ga0496102_0188965 | 3300048905 | Bacteria | 1941 |
| 691 | Ga0496102_0896913 | 3300048905 | Bacteria | 808 |
| 692 | Ga0496103_0337634 | 3300048906 | Bacteria | 969 |
| 693 | Ga0496103_0718279 | 3300048906 | Bacteria | 633 |
| 694 | Ga0496104_0169874 | 3300048907 | Bacteria | 2091 |
| 695 | Ga0496104_0641772 | 3300048907 | Bacteria | 971 |
| 696 | Ga0496105_0098094 | 3300048908 | Bacteria | 2420 |
| 697 | Ga0496106_0042430 | 3300048909 | Bacteria | 3412 |
| 698 | Ga0496106_0201575 | 3300048909 | Bacteria | 1584 |
| 699 | Ga0496106_0446461 | 3300048909 | Bacteria | 1039 |
| 700 | Ga0496107_0209823 | 3300048910 | Bacteria | 1448 |
| 701 | Ga0496108_0061551 | 3300048911 | Bacteria | 3159 |
| 702 | Ga0496108_0314202 | 3300048911 | Bacteria | 1365 |
| 703 | Ga0496108_1097007 | 3300048911 | Bacteria | 676 |
| 704 | Ga0496109_0062553 | 3300048912 | Bacteria | 3404 |
| 705 | Ga0496109_0080328 | 3300048912 | Bacteria | 3004 |
| 706 | Ga0496109_0090762 | 3300048912 | Bacteria | 2826 |
| 707 | Ga0496110_0056619 | 3300048913 | Bacteria | 3450 |
| 708 | Ga0496110_0366619 | 3300048913 | Bacteria | 1312 |
| 709 | Ga0496111_0113884 | 3300048914 | Bacteria | 1993 |
| 710 | Ga0496112_0021255 | 3300048915 | Bacteria | 6169 |
| 711 | Ga0496112_0046863 | 3300048915 | Bacteria | 4241 |
| 712 | Ga0496112_0119112 | 3300048915 | Bacteria | 2610 |
| 713 | Ga0496112_0378328 | 3300048915 | Bacteria | 1357 |
| 714 | Ga0496112_1374904 | 3300048915 | Bacteria | 621 |
| 715 | Ga0496114_0695189 | 3300048917 | Bacteria | 892 |
| 716 | Ga0496114_0755235 | 3300048917 | Bacteria | 850 |
| 717 | Ga0496115_0076081 | 3300048918 | Bacteria | 2728 |
| 718 | Ga0496115_0170521 | 3300048918 | Bacteria | 1800 |
| 719 | Ga0496115_1292279 | 3300048918 | Bacteria | 544 |
| 720 | Ga0496116_0449943 | 3300048919 | Bacteria | 552 |
| 721 | Ga0496121_0208825 | 3300048924 | Bacteria | 1385 |
| 722 | Ga0496121_0211646 | 3300048924 | Bacteria | 1373 |
| 723 | Ga0496121_0300405 | 3300048924 | Bacteria | 1090 |
| 724 | Ga0496124_0209237 | 3300048927 | Bacteria | 1477 |
| 725 | Ga0496126_0713111 | 3300048929 | Bacteria | 778 |
| 726 | Ga0496126_0909978 | 3300048929 | Bacteria | 666 |
| 727 | Ga0501306_011033 | 3300049127 | Bacteria | 1146 |
| 728 | Ga0501306_038222 | 3300049127 | Bacteria | 736 |
| 729 | Ga0501306_063005 | 3300049127 | Bacteria | 614 |
| 730 | Ga0501309_027981 | 3300049129 | Bacteria | 820 |
| 731 | Ga0501309_044312 | 3300049129 | Bacteria | 686 |
| 732 | Ga0501310_008648 | 3300049130 | Bacteria | 1109 |
| 733 | Ga0501305_028967 | 3300049161 | Bacteria | 855 |
| 734 | Ga0501305_041646 | 3300049161 | Bacteria | 749 |
| 735 | Ga0501307_002581 | 3300049162 | Bacteria | 1702 |
| 736 | Ga0501307_028701 | 3300049162 | Bacteria | 762 |
| 737 | Ga0501316_035480 | 3300049532 | Bacteria | 681 |
| 738 | Ga0501318_000576 | 3300049534 | Bacteria | 2418 |
| 739 | Ga0501320_000727 | 3300049536 | Bacteria | 2080 |
| 740 | Ga0501320_001422 | 3300049536 | Bacteria | 1758 |
| 741 | Ga0501320_066417 | 3300049536 | Bacteria | 515 |
| 742 | Ga0501323_027089 | 3300049539 | Bacteria | 788 |
| 743 | Ga0501324_006579 | 3300049540 | Bacteria | 983 |
| 744 | Ga0501327_14510 | 3300049543 | Bacteria | 551 |
| 745 | Ga0501031_0093208 | 3300049568 | Bacteria | 1966 |
| 746 | Ga0501031_0233489 | 3300049568 | Bacteria | 1197 |
| 747 | Ga0501031_0272932 | 3300049568 | Bacteria | 1098 |
| 748 | Ga0501031_0442911 | 3300049568 | Bacteria | 839 |
| 749 | Ga0501032_0015661 | 3300049569 | Bacteria | 5345 |
| 750 | Ga0501032_0035186 | 3300049569 | Bacteria | 3426 |
| 751 | Ga0501032_0295651 | 3300049569 | Bacteria | 1047 |
| 752 | Ga0501032_0845257 | 3300049569 | Bacteria | 577 |
| 753 | Ga0501033_0044470 | 3300049570 | Bacteria | 3305 |
| 754 | Ga0501033_0120539 | 3300049570 | Bacteria | 1904 |
| 755 | Ga0501033_0197703 | 3300049570 | Bacteria | 1437 |
| 756 | Ga0501033_0301892 | 3300049570 | Bacteria | 1127 |
| 757 | Ga0501033_0403347 | 3300049570 | Bacteria | 953 |
| 758 | Ga0501033_0538628 | 3300049570 | Bacteria | 805 |
| 759 | Ga0501034_0000482 | 3300049571 | Bacteria | 65380 |
| 760 | Ga0501034_0049039 | 3300049571 | Bacteria | 4261 |
| 761 | Ga0501034_0109362 | 3300049571 | Bacteria | 2755 |
| 762 | Ga0501034_0151831 | 3300049571 | Bacteria | 2292 |
| 763 | Ga0501034_0405129 | 3300049571 | Bacteria | 1286 |
| 764 | Ga0501034_0475920 | 3300049571 | Bacteria | 1164 |
| 765 | Ga0501034_0476017 | 3300049571 | Bacteria | 1164 |
| 766 | Ga0501034_0757261 | 3300049571 | Bacteria | 866 |
| 767 | Ga0501034_1433094 | 3300049571 | Bacteria | 565 |
| 768 | Ga0501036_0037299 | 3300049572 | Bacteria | 4112 |
| 769 | Ga0501036_0043498 | 3300049572 | Bacteria | 3804 |
| 770 | Ga0501036_0879387 | 3300049572 | Bacteria | 736 |
| 771 | Ga0501036_0940824 | 3300049572 | Bacteria | 708 |
| 772 | Ga0501036_1022627 | 3300049572 | Bacteria | 676 |
| 773 | Ga0501036_1468069 | 3300049572 | Bacteria | 552 |
| 774 | Ga0501037_0016304 | 3300049573 | Bacteria | 5468 |
| 775 | Ga0501037_0054390 | 3300049573 | Bacteria | 2927 |
| 776 | Ga0501037_0276370 | 3300049573 | Bacteria | 1171 |
| 777 | Ga0501037_0536280 | 3300049573 | Bacteria | 791 |
| 778 | Ga0501037_0810173 | 3300049573 | Bacteria | 618 |
| 779 | Ga0501038_0051319 | 3300049574 | Bacteria | 3560 |
| 780 | Ga0501038_0071829 | 3300049574 | Bacteria | 2935 |
| 781 | Ga0501038_0157001 | 3300049574 | Bacteria | 1852 |
| 782 | Ga0501038_0160280 | 3300049574 | Bacteria | 1829 |
| 783 | Ga0501038_0290242 | 3300049574 | Bacteria | 1286 |
| 784 | Ga0501038_0535092 | 3300049574 | Bacteria | 893 |
| 785 | Ga0501038_0978970 | 3300049574 | Bacteria | 622 |
| 786 | Ga0501039_0008725 | 3300049575 | Bacteria | 7719 |
| 787 | Ga0501039_0940187 | 3300049575 | Bacteria | 672 |
| 788 | Ga0501040_0001777 | 3300049576 | Bacteria | 13865 |
| 789 | Ga0501040_0333344 | 3300049576 | Bacteria | 1086 |
| 790 | Ga0501040_0577367 | 3300049576 | Bacteria | 812 |
| 791 | Ga0501040_0747365 | 3300049576 | Bacteria | 708 |
| 792 | Ga0501041_0060253 | 3300049577 | Bacteria | 2323 |
| 793 | Ga0501042_0027487 | 3300049578 | Bacteria | 4001 |
| 794 | Ga0501042_0119502 | 3300049578 | Bacteria | 1897 |
| 795 | Ga0501042_0198415 | 3300049578 | Bacteria | 1447 |
| 796 | Ga0501042_0202009 | 3300049578 | Bacteria | 1433 |
| 797 | Ga0501043_0035339 | 3300049579 | Bacteria | 3930 |
| 798 | Ga0501043_0064389 | 3300049579 | Bacteria | 2879 |
| 799 | Ga0501043_0283443 | 3300049579 | Bacteria | 1270 |
| 800 | Ga0501043_0284177 | 3300049579 | Bacteria | 1268 |
| 801 | Ga0501043_0300674 | 3300049579 | Bacteria | 1226 |
| 802 | Ga0501043_0711707 | 3300049579 | Bacteria | 733 |
| 803 | Ga0501046_0067063 | 3300049580 | Bacteria | 2795 |
| 804 | Ga0501046_0114041 | 3300049580 | Bacteria | 2062 |
| 805 | Ga0501046_0894257 | 3300049580 | Bacteria | 620 |
| 806 | Ga0501047_0035355 | 3300049581 | Bacteria | 4826 |
| 807 | Ga0501047_0366223 | 3300049581 | Bacteria | 1276 |
| 808 | Ga0501047_0396854 | 3300049581 | Bacteria | 1213 |
| 809 | Ga0501047_0561251 | 3300049581 | Bacteria | 965 |
| 810 | Ga0501048_0020171 | 3300049582 | Bacteria | 4888 |
| 811 | Ga0501048_0611238 | 3300049582 | Bacteria | 783 |
| 812 | Ga0501048_0906220 | 3300049582 | Bacteria | 634 |
| 813 | Ga0501048_1128766 | 3300049582 | Bacteria | 564 |
| 814 | Ga0501067_0273044 | 3300049583 | Bacteria | 941 |
| 815 | Ga0501068_0184691 | 3300049584 | Bacteria | 1319 |
| 816 | Ga0501068_0252218 | 3300049584 | Bacteria | 1125 |
| 817 | Ga0501068_0310709 | 3300049584 | Bacteria | 1010 |
| 818 | Ga0501068_0730687 | 3300049584 | Bacteria | 648 |
| 819 | Ga0501069_0000969 | 3300049585 | Bacteria | 13657 |
| 820 | Ga0501069_0030764 | 3300049585 | Bacteria | 2949 |
| 821 | Ga0501069_0172860 | 3300049585 | Bacteria | 1247 |
| 822 | Ga0501069_0238789 | 3300049585 | Bacteria | 1059 |
| 823 | Ga0501070_0043862 | 3300049586 | Bacteria | 3721 |
| 824 | Ga0501070_0046897 | 3300049586 | Bacteria | 3594 |
| 825 | Ga0501070_0070015 | 3300049586 | Bacteria | 2904 |
| 826 | Ga0501071_0020326 | 3300049587 | Bacteria | 4613 |
| 827 | Ga0501071_0585217 | 3300049587 | Bacteria | 858 |
| 828 | Ga0501071_1017905 | 3300049587 | Bacteria | 640 |
| 829 | Ga0501071_1481511 | 3300049587 | Bacteria | 524 |
| 830 | Ga0501072_0158728 | 3300049588 | Bacteria | 1804 |
| 831 | Ga0501072_0625140 | 3300049588 | Bacteria | 848 |
| 832 | Ga0501073_0061696 | 3300049589 | Bacteria | 2615 |
| 833 | Ga0501073_0103447 | 3300049589 | Bacteria | 1977 |
| 834 | Ga0501073_0171716 | 3300049589 | Bacteria | 1501 |
| 835 | Ga0501073_0181298 | 3300049589 | Bacteria | 1457 |
| 836 | Ga0501073_0302090 | 3300049589 | Bacteria | 1104 |
| 837 | Ga0501073_0447129 | 3300049589 | Bacteria | 893 |
| 838 | Ga0501074_0011507 | 3300049590 | Bacteria | 6432 |
| 839 | Ga0501074_0028285 | 3300049590 | Bacteria | 4063 |
| 840 | Ga0501074_0445646 | 3300049590 | Bacteria | 918 |
| 841 | Ga0501074_0649292 | 3300049590 | Bacteria | 745 |
| 842 | Ga0501074_0745184 | 3300049590 | Bacteria | 691 |
| 843 | Ga0501075_0964838 | 3300049591 | Bacteria | 648 |
| 844 | Ga0501075_1379473 | 3300049591 | Bacteria | 534 |
| 845 | Ga0501075_1546443 | 3300049591 | Bacteria | 502 |
| 846 | Ga0501076_0020486 | 3300049592 | Bacteria | 5063 |
| 847 | Ga0501076_0222571 | 3300049592 | Bacteria | 1542 |
| 848 | Ga0501077_0052349 | 3300049593 | Bacteria | 2593 |
| 849 | Ga0501077_0426384 | 3300049593 | Bacteria | 849 |
| 850 | Ga0501206_033539 | 3300049653 | Bacteria | 771 |
| 851 | Ga0501251_046887 | 3300049681 | Bacteria | 673 |
| 852 | Ga0501259_065450 | 3300049688 | Bacteria | 769 |
| 853 | Ga0501261_033554 | 3300049690 | Bacteria | 785 |
| 854 | Ga0501079_0005549 | 3300049741 | Bacteria | 9408 |
| 855 | Ga0501079_0029888 | 3300049741 | Bacteria | 4186 |
| 856 | Ga0501079_0397195 | 3300049741 | Bacteria | 1081 |
| 857 | Ga0501079_1035571 | 3300049741 | Bacteria | 647 |
| 858 | Ga0501080_0046194 | 3300049742 | Bacteria | 4056 |
| 859 | Ga0501080_0219114 | 3300049742 | Bacteria | 1742 |
| 860 | Ga0501080_0371191 | 3300049742 | Bacteria | 1290 |
| 861 | Ga0501080_0380505 | 3300049742 | Bacteria | 1272 |
| 862 | Ga0501080_0840651 | 3300049742 | Bacteria | 803 |
| 863 | Ga0501080_0918823 | 3300049742 | Bacteria | 762 |
| 864 | Ga0501081_0002099 | 3300049743 | Bacteria | 12454 |
| 865 | Ga0501081_1385466 | 3300049743 | Bacteria | 534 |
| 866 | Ga0501083_0018111 | 3300049744 | Bacteria | 4910 |
| 867 | Ga0501266_030623 | 3300049763 | Bacteria | 767 |
| 868 | Ga0501035_0003888 | 3300049822 | Bacteria | 14246 |
| 869 | Ga0501035_0046074 | 3300049822 | Bacteria | 3922 |
| 870 | Ga0501035_0051238 | 3300049822 | Bacteria | 3696 |
| 871 | Ga0501035_0120480 | 3300049822 | Bacteria | 2294 |
| 872 | Ga0501035_0192367 | 3300049822 | Bacteria | 1754 |
| 873 | Ga0501035_1245537 | 3300049822 | Bacteria | 576 |
| 874 | Ga0501035_1476699 | 3300049822 | Bacteria | 519 |
| 875 | Ga0501044_0000222 | 3300049823 | Bacteria | 71930 |
| 876 | Ga0501044_0017505 | 3300049823 | Bacteria | 7690 |
| 877 | Ga0501044_0031615 | 3300049823 | Bacteria | 5570 |
| 878 | Ga0501044_0048954 | 3300049823 | Bacteria | 4363 |
| 879 | Ga0501044_0132345 | 3300049823 | Bacteria | 2487 |
| 880 | Ga0501044_0321313 | 3300049823 | Bacteria | 1472 |
| 881 | Ga0501044_0391300 | 3300049823 | Bacteria | 1304 |
| 882 | Ga0501044_1621238 | 3300049823 | Bacteria | 512 |
| 883 | Ga0501045_0058715 | 3300049824 | Bacteria | 2817 |
| 884 | Ga0501045_0072947 | 3300049824 | Bacteria | 2527 |
| 885 | Ga0501212_080625 | 3300049851 | Bacteria | 588 |
| 886 | nmdc:mga03683_12339_c1 | 3300050489 | Bacteria | 3118 |
| 887 | nmdc:mga03683_127600_c1 | 3300050489 | Bacteria | 1136 |
| 888 | nmdc:mga03683_254847_c1 | 3300050489 | Bacteria | 816 |
| 889 | nmdc:mga03683_30010_c1 | 3300050489 | Bacteria | 2173 |
| 890 | nmdc:mga03683_528534_c1 | 3300050489 | Bacteria | 573 |
| 891 | nmdc:mga03n38_14252_c1 | 3300050490 | Bacteria | 3042 |
| 892 | nmdc:mga03n38_510125_c1 | 3300050490 | Bacteria | 676 |
| 893 | nmdc:mga03n38_520422_c1 | 3300050490 | Bacteria | 670 |
| 894 | nmdc:mga00v17_100631_c1 | 3300050491 | Bacteria | 1824 |
| 895 | nmdc:mga00v17_231521_c1 | 3300050491 | Bacteria | 1197 |
| 896 | nmdc:mga00v17_81837_c1 | 3300050491 | Bacteria | 2017 |
| 897 | nmdc:mga0yw44_11167_c1 | 3300050492 | Bacteria | 4621 |
| 898 | nmdc:mga0yw44_414509_c1 | 3300050492 | Bacteria | 912 |
| 899 | nmdc:mga0yw44_60321_c1 | 3300050492 | Bacteria | 2323 |
| 900 | nmdc:mga0k408_1021_c1 | 3300050493 | Bacteria | 15347 |
| 901 | nmdc:mga06z11_160028_c1 | 3300050494 | Bacteria | 1286 |
| 902 | nmdc:mga06z11_330740_c1 | 3300050494 | Bacteria | 910 |
| 903 | nmdc:mga06z11_365311_c1 | 3300050494 | Bacteria | 865 |
| 904 | nmdc:mga07m45_5559_c1 | 3300050496 | Bacteria | 6288 |
| 905 | nmdc:mga05p37_1676427_c1 | 3300050507 | Bacteria | 621 |
| 906 | nmdc:mga05p37_1773_c1 | 3300050507 | Bacteria | 25196 |
| 907 | nmdc:mga05p37_371627_c1 | 3300050507 | Bacteria | 1678 |
| 908 | nmdc:mga05p37_42475_c1 | 3300050507 | Bacteria | 5586 |
| 909 | nmdc:mga05p37_84457_c1 | 3300050507 | Bacteria | 3912 |
| 910 | nmdc:mga09592_1121654_c1 | 3300050508 | Bacteria | 653 |
| 911 | nmdc:mga09592_1398633_c1 | 3300050508 | Bacteria | 572 |
| 912 | nmdc:mga09592_188680_c1 | 3300050508 | Bacteria | 1784 |
| 913 | nmdc:mga09592_191101_c1 | 3300050508 | Bacteria | 1772 |
| 914 | nmdc:mga09592_952939_c1 | 3300050508 | Bacteria | 719 |
| 915 | nmdc:mga0qj67_44746_c1 | 3300050509 | Bacteria | 3491 |
| 916 | nmdc:mga0qj67_691431_c1 | 3300050509 | Bacteria | 812 |
| 917 | nmdc:mga06r32_10132_c1 | 3300050510 | Bacteria | 8509 |
| 918 | nmdc:mga06r32_164435_c1 | 3300050510 | Bacteria | 2202 |
| 919 | nmdc:mga06r32_1672188_c1 | 3300050510 | Bacteria | 574 |
| 920 | nmdc:mga06r32_489083_c1 | 3300050510 | Bacteria | 1208 |
| 921 | nmdc:mga08y16_1357597_c1 | 3300050511 | Bacteria | 675 |
| 922 | nmdc:mga08y16_136821_c1 | 3300050511 | Bacteria | 2546 |
| 923 | nmdc:mga08y16_93113_c1 | 3300050511 | Bacteria | 3140 |
| 924 | nmdc:mga0n895_468602_c1 | 3300050512 | Bacteria | 1271 |
| 925 | nmdc:mga0rr50_1048462_c1 | 3300050513 | Bacteria | 694 |
| 926 | nmdc:mga0rr50_184851_c1 | 3300050513 | Bacteria | 1705 |
| 927 | nmdc:mga0rr50_700375_c1 | 3300050513 | Bacteria | 864 |
| 928 | nmdc:mga08x19_223453_c1 | 3300050514 | Bacteria | 1294 |
| 929 | nmdc:mga08x19_383583_c1 | 3300050514 | Bacteria | 984 |
| 930 | nmdc:mga0a205_66873_c1 | 3300050515 | Bacteria | 3472 |
| 931 | nmdc:mga0a205_721670_c1 | 3300050515 | Bacteria | 846 |
| 932 | Ga0495612_0040216 | 3300053078 | Bacteria | 1904 |
| 933 | Ga0495655_0129211 | 3300053083 | Bacteria | 777 |
| 934 | Ga0495655_0174731 | 3300053083 | Bacteria | 689 |
| 935 | Ga0495595_0533955 | 3300053084 | Bacteria | 599 |
| 936 | Ga0500641_0002284 | 3300053096 | Bacteria | 6803 |
| 937 | Ga0500555_064131 | 3300053103 | Bacteria | 982 |
| 938 | Ga0500556_0014330 | 3300053104 | Bacteria | 2419 |
| 939 | Ga0500557_052121 | 3300053105 | Bacteria | 1314 |
| 940 | Ga0500562_004084 | 3300053108 | Bacteria | 3679 |
| 941 | Ga0500562_060493 | 3300053108 | Bacteria | 1017 |
| 942 | Ga0500593_225104 | 3300053117 | Bacteria | 655 |
| 943 | Ga0500621_302391 | 3300053126 | Bacteria | 511 |
| 944 | Ga0500655_067673 | 3300053133 | Bacteria | 725 |
| 945 | Ga0500559_0063546 | 3300053136 | Bacteria | 1650 |
| 946 | Ga0500561_0002020 | 3300053137 | Bacteria | 3370 |
| 947 | Ga0500604_0027297 | 3300053151 | Bacteria | 1651 |
| 948 | Ga0500616_0047381 | 3300053153 | Bacteria | 2282 |
| 949 | Ga0500616_0093711 | 3300053153 | Bacteria | 1481 |
| 950 | Ga0500616_0220183 | 3300053153 | Bacteria | 828 |
| 951 | Ga0500622_0036800 | 3300053156 | Bacteria | 2557 |
| 952 | Ga0500627_0055855 | 3300053158 | Bacteria | 1730 |
| 953 | Ga0500634_0207347 | 3300053161 | Bacteria | 854 |
| 954 | Ga0500645_050922 | 3300053730 | Bacteria | 1208 |
| 955 | Ga0501084_0014098 | 3300054114 | Bacteria | 6619 |
| 956 | Ga0501084_0077972 | 3300054114 | Bacteria | 2777 |
| 957 | Ga0501084_0143274 | 3300054114 | Bacteria | 2013 |
| 958 | Ga0501084_0264304 | 3300054114 | Bacteria | 1453 |
| 959 | Ga0501084_1180791 | 3300054114 | Bacteria | 642 |
| 960 | Ga0501084_1547921 | 3300054114 | Bacteria | 555 |
| 961 | Ga0501084_1784546 | 3300054114 | Bacteria | 514 |
| 962 | Ga0590071_138744 | 3300059421 | Bacteria | 627 |
| 963 | Ga0590074_077456 | 3300059423 | Bacteria | 632 |
| 964 | Ga0590075_040918 | 3300059424 | Bacteria | 1185 |
| 965 | Ga0587066_030641 | 3300059490 | Bacteria | 957 |
| 966 | Ga0587070_178161 | 3300059491 | Bacteria | 551 |
| 967 | Ga0587077_073015 | 3300059493 | Bacteria | 771 |
| 968 | Ga0587077_106651 | 3300059493 | Bacteria | 681 |
| 969 | Ga0587083_0028661 | 3300059505 | Bacteria | 1091 |
| 970 | Ga0587085_021339 | 3300059506 | Bacteria | 989 |
| 971 | Ga0587091_006969 | 3300059511 | Bacteria | 1611 |
| 972 | Ga0587091_020521 | 3300059511 | Bacteria | 1148 |
| 973 | Ga0587091_195005 | 3300059511 | Bacteria | 541 |
| 974 | Ga0587095_005287 | 3300059514 | Bacteria | 972 |
| 975 | Ga0587106_008775 | 3300059605 | Bacteria | 1269 |
| 976 | Ga0587106_099560 | 3300059605 | Bacteria | 592 |
| 977 | Ga0587101_139665 | 3300059623 | Bacteria | 516 |
| 978 | Ga0587109_076114 | 3300059624 | Bacteria | 734 |
| 979 | Ga0587115_083426 | 3300059626 | Bacteria | 570 |
| 980 | Ga0587128_035764 | 3300059630 | Bacteria | 846 |
| 981 | Ga0587062_086165 | 3300059639 | Bacteria | 591 |
| 982 | Ga0587068_077236 | 3300059641 | Bacteria | 667 |
| 983 | Ga0587076_008729 | 3300059645 | Bacteria | 1423 |
| 984 | Ga0587078_028397 | 3300059646 | Bacteria | 743 |
| 985 | Ga0587079_010177 | 3300059647 | Bacteria | 1484 |
| 986 | Ga0587100_014968 | 3300059648 | Bacteria | 706 |
| 987 | Ga0587105_009752 | 3300059651 | Bacteria | 717 |
| 988 | Ga0587107_033944 | 3300059652 | Bacteria | 792 |
| 989 | Ga0587124_025483 | 3300059660 | Bacteria | 628 |
| 990 | Ga0587111_0151900 | 3300060346 | Bacteria | 623 |
| 991 | Ga0501082_0006704 | 3300060353 | Bacteria | 9961 |
| 992 | Ga0501082_0019797 | 3300060353 | Bacteria | 5804 |
| 993 | Ga0501082_0269726 | 3300060353 | Bacteria | 1481 |
| 994 | Ga0501082_0353275 | 3300060353 | Bacteria | 1282 |
| 995 | Ga0501082_0653954 | 3300060353 | Bacteria | 920 |
| 996 | Ga0530510_0050130 | 3300061734 | Bacteria | 3015 |
| 997 | Ga0530510_0146352 | 3300061734 | Bacteria | 1743 |
| 998 | Ga0530510_0243345 | 3300061734 | Bacteria | 1340 |
| 999 | Ga0530510_0283034 | 3300061734 | Bacteria | 1239 |
| 1000 | Ga0530510_0812268 | 3300061734 | Bacteria | 714 |
| 1001 | Ga0530510_0948194 | 3300061734 | Bacteria | 658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0747365 | Ga0501040_0747365_12_335 | 78 |
| 2 | 3300031344 | Ga0265316_10497629 | Ga0265316_104976292 | 83 |
| 3 | 3300042006 | Ga0439432_110799 | Ga0439432_110799_26_364 | 83 |
| 4 | 3300042010 | Ga0439452_055235 | Ga0439452_055235_150_488 | 83 |
| 5 | 3300049572 | Ga0501036_0940824 | Ga0501036_0940824_179_517 | 83 |
| 6 | 3300049590 | Ga0501074_0445646 | Ga0501074_0445646_332_670 | 83 |
| 7 | 3300049591 | Ga0501075_1546443 | Ga0501075_1546443_21_359 | 83 |
| 8 | 3300049742 | Ga0501080_0840651 | Ga0501080_0840651_266_604 | 83 |
| 9 | 3300060353 | Ga0501082_0269726 | Ga0501082_0269726_449_787 | 83 |
| 10 | 3300061734 | Ga0530510_0283034 | Ga0530510_0283034_271_609 | 83 |
| 11 | 3300046460 | Ga0495638_0478707 | Ga0495638_0478707_99_371 | 86 |
| 12 | 3300013308 | Ga0157375_10288130 | Ga0157375_102881302 | 87 |
| 13 | 3300046475 | Ga0495639_0067778 | Ga0495639_0067778_1257_1520 | 87 |
| 14 | 3300049584 | Ga0501068_0310709 | Ga0501068_0310709_63_326 | 87 |
| 15 | iso_pu_bacteria | 2739367655 | 2739611114 | 87 |
| 16 | iso_pu_bacteria | 2881927736 | 2881928705 | 87 |
| 17 | iso_pu_bacteria | 2887375801 | 2887376462 | 87 |
| 18 | iso_pu_bacteria | 2895511927 | 2895513760 | 87 |
| 19 | iso_pu_bacteria | 8048746797 | 8048749963 | 87 |
| 20 | 3300005547 | Ga0070693_100234644 | Ga0070693_1002346442 | 88 |
| 21 | 3300009101 | Ga0105247_10739742 | Ga0105247_107397422 | 88 |
| 22 | 3300032002 | Ga0307416_102929555 | Ga0307416_1029295552 | 88 |
| 23 | 3300041496 | Ga0451839_0695104 | Ga0451839_0695104_91_357 | 88 |
| 24 | 3300045976 | Ga0466967_1794277 | Ga0466967_1794277_234_581 | 88 |
| 25 | iso_pu_bacteria | 2503198000 | 2503202663 | 88 |
| 26 | iso_pu_bacteria | 2508501123 | 2509117722 | 88 |
| 27 | iso_pu_bacteria | 2508501127 | 2509143593 | 88 |
| 28 | iso_pu_bacteria | 2509276018 | 2509372992 | 88 |
| 29 | iso_pu_bacteria | 2510065059 | 2510319916 | 88 |
| 30 | iso_pu_bacteria | 2512875016 | 2512930563 | 88 |
| 31 | iso_pu_bacteria | 2512875024 | 2512958295 | 88 |
| 32 | iso_pu_bacteria | 2513237164 | 2514032572 | 88 |
| 33 | iso_pu_bacteria | 2513237305 | 2514422083 | 88 |
| 34 | iso_pu_bacteria | 2588253730 | 2588516205 | 88 |
| 35 | iso_pu_bacteria | 2595698237 | 2596374056 | 88 |
| 36 | iso_pu_bacteria | 2597489875 | 2597813652 | 88 |
| 37 | iso_pu_bacteria | 2599185301 | 2599939540 | 88 |
| 38 | iso_pu_bacteria | 2643221551 | 2643775171 | 88 |
| 39 | iso_pu_bacteria | 2643221555 | 2643793617 | 88 |
| 40 | iso_pu_bacteria | 2643221595 | 2643987300 | 88 |
| 41 | iso_pu_bacteria | 2643221627 | 2644155624 | 88 |
| 42 | iso_pu_bacteria | 2687453392 | 2688599061 | 88 |
| 43 | iso_pu_bacteria | 2693429783 | 2694631910 | 88 |
| 44 | iso_pu_bacteria | 2693429784 | 2694634669 | 88 |
| 45 | iso_pu_bacteria | 2721755686 | 2723576065 | 88 |
| 46 | iso_pu_bacteria | 2756170246 | 2756677755 | 88 |
| 47 | iso_pu_bacteria | 2791355123 | 2792750748 | 88 |
| 48 | iso_pu_bacteria | 2821443989 | 2821444052 | 88 |
| 49 | iso_pu_bacteria | 2834578030 | 2834579291 | 88 |
| 50 | iso_pu_bacteria | 2840878972 | 2840883975 | 88 |
| 51 | iso_pu_bacteria | 2841734538 | 2841740454 | 88 |
| 52 | iso_pu_bacteria | 2842775625 | 2842778817 | 88 |
| 53 | iso_pu_bacteria | 2844002411 | 2844006799 | 88 |
| 54 | iso_pu_bacteria | 2844009547 | 2844014460 | 88 |
| 55 | iso_pu_bacteria | 2847670302 | 2847670793 | 88 |
| 56 | iso_pu_bacteria | 2847686936 | 2847687070 | 88 |
| 57 | iso_pu_bacteria | 2854681122 | 2854685322 | 88 |
| 58 | iso_pu_bacteria | 2856314179 | 2856316250 | 88 |
| 59 | iso_pu_bacteria | 2856320880 | 2856325074 | 88 |
| 60 | iso_pu_bacteria | 2856328259 | 2856330568 | 88 |
| 61 | iso_pu_bacteria | 2856334872 | 2856340868 | 88 |
| 62 | iso_pu_bacteria | 2856342000 | 2856345836 | 88 |
| 63 | iso_pu_bacteria | 2856349417 | 2856349738 | 88 |
| 64 | iso_pu_bacteria | 2856364286 | 2856369152 | 88 |
| 65 | iso_pu_bacteria | 2857349434 | 2857355584 | 88 |
| 66 | iso_pu_bacteria | 2857367948 | 2857372578 | 88 |
| 67 | iso_pu_bacteria | 2869162929 | 2869168979 | 88 |
| 68 | iso_pu_bacteria | 2869169390 | 2869174092 | 88 |
| 69 | iso_pu_bacteria | 2869234852 | 2869237164 | 88 |
| 70 | iso_pu_bacteria | 2869242130 | 2869243190 | 88 |
| 71 | iso_pu_bacteria | 2869249662 | 2869252739 | 88 |
| 72 | iso_pu_bacteria | 2869256925 | 2869262744 | 88 |
| 73 | iso_pu_bacteria | 2869264136 | 2869270261 | 88 |
| 74 | iso_pu_bacteria | 2869271264 | 2869273277 | 88 |
| 75 | iso_pu_bacteria | 2869278585 | 2869280904 | 88 |
| 76 | iso_pu_bacteria | 2869285874 | 2869288390 | 88 |
| 77 | iso_pu_bacteria | 2871429161 | 2871432099 | 88 |
| 78 | iso_pu_bacteria | 2871435913 | 2871439290 | 88 |
| 79 | iso_pu_bacteria | 2871444079 | 2871448834 | 88 |
| 80 | iso_pu_bacteria | 2871451962 | 2871455260 | 88 |
| 81 | iso_pu_bacteria | 2871459585 | 2871459677 | 88 |
| 82 | iso_pu_bacteria | 2871466892 | 2871470932 | 88 |
| 83 | iso_pu_bacteria | 2871474448 | 2871480992 | 88 |
| 84 | iso_pu_bacteria | 2871481445 | 2871484310 | 88 |
| 85 | iso_pu_bacteria | 2871495908 | 2871500456 | 88 |
| 86 | iso_pu_bacteria | 2874102143 | 2874106571 | 88 |
| 87 | iso_pu_bacteria | 2874109183 | 2874116549 | 88 |
| 88 | iso_pu_bacteria | 2874116593 | 2874120802 | 88 |
| 89 | iso_pu_bacteria | 2874123672 | 2874125707 | 88 |
| 90 | iso_pu_bacteria | 2874131515 | 2874136983 | 88 |
| 91 | iso_pu_bacteria | 2874139085 | 2874141428 | 88 |
| 92 | iso_pu_bacteria | 2874146452 | 2874150978 | 88 |
| 93 | iso_pu_bacteria | 2874155637 | 2874157317 | 88 |
| 94 | iso_pu_bacteria | 2874162495 | 2874163764 | 88 |
| 95 | iso_pu_bacteria | 2874168670 | 2874172571 | 88 |
| 96 | iso_pu_bacteria | 2876363079 | 2876368091 | 88 |
| 97 | iso_pu_bacteria | 2876369609 | 2876377612 | 88 |
| 98 | iso_pu_bacteria | 2876377896 | 2876378399 | 88 |
| 99 | iso_pu_bacteria | 2876386047 | 2876392722 | 88 |
| 100 | iso_pu_bacteria | 2876399893 | 2876400645 | 88 |
| 101 | iso_pu_bacteria | 2876406927 | 2876409343 | 88 |
| 102 | iso_pu_bacteria | 2876413966 | 2876417007 | 88 |
| 103 | iso_pu_bacteria | 2876420981 | 2876427164 | 88 |
| 104 | iso_pu_bacteria | 2878035449 | 2878041573 | 88 |
| 105 | iso_pu_bacteria | 2878730984 | 2878734409 | 88 |
| 106 | iso_pu_bacteria | 2878738818 | 2878743157 | 88 |
| 107 | iso_pu_bacteria | 2878745973 | 2878748818 | 88 |
| 108 | iso_pu_bacteria | 2878760144 | 2878764545 | 88 |
| 109 | iso_pu_bacteria | 2878767105 | 2878771646 | 88 |
| 110 | iso_pu_bacteria | 2878774303 | 2878776385 | 88 |
| 111 | iso_pu_bacteria | 2878781027 | 2878782384 | 88 |
| 112 | iso_pu_bacteria | 2878788777 | 2878796106 | 88 |
| 113 | iso_pu_bacteria | 2881147464 | 2881152550 | 88 |
| 114 | iso_pu_bacteria | 2881155292 | 2881155977 | 88 |
| 115 | iso_pu_bacteria | 2881161766 | 2881161794 | 88 |
| 116 | iso_pu_bacteria | 2881853255 | 2881859812 | 88 |
| 117 | iso_pu_bacteria | 2882632389 | 2882633061 | 88 |
| 118 | iso_pu_bacteria | 2885305155 | 2885310679 | 88 |
| 119 | iso_pu_bacteria | 2885312484 | 2885317443 | 88 |
| 120 | iso_pu_bacteria | 2885326080 | 2885326857 | 88 |
| 121 | iso_pu_bacteria | 2885342637 | 2885344968 | 88 |
| 122 | iso_pu_bacteria | 2885350715 | 2885356345 | 88 |
| 123 | iso_pu_bacteria | 2888337043 | 2888340695 | 88 |
| 124 | iso_pu_bacteria | 2888343758 | 2888347874 | 88 |
| 125 | iso_pu_bacteria | 2888350351 | 2888356891 | 88 |
| 126 | iso_pu_bacteria | 2889010040 | 2889011938 | 88 |
| 127 | iso_pu_bacteria | 2889016732 | 2889023130 | 88 |
| 128 | iso_pu_bacteria | 2889306138 | 2889311567 | 88 |
| 129 | iso_pu_bacteria | 2897803580 | 2897804182 | 88 |
| 130 | iso_pu_bacteria | 2898795034 | 2898796994 | 88 |
| 131 | iso_pu_bacteria | 2899275550 | 2899277176 | 88 |
| 132 | iso_pu_bacteria | 2902330777 | 2902334107 | 88 |
| 133 | iso_pu_bacteria | 2902405164 | 2902411806 | 88 |
| 134 | iso_pu_bacteria | 2903448605 | 2903452111 | 88 |
| 135 | iso_pu_bacteria | 2903492973 | 2903501556 | 88 |
| 136 | iso_pu_bacteria | 2903513507 | 2903521196 | 88 |
| 137 | iso_pu_bacteria | 2903521522 | 2903527087 | 88 |
| 138 | iso_pu_bacteria | 2903528002 | 2903533314 | 88 |
| 139 | iso_pu_bacteria | 2903540706 | 2903545269 | 88 |
| 140 | iso_pu_bacteria | 2906308376 | 2906311170 | 88 |
| 141 | iso_pu_bacteria | 2906321335 | 2906323937 | 88 |
| 142 | iso_pu_bacteria | 2906328253 | 2906328358 | 88 |
| 143 | iso_pu_bacteria | 2906354277 | 2906362588 | 88 |
| 144 | iso_pu_bacteria | 2906363423 | 2906370621 | 88 |
| 145 | iso_pu_bacteria | 2906370794 | 2906374325 | 88 |
| 146 | iso_pu_bacteria | 2906378014 | 2906378865 | 88 |
| 147 | iso_pu_bacteria | 2906386501 | 2906391760 | 88 |
| 148 | iso_pu_bacteria | 2906393657 | 2906398069 | 88 |
| 149 | iso_pu_bacteria | 2906401398 | 2906404631 | 88 |
| 150 | iso_pu_bacteria | 2906408224 | 2906410575 | 88 |
| 151 | iso_pu_bacteria | 2906414383 | 2906416387 | 88 |
| 152 | iso_pu_bacteria | 2906427513 | 2906432082 | 88 |
| 153 | iso_pu_bacteria | 2922130491 | 2922136225 | 88 |
| 154 | iso_pu_bacteria | 2922151315 | 2922154901 | 88 |
| 155 | iso_pu_bacteria | 2922158528 | 2922159636 | 88 |
| 156 | iso_pu_bacteria | 2922172374 | 2922175803 | 88 |
| 157 | iso_pu_bacteria | 2922178524 | 2922182765 | 88 |
| 158 | iso_pu_bacteria | 2922185730 | 2922191547 | 88 |
| 159 | iso_pu_bacteria | 2924710171 | 2924716985 | 88 |
| 160 | iso_pu_bacteria | 2924718760 | 2924724367 | 88 |
| 161 | iso_pu_bacteria | 2924726620 | 2924727281 | 88 |
| 162 | iso_pu_bacteria | 2924733363 | 2924736135 | 88 |
| 163 | iso_pu_bacteria | 2924741084 | 2924744180 | 88 |
| 164 | iso_pu_bacteria | 2924748358 | 2924750384 | 88 |
| 165 | iso_pu_bacteria | 2924754689 | 2924759039 | 88 |
| 166 | iso_pu_bacteria | 2924762789 | 2924763824 | 88 |
| 167 | iso_pu_bacteria | 2924776078 | 2924777271 | 88 |
| 168 | iso_pu_bacteria | 2928125067 | 2928129947 | 88 |
| 169 | iso_pu_bacteria | 2937813078 | 2937813391 | 88 |
| 170 | iso_pu_bacteria | 2937822353 | 2937826676 | 88 |
| 171 | iso_pu_bacteria | 2937836603 | 2937839992 | 88 |
| 172 | iso_pu_bacteria | 2937848649 | 2937853627 | 88 |
| 173 | iso_pu_bacteria | 2937861824 | 2937864413 | 88 |
| 174 | iso_pu_bacteria | 2937868953 | 2937869775 | 88 |
| 175 | iso_pu_bacteria | 2937877337 | 2937879324 | 88 |
| 176 | iso_pu_bacteria | 2937891427 | 2937898210 | 88 |
| 177 | iso_pu_bacteria | 2937972304 | 2937974942 | 88 |
| 178 | iso_pu_bacteria | 2937980651 | 2937986793 | 88 |
| 179 | iso_pu_bacteria | 2937994558 | 2937999119 | 88 |
| 180 | iso_pu_bacteria | 2938014810 | 2938019866 | 88 |
| 181 | iso_pu_bacteria | 2939669807 | 2939671389 | 88 |
| 182 | iso_pu_bacteria | 2958034702 | 2958036867 | 88 |
| 183 | iso_pu_bacteria | 2958041894 | 2958046316 | 88 |
| 184 | iso_pu_bacteria | 2958041894 | 2958050489 | 88 |
| 185 | iso_pu_bacteria | 2958064165 | 2958070271 | 88 |
| 186 | iso_pu_bacteria | 2958071322 | 2958072569 | 88 |
| 187 | iso_pu_bacteria | 2958084443 | 2958086499 | 88 |
| 188 | iso_pu_bacteria | 2958092219 | 2958095867 | 88 |
| 189 | iso_pu_bacteria | 2958100919 | 2958101585 | 88 |
| 190 | iso_pu_bacteria | 2958108152 | 2958112973 | 88 |
| 191 | iso_pu_bacteria | 2958115193 | 2958122494 | 88 |
| 192 | iso_pu_bacteria | 2958122699 | 2958130105 | 88 |
| 193 | iso_pu_bacteria | 2958130278 | 2958132791 | 88 |
| 194 | iso_pu_bacteria | 2958137437 | 2958142863 | 88 |
| 195 | iso_pu_bacteria | 2958144490 | 2958145628 | 88 |
| 196 | iso_pu_bacteria | 2958158011 | 2958162969 | 88 |
| 197 | iso_pu_bacteria | 2958165035 | 2958169593 | 88 |
| 198 | iso_pu_bacteria | 2958172287 | 2958177802 | 88 |
| 199 | iso_pu_bacteria | 2958179912 | 2958182923 | 88 |
| 200 | iso_pu_bacteria | 2961077736 | 2961080803 | 88 |
| 201 | iso_pu_bacteria | 2961127735 | 2961133185 | 88 |
| 202 | iso_pu_bacteria | 2961136820 | 2961139069 | 88 |
| 203 | iso_pu_bacteria | 2961163497 | 2961168053 | 88 |
| 204 | iso_pu_bacteria | 2961183825 | 2961186462 | 88 |
| 205 | iso_pu_bacteria | 2963644680 | 2963648664 | 88 |
| 206 | iso_pu_bacteria | 2965018300 | 2965022872 | 88 |
| 207 | iso_pu_bacteria | 2965025482 | 2965027343 | 88 |
| 208 | iso_pu_bacteria | 2965032056 | 2965032628 | 88 |
| 209 | iso_pu_bacteria | 2965040258 | 2965043353 | 88 |
| 210 | iso_pu_bacteria | 2965047637 | 2965051449 | 88 |
| 211 | iso_pu_bacteria | 2965062239 | 2965066168 | 88 |
| 212 | iso_pu_bacteria | 2965089291 | 2965091048 | 88 |
| 213 | iso_pu_bacteria | 2965102966 | 2965109560 | 88 |
| 214 | iso_pu_bacteria | 2965110997 | 2965118071 | 88 |
| 215 | iso_pu_bacteria | 2965119406 | 2965122195 | 88 |
| 216 | iso_pu_bacteria | 2968016561 | 2968017458 | 88 |
| 217 | iso_pu_bacteria | 2968083720 | 2968083891 | 88 |
| 218 | iso_pu_bacteria | 2968091066 | 2968092506 | 88 |
| 219 | iso_pu_bacteria | 2968097103 | 2968102406 | 88 |
| 220 | iso_pu_bacteria | 2968117919 | 2968122809 | 88 |
| 221 | iso_pu_bacteria | 2968128360 | 2968128763 | 88 |
| 222 | iso_pu_bacteria | 2968138860 | 2968146577 | 88 |
| 223 | iso_pu_bacteria | 2968171901 | 2968176453 | 88 |
| 224 | iso_pu_bacteria | 2970469710 | 2970472366 | 88 |
| 225 | iso_pu_bacteria | 2970489779 | 2970490913 | 88 |
| 226 | iso_pu_bacteria | 2970510686 | 2970513855 | 88 |
| 227 | iso_pu_bacteria | 2970524798 | 2970530009 | 88 |
| 228 | iso_pu_bacteria | 2970532167 | 2970538681 | 88 |
| 229 | iso_pu_bacteria | 2970540015 | 2970546598 | 88 |
| 230 | iso_pu_bacteria | 2970547951 | 2970548835 | 88 |
| 231 | iso_pu_bacteria | 2970554993 | 2970559392 | 88 |
| 232 | iso_pu_bacteria | 2970593180 | 2970595508 | 88 |
| 233 | iso_pu_bacteria | 2970619444 | 2970620324 | 88 |
| 234 | iso_pu_bacteria | 2970627176 | 2970631992 | 88 |
| 235 | iso_pu_bacteria | 2977843712 | 2977845391 | 88 |
| 236 | iso_pu_bacteria | 2977851361 | 2977851788 | 88 |
| 237 | iso_pu_bacteria | 2977858184 | 2977860269 | 88 |
| 238 | iso_pu_bacteria | 2977864932 | 2977871955 | 88 |
| 239 | iso_pu_bacteria | 2977872689 | 2977877707 | 88 |
| 240 | iso_pu_bacteria | 2977898635 | 2977906633 | 88 |
| 241 | iso_pu_bacteria | 2977907340 | 2977911815 | 88 |
| 242 | iso_pu_bacteria | 2977915119 | 2977917217 | 88 |
| 243 | iso_pu_bacteria | 2977922695 | 2977928130 | 88 |
| 244 | iso_pu_bacteria | 2977935797 | 2977939437 | 88 |
| 245 | iso_pu_bacteria | 2977942078 | 2977946924 | 88 |
| 246 | iso_pu_bacteria | 2977950692 | 2977951365 | 88 |
| 247 | iso_pu_bacteria | 2977957713 | 2977958670 | 88 |
| 248 | iso_pu_bacteria | 2977971508 | 2977976587 | 88 |
| 249 | iso_pu_bacteria | 2977986579 | 2977989490 | 88 |
| 250 | iso_pu_bacteria | 2979710463 | 2979716967 | 88 |
| 251 | iso_pu_bacteria | 2979742915 | 2979746034 | 88 |
| 252 | iso_pu_bacteria | 2979764755 | 2979765768 | 88 |
| 253 | iso_pu_bacteria | 2979772303 | 2979777658 | 88 |
| 254 | iso_pu_bacteria | 2979779861 | 2979783035 | 88 |
| 255 | iso_pu_bacteria | 2987636660 | 2987640718 | 88 |
| 256 | iso_pu_bacteria | 2987645492 | 2987647815 | 88 |
| 257 | iso_pu_bacteria | 2987652177 | 2987652492 | 88 |
| 258 | iso_pu_bacteria | 2987659509 | 2987664067 | 88 |
| 259 | iso_pu_bacteria | 2987666974 | 2987670292 | 88 |
| 260 | iso_pu_bacteria | 2987673487 | 2987674292 | 88 |
| 261 | iso_pu_bacteria | 2996341866 | 2996347145 | 88 |
| 262 | iso_pu_bacteria | 2996348954 | 2996351237 | 88 |
| 263 | iso_pu_bacteria | 2996386984 | 2996390908 | 88 |
| 264 | iso_pu_bacteria | 3000135777 | 3000136167 | 88 |
| 265 | iso_pu_bacteria | 3004167301 | 3004170191 | 88 |
| 266 | iso_pu_bacteria | 3004188549 | 3004193122 | 88 |
| 267 | iso_pu_bacteria | 3004195979 | 3004197761 | 88 |
| 268 | iso_pu_bacteria | 3004203850 | 3004208915 | 88 |
| 269 | iso_pu_bacteria | 3004211236 | 3004213101 | 88 |
| 270 | iso_pu_bacteria | 3004218560 | 3004222136 | 88 |
| 271 | iso_pu_bacteria | 3004232784 | 3004239291 | 88 |
| 272 | iso_pu_bacteria | 3004239961 | 3004242913 | 88 |
| 273 | iso_pu_bacteria | 3004248173 | 3004253242 | 88 |
| 274 | iso_pu_bacteria | 3004268573 | 3004273803 | 88 |
| 275 | iso_pu_bacteria | 3004275668 | 3004277935 | 88 |
| 276 | iso_pu_bacteria | 3004289098 | 3004290230 | 88 |
| 277 | iso_pu_bacteria | 3004334049 | 3004340239 | 88 |
| 278 | iso_pu_bacteria | 637000159 | 637073558 | 88 |
| 279 | iso_pu_bacteria | 649633066 | 649873494 | 88 |
| 280 | iso_pu_bacteria | 8004300914 | 8004304431 | 88 |
| 281 | iso_pu_bacteria | 8004312739 | 8004316466 | 88 |
| 282 | iso_pu_bacteria | 8004361976 | 8004366442 | 88 |
| 283 | iso_pu_bacteria | 8004387939 | 8004390921 | 88 |
| 284 | iso_pu_bacteria | 8004395343 | 8004402337 | 88 |
| 285 | iso_pu_bacteria | 8004445564 | 8004451613 | 88 |
| 286 | iso_pu_bacteria | 8004633249 | 8004638924 | 88 |
| 287 | iso_pu_bacteria | 8004640170 | 8004643104 | 88 |
| 288 | iso_pu_bacteria | 8004695233 | 8004701070 | 88 |
| 289 | iso_pu_bacteria | 8004703790 | 8004714454 | 88 |
| 290 | iso_pu_bacteria | 8004714634 | 8004717473 | 88 |
| 291 | iso_pu_bacteria | 8004727605 | 8004731769 | 88 |
| 292 | iso_pu_bacteria | 8055617313 | 8055622007 | 88 |
| 293 | 3300005614 | Ga0068856_100629195 | Ga0068856_1006291953 | 89 |
| 294 | 3300013297 | Ga0157378_12824613 | Ga0157378_128246132 | 89 |
| 295 | 3300025917 | Ga0207660_10769704 | Ga0207660_107697042 | 89 |
| 296 | 3300037471 | Ga0395905_0537049 | Ga0395905_0537049_70_348 | 89 |
| 297 | 3300046615 | Ga0495656_0077328 | Ga0495656_0077328_1203_1472 | 89 |
| 298 | 3300049536 | Ga0501320_066417 | Ga0501320_066417_73_342 | 89 |
| 299 | 3300049568 | Ga0501031_0272932 | Ga0501031_0272932_107_484 | 89 |
| 300 | 3300049571 | Ga0501034_1433094 | Ga0501034_1433094_217_495 | 89 |
| 301 | 3300049572 | Ga0501036_0043498 | Ga0501036_0043498_1110_1487 | 89 |
| 302 | 3300049573 | Ga0501037_0536280 | Ga0501037_0536280_82_459 | 89 |
| 303 | 3300049574 | Ga0501038_0071829 | Ga0501038_0071829_676_1053 | 89 |
| 304 | 3300049576 | Ga0501040_0001777 | Ga0501040_0001777_10536_10913 | 89 |
| 305 | 3300049577 | Ga0501041_0060253 | Ga0501041_0060253_1072_1449 | 89 |
| 306 | 3300049578 | Ga0501042_0027487 | Ga0501042_0027487_688_1065 | 89 |
| 307 | 3300049579 | Ga0501043_0300674 | Ga0501043_0300674_143_520 | 89 |
| 308 | 3300049580 | Ga0501046_0114041 | Ga0501046_0114041_1112_1489 | 89 |
| 309 | 3300049585 | Ga0501069_0172860 | Ga0501069_0172860_807_1184 | 89 |
| 310 | 3300049588 | Ga0501072_0158728 | Ga0501072_0158728_795_1172 | 89 |
| 311 | 3300049590 | Ga0501074_0028285 | Ga0501074_0028285_1325_1702 | 89 |
| 312 | 3300049592 | Ga0501076_0020486 | Ga0501076_0020486_3575_3952 | 89 |
| 313 | 3300049593 | Ga0501077_0052349 | Ga0501077_0052349_1746_2123 | 89 |
| 314 | 3300049741 | Ga0501079_0029888 | Ga0501079_0029888_2938_3315 | 89 |
| 315 | 3300049742 | Ga0501080_0046194 | Ga0501080_0046194_2363_2740 | 89 |
| 316 | 3300049743 | Ga0501081_0002099 | Ga0501081_0002099_9127_9504 | 89 |
| 317 | 3300049824 | Ga0501045_0058715 | Ga0501045_0058715_432_809 | 89 |
| 318 | 3300050508 | nmdc:mga09592_1398633_c1 | nmdc:mga09592_1398633_c1_40_351 | 89 |
| 319 | 3300054114 | Ga0501084_0014098 | Ga0501084_0014098_3513_3890 | 89 |
| 320 | 3300060353 | Ga0501082_0006704 | Ga0501082_0006704_2979_3356 | 89 |
| 321 | 3300003659 | JGI25404J52841_10036354 | JGI25404J52841_100363542 | 90 |
| 322 | 3300005329 | Ga0070683_100307635 | Ga0070683_1003076352 | 90 |
| 323 | 3300005341 | Ga0070691_10481719 | Ga0070691_104817192 | 90 |
| 324 | 3300005355 | Ga0070671_100907260 | Ga0070671_1009072602 | 90 |
| 325 | 3300005459 | Ga0068867_101427148 | Ga0068867_1014271482 | 90 |
| 326 | 3300005578 | Ga0068854_100126535 | Ga0068854_1001265352 | 90 |
| 327 | 3300005841 | Ga0068863_100175261 | Ga0068863_1001752613 | 90 |
| 328 | 3300005983 | Ga0081540_1008438 | Ga0081540_100843814 | 90 |
| 329 | 3300006175 | Ga0070712_100954403 | Ga0070712_1009544032 | 90 |
| 330 | 3300006237 | Ga0097621_100585112 | Ga0097621_1005851122 | 90 |
| 331 | 3300006844 | Ga0075428_102694369 | Ga0075428_1026943691 | 90 |
| 332 | 3300006846 | Ga0075430_101286480 | Ga0075430_1012864802 | 90 |
| 333 | 3300007076 | Ga0075435_100257087 | Ga0075435_1002570872 | 90 |
| 334 | 3300009094 | Ga0111539_11186742 | Ga0111539_111867422 | 90 |
| 335 | 3300009148 | Ga0105243_10578929 | Ga0105243_105789292 | 90 |
| 336 | 3300010375 | Ga0105239_10658354 | Ga0105239_106583543 | 90 |
| 337 | 3300012490 | Ga0157322_1029946 | Ga0157322_10299462 | 90 |
| 338 | 3300013307 | Ga0157372_11586586 | Ga0157372_115865862 | 90 |
| 339 | 3300013308 | Ga0157375_11633331 | Ga0157375_116333311 | 90 |
| 340 | 3300014969 | Ga0157376_10180451 | Ga0157376_101804513 | 90 |
| 341 | 3300025931 | Ga0207644_10326829 | Ga0207644_103268293 | 90 |
| 342 | 3300025936 | Ga0207670_10973312 | Ga0207670_109733121 | 90 |
| 343 | 3300025944 | Ga0207661_10281722 | Ga0207661_102817223 | 90 |
| 344 | 3300025945 | Ga0207679_10330417 | Ga0207679_103304171 | 90 |
| 345 | 3300025981 | Ga0207640_10107100 | Ga0207640_101071003 | 90 |
| 346 | 3300026075 | Ga0207708_10554491 | Ga0207708_105544912 | 90 |
| 347 | 3300026088 | Ga0207641_10154200 | Ga0207641_101542003 | 90 |
| 348 | 3300026089 | Ga0207648_10568390 | Ga0207648_105683903 | 90 |
| 349 | 3300028380 | Ga0268265_10864402 | Ga0268265_108644022 | 90 |
| 350 | 3300035085 | Ga0373929_0027794 | Ga0373929_0027794_329_658 | 90 |
| 351 | 3300035088 | Ga0373940_0047019 | Ga0373940_0047019_155_484 | 90 |
| 352 | 3300035090 | Ga0373949_0063774 | Ga0373949_0063774_121_450 | 90 |
| 353 | 3300035112 | Ga0373932_0045214 | Ga0373932_0045214_884_1213 | 90 |
| 354 | 3300035115 | Ga0373941_0063200 | Ga0373941_0063200_22_351 | 90 |
| 355 | 3300035121 | Ga0373960_0004525 | Ga0373960_0004525_1935_2264 | 90 |
| 356 | 3300035241 | Ga0373961_0060924 | Ga0373961_0060924_574_903 | 90 |
| 357 | 3300035691 | Ga0373931_0028558 | Ga0373931_0028558_1879_2208 | 90 |
| 358 | 3300039450 | Ga0436363_1628752 | Ga0436363_1628752_70_390 | 90 |
| 359 | 3300041997 | Ga0439431_0149718 | Ga0439431_0149718_233_559 | 90 |
| 360 | 3300042156 | Ga0439446_0054400 | Ga0439446_0054400_101_427 | 90 |
| 361 | 3300042532 | Ga0450893_0021936 | Ga0450893_0021936_636_971 | 90 |
| 362 | 3300042993 | Ga0439440_0089182 | Ga0439440_0089182_77_412 | 90 |
| 363 | 3300046557 | Ga0495622_0237134 | Ga0495622_0237134_266_595 | 90 |
| 364 | 3300046660 | Ga0495625_0842533 | Ga0495625_0842533_25_366 | 90 |
| 365 | 3300048903 | Ga0496100_0300013 | Ga0496100_0300013_482_811 | 90 |
| 366 | 3300048903 | Ga0496100_0952312 | Ga0496100_0952312_198_530 | 90 |
| 367 | 3300048904 | Ga0496101_0125826 | Ga0496101_0125826_1406_1735 | 90 |
| 368 | 3300048905 | Ga0496102_0188965 | Ga0496102_0188965_332_661 | 90 |
| 369 | 3300048908 | Ga0496105_0098094 | Ga0496105_0098094_540_869 | 90 |
| 370 | 3300048909 | Ga0496106_0042430 | Ga0496106_0042430_2459_2788 | 90 |
| 371 | 3300048910 | Ga0496107_0209823 | Ga0496107_0209823_1104_1433 | 90 |
| 372 | 3300048915 | Ga0496112_0119112 | Ga0496112_0119112_434_763 | 90 |
| 373 | 3300048918 | Ga0496115_0076081 | Ga0496115_0076081_2096_2425 | 90 |
| 374 | 3300050510 | nmdc:mga06r32_1672188_c1 | nmdc:mga06r32_1672188_c1_230_541 | 90 |
| 375 | 3300050513 | nmdc:mga0rr50_184851_c1 | nmdc:mga0rr50_184851_c1_735_1088 | 90 |
| 376 | 3300050514 | nmdc:mga08x19_223453_c1 | nmdc:mga08x19_223453_c1_414_767 | 90 |
| 377 | 3300003371 | JGI26145J50221_1022307 | JGI26145J50221_10223071 | 91 |
| 378 | 3300005366 | Ga0070659_101645469 | Ga0070659_1016454691 | 91 |
| 379 | 3300005444 | Ga0070694_100087577 | Ga0070694_1000875773 | 91 |
| 380 | 3300005457 | Ga0070662_100090344 | Ga0070662_1000903441 | 91 |
| 381 | 3300005543 | Ga0070672_100594160 | Ga0070672_1005941602 | 91 |
| 382 | 3300005545 | Ga0070695_100387782 | Ga0070695_1003877823 | 91 |
| 383 | 3300005546 | Ga0070696_100017763 | Ga0070696_1000177634 | 91 |
| 384 | 3300005547 | Ga0070693_100093838 | Ga0070693_1000938382 | 91 |
| 385 | 3300005563 | Ga0068855_101431147 | Ga0068855_1014311472 | 91 |
| 386 | 3300005564 | Ga0070664_101783881 | Ga0070664_1017838812 | 91 |
| 387 | 3300005614 | Ga0068856_100173262 | Ga0068856_1001732623 | 91 |
| 388 | 3300005616 | Ga0068852_101354444 | Ga0068852_1013544442 | 91 |
| 389 | 3300005844 | Ga0068862_101106375 | Ga0068862_1011063752 | 91 |
| 390 | 3300006844 | Ga0075428_100038388 | Ga0075428_1000383884 | 91 |
| 391 | 3300006846 | Ga0075430_100662420 | Ga0075430_1006624202 | 91 |
| 392 | 3300006847 | Ga0075431_100120442 | Ga0075431_1001204424 | 91 |
| 393 | 3300006852 | Ga0075433_11115434 | Ga0075433_111154342 | 91 |
| 394 | 3300006880 | Ga0075429_100205004 | Ga0075429_1002050042 | 91 |
| 395 | 3300009094 | Ga0111539_10079410 | Ga0111539_100794102 | 91 |
| 396 | 3300009094 | Ga0111539_10146569 | Ga0111539_101465693 | 91 |
| 397 | 3300009098 | Ga0105245_13151583 | Ga0105245_131515832 | 91 |
| 398 | 3300009147 | Ga0114129_10282465 | Ga0114129_102824655 | 91 |
| 399 | 3300009147 | Ga0114129_10396737 | Ga0114129_103967374 | 91 |
| 400 | 3300009177 | Ga0105248_13286726 | Ga0105248_132867262 | 91 |
| 401 | 3300012507 | Ga0157342_1061653 | Ga0157342_10616531 | 91 |
| 402 | 3300013297 | Ga0157378_12233764 | Ga0157378_122337642 | 91 |
| 403 | 3300020077 | Ga0206351_10012725 | Ga0206351_100127252 | 91 |
| 404 | 3300024225 | Ga0224572_1089236 | Ga0224572_10892361 | 91 |
| 405 | 3300025910 | Ga0207684_10588933 | Ga0207684_105889331 | 91 |
| 406 | 3300025931 | Ga0207644_11808892 | Ga0207644_118088922 | 91 |
| 407 | 3300025932 | Ga0207690_10221657 | Ga0207690_102216572 | 91 |
| 408 | 3300025933 | Ga0207706_10083691 | Ga0207706_100836912 | 91 |
| 409 | 3300026078 | Ga0207702_10073915 | Ga0207702_100739155 | 91 |
| 410 | 3300027666 | Ga0209282_1000032 | Ga0209282_1000032158 | 91 |
| 411 | 3300027876 | Ga0209974_10012559 | Ga0209974_100125594 | 91 |
| 412 | 3300027907 | Ga0207428_10704774 | Ga0207428_107047742 | 91 |
| 413 | 3300028380 | Ga0268265_10162575 | Ga0268265_101625753 | 91 |
| 414 | 3300028786 | Ga0307517_10115379 | Ga0307517_101153794 | 91 |
| 415 | 3300029957 | Ga0265324_10000500 | Ga0265324_1000050039 | 91 |
| 416 | 3300030522 | Ga0307512_10457118 | Ga0307512_104571181 | 91 |
| 417 | 3300030863 | Ga0265766_1024028 | Ga0265766_10240281 | 91 |
| 418 | 3300031250 | Ga0265331_10107041 | Ga0265331_101070412 | 91 |
| 419 | 3300031251 | Ga0265327_10071532 | Ga0265327_100715323 | 91 |
| 420 | 3300031344 | Ga0265316_10316460 | Ga0265316_103164602 | 91 |
| 421 | 3300031711 | Ga0265314_10001521 | Ga0265314_100015217 | 91 |
| 422 | 3300031712 | Ga0265342_10369250 | Ga0265342_103692501 | 91 |
| 423 | 3300031730 | Ga0307516_10000048 | Ga0307516_1000004827 | 91 |
| 424 | 3300031731 | Ga0307405_10304730 | Ga0307405_103047301 | 91 |
| 425 | 3300031824 | Ga0307413_10153805 | Ga0307413_101538053 | 91 |
| 426 | 3300031852 | Ga0307410_10722459 | Ga0307410_107224592 | 91 |
| 427 | 3300032002 | Ga0307416_102429323 | Ga0307416_1024293232 | 91 |
| 428 | 3300032004 | Ga0307414_10123159 | Ga0307414_101231594 | 91 |
| 429 | 3300032004 | Ga0307414_11146249 | Ga0307414_111462492 | 91 |
| 430 | 3300032126 | Ga0307415_100793929 | Ga0307415_1007939292 | 91 |
| 431 | 3300035084 | Ga0373928_0041260 | Ga0373928_0041260_609_884 | 91 |
| 432 | 3300035091 | Ga0373951_0059414 | Ga0373951_0059414_343_618 | 91 |
| 433 | 3300035172 | Ga0373955_0396895 | Ga0373955_0396895_211_549 | 91 |
| 434 | 3300035398 | Ga0316574_0385368 | Ga0316574_0385368_115_390 | 91 |
| 435 | 3300035691 | Ga0373931_0205613 | Ga0373931_0205613_58_333 | 91 |
| 436 | 3300035695 | Ga0373927_0029560 | Ga0373927_0029560_2868_3209 | 91 |
| 437 | 3300037312 | Ga0395899_0383044 | Ga0395899_0383044_90_365 | 91 |
| 438 | 3300037418 | Ga0395900_0168314 | Ga0395900_0168314_1868_2143 | 91 |
| 439 | 3300037466 | Ga0395898_0196913 | Ga0395898_0196913_1464_1739 | 91 |
| 440 | 3300037471 | Ga0395905_0022623 | Ga0395905_0022623_3599_3874 | 91 |
| 441 | 3300037853 | Ga0436364_0154708 | Ga0436364_0154708_726_1001 | 91 |
| 442 | 3300038443 | Ga0395901_0061803 | Ga0395901_0061803_217_492 | 91 |
| 443 | 3300039437 | Ga0436365_0383888 | Ga0436365_0383888_868_1155 | 91 |
| 444 | 3300041441 | Ga0451787_362070 | Ga0451787_362070_281_556 | 91 |
| 445 | 3300041453 | Ga0451797_0747974 | Ga0451797_0747974_27_305 | 91 |
| 446 | 3300041454 | Ga0451799_09344 | Ga0451799_09344_113_391 | 91 |
| 447 | 3300041455 | Ga0451801_35813 | Ga0451801_35813_609_887 | 91 |
| 448 | 3300041457 | Ga0451803_08367 | Ga0451803_08367_199_477 | 91 |
| 449 | 3300041458 | Ga0451798_0617325 | Ga0451798_0617325_126_404 | 91 |
| 450 | 3300041460 | Ga0451802_1537885 | Ga0451802_1537885_580_858 | 91 |
| 451 | 3300041461 | Ga0451805_061040 | Ga0451805_061040_577_855 | 91 |
| 452 | 3300041464 | Ga0451808_30401 | Ga0451808_30401_146_424 | 91 |
| 453 | 3300041496 | Ga0451839_0847847 | Ga0451839_0847847_269_544 | 91 |
| 454 | 3300041509 | Ga0451843_0055671 | Ga0451843_0055671_331_612 | 91 |
| 455 | 3300041509 | Ga0451843_1768234 | Ga0451843_1768234_250_525 | 91 |
| 456 | 3300042012 | Ga0439455_0168740 | Ga0439455_0168740_63_344 | 91 |
| 457 | 3300042118 | Ga0450914_001376 | Ga0450914_001376_125_406 | 91 |
| 458 | 3300042132 | Ga0450895_020207 | Ga0450895_020207_68_346 | 91 |
| 459 | 3300042142 | Ga0450905_012598 | Ga0450905_012598_783_1064 | 91 |
| 460 | 3300042876 | Ga0451577_0761776 | Ga0451577_0761776_220_498 | 91 |
| 461 | 3300044673 | Ga0453683_0103988 | Ga0453683_0103988_844_1119 | 91 |
| 462 | 3300044673 | Ga0453683_0452538 | Ga0453683_0452538_54_335 | 91 |
| 463 | 3300044712 | Ga0453684_0007381 | Ga0453684_0007381_1760_2035 | 91 |
| 464 | 3300045051 | Ga0451576_0049923 | Ga0451576_0049923_1085_1363 | 91 |
| 465 | 3300045051 | Ga0451576_0212441 | Ga0451576_0212441_61_336 | 91 |
| 466 | 3300045051 | Ga0451576_0799428 | Ga0451576_0799428_12_293 | 91 |
| 467 | 3300046455 | Ga0495603_0176416 | Ga0495603_0176416_23_364 | 91 |
| 468 | 3300046457 | Ga0495590_0018187 | Ga0495590_0018187_1457_1798 | 91 |
| 469 | 3300046472 | Ga0495580_0315331 | Ga0495580_0315331_60_401 | 91 |
| 470 | 3300046491 | Ga0495584_0372397 | Ga0495584_0372397_263_601 | 91 |
| 471 | 3300046528 | Ga0495642_0412170 | Ga0495642_0412170_130_471 | 91 |
| 472 | 3300046538 | Ga0495609_0091258 | Ga0495609_0091258_405_743 | 91 |
| 473 | 3300046542 | Ga0495597_0068974 | Ga0495597_0068974_226_549 | 91 |
| 474 | 3300046684 | Ga0495669_0133842 | Ga0495669_0133842_160_501 | 91 |
| 475 | 3300047445 | Ga0495677_0380161 | Ga0495677_0380161_66_404 | 91 |
| 476 | 3300048904 | Ga0496101_0080044 | Ga0496101_0080044_158_439 | 91 |
| 477 | 3300048906 | Ga0496103_0718279 | Ga0496103_0718279_139_420 | 91 |
| 478 | 3300048907 | Ga0496104_0169874 | Ga0496104_0169874_711_992 | 91 |
| 479 | 3300048909 | Ga0496106_0201575 | Ga0496106_0201575_351_632 | 91 |
| 480 | 3300048911 | Ga0496108_0061551 | Ga0496108_0061551_2529_2810 | 91 |
| 481 | 3300048912 | Ga0496109_0080328 | Ga0496109_0080328_288_569 | 91 |
| 482 | 3300048914 | Ga0496111_0113884 | Ga0496111_0113884_749_1030 | 91 |
| 483 | 3300048915 | Ga0496112_0021255 | Ga0496112_0021255_3383_3664 | 91 |
| 484 | 3300048915 | Ga0496112_0378328 | Ga0496112_0378328_105_467 | 91 |
| 485 | 3300048917 | Ga0496114_0695189 | Ga0496114_0695189_531_863 | 91 |
| 486 | 3300048918 | Ga0496115_0170521 | Ga0496115_0170521_472_804 | 91 |
| 487 | 3300049127 | Ga0501306_063005 | Ga0501306_063005_290_571 | 91 |
| 488 | 3300049543 | Ga0501327_14510 | Ga0501327_14510_134_412 | 91 |
| 489 | 3300049569 | Ga0501032_0845257 | Ga0501032_0845257_43_318 | 91 |
| 490 | 3300049570 | Ga0501033_0120539 | Ga0501033_0120539_268_543 | 91 |
| 491 | 3300049570 | Ga0501033_0197703 | Ga0501033_0197703_954_1229 | 91 |
| 492 | 3300049572 | Ga0501036_0879387 | Ga0501036_0879387_373_717 | 91 |
| 493 | 3300049573 | Ga0501037_0054390 | Ga0501037_0054390_537_812 | 91 |
| 494 | 3300049573 | Ga0501037_0810173 | Ga0501037_0810173_81_374 | 91 |
| 495 | 3300049574 | Ga0501038_0157001 | Ga0501038_0157001_1324_1617 | 91 |
| 496 | 3300049574 | Ga0501038_0160280 | Ga0501038_0160280_703_978 | 91 |
| 497 | 3300049574 | Ga0501038_0290242 | Ga0501038_0290242_607_951 | 91 |
| 498 | 3300049578 | Ga0501042_0198415 | Ga0501042_0198415_941_1234 | 91 |
| 499 | 3300049578 | Ga0501042_0202009 | Ga0501042_0202009_295_639 | 91 |
| 500 | 3300049579 | Ga0501043_0064389 | Ga0501043_0064389_1580_1855 | 91 |
| 501 | 3300049579 | Ga0501043_0284177 | Ga0501043_0284177_582_926 | 91 |
| 502 | 3300049581 | Ga0501047_0561251 | Ga0501047_0561251_579_854 | 91 |
| 503 | 3300049582 | Ga0501048_0611238 | Ga0501048_0611238_89_433 | 91 |
| 504 | 3300049584 | Ga0501068_0730687 | Ga0501068_0730687_166_459 | 91 |
| 505 | 3300049588 | Ga0501072_0625140 | Ga0501072_0625140_236_529 | 91 |
| 506 | 3300049742 | Ga0501080_0918823 | Ga0501080_0918823_267_560 | 91 |
| 507 | 3300049822 | Ga0501035_0120480 | Ga0501035_0120480_1519_1794 | 91 |
| 508 | 3300049823 | Ga0501044_0017505 | Ga0501044_0017505_4359_4634 | 91 |
| 509 | 3300049823 | Ga0501044_1621238 | Ga0501044_1621238_73_348 | 91 |
| 510 | 3300049851 | Ga0501212_080625 | Ga0501212_080625_303_578 | 91 |
| 511 | 3300050489 | nmdc:mga03683_127600_c1 | nmdc:mga03683_127600_c1_280_558 | 91 |
| 512 | 3300050489 | nmdc:mga03683_254847_c1 | nmdc:mga03683_254847_c1_425_703 | 91 |
| 513 | 3300050490 | nmdc:mga03n38_510125_c1 | nmdc:mga03n38_510125_c1_209_487 | 91 |
| 514 | 3300050490 | nmdc:mga03n38_520422_c1 | nmdc:mga03n38_520422_c1_149_427 | 91 |
| 515 | 3300050493 | nmdc:mga0k408_1021_c1 | nmdc:mga0k408_1021_c1_3032_3310 | 91 |
| 516 | 3300050494 | nmdc:mga06z11_330740_c1 | nmdc:mga06z11_330740_c1_541_819 | 91 |
| 517 | 3300050507 | nmdc:mga05p37_84457_c1 | nmdc:mga05p37_84457_c1_464_823 | 91 |
| 518 | 3300050508 | nmdc:mga09592_188680_c1 | nmdc:mga09592_188680_c1_241_600 | 91 |
| 519 | 3300050508 | nmdc:mga09592_952939_c1 | nmdc:mga09592_952939_c1_20_301 | 91 |
| 520 | 3300050509 | nmdc:mga0qj67_44746_c1 | nmdc:mga0qj67_44746_c1_3079_3399 | 91 |
| 521 | 3300050509 | nmdc:mga0qj67_691431_c1 | nmdc:mga0qj67_691431_c1_276_635 | 91 |
| 522 | 3300050511 | nmdc:mga08y16_136821_c1 | nmdc:mga08y16_136821_c1_1392_1733 | 91 |
| 523 | 3300053126 | Ga0500621_302391 | Ga0500621_302391_85_363 | 91 |
| 524 | 3300053137 | Ga0500561_0002020 | Ga0500561_0002020_2536_2814 | 91 |
| 525 | 3300053153 | Ga0500616_0047381 | Ga0500616_0047381_1604_1879 | 91 |
| 526 | 3300053158 | Ga0500627_0055855 | Ga0500627_0055855_1015_1293 | 91 |
| 527 | 3300053161 | Ga0500634_0207347 | Ga0500634_0207347_398_673 | 91 |
| 528 | 3300054114 | Ga0501084_0143274 | Ga0501084_0143274_1367_1660 | 91 |
| 529 | 3300059493 | Ga0587077_073015 | Ga0587077_073015_369_650 | 91 |
| 530 | 3300059623 | Ga0587101_139665 | Ga0587101_139665_154_429 | 91 |
| 531 | 3300061734 | Ga0530510_0146352 | Ga0530510_0146352_973_1266 | 91 |
| 532 | 3300002244 | JGI24742J22300_10073186 | JGI24742J22300_100731862 | 92 |
| 533 | 3300003214 | JGI25165J46597_1000961 | JGI25165J46597_100096124 | 92 |
| 534 | 3300005327 | Ga0070658_10369759 | Ga0070658_103697593 | 92 |
| 535 | 3300005328 | Ga0070676_10314514 | Ga0070676_103145142 | 92 |
| 536 | 3300005329 | Ga0070683_100053275 | Ga0070683_1000532756 | 92 |
| 537 | 3300005329 | Ga0070683_100604505 | Ga0070683_1006045053 | 92 |
| 538 | 3300005329 | Ga0070683_102230844 | Ga0070683_1022308442 | 92 |
| 539 | 3300005331 | Ga0070670_101643710 | Ga0070670_1016437102 | 92 |
| 540 | 3300005336 | Ga0070680_100099273 | Ga0070680_1000992732 | 92 |
| 541 | 3300005336 | Ga0070680_101895307 | Ga0070680_1018953071 | 92 |
| 542 | 3300005338 | Ga0068868_101793280 | Ga0068868_1017932802 | 92 |
| 543 | 3300005339 | Ga0070660_100002390 | Ga0070660_10000239014 | 92 |
| 544 | 3300005339 | Ga0070660_100549482 | Ga0070660_1005494822 | 92 |
| 545 | 3300005340 | Ga0070689_100820848 | Ga0070689_1008208482 | 92 |
| 546 | 3300005340 | Ga0070689_100829538 | Ga0070689_1008295382 | 92 |
| 547 | 3300005343 | Ga0070687_101399756 | Ga0070687_1013997562 | 92 |
| 548 | 3300005344 | Ga0070661_100005946 | Ga0070661_10000594614 | 92 |
| 549 | 3300005345 | Ga0070692_10999567 | Ga0070692_109995672 | 92 |
| 550 | 3300005354 | Ga0070675_101376318 | Ga0070675_1013763182 | 92 |
| 551 | 3300005356 | Ga0070674_102188399 | Ga0070674_1021883991 | 92 |
| 552 | 3300005365 | Ga0070688_100032863 | Ga0070688_1000328636 | 92 |
| 553 | 3300005366 | Ga0070659_100438067 | Ga0070659_1004380673 | 92 |
| 554 | 3300005366 | Ga0070659_100449747 | Ga0070659_1004497472 | 92 |
| 555 | 3300005366 | Ga0070659_100521477 | Ga0070659_1005214773 | 92 |
| 556 | 3300005436 | Ga0070713_100094598 | Ga0070713_1000945984 | 92 |
| 557 | 3300005439 | Ga0070711_100455858 | Ga0070711_1004558582 | 92 |
| 558 | 3300005441 | Ga0070700_101507759 | Ga0070700_1015077592 | 92 |
| 559 | 3300005455 | Ga0070663_100231407 | Ga0070663_1002314073 | 92 |
| 560 | 3300005456 | Ga0070678_100573140 | Ga0070678_1005731402 | 92 |
| 561 | 3300005456 | Ga0070678_100610737 | Ga0070678_1006107372 | 92 |
| 562 | 3300005458 | Ga0070681_10501507 | Ga0070681_105015071 | 92 |
| 563 | 3300005459 | Ga0068867_100104315 | Ga0068867_1001043152 | 92 |
| 564 | 3300005459 | Ga0068867_100604780 | Ga0068867_1006047802 | 92 |
| 565 | 3300005459 | Ga0068867_101189746 | Ga0068867_1011897462 | 92 |
| 566 | 3300005466 | Ga0070685_10055693 | Ga0070685_100556933 | 92 |
| 567 | 3300005530 | Ga0070679_100669570 | Ga0070679_1006695702 | 92 |
| 568 | 3300005530 | Ga0070679_101376566 | Ga0070679_1013765662 | 92 |
| 569 | 3300005530 | Ga0070679_101423462 | Ga0070679_1014234622 | 92 |
| 570 | 3300005535 | Ga0070684_100052119 | Ga0070684_1000521197 | 92 |
| 571 | 3300005535 | Ga0070684_100099335 | Ga0070684_1000993355 | 92 |
| 572 | 3300005535 | Ga0070684_100535134 | Ga0070684_1005351342 | 92 |
| 573 | 3300005539 | Ga0068853_100013375 | Ga0068853_1000133755 | 92 |
| 574 | 3300005539 | Ga0068853_100893954 | Ga0068853_1008939542 | 92 |
| 575 | 3300005547 | Ga0070693_100702385 | Ga0070693_1007023852 | 92 |
| 576 | 3300005548 | Ga0070665_100109440 | Ga0070665_1001094405 | 92 |
| 577 | 3300005548 | Ga0070665_102408002 | Ga0070665_1024080022 | 92 |
| 578 | 3300005563 | Ga0068855_100006773 | Ga0068855_1000067733 | 92 |
| 579 | 3300005564 | Ga0070664_100191442 | Ga0070664_1001914422 | 92 |
| 580 | 3300005564 | Ga0070664_100210188 | Ga0070664_1002101881 | 92 |
| 581 | 3300005564 | Ga0070664_100677457 | Ga0070664_1006774572 | 92 |
| 582 | 3300005577 | Ga0068857_100043062 | Ga0068857_1000430626 | 92 |
| 583 | 3300005577 | Ga0068857_102476524 | Ga0068857_1024765242 | 92 |
| 584 | 3300005578 | Ga0068854_100384219 | Ga0068854_1003842192 | 92 |
| 585 | 3300005614 | Ga0068856_100158389 | Ga0068856_1001583892 | 92 |
| 586 | 3300005614 | Ga0068856_100161436 | Ga0068856_1001614362 | 92 |
| 587 | 3300005614 | Ga0068856_101236971 | Ga0068856_1012369712 | 92 |
| 588 | 3300005616 | Ga0068852_101228875 | Ga0068852_1012288752 | 92 |
| 589 | 3300005616 | Ga0068852_102728273 | Ga0068852_1027282732 | 92 |
| 590 | 3300005617 | Ga0068859_100316849 | Ga0068859_1003168493 | 92 |
| 591 | 3300005617 | Ga0068859_101470644 | Ga0068859_1014706441 | 92 |
| 592 | 3300005718 | Ga0068866_10482550 | Ga0068866_104825501 | 92 |
| 593 | 3300005842 | Ga0068858_100681127 | Ga0068858_1006811273 | 92 |
| 594 | 3300005843 | Ga0068860_100845551 | Ga0068860_1008455513 | 92 |
| 595 | 3300005843 | Ga0068860_102399265 | Ga0068860_1023992651 | 92 |
| 596 | 3300005844 | Ga0068862_100466502 | Ga0068862_1004665022 | 92 |
| 597 | 3300005844 | Ga0068862_101423902 | Ga0068862_1014239022 | 92 |
| 598 | 3300005937 | Ga0081455_10061752 | Ga0081455_100617525 | 92 |
| 599 | 3300006048 | Ga0075363_100004858 | Ga0075363_1000048584 | 92 |
| 600 | 3300006051 | Ga0075364_10095261 | Ga0075364_100952612 | 92 |
| 601 | 3300006051 | Ga0075364_10216020 | Ga0075364_102160203 | 92 |
| 602 | 3300006173 | Ga0070716_101275562 | Ga0070716_1012755622 | 92 |
| 603 | 3300006177 | Ga0075362_10015125 | Ga0075362_100151253 | 92 |
| 604 | 3300006177 | Ga0075362_10418025 | Ga0075362_104180252 | 92 |
| 605 | 3300006178 | Ga0075367_10201217 | Ga0075367_102012173 | 92 |
| 606 | 3300006353 | Ga0075370_10003104 | Ga0075370_100031047 | 92 |
| 607 | 3300006358 | Ga0068871_100502548 | Ga0068871_1005025483 | 92 |
| 608 | 3300006852 | Ga0075433_10068755 | Ga0075433_100687557 | 92 |
| 609 | 3300006871 | Ga0075434_100299829 | Ga0075434_1002998293 | 92 |
| 610 | 3300006880 | Ga0075429_100218905 | Ga0075429_1002189052 | 92 |
| 611 | 3300006881 | Ga0068865_100058757 | Ga0068865_1000587572 | 92 |
| 612 | 3300006931 | Ga0097620_100316858 | Ga0097620_1003168582 | 92 |
| 613 | 3300006931 | Ga0097620_101470637 | Ga0097620_1014706371 | 92 |
| 614 | 3300007076 | Ga0075435_101266269 | Ga0075435_1012662692 | 92 |
| 615 | 3300007076 | Ga0075435_101323175 | Ga0075435_1013231752 | 92 |
| 616 | 3300009093 | Ga0105240_10598473 | Ga0105240_105984733 | 92 |
| 617 | 3300009098 | Ga0105245_10195049 | Ga0105245_101950493 | 92 |
| 618 | 3300009098 | Ga0105245_10411966 | Ga0105245_104119662 | 92 |
| 619 | 3300009098 | Ga0105245_12703522 | Ga0105245_127035222 | 92 |
| 620 | 3300009147 | Ga0114129_10076149 | Ga0114129_100761492 | 92 |
| 621 | 3300009148 | Ga0105243_10411685 | Ga0105243_104116853 | 92 |
| 622 | 3300009148 | Ga0105243_10590318 | Ga0105243_105903182 | 92 |
| 623 | 3300009148 | Ga0105243_10669595 | Ga0105243_106695952 | 92 |
| 624 | 3300009174 | Ga0105241_10655747 | Ga0105241_106557472 | 92 |
| 625 | 3300009176 | Ga0105242_11591591 | Ga0105242_115915912 | 92 |
| 626 | 3300009177 | Ga0105248_10140985 | Ga0105248_101409853 | 92 |
| 627 | 3300009545 | Ga0105237_10002619 | Ga0105237_1000261931 | 92 |
| 628 | 3300009545 | Ga0105237_10471743 | Ga0105237_104717432 | 92 |
| 629 | 3300009553 | Ga0105249_11346463 | Ga0105249_113464632 | 92 |
| 630 | 3300010375 | Ga0105239_10102043 | Ga0105239_101020436 | 92 |
| 631 | 3300011119 | Ga0105246_10525059 | Ga0105246_105250592 | 92 |
| 632 | 3300012481 | Ga0157320_1011992 | Ga0157320_10119922 | 92 |
| 633 | 3300012488 | Ga0157343_1003739 | Ga0157343_10037392 | 92 |
| 634 | 3300012497 | Ga0157319_1018783 | Ga0157319_10187832 | 92 |
| 635 | 3300012512 | Ga0157327_1009341 | Ga0157327_10093412 | 92 |
| 636 | 3300013102 | Ga0157371_10605938 | Ga0157371_106059382 | 92 |
| 637 | 3300013104 | Ga0157370_10422380 | Ga0157370_104223802 | 92 |
| 638 | 3300013104 | Ga0157370_10601969 | Ga0157370_106019692 | 92 |
| 639 | 3300013105 | Ga0157369_10124513 | Ga0157369_101245134 | 92 |
| 640 | 3300013296 | Ga0157374_10218485 | Ga0157374_102184853 | 92 |
| 641 | 3300013296 | Ga0157374_12710550 | Ga0157374_127105502 | 92 |
| 642 | 3300013297 | Ga0157378_10456063 | Ga0157378_104560632 | 92 |
| 643 | 3300013306 | Ga0163162_13074766 | Ga0163162_130747662 | 92 |
| 644 | 3300013308 | Ga0157375_10321513 | Ga0157375_103215132 | 92 |
| 645 | 3300013308 | Ga0157375_13821583 | Ga0157375_138215831 | 92 |
| 646 | 3300014968 | Ga0157379_11386180 | Ga0157379_113861802 | 92 |
| 647 | 3300014969 | Ga0157376_10770891 | Ga0157376_107708912 | 92 |
| 648 | 3300014969 | Ga0157376_11978993 | Ga0157376_119789932 | 92 |
| 649 | 3300015265 | Ga0182005_1006944 | Ga0182005_10069442 | 92 |
| 650 | 3300015265 | Ga0182005_1115342 | Ga0182005_11153422 | 92 |
| 651 | 3300017792 | Ga0163161_11989211 | Ga0163161_119892112 | 92 |
| 652 | 3300020610 | Ga0154015_1181558 | Ga0154015_11815582 | 92 |
| 653 | 3300021388 | Ga0213875_10376426 | Ga0213875_103764262 | 92 |
| 654 | 3300021441 | Ga0213871_10018399 | Ga0213871_100183993 | 92 |
| 655 | 3300021441 | Ga0213871_10224361 | Ga0213871_102243612 | 92 |
| 656 | 3300025231 | Ga0207427_101449 | Ga0207427_1014498 | 92 |
| 657 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029332 | 92 |
| 658 | 3300025294 | Ga0209025_1126623 | Ga0209025_11266232 | 92 |
| 659 | 3300025302 | Ga0207426_1073154 | Ga0207426_10731543 | 92 |
| 660 | 3300025303 | Ga0209051_1102276 | Ga0209051_11022762 | 92 |
| 661 | 3300025901 | Ga0207688_10905613 | Ga0207688_109056132 | 92 |
| 662 | 3300025901 | Ga0207688_11011188 | Ga0207688_110111882 | 92 |
| 663 | 3300025904 | Ga0207647_10063680 | Ga0207647_100636804 | 92 |
| 664 | 3300025907 | Ga0207645_10347630 | Ga0207645_103476301 | 92 |
| 665 | 3300025909 | Ga0207705_10001453 | Ga0207705_1000145314 | 92 |
| 666 | 3300025909 | Ga0207705_10563534 | Ga0207705_105635342 | 92 |
| 667 | 3300025909 | Ga0207705_10974227 | Ga0207705_109742272 | 92 |
| 668 | 3300025911 | Ga0207654_11071908 | Ga0207654_110719082 | 92 |
| 669 | 3300025912 | Ga0207707_10065034 | Ga0207707_100650342 | 92 |
| 670 | 3300025912 | Ga0207707_10150230 | Ga0207707_101502302 | 92 |
| 671 | 3300025914 | Ga0207671_10001074 | Ga0207671_1000107431 | 92 |
| 672 | 3300025914 | Ga0207671_10987266 | Ga0207671_109872661 | 92 |
| 673 | 3300025916 | Ga0207663_10419978 | Ga0207663_104199782 | 92 |
| 674 | 3300025917 | Ga0207660_10127508 | Ga0207660_101275082 | 92 |
| 675 | 3300025917 | Ga0207660_11161181 | Ga0207660_111611812 | 92 |
| 676 | 3300025919 | Ga0207657_10006791 | Ga0207657_100067913 | 92 |
| 677 | 3300025919 | Ga0207657_10114000 | Ga0207657_101140001 | 92 |
| 678 | 3300025920 | Ga0207649_10000194 | Ga0207649_1000019465 | 92 |
| 679 | 3300025921 | Ga0207652_10077820 | Ga0207652_100778205 | 92 |
| 680 | 3300025921 | Ga0207652_10176407 | Ga0207652_101764072 | 92 |
| 681 | 3300025921 | Ga0207652_10649732 | Ga0207652_106497322 | 92 |
| 682 | 3300025924 | Ga0207694_10304721 | Ga0207694_103047211 | 92 |
| 683 | 3300025925 | Ga0207650_10445007 | Ga0207650_104450073 | 92 |
| 684 | 3300025926 | Ga0207659_10653137 | Ga0207659_106531372 | 92 |
| 685 | 3300025927 | Ga0207687_10966340 | Ga0207687_109663402 | 92 |
| 686 | 3300025932 | Ga0207690_10349373 | Ga0207690_103493732 | 92 |
| 687 | 3300025932 | Ga0207690_10551152 | Ga0207690_105511522 | 92 |
| 688 | 3300025936 | Ga0207670_10386673 | Ga0207670_103866733 | 92 |
| 689 | 3300025936 | Ga0207670_10584286 | Ga0207670_105842862 | 92 |
| 690 | 3300025938 | Ga0207704_10234376 | Ga0207704_102343762 | 92 |
| 691 | 3300025940 | Ga0207691_11470465 | Ga0207691_114704652 | 92 |
| 692 | 3300025941 | Ga0207711_10501217 | Ga0207711_105012172 | 92 |
| 693 | 3300025944 | Ga0207661_10061857 | Ga0207661_100618573 | 92 |
| 694 | 3300025944 | Ga0207661_10242014 | Ga0207661_102420143 | 92 |
| 695 | 3300025945 | Ga0207679_11336920 | Ga0207679_113369202 | 92 |
| 696 | 3300025949 | Ga0207667_10002756 | Ga0207667_1000275628 | 92 |
| 697 | 3300025949 | Ga0207667_11247038 | Ga0207667_112470382 | 92 |
| 698 | 3300025960 | Ga0207651_10263706 | Ga0207651_102637062 | 92 |
| 699 | 3300025972 | Ga0207668_11046118 | Ga0207668_110461182 | 92 |
| 700 | 3300026035 | Ga0207703_11317563 | Ga0207703_113175632 | 92 |
| 701 | 3300026035 | Ga0207703_11618103 | Ga0207703_116181032 | 92 |
| 702 | 3300026041 | Ga0207639_10009890 | Ga0207639_1000989012 | 92 |
| 703 | 3300026041 | Ga0207639_10121098 | Ga0207639_101210982 | 92 |
| 704 | 3300026067 | Ga0207678_10022593 | Ga0207678_1002259313 | 92 |
| 705 | 3300026075 | Ga0207708_10110240 | Ga0207708_101102404 | 92 |
| 706 | 3300026078 | Ga0207702_10997846 | Ga0207702_109978462 | 92 |
| 707 | 3300026116 | Ga0207674_10013836 | Ga0207674_100138363 | 92 |
| 708 | 3300026116 | Ga0207674_10101849 | Ga0207674_101018492 | 92 |
| 709 | 3300026118 | Ga0207675_100213567 | Ga0207675_1002135673 | 92 |
| 710 | 3300026118 | Ga0207675_102476482 | Ga0207675_1024764821 | 92 |
| 711 | 3300026121 | Ga0207683_10085243 | Ga0207683_100852434 | 92 |
| 712 | 3300026121 | Ga0207683_10270036 | Ga0207683_102700362 | 92 |
| 713 | 3300026121 | Ga0207683_10619623 | Ga0207683_106196232 | 92 |
| 714 | 3300028379 | Ga0268266_10000321 | Ga0268266_1000032114 | 92 |
| 715 | 3300028381 | Ga0268264_10857827 | Ga0268264_108578272 | 92 |
| 716 | 3300030760 | Ga0265762_1174339 | Ga0265762_11743392 | 92 |
| 717 | 3300031241 | Ga0265325_10131935 | Ga0265325_101319351 | 92 |
| 718 | 3300031251 | Ga0265327_10413512 | Ga0265327_104135122 | 92 |
| 719 | 3300031344 | Ga0265316_10040773 | Ga0265316_100407739 | 92 |
| 720 | 3300031548 | Ga0307408_100361446 | Ga0307408_1003614463 | 92 |
| 721 | 3300031731 | Ga0307405_10993751 | Ga0307405_109937512 | 92 |
| 722 | 3300031731 | Ga0307405_11571875 | Ga0307405_115718751 | 92 |
| 723 | 3300031824 | Ga0307413_10456558 | Ga0307413_104565582 | 92 |
| 724 | 3300031852 | Ga0307410_10554150 | Ga0307410_105541502 | 92 |
| 725 | 3300031852 | Ga0307410_10753272 | Ga0307410_107532722 | 92 |
| 726 | 3300031903 | Ga0307407_10307945 | Ga0307407_103079452 | 92 |
| 727 | 3300031911 | Ga0307412_10487792 | Ga0307412_104877922 | 92 |
| 728 | 3300032002 | Ga0307416_101573201 | Ga0307416_1015732012 | 92 |
| 729 | 3300032004 | Ga0307414_10324126 | Ga0307414_103241263 | 92 |
| 730 | 3300032005 | Ga0307411_10410308 | Ga0307411_104103082 | 92 |
| 731 | 3300032126 | Ga0307415_100936080 | Ga0307415_1009360802 | 92 |
| 732 | 3300032133 | Ga0316583_10317123 | Ga0316583_103171232 | 92 |
| 733 | 3300032168 | Ga0316593_10020888 | Ga0316593_100208882 | 92 |
| 734 | 3300032168 | Ga0316593_10043962 | Ga0316593_100439622 | 92 |
| 735 | 3300032168 | Ga0316593_10063317 | Ga0316593_100633172 | 92 |
| 736 | 3300032168 | Ga0316593_10091179 | Ga0316593_100911792 | 92 |
| 737 | 3300032168 | Ga0316593_10128486 | Ga0316593_101284862 | 92 |
| 738 | 3300032168 | Ga0316593_10401167 | Ga0316593_104011671 | 92 |
| 739 | 3300033529 | Ga0316587_1087875 | Ga0316587_10878752 | 92 |
| 740 | 3300033541 | Ga0316596_1042721 | Ga0316596_10427213 | 92 |
| 741 | 3300035725 | Ga0373947_0556276 | Ga0373947_0556276_35_319 | 92 |
| 742 | 3300036401 | Ga0373937_0524014 | Ga0373937_0524014_455_733 | 92 |
| 743 | 3300036712 | Ga0316584_0213436 | Ga0316584_0213436_222_500 | 92 |
| 744 | 3300036712 | Ga0316584_0237850 | Ga0316584_0237850_31_309 | 92 |
| 745 | 3300037068 | Ga0373925_0059917 | Ga0373925_0059917_940_1224 | 92 |
| 746 | 3300037312 | Ga0395899_0009289 | Ga0395899_0009289_3891_4169 | 92 |
| 747 | 3300037418 | Ga0395900_0079088 | Ga0395900_0079088_3061_3339 | 92 |
| 748 | 3300037418 | Ga0395900_0237666 | Ga0395900_0237666_1146_1424 | 92 |
| 749 | 3300037418 | Ga0395900_1299754 | Ga0395900_1299754_63_341 | 92 |
| 750 | 3300037466 | Ga0395898_0009501 | Ga0395898_0009501_8097_8375 | 92 |
| 751 | 3300037466 | Ga0395898_0062833 | Ga0395898_0062833_2274_2552 | 92 |
| 752 | 3300037466 | Ga0395898_0162999 | Ga0395898_0162999_1467_1745 | 92 |
| 753 | 3300037853 | Ga0436364_0387099 | Ga0436364_0387099_268_546 | 92 |
| 754 | 3300037853 | Ga0436364_1329342 | Ga0436364_1329342_543_821 | 92 |
| 755 | 3300038443 | Ga0395901_0029226 | Ga0395901_0029226_5058_5336 | 92 |
| 756 | 3300039062 | Ga0400483_065380 | Ga0400483_065380_108_386 | 92 |
| 757 | 3300039062 | Ga0400483_074646 | Ga0400483_074646_404_682 | 92 |
| 758 | 3300039062 | Ga0400483_079140 | Ga0400483_079140_6038_6316 | 92 |
| 759 | 3300039062 | Ga0400483_191914 | Ga0400483_191914_1151_1429 | 92 |
| 760 | 3300039062 | Ga0400483_212486 | Ga0400483_212486_581_859 | 92 |
| 761 | 3300039437 | Ga0436365_1100019 | Ga0436365_1100019_128_406 | 92 |
| 762 | 3300039437 | Ga0436365_1356266 | Ga0436365_1356266_124_402 | 92 |
| 763 | 3300039438 | Ga0436360_0558978 | Ga0436360_0558978_1579_1857 | 92 |
| 764 | 3300039438 | Ga0436360_1332781 | Ga0436360_1332781_182_460 | 92 |
| 765 | 3300039447 | Ga0436361_0700032 | Ga0436361_0700032_663_941 | 92 |
| 766 | 3300039453 | Ga0436362_0281584 | Ga0436362_0281584_51_329 | 92 |
| 767 | 3300039453 | Ga0436362_1042172 | Ga0436362_1042172_138_416 | 92 |
| 768 | 3300041413 | Ga0439465_0172218 | Ga0439465_0172218_344_622 | 92 |
| 769 | 3300041441 | Ga0451787_425155 | Ga0451787_425155_114_392 | 92 |
| 770 | 3300041452 | Ga0451793_1804433 | Ga0451793_1804433_179_457 | 92 |
| 771 | 3300041496 | Ga0451839_1229688 | Ga0451839_1229688_198_482 | 92 |
| 772 | 3300041997 | Ga0439431_0173237 | Ga0439431_0173237_17_295 | 92 |
| 773 | 3300042004 | Ga0439445_0023544 | Ga0439445_0023544_28_306 | 92 |
| 774 | 3300042007 | Ga0439449_0108023 | Ga0439449_0108023_172_450 | 92 |
| 775 | 3300042145 | Ga0450906_109365 | Ga0450906_109365_36_314 | 92 |
| 776 | 3300042461 | Ga0439460_0220407 | Ga0439460_0220407_39_374 | 92 |
| 777 | 3300044683 | Ga0466965_0331637 | Ga0466965_0331637_160_438 | 92 |
| 778 | 3300044683 | Ga0466965_0442654 | Ga0466965_0442654_373_651 | 92 |
| 779 | 3300044684 | Ga0466966_0759665 | Ga0466966_0759665_52_330 | 92 |
| 780 | 3300044706 | Ga0466964_0239149 | Ga0466964_0239149_255_533 | 92 |
| 781 | 3300044719 | Ga0466971_0452486 | Ga0466971_0452486_47_325 | 92 |
| 782 | 3300044735 | Ga0466968_0056953 | Ga0466968_0056953_302_580 | 92 |
| 783 | 3300044765 | Ga0466970_0371334 | Ga0466970_0371334_56_334 | 92 |
| 784 | 3300044765 | Ga0466970_0471772 | Ga0466970_0471772_241_519 | 92 |
| 785 | 3300044842 | Ga0466957_0902304 | Ga0466957_0902304_235_513 | 92 |
| 786 | 3300044901 | Ga0466960_0051465 | Ga0466960_0051465_1309_1587 | 92 |
| 787 | 3300044901 | Ga0466960_0079876 | Ga0466960_0079876_1138_1416 | 92 |
| 788 | 3300044901 | Ga0466960_0410521 | Ga0466960_0410521_213_491 | 92 |
| 789 | 3300045051 | Ga0451576_0003979 | Ga0451576_0003979_16322_16600 | 92 |
| 790 | 3300045836 | Ga0466958_0827902 | Ga0466958_0827902_96_374 | 92 |
| 791 | 3300045976 | Ga0466967_1475832 | Ga0466967_1475832_161_439 | 92 |
| 792 | 3300045976 | Ga0466967_1971071 | Ga0466967_1971071_193_471 | 92 |
| 793 | 3300046461 | Ga0495641_0039986 | Ga0495641_0039986_370_654 | 92 |
| 794 | 3300046473 | Ga0495582_0324047 | Ga0495582_0324047_570_854 | 92 |
| 795 | 3300046473 | Ga0495582_0447538 | Ga0495582_0447538_120_398 | 92 |
| 796 | 3300046473 | Ga0495582_0550981 | Ga0495582_0550981_103_387 | 92 |
| 797 | 3300046476 | Ga0495662_0528191 | Ga0495662_0528191_64_348 | 92 |
| 798 | 3300046517 | Ga0495630_0405713 | Ga0495630_0405713_64_348 | 92 |
| 799 | 3300046531 | Ga0495665_0058685 | Ga0495665_0058685_1282_1566 | 92 |
| 800 | 3300046535 | Ga0495586_0053697 | Ga0495586_0053697_1670_1954 | 92 |
| 801 | 3300046615 | Ga0495656_0754794 | Ga0495656_0754794_126_404 | 92 |
| 802 | 3300046616 | Ga0495668_0095498 | Ga0495668_0095498_437_715 | 92 |
| 803 | 3300046683 | Ga0495658_0258897 | Ga0495658_0258897_465_749 | 92 |
| 804 | 3300046689 | Ga0495613_0821789 | Ga0495613_0821789_287_571 | 92 |
| 805 | 3300046690 | Ga0495624_0544032 | Ga0495624_0544032_294_578 | 92 |
| 806 | 3300046691 | Ga0495670_0214308 | Ga0495670_0214308_147_425 | 92 |
| 807 | 3300047315 | Ga0495581_0116374 | Ga0495581_0116374_436_720 | 92 |
| 808 | 3300047318 | Ga0495636_0295753 | Ga0495636_0295753_88_423 | 92 |
| 809 | 3300047320 | Ga0495672_0102786 | Ga0495672_0102786_515_793 | 92 |
| 810 | 3300047321 | Ga0495676_0344460 | Ga0495676_0344460_268_552 | 92 |
| 811 | 3300047321 | Ga0495676_0792558 | Ga0495676_0792558_193_477 | 92 |
| 812 | 3300048903 | Ga0496100_1249570 | Ga0496100_1249570_165_449 | 92 |
| 813 | 3300048905 | Ga0496102_0896913 | Ga0496102_0896913_98_382 | 92 |
| 814 | 3300048906 | Ga0496103_0337634 | Ga0496103_0337634_513_797 | 92 |
| 815 | 3300048907 | Ga0496104_0641772 | Ga0496104_0641772_586_870 | 92 |
| 816 | 3300048909 | Ga0496106_0446461 | Ga0496106_0446461_450_734 | 92 |
| 817 | 3300048911 | Ga0496108_0314202 | Ga0496108_0314202_83_367 | 92 |
| 818 | 3300048911 | Ga0496108_1097007 | Ga0496108_1097007_369_653 | 92 |
| 819 | 3300048912 | Ga0496109_0062553 | Ga0496109_0062553_2200_2484 | 92 |
| 820 | 3300048912 | Ga0496109_0090762 | Ga0496109_0090762_935_1219 | 92 |
| 821 | 3300048913 | Ga0496110_0056619 | Ga0496110_0056619_28_312 | 92 |
| 822 | 3300048913 | Ga0496110_0366619 | Ga0496110_0366619_167_451 | 92 |
| 823 | 3300048915 | Ga0496112_0046863 | Ga0496112_0046863_1388_1672 | 92 |
| 824 | 3300048917 | Ga0496114_0755235 | Ga0496114_0755235_226_510 | 92 |
| 825 | 3300048919 | Ga0496116_0449943 | Ga0496116_0449943_166_444 | 92 |
| 826 | 3300048924 | Ga0496121_0208825 | Ga0496121_0208825_97_375 | 92 |
| 827 | 3300048924 | Ga0496121_0211646 | Ga0496121_0211646_609_887 | 92 |
| 828 | 3300048924 | Ga0496121_0300405 | Ga0496121_0300405_170_448 | 92 |
| 829 | 3300048927 | Ga0496124_0209237 | Ga0496124_0209237_532_810 | 92 |
| 830 | 3300048929 | Ga0496126_0713111 | Ga0496126_0713111_78_356 | 92 |
| 831 | 3300048929 | Ga0496126_0909978 | Ga0496126_0909978_160_438 | 92 |
| 832 | 3300049127 | Ga0501306_011033 | Ga0501306_011033_373_651 | 92 |
| 833 | 3300049127 | Ga0501306_038222 | Ga0501306_038222_349_627 | 92 |
| 834 | 3300049129 | Ga0501309_027981 | Ga0501309_027981_29_307 | 92 |
| 835 | 3300049129 | Ga0501309_044312 | Ga0501309_044312_224_502 | 92 |
| 836 | 3300049130 | Ga0501310_008648 | Ga0501310_008648_599_877 | 92 |
| 837 | 3300049161 | Ga0501305_028967 | Ga0501305_028967_237_515 | 92 |
| 838 | 3300049161 | Ga0501305_041646 | Ga0501305_041646_373_651 | 92 |
| 839 | 3300049162 | Ga0501307_002581 | Ga0501307_002581_1318_1596 | 92 |
| 840 | 3300049162 | Ga0501307_028701 | Ga0501307_028701_64_342 | 92 |
| 841 | 3300049532 | Ga0501316_035480 | Ga0501316_035480_152_430 | 92 |
| 842 | 3300049534 | Ga0501318_000576 | Ga0501318_000576_990_1268 | 92 |
| 843 | 3300049536 | Ga0501320_000727 | Ga0501320_000727_116_394 | 92 |
| 844 | 3300049536 | Ga0501320_001422 | Ga0501320_001422_373_651 | 92 |
| 845 | 3300049539 | Ga0501323_027089 | Ga0501323_027089_372_650 | 92 |
| 846 | 3300049540 | Ga0501324_006579 | Ga0501324_006579_299_577 | 92 |
| 847 | 3300049568 | Ga0501031_0093208 | Ga0501031_0093208_464_742 | 92 |
| 848 | 3300049568 | Ga0501031_0233489 | Ga0501031_0233489_731_1009 | 92 |
| 849 | 3300049568 | Ga0501031_0442911 | Ga0501031_0442911_49_327 | 92 |
| 850 | 3300049569 | Ga0501032_0015661 | Ga0501032_0015661_3105_3383 | 92 |
| 851 | 3300049569 | Ga0501032_0035186 | Ga0501032_0035186_975_1253 | 92 |
| 852 | 3300049569 | Ga0501032_0295651 | Ga0501032_0295651_647_925 | 92 |
| 853 | 3300049570 | Ga0501033_0044470 | Ga0501033_0044470_1147_1425 | 92 |
| 854 | 3300049570 | Ga0501033_0301892 | Ga0501033_0301892_277_555 | 92 |
| 855 | 3300049570 | Ga0501033_0403347 | Ga0501033_0403347_594_872 | 92 |
| 856 | 3300049570 | Ga0501033_0538628 | Ga0501033_0538628_349_627 | 92 |
| 857 | 3300049571 | Ga0501034_0000482 | Ga0501034_0000482_45149_45427 | 92 |
| 858 | 3300049571 | Ga0501034_0049039 | Ga0501034_0049039_2718_2996 | 92 |
| 859 | 3300049571 | Ga0501034_0109362 | Ga0501034_0109362_448_726 | 92 |
| 860 | 3300049571 | Ga0501034_0151831 | Ga0501034_0151831_1366_1644 | 92 |
| 861 | 3300049571 | Ga0501034_0405129 | Ga0501034_0405129_411_689 | 92 |
| 862 | 3300049571 | Ga0501034_0475920 | Ga0501034_0475920_679_957 | 92 |
| 863 | 3300049571 | Ga0501034_0476017 | Ga0501034_0476017_329_607 | 92 |
| 864 | 3300049571 | Ga0501034_0757261 | Ga0501034_0757261_409_687 | 92 |
| 865 | 3300049572 | Ga0501036_0037299 | Ga0501036_0037299_1407_1685 | 92 |
| 866 | 3300049572 | Ga0501036_1022627 | Ga0501036_1022627_90_368 | 92 |
| 867 | 3300049572 | Ga0501036_1468069 | Ga0501036_1468069_132_410 | 92 |
| 868 | 3300049573 | Ga0501037_0016304 | Ga0501037_0016304_1263_1541 | 92 |
| 869 | 3300049573 | Ga0501037_0276370 | Ga0501037_0276370_478_756 | 92 |
| 870 | 3300049574 | Ga0501038_0051319 | Ga0501038_0051319_2136_2414 | 92 |
| 871 | 3300049574 | Ga0501038_0535092 | Ga0501038_0535092_364_642 | 92 |
| 872 | 3300049574 | Ga0501038_0978970 | Ga0501038_0978970_73_351 | 92 |
| 873 | 3300049575 | Ga0501039_0008725 | Ga0501039_0008725_6332_6610 | 92 |
| 874 | 3300049575 | Ga0501039_0940187 | Ga0501039_0940187_75_353 | 92 |
| 875 | 3300049576 | Ga0501040_0333344 | Ga0501040_0333344_228_506 | 92 |
| 876 | 3300049576 | Ga0501040_0577367 | Ga0501040_0577367_325_603 | 92 |
| 877 | 3300049578 | Ga0501042_0119502 | Ga0501042_0119502_673_951 | 92 |
| 878 | 3300049579 | Ga0501043_0035339 | Ga0501043_0035339_90_368 | 92 |
| 879 | 3300049579 | Ga0501043_0283443 | Ga0501043_0283443_941_1219 | 92 |
| 880 | 3300049579 | Ga0501043_0711707 | Ga0501043_0711707_132_410 | 92 |
| 881 | 3300049580 | Ga0501046_0067063 | Ga0501046_0067063_141_419 | 92 |
| 882 | 3300049580 | Ga0501046_0894257 | Ga0501046_0894257_290_568 | 92 |
| 883 | 3300049581 | Ga0501047_0035355 | Ga0501047_0035355_1263_1541 | 92 |
| 884 | 3300049581 | Ga0501047_0366223 | Ga0501047_0366223_233_511 | 92 |
| 885 | 3300049581 | Ga0501047_0396854 | Ga0501047_0396854_547_825 | 92 |
| 886 | 3300049582 | Ga0501048_0020171 | Ga0501048_0020171_1533_1811 | 92 |
| 887 | 3300049582 | Ga0501048_0906220 | Ga0501048_0906220_302_580 | 92 |
| 888 | 3300049582 | Ga0501048_1128766 | Ga0501048_1128766_159_437 | 92 |
| 889 | 3300049583 | Ga0501067_0273044 | Ga0501067_0273044_521_799 | 92 |
| 890 | 3300049584 | Ga0501068_0184691 | Ga0501068_0184691_802_1092 | 92 |
| 891 | 3300049584 | Ga0501068_0252218 | Ga0501068_0252218_20_298 | 92 |
| 892 | 3300049585 | Ga0501069_0000969 | Ga0501069_0000969_10275_10553 | 92 |
| 893 | 3300049585 | Ga0501069_0030764 | Ga0501069_0030764_1295_1612 | 92 |
| 894 | 3300049585 | Ga0501069_0238789 | Ga0501069_0238789_620_898 | 92 |
| 895 | 3300049586 | Ga0501070_0043862 | Ga0501070_0043862_2230_2547 | 92 |
| 896 | 3300049586 | Ga0501070_0046897 | Ga0501070_0046897_1811_2089 | 92 |
| 897 | 3300049586 | Ga0501070_0070015 | Ga0501070_0070015_1407_1685 | 92 |
| 898 | 3300049587 | Ga0501071_0020326 | Ga0501071_0020326_2016_2294 | 92 |
| 899 | 3300049587 | Ga0501071_0585217 | Ga0501071_0585217_559_837 | 92 |
| 900 | 3300049587 | Ga0501071_1017905 | Ga0501071_1017905_245_523 | 92 |
| 901 | 3300049587 | Ga0501071_1481511 | Ga0501071_1481511_187_465 | 92 |
| 902 | 3300049589 | Ga0501073_0061696 | Ga0501073_0061696_1534_1812 | 92 |
| 903 | 3300049589 | Ga0501073_0103447 | Ga0501073_0103447_579_857 | 92 |
| 904 | 3300049589 | Ga0501073_0171716 | Ga0501073_0171716_322_600 | 92 |
| 905 | 3300049589 | Ga0501073_0447129 | Ga0501073_0447129_169_447 | 92 |
| 906 | 3300049590 | Ga0501074_0011507 | Ga0501074_0011507_3105_3383 | 92 |
| 907 | 3300049590 | Ga0501074_0649292 | Ga0501074_0649292_107_385 | 92 |
| 908 | 3300049590 | Ga0501074_0745184 | Ga0501074_0745184_86_403 | 92 |
| 909 | 3300049591 | Ga0501075_0964838 | Ga0501075_0964838_28_306 | 92 |
| 910 | 3300049593 | Ga0501077_0426384 | Ga0501077_0426384_92_370 | 92 |
| 911 | 3300049653 | Ga0501206_033539 | Ga0501206_033539_386_664 | 92 |
| 912 | 3300049681 | Ga0501251_046887 | Ga0501251_046887_355_633 | 92 |
| 913 | 3300049688 | Ga0501259_065450 | Ga0501259_065450_39_317 | 92 |
| 914 | 3300049690 | Ga0501261_033554 | Ga0501261_033554_22_300 | 92 |
| 915 | 3300049741 | Ga0501079_0005549 | Ga0501079_0005549_3962_4240 | 92 |
| 916 | 3300049741 | Ga0501079_1035571 | Ga0501079_1035571_169_447 | 92 |
| 917 | 3300049742 | Ga0501080_0219114 | Ga0501080_0219114_1180_1497 | 92 |
| 918 | 3300049742 | Ga0501080_0371191 | Ga0501080_0371191_359_637 | 92 |
| 919 | 3300049742 | Ga0501080_0380505 | Ga0501080_0380505_628_963 | 92 |
| 920 | 3300049743 | Ga0501081_1385466 | Ga0501081_1385466_244_522 | 92 |
| 921 | 3300049744 | Ga0501083_0018111 | Ga0501083_0018111_3097_3375 | 92 |
| 922 | 3300049763 | Ga0501266_030623 | Ga0501266_030623_360_638 | 92 |
| 923 | 3300049822 | Ga0501035_0003888 | Ga0501035_0003888_8772_9050 | 92 |
| 924 | 3300049822 | Ga0501035_0046074 | Ga0501035_0046074_2822_3100 | 92 |
| 925 | 3300049822 | Ga0501035_0051238 | Ga0501035_0051238_804_1082 | 92 |
| 926 | 3300049822 | Ga0501035_0192367 | Ga0501035_0192367_1352_1630 | 92 |
| 927 | 3300049822 | Ga0501035_1245537 | Ga0501035_1245537_149_427 | 92 |
| 928 | 3300049822 | Ga0501035_1476699 | Ga0501035_1476699_142_420 | 92 |
| 929 | 3300049823 | Ga0501044_0000222 | Ga0501044_0000222_21130_21408 | 92 |
| 930 | 3300049823 | Ga0501044_0031615 | Ga0501044_0031615_2146_2424 | 92 |
| 931 | 3300049823 | Ga0501044_0048954 | Ga0501044_0048954_158_436 | 92 |
| 932 | 3300049823 | Ga0501044_0132345 | Ga0501044_0132345_1406_1684 | 92 |
| 933 | 3300049823 | Ga0501044_0321313 | Ga0501044_0321313_101_379 | 92 |
| 934 | 3300049823 | Ga0501044_0391300 | Ga0501044_0391300_898_1176 | 92 |
| 935 | 3300049824 | Ga0501045_0072947 | Ga0501045_0072947_392_670 | 92 |
| 936 | 3300050489 | nmdc:mga03683_12339_c1 | nmdc:mga03683_12339_c1_2250_2528 | 92 |
| 937 | 3300050489 | nmdc:mga03683_528534_c1 | nmdc:mga03683_528534_c1_223_501 | 92 |
| 938 | 3300050490 | nmdc:mga03n38_14252_c1 | nmdc:mga03n38_14252_c1_488_766 | 92 |
| 939 | 3300050491 | nmdc:mga00v17_231521_c1 | nmdc:mga00v17_231521_c1_735_1013 | 92 |
| 940 | 3300050491 | nmdc:mga00v17_81837_c1 | nmdc:mga00v17_81837_c1_1102_1380 | 92 |
| 941 | 3300050492 | nmdc:mga0yw44_11167_c1 | nmdc:mga0yw44_11167_c1_1048_1374 | 92 |
| 942 | 3300050492 | nmdc:mga0yw44_60321_c1 | nmdc:mga0yw44_60321_c1_1502_1780 | 92 |
| 943 | 3300050494 | nmdc:mga06z11_160028_c1 | nmdc:mga06z11_160028_c1_730_1008 | 92 |
| 944 | 3300050496 | nmdc:mga07m45_5559_c1 | nmdc:mga07m45_5559_c1_2590_2868 | 92 |
| 945 | 3300050507 | nmdc:mga05p37_42475_c1 | nmdc:mga05p37_42475_c1_102_386 | 92 |
| 946 | 3300050508 | nmdc:mga09592_191101_c1 | nmdc:mga09592_191101_c1_58_342 | 92 |
| 947 | 3300050510 | nmdc:mga06r32_489083_c1 | nmdc:mga06r32_489083_c1_306_644 | 92 |
| 948 | 3300050511 | nmdc:mga08y16_1357597_c1 | nmdc:mga08y16_1357597_c1_11_289 | 92 |
| 949 | 3300050512 | nmdc:mga0n895_468602_c1 | nmdc:mga0n895_468602_c1_699_1037 | 92 |
| 950 | 3300050515 | nmdc:mga0a205_66873_c1 | nmdc:mga0a205_66873_c1_2365_2703 | 92 |
| 951 | 3300053096 | Ga0500641_0002284 | Ga0500641_0002284_3548_3826 | 92 |
| 952 | 3300053103 | Ga0500555_064131 | Ga0500555_064131_46_324 | 92 |
| 953 | 3300053104 | Ga0500556_0014330 | Ga0500556_0014330_1241_1519 | 92 |
| 954 | 3300053105 | Ga0500557_052121 | Ga0500557_052121_803_1081 | 92 |
| 955 | 3300053108 | Ga0500562_004084 | Ga0500562_004084_2576_2854 | 92 |
| 956 | 3300053108 | Ga0500562_060493 | Ga0500562_060493_438_716 | 92 |
| 957 | 3300053117 | Ga0500593_225104 | Ga0500593_225104_149_427 | 92 |
| 958 | 3300053136 | Ga0500559_0063546 | Ga0500559_0063546_613_891 | 92 |
| 959 | 3300053151 | Ga0500604_0027297 | Ga0500604_0027297_308_586 | 92 |
| 960 | 3300053153 | Ga0500616_0093711 | Ga0500616_0093711_466_744 | 92 |
| 961 | 3300053153 | Ga0500616_0220183 | Ga0500616_0220183_433_711 | 92 |
| 962 | 3300053156 | Ga0500622_0036800 | Ga0500622_0036800_956_1234 | 92 |
| 963 | 3300053730 | Ga0500645_050922 | Ga0500645_050922_839_1117 | 92 |
| 964 | 3300054114 | Ga0501084_0077972 | Ga0501084_0077972_1390_1668 | 92 |
| 965 | 3300054114 | Ga0501084_0264304 | Ga0501084_0264304_494_772 | 92 |
| 966 | 3300054114 | Ga0501084_1547921 | Ga0501084_1547921_131_409 | 92 |
| 967 | 3300054114 | Ga0501084_1784546 | Ga0501084_1784546_59_337 | 92 |
| 968 | 3300059421 | Ga0590071_138744 | Ga0590071_138744_18_296 | 92 |
| 969 | 3300059423 | Ga0590074_077456 | Ga0590074_077456_135_413 | 92 |
| 970 | 3300059424 | Ga0590075_040918 | Ga0590075_040918_569_847 | 92 |
| 971 | 3300059490 | Ga0587066_030641 | Ga0587066_030641_427_705 | 92 |
| 972 | 3300059491 | Ga0587070_178161 | Ga0587070_178161_149_427 | 92 |
| 973 | 3300059493 | Ga0587077_106651 | Ga0587077_106651_320_598 | 92 |
| 974 | 3300059505 | Ga0587083_0028661 | Ga0587083_0028661_27_305 | 92 |
| 975 | 3300059506 | Ga0587085_021339 | Ga0587085_021339_415_693 | 92 |
| 976 | 3300059511 | Ga0587091_006969 | Ga0587091_006969_138_416 | 92 |
| 977 | 3300059511 | Ga0587091_020521 | Ga0587091_020521_836_1114 | 92 |
| 978 | 3300059511 | Ga0587091_195005 | Ga0587091_195005_173_451 | 92 |
| 979 | 3300059514 | Ga0587095_005287 | Ga0587095_005287_376_654 | 92 |
| 980 | 3300059605 | Ga0587106_008775 | Ga0587106_008775_349_627 | 92 |
| 981 | 3300059605 | Ga0587106_099560 | Ga0587106_099560_288_566 | 92 |
| 982 | 3300059624 | Ga0587109_076114 | Ga0587109_076114_427_705 | 92 |
| 983 | 3300059626 | Ga0587115_083426 | Ga0587115_083426_214_492 | 92 |
| 984 | 3300059630 | Ga0587128_035764 | Ga0587128_035764_356_634 | 92 |
| 985 | 3300059639 | Ga0587062_086165 | Ga0587062_086165_126_404 | 92 |
| 986 | 3300059641 | Ga0587068_077236 | Ga0587068_077236_116_394 | 92 |
| 987 | 3300059645 | Ga0587076_008729 | Ga0587076_008729_388_666 | 92 |
| 988 | 3300059646 | Ga0587078_028397 | Ga0587078_028397_410_688 | 92 |
| 989 | 3300059647 | Ga0587079_010177 | Ga0587079_010177_853_1131 | 92 |
| 990 | 3300059648 | Ga0587100_014968 | Ga0587100_014968_216_494 | 92 |
| 991 | 3300059651 | Ga0587105_009752 | Ga0587105_009752_378_656 | 92 |
| 992 | 3300059652 | Ga0587107_033944 | Ga0587107_033944_391_669 | 92 |
| 993 | 3300059660 | Ga0587124_025483 | Ga0587124_025483_10_288 | 92 |
| 994 | 3300060346 | Ga0587111_0151900 | Ga0587111_0151900_290_568 | 92 |
| 995 | 3300060353 | Ga0501082_0019797 | Ga0501082_0019797_2491_2769 | 92 |
| 996 | 3300060353 | Ga0501082_0653954 | Ga0501082_0653954_366_644 | 92 |
| 997 | 3300061734 | Ga0530510_0050130 | Ga0530510_0050130_1764_2099 | 92 |
| 998 | 3300061734 | Ga0530510_0243345 | Ga0530510_0243345_908_1186 | 92 |
| 999 | 3300061734 | Ga0530510_0812268 | Ga0530510_0812268_112_390 | 92 |
| 1000 | 3300061734 | Ga0530510_0948194 | Ga0530510_0948194_203_481 | 92 |
| 1001 | 3300005330 | Ga0070690_100506659 | Ga0070690_1005066593 | 93 |
| 1002 | 3300005336 | Ga0070680_101502044 | Ga0070680_1015020442 | 93 |
| 1003 | 3300005338 | Ga0068868_100586001 | Ga0068868_1005860012 | 93 |
| 1004 | 3300005339 | Ga0070660_100878404 | Ga0070660_1008784042 | 93 |
| 1005 | 3300005341 | Ga0070691_10194117 | Ga0070691_101941172 | 93 |
| 1006 | 3300005344 | Ga0070661_100362416 | Ga0070661_1003624161 | 93 |
| 1007 | 3300005345 | Ga0070692_11426567 | Ga0070692_114265671 | 93 |
| 1008 | 3300005367 | Ga0070667_100463754 | Ga0070667_1004637541 | 93 |
| 1009 | 3300005435 | Ga0070714_100858022 | Ga0070714_1008580222 | 93 |
| 1010 | 3300005440 | Ga0070705_100060632 | Ga0070705_1000606324 | 93 |
| 1011 | 3300005441 | Ga0070700_100410419 | Ga0070700_1004104192 | 93 |
| 1012 | 3300005457 | Ga0070662_100797369 | Ga0070662_1007973692 | 93 |
| 1013 | 3300005458 | Ga0070681_10671287 | Ga0070681_106712873 | 93 |
| 1014 | 3300005458 | Ga0070681_10783235 | Ga0070681_107832352 | 93 |
| 1015 | 3300005459 | Ga0068867_100140882 | Ga0068867_1001408822 | 93 |
| 1016 | 3300005468 | Ga0070707_100449824 | Ga0070707_1004498243 | 93 |
| 1017 | 3300005471 | Ga0070698_100014515 | Ga0070698_10001451513 | 93 |
| 1018 | 3300005471 | Ga0070698_101240397 | Ga0070698_1012403972 | 93 |
| 1019 | 3300005530 | Ga0070679_100088987 | Ga0070679_1000889873 | 93 |
| 1020 | 3300005530 | Ga0070679_100617320 | Ga0070679_1006173203 | 93 |
| 1021 | 3300005539 | Ga0068853_100440329 | Ga0068853_1004403293 | 93 |
| 1022 | 3300005544 | Ga0070686_100449857 | Ga0070686_1004498571 | 93 |
| 1023 | 3300005545 | Ga0070695_100034730 | Ga0070695_1000347304 | 93 |
| 1024 | 3300005547 | Ga0070693_100200155 | Ga0070693_1002001552 | 93 |
| 1025 | 3300005563 | Ga0068855_100169574 | Ga0068855_1001695744 | 93 |
| 1026 | 3300005577 | Ga0068857_100403312 | Ga0068857_1004033122 | 93 |
| 1027 | 3300005614 | Ga0068856_100448749 | Ga0068856_1004487492 | 93 |
| 1028 | 3300005614 | Ga0068856_101246424 | Ga0068856_1012464242 | 93 |
| 1029 | 3300005616 | Ga0068852_100790803 | Ga0068852_1007908032 | 93 |
| 1030 | 3300005617 | Ga0068859_101099278 | Ga0068859_1010992781 | 93 |
| 1031 | 3300005618 | Ga0068864_101459685 | Ga0068864_1014596852 | 93 |
| 1032 | 3300005719 | Ga0068861_100962324 | Ga0068861_1009623242 | 93 |
| 1033 | 3300005719 | Ga0068861_101696751 | Ga0068861_1016967512 | 93 |
| 1034 | 3300005834 | Ga0068851_10272997 | Ga0068851_102729972 | 93 |
| 1035 | 3300005842 | Ga0068858_101397477 | Ga0068858_1013974771 | 93 |
| 1036 | 3300005843 | Ga0068860_100151341 | Ga0068860_1001513411 | 93 |
| 1037 | 3300005844 | Ga0068862_100208344 | Ga0068862_1002083442 | 93 |
| 1038 | 3300005983 | Ga0081540_1004248 | Ga0081540_10042488 | 93 |
| 1039 | 3300005983 | Ga0081540_1032087 | Ga0081540_10320876 | 93 |
| 1040 | 3300006175 | Ga0070712_100149925 | Ga0070712_1001499253 | 93 |
| 1041 | 3300006358 | Ga0068871_100063920 | Ga0068871_1000639206 | 93 |
| 1042 | 3300006358 | Ga0068871_100548815 | Ga0068871_1005488153 | 93 |
| 1043 | 3300006844 | Ga0075428_100958316 | Ga0075428_1009583162 | 93 |
| 1044 | 3300006846 | Ga0075430_100038858 | Ga0075430_1000388587 | 93 |
| 1045 | 3300006852 | Ga0075433_10670941 | Ga0075433_106709412 | 93 |
| 1046 | 3300006871 | Ga0075434_100155197 | Ga0075434_1001551972 | 93 |
| 1047 | 3300006881 | Ga0068865_100170832 | Ga0068865_1001708322 | 93 |
| 1048 | 3300006914 | Ga0075436_100560062 | Ga0075436_1005600622 | 93 |
| 1049 | 3300006931 | Ga0097620_101099276 | Ga0097620_1010992761 | 93 |
| 1050 | 3300007076 | Ga0075435_101173984 | Ga0075435_1011739842 | 93 |
| 1051 | 3300009098 | Ga0105245_10432327 | Ga0105245_104323272 | 93 |
| 1052 | 3300009098 | Ga0105245_12794392 | Ga0105245_127943921 | 93 |
| 1053 | 3300009148 | Ga0105243_10122511 | Ga0105243_101225114 | 93 |
| 1054 | 3300009174 | Ga0105241_10017868 | Ga0105241_1001786811 | 93 |
| 1055 | 3300009176 | Ga0105242_11117859 | Ga0105242_111178592 | 93 |
| 1056 | 3300009176 | Ga0105242_11560480 | Ga0105242_115604802 | 93 |
| 1057 | 3300009177 | Ga0105248_10284388 | Ga0105248_102843883 | 93 |
| 1058 | 3300009545 | Ga0105237_10047955 | Ga0105237_100479552 | 93 |
| 1059 | 3300009551 | Ga0105238_11661901 | Ga0105238_116619012 | 93 |
| 1060 | 3300010375 | Ga0105239_10291478 | Ga0105239_102914782 | 93 |
| 1061 | 3300010375 | Ga0105239_10541023 | Ga0105239_105410232 | 93 |
| 1062 | 3300010375 | Ga0105239_11736225 | Ga0105239_117362251 | 93 |
| 1063 | 3300013100 | Ga0157373_10685601 | Ga0157373_106856012 | 93 |
| 1064 | 3300013105 | Ga0157369_10675688 | Ga0157369_106756882 | 93 |
| 1065 | 3300013296 | Ga0157374_10368360 | Ga0157374_103683602 | 93 |
| 1066 | 3300013307 | Ga0157372_10968208 | Ga0157372_109682082 | 93 |
| 1067 | 3300014326 | Ga0157380_11336915 | Ga0157380_113369152 | 93 |
| 1068 | 3300014326 | Ga0157380_12206039 | Ga0157380_122060392 | 93 |
| 1069 | 3300014969 | Ga0157376_10223096 | Ga0157376_102230964 | 93 |
| 1070 | 3300024227 | Ga0228598_1072408 | Ga0228598_10724081 | 93 |
| 1071 | 3300025321 | Ga0207656_10327467 | Ga0207656_103274672 | 93 |
| 1072 | 3300025906 | Ga0207699_10295384 | Ga0207699_102953842 | 93 |
| 1073 | 3300025909 | Ga0207705_10359009 | Ga0207705_103590092 | 93 |
| 1074 | 3300025909 | Ga0207705_10799814 | Ga0207705_107998142 | 93 |
| 1075 | 3300025911 | Ga0207654_10091223 | Ga0207654_100912232 | 93 |
| 1076 | 3300025913 | Ga0207695_10150035 | Ga0207695_101500353 | 93 |
| 1077 | 3300025917 | Ga0207660_11040210 | Ga0207660_110402102 | 93 |
| 1078 | 3300025919 | Ga0207657_10050665 | Ga0207657_100506651 | 93 |
| 1079 | 3300025920 | Ga0207649_10292325 | Ga0207649_102923253 | 93 |
| 1080 | 3300025921 | Ga0207652_10402790 | Ga0207652_104027902 | 93 |
| 1081 | 3300025922 | Ga0207646_10164402 | Ga0207646_101644022 | 93 |
| 1082 | 3300025924 | Ga0207694_10806853 | Ga0207694_108068532 | 93 |
| 1083 | 3300025928 | Ga0207700_10214806 | Ga0207700_102148062 | 93 |
| 1084 | 3300025929 | Ga0207664_10597443 | Ga0207664_105974432 | 93 |
| 1085 | 3300025929 | Ga0207664_10629612 | Ga0207664_106296123 | 93 |
| 1086 | 3300025935 | Ga0207709_10062259 | Ga0207709_100622594 | 93 |
| 1087 | 3300025937 | Ga0207669_10286618 | Ga0207669_102866182 | 93 |
| 1088 | 3300025941 | Ga0207711_10432077 | Ga0207711_104320772 | 93 |
| 1089 | 3300025949 | Ga0207667_10215153 | Ga0207667_102151534 | 93 |
| 1090 | 3300025949 | Ga0207667_10261322 | Ga0207667_102613222 | 93 |
| 1091 | 3300025972 | Ga0207668_10414281 | Ga0207668_104142812 | 93 |
| 1092 | 3300025981 | Ga0207640_11565908 | Ga0207640_115659082 | 93 |
| 1093 | 3300026023 | Ga0207677_10379112 | Ga0207677_103791123 | 93 |
| 1094 | 3300026035 | Ga0207703_10057141 | Ga0207703_100571416 | 93 |
| 1095 | 3300026075 | Ga0207708_11610985 | Ga0207708_116109851 | 93 |
| 1096 | 3300026078 | Ga0207702_10030901 | Ga0207702_100309012 | 93 |
| 1097 | 3300026078 | Ga0207702_10769845 | Ga0207702_107698451 | 93 |
| 1098 | 3300026078 | Ga0207702_11609110 | Ga0207702_116091102 | 93 |
| 1099 | 3300026088 | Ga0207641_10307914 | Ga0207641_103079143 | 93 |
| 1100 | 3300026089 | Ga0207648_10130957 | Ga0207648_101309573 | 93 |
| 1101 | 3300026089 | Ga0207648_10210247 | Ga0207648_102102474 | 93 |
| 1102 | 3300026118 | Ga0207675_101130887 | Ga0207675_1011308872 | 93 |
| 1103 | 3300028379 | Ga0268266_10179973 | Ga0268266_101799732 | 93 |
| 1104 | 3300028380 | Ga0268265_10951628 | Ga0268265_109516282 | 93 |
| 1105 | 3300028577 | Ga0265318_10000037 | Ga0265318_100000377 | 93 |
| 1106 | 3300031250 | Ga0265331_10002092 | Ga0265331_1000209224 | 93 |
| 1107 | 3300031852 | Ga0307410_10679249 | Ga0307410_106792492 | 93 |
| 1108 | 3300035084 | Ga0373928_0214495 | Ga0373928_0214495_32_322 | 93 |
| 1109 | 3300035116 | Ga0373945_0393499 | Ga0373945_0393499_299_595 | 93 |
| 1110 | 3300035170 | Ga0373943_0005741 | Ga0373943_0005741_3017_3313 | 93 |
| 1111 | 3300035691 | Ga0373931_0198449 | Ga0373931_0198449_432_725 | 93 |
| 1112 | 3300035691 | Ga0373931_0395018 | Ga0373931_0395018_260_550 | 93 |
| 1113 | 3300035692 | Ga0373935_0066301 | Ga0373935_0066301_1849_2145 | 93 |
| 1114 | 3300035695 | Ga0373927_0370766 | Ga0373927_0370766_492_785 | 93 |
| 1115 | 3300035695 | Ga0373927_0711762 | Ga0373927_0711762_161_457 | 93 |
| 1116 | 3300035724 | Ga0373933_0622290 | Ga0373933_0622290_257_553 | 93 |
| 1117 | 3300035725 | Ga0373947_0271981 | Ga0373947_0271981_215_511 | 93 |
| 1118 | 3300037312 | Ga0395899_0010562 | Ga0395899_0010562_4631_4918 | 93 |
| 1119 | 3300037312 | Ga0395899_0048114 | Ga0395899_0048114_153_440 | 93 |
| 1120 | 3300037418 | Ga0395900_0009123 | Ga0395900_0009123_4877_5164 | 93 |
| 1121 | 3300037418 | Ga0395900_0025293 | Ga0395900_0025293_1283_1570 | 93 |
| 1122 | 3300037418 | Ga0395900_0187406 | Ga0395900_0187406_1063_1350 | 93 |
| 1123 | 3300037466 | Ga0395898_0012796 | Ga0395898_0012796_2621_2908 | 93 |
| 1124 | 3300037466 | Ga0395898_0053632 | Ga0395898_0053632_2602_2889 | 93 |
| 1125 | 3300037466 | Ga0395898_0123226 | Ga0395898_0123226_615_902 | 93 |
| 1126 | 3300037471 | Ga0395905_0007439 | Ga0395905_0007439_4337_4624 | 93 |
| 1127 | 3300037471 | Ga0395905_0509100 | Ga0395905_0509100_800_1087 | 93 |
| 1128 | 3300038443 | Ga0395901_0016098 | Ga0395901_0016098_1231_1518 | 93 |
| 1129 | 3300038443 | Ga0395901_0022055 | Ga0395901_0022055_3706_3993 | 93 |
| 1130 | 3300039437 | Ga0436365_1600671 | Ga0436365_1600671_260_619 | 93 |
| 1131 | 3300042876 | Ga0451577_0018151 | Ga0451577_0018151_4021_4311 | 93 |
| 1132 | 3300044712 | Ga0453684_1356476 | Ga0453684_1356476_279_569 | 93 |
| 1133 | 3300046452 | Ga0495617_170429 | Ga0495617_170429_35_322 | 93 |
| 1134 | 3300046455 | Ga0495603_0029274 | Ga0495603_0029274_2677_2964 | 93 |
| 1135 | 3300046472 | Ga0495580_0587980 | Ga0495580_0587980_396_692 | 93 |
| 1136 | 3300046473 | Ga0495582_0229562 | Ga0495582_0229562_434_730 | 93 |
| 1137 | 3300046474 | Ga0495605_0036527 | Ga0495605_0036527_708_995 | 93 |
| 1138 | 3300046491 | Ga0495584_0079201 | Ga0495584_0079201_911_1267 | 93 |
| 1139 | 3300046491 | Ga0495584_0515047 | Ga0495584_0515047_57_344 | 93 |
| 1140 | 3300046499 | Ga0495594_0520465 | Ga0495594_0520465_316_612 | 93 |
| 1141 | 3300046500 | Ga0495596_0317432 | Ga0495596_0317432_232_519 | 93 |
| 1142 | 3300046513 | Ga0495616_0100407 | Ga0495616_0100407_902_1189 | 93 |
| 1143 | 3300046517 | Ga0495630_0196254 | Ga0495630_0196254_394_675 | 93 |
| 1144 | 3300046518 | Ga0495631_0252621 | Ga0495631_0252621_246_533 | 93 |
| 1145 | 3300046519 | Ga0495632_0494389 | Ga0495632_0494389_65_352 | 93 |
| 1146 | 3300046525 | Ga0495663_0034649 | Ga0495663_0034649_515_802 | 93 |
| 1147 | 3300046528 | Ga0495642_0444367 | Ga0495642_0444367_238_525 | 93 |
| 1148 | 3300046531 | Ga0495665_0204499 | Ga0495665_0204499_119_415 | 93 |
| 1149 | 3300046531 | Ga0495665_0539679 | Ga0495665_0539679_146_439 | 93 |
| 1150 | 3300046542 | Ga0495597_0079257 | Ga0495597_0079257_575_862 | 93 |
| 1151 | 3300046558 | Ga0495633_0353752 | Ga0495633_0353752_225_512 | 93 |
| 1152 | 3300046664 | Ga0495659_0059455 | Ga0495659_0059455_974_1261 | 93 |
| 1153 | 3300046664 | Ga0495659_0376048 | Ga0495659_0376048_139_495 | 93 |
| 1154 | 3300046665 | Ga0495661_0263467 | Ga0495661_0263467_123_410 | 93 |
| 1155 | 3300046679 | Ga0495623_0639075 | Ga0495623_0639075_89_382 | 93 |
| 1156 | 3300046691 | Ga0495670_0246030 | Ga0495670_0246030_67_354 | 93 |
| 1157 | 3300046794 | Ga0495589_0034414 | Ga0495589_0034414_444_731 | 93 |
| 1158 | 3300046794 | Ga0495589_0384693 | Ga0495589_0384693_178_465 | 93 |
| 1159 | 3300046810 | Ga0495660_0177699 | Ga0495660_0177699_650_937 | 93 |
| 1160 | 3300047444 | Ga0495675_0396115 | Ga0495675_0396115_284_577 | 93 |
| 1161 | 3300047445 | Ga0495677_0429704 | Ga0495677_0429704_157_444 | 93 |
| 1162 | 3300047446 | Ga0495679_051517 | Ga0495679_051517_714_1001 | 93 |
| 1163 | 3300047471 | Ga0495684_0112941 | Ga0495684_0112941_1253_1549 | 93 |
| 1164 | 3300048091 | Ga0495626_0036606 | Ga0495626_0036606_617_904 | 93 |
| 1165 | 3300048915 | Ga0496112_1374904 | Ga0496112_1374904_112_405 | 93 |
| 1166 | 3300048918 | Ga0496115_1292279 | Ga0496115_1292279_107_400 | 93 |
| 1167 | 3300049589 | Ga0501073_0302090 | Ga0501073_0302090_596_910 | 93 |
| 1168 | 3300049741 | Ga0501079_0397195 | Ga0501079_0397195_345_689 | 93 |
| 1169 | 3300050510 | nmdc:mga06r32_10132_c1 | nmdc:mga06r32_10132_c1_6115_6480 | 93 |
| 1170 | 3300050513 | nmdc:mga0rr50_1048462_c1 | nmdc:mga0rr50_1048462_c1_190_477 | 93 |
| 1171 | 3300050514 | nmdc:mga08x19_383583_c1 | nmdc:mga08x19_383583_c1_315_602 | 93 |
| 1172 | 3300050515 | nmdc:mga0a205_721670_c1 | nmdc:mga0a205_721670_c1_93_380 | 93 |
| 1173 | 3300053078 | Ga0495612_0040216 | Ga0495612_0040216_935_1231 | 93 |
| 1174 | 3300053083 | Ga0495655_0129211 | Ga0495655_0129211_453_740 | 93 |
| 1175 | 3300053133 | Ga0500655_067673 | Ga0500655_067673_27_314 | 93 |
| 1176 | 3300060353 | Ga0501082_0353275 | Ga0501082_0353275_391_705 | 93 |
| 1177 | 3300005329 | Ga0070683_101385591 | Ga0070683_1013855912 | 94 |
| 1178 | 3300005436 | Ga0070713_100070192 | Ga0070713_1000701921 | 94 |
| 1179 | 3300005467 | Ga0070706_101619094 | Ga0070706_1016190942 | 94 |
| 1180 | 3300005518 | Ga0070699_100042312 | Ga0070699_1000423125 | 94 |
| 1181 | 3300005937 | Ga0081455_10204364 | Ga0081455_102043643 | 94 |
| 1182 | 3300005981 | Ga0081538_10137999 | Ga0081538_101379992 | 94 |
| 1183 | 3300006051 | Ga0075364_10052785 | Ga0075364_100527853 | 94 |
| 1184 | 3300006177 | Ga0075362_10035975 | Ga0075362_100359754 | 94 |
| 1185 | 3300006847 | Ga0075431_100227691 | Ga0075431_1002276913 | 94 |
| 1186 | 3300006871 | Ga0075434_102440008 | Ga0075434_1024400082 | 94 |
| 1187 | 3300009094 | Ga0111539_10851327 | Ga0111539_108513272 | 94 |
| 1188 | 3300009147 | Ga0114129_10185815 | Ga0114129_101858155 | 94 |
| 1189 | 3300049591 | Ga0501075_1379473 | Ga0501075_1379473_107_463 | 94 |
| 1190 | 3300050489 | nmdc:mga03683_30010_c1 | nmdc:mga03683_30010_c1_1551_1898 | 94 |
| 1191 | 3300050491 | nmdc:mga00v17_100631_c1 | nmdc:mga00v17_100631_c1_1099_1446 | 94 |
| 1192 | 3300050492 | nmdc:mga0yw44_414509_c1 | nmdc:mga0yw44_414509_c1_178_525 | 94 |
| 1193 | 3300050507 | nmdc:mga05p37_371627_c1 | nmdc:mga05p37_371627_c1_917_1264 | 94 |
| 1194 | 3300050510 | nmdc:mga06r32_164435_c1 | nmdc:mga06r32_164435_c1_1119_1466 | 94 |
| 1195 | 3300053084 | Ga0495595_0533955 | Ga0495595_0533955_116_454 | 94 |
| 1196 | 3300006844 | Ga0075428_100712737 | Ga0075428_1007127372 | 95 |
| 1197 | 3300009147 | Ga0114129_10005890 | Ga0114129_100058909 | 95 |
| 1198 | 3300021361 | Ga0213872_10049267 | Ga0213872_100492673 | 95 |
| 1199 | 3300025916 | Ga0207663_10808044 | Ga0207663_108080442 | 95 |
| 1200 | 3300035116 | Ga0373945_0156320 | Ga0373945_0156320_176_511 | 95 |
| 1201 | 3300035170 | Ga0373943_0966778 | Ga0373943_0966778_35_370 | 95 |
| 1202 | 3300035171 | Ga0373946_0116740 | Ga0373946_0116740_467_802 | 95 |
| 1203 | 3300035692 | Ga0373935_0238773 | Ga0373935_0238773_762_1097 | 95 |
| 1204 | 3300035725 | Ga0373947_0093943 | Ga0373947_0093943_1049_1384 | 95 |
| 1205 | 3300037068 | Ga0373925_0184455 | Ga0373925_0184455_1180_1515 | 95 |
| 1206 | 3300039447 | Ga0436361_0316570 | Ga0436361_0316570_3333_3695 | 95 |
| 1207 | 3300039453 | Ga0436362_0377953 | Ga0436362_0377953_343_705 | 95 |
| 1208 | 3300042438 | Ga0439459_0073839 | Ga0439459_0073839_18_350 | 95 |
| 1209 | 3300046473 | Ga0495582_0013538 | Ga0495582_0013538_1110_1445 | 95 |
| 1210 | 3300046499 | Ga0495594_0218487 | Ga0495594_0218487_336_671 | 95 |
| 1211 | 3300046531 | Ga0495665_0160378 | Ga0495665_0160378_23_358 | 95 |
| 1212 | 3300046681 | Ga0495647_0146014 | Ga0495647_0146014_202_537 | 95 |
| 1213 | 3300046683 | Ga0495658_0015745 | Ga0495658_0015745_2036_2371 | 95 |
| 1214 | 3300046689 | Ga0495613_0169344 | Ga0495613_0169344_571_906 | 95 |
| 1215 | 3300046692 | Ga0495671_0356069 | Ga0495671_0356069_209_544 | 95 |
| 1216 | 3300047315 | Ga0495581_0101344 | Ga0495581_0101344_426_761 | 95 |
| 1217 | 3300047320 | Ga0495672_0158321 | Ga0495672_0158321_679_993 | 95 |
| 1218 | 3300050494 | nmdc:mga06z11_365311_c1 | nmdc:mga06z11_365311_c1_48_368 | 95 |
| 1219 | 3300050507 | nmdc:mga05p37_1773_c1 | nmdc:mga05p37_1773_c1_8683_9048 | 95 |
| 1220 | 3300050508 | nmdc:mga09592_1121654_c1 | nmdc:mga09592_1121654_c1_119_484 | 95 |
| 1221 | 3300005435 | Ga0070714_100488863 | Ga0070714_1004888631 | 96 |
| 1222 | 3300006914 | Ga0075436_100922743 | Ga0075436_1009227431 | 96 |
| 1223 | 3300006847 | Ga0075431_101065795 | Ga0075431_1010657952 | 97 |
| 1224 | 3300021377 | Ga0213874_10309410 | Ga0213874_103094102 | 97 |
| 1225 | 3300031241 | Ga0265325_10000449 | Ga0265325_100004496 | 97 |
| 1226 | 3300038443 | Ga0395901_1087593 | Ga0395901_1087593_271_624 | 97 |
| 1227 | 3300039438 | Ga0436360_1138201 | Ga0436360_1138201_417_746 | 97 |
| 1228 | 3300039450 | Ga0436363_1676224 | Ga0436363_1676224_266_589 | 97 |
| 1229 | 3300050507 | nmdc:mga05p37_1676427_c1 | nmdc:mga05p37_1676427_c1_115_480 | 97 |
| 1230 | 3300003215 | JGI25153J46596_10008996 | JGI25153J46596_1000899610 | 98 |
| 1231 | 3300003215 | JGI25153J46596_10017054 | JGI25153J46596_100170544 | 98 |
| 1232 | 3300003911 | JGI25405J52794_10035110 | JGI25405J52794_100351101 | 98 |
| 1233 | 3300005937 | Ga0081455_10011198 | Ga0081455_100111985 | 98 |
| 1234 | 3300006880 | Ga0075429_100497999 | Ga0075429_1004979991 | 98 |
| 1235 | 3300014326 | Ga0157380_11066332 | Ga0157380_110663322 | 98 |
| 1236 | 3300025297 | Ga0209758_1000548 | Ga0209758_100054854 | 98 |
| 1237 | 3300035086 | Ga0373934_0166095 | Ga0373934_0166095_376_708 | 98 |
| 1238 | 3300035695 | Ga0373927_0575874 | Ga0373927_0575874_384_710 | 98 |
| 1239 | 3300035724 | Ga0373933_0928256 | Ga0373933_0928256_68_400 | 98 |
| 1240 | 3300036401 | Ga0373937_1327369 | Ga0373937_1327369_283_615 | 98 |
| 1241 | 3300037418 | Ga0395900_0088998 | Ga0395900_0088998_2793_3146 | 98 |
| 1242 | 3300037466 | Ga0395898_0210988 | Ga0395898_0210988_98_451 | 98 |
| 1243 | 3300037471 | Ga0395905_0187513 | Ga0395905_0187513_1395_1748 | 98 |
| 1244 | 3300038443 | Ga0395901_0132861 | Ga0395901_0132861_1445_1798 | 98 |
| 1245 | 3300042438 | Ga0439459_0208381 | Ga0439459_0208381_19_318 | 98 |
| 1246 | 3300046528 | Ga0495642_0373751 | Ga0495642_0373751_66_419 | 98 |
| 1247 | 3300046615 | Ga0495656_0555594 | Ga0495656_0555594_198_551 | 98 |
| 1248 | 3300046660 | Ga0495625_0482409 | Ga0495625_0482409_429_728 | 98 |
| 1249 | 3300054114 | Ga0501084_1180791 | Ga0501084_1180791_28_324 | 98 |
| 1250 | 3300005937 | Ga0081455_10305810 | Ga0081455_103058101 | 99 |
| 1251 | 3300006048 | Ga0075363_100942991 | Ga0075363_1009429912 | 99 |
| 1252 | 3300021388 | Ga0213875_10000089 | Ga0213875_10000089113 | 99 |
| 1253 | 3300037853 | Ga0436364_0333324 | Ga0436364_0333324_8186_8512 | 99 |
| 1254 | 3300039437 | Ga0436365_0998743 | Ga0436365_0998743_824_1150 | 99 |
| 1255 | 3300046460 | Ga0495638_0209432 | Ga0495638_0209432_239_562 | 99 |
| 1256 | 3300005983 | Ga0081540_1030792 | Ga0081540_10307924 | 100 |
| 1257 | 3300049589 | Ga0501073_0181298 | Ga0501073_0181298_55_363 | 100 |
| 1258 | 3300049592 | Ga0501076_0222571 | Ga0501076_0222571_1222_1524 | 100 |
| 1259 | 3300050513 | nmdc:mga0rr50_700375_c1 | nmdc:mga0rr50_700375_c1_172_543 | 100 |
| 1260 | 3300031911 | Ga0307412_11557027 | Ga0307412_115570272 | 101 |
| 1261 | 3300032126 | Ga0307415_100427324 | Ga0307415_1004273242 | 101 |
| 1262 | 3300005471 | Ga0070698_101367130 | Ga0070698_1013671302 | 102 |
| 1263 | 3300009094 | Ga0111539_10060664 | Ga0111539_100606647 | 102 |
| 1264 | 3300031691 | Ga0316579_10010091 | Ga0316579_100100915 | 102 |
| 1265 | 3300032133 | Ga0316583_10116423 | Ga0316583_101164232 | 102 |
| 1266 | 3300032168 | Ga0316593_10164792 | Ga0316593_101647921 | 102 |
| 1267 | 3300036647 | Ga0316582_0264236 | Ga0316582_0264236_338_646 | 102 |
| 1268 | 3300050511 | nmdc:mga08y16_93113_c1 | nmdc:mga08y16_93113_c1_331_687 | 102 |
| 1269 | 3300053083 | Ga0495655_0174731 | Ga0495655_0174731_32_343 | 103 |
| 1270 | 3300006028 | Ga0070717_12111438 | Ga0070717_121114381 | 104 |
| 1271 | 3300021358 | Ga0213873_10071188 | Ga0213873_100711883 | 105 |
| 1272 | 3300021384 | Ga0213876_10112449 | Ga0213876_101124492 | 105 |
| 1273 | 3300039437 | Ga0436365_0104312 | Ga0436365_0104312_471_791 | 105 |
| 1274 | 3300002239 | JGI24034J26672_10002598 | JGI24034J26672_100025981 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kzx-assembly1.cif.gz_P | rabbit 40s ribosomal subunit in complex with eif1. | 0.9525 | 27 | 81 |
| 4v6x-assembly1.cif.gz_AP | structure of the human 80s ribosome | 0.9525 | 27 | 81 |
| 6p5n-assembly1.cif.gz_Q | structure of a mammalian 80s ribosome in complex with a single translocated israeli acute paralysis virus ires and erf1 | 0.9344 | 27 | 81 |
| 5xxu-assembly1.cif.gz_P | small subunit of toxoplasma gondii ribosome | 0.9301 | 27 | 81 |
| 7pjy-assembly1.cif.gz_s | structure of the 70s-ef-g-gdp ribosome complex with trnas in chimeric state 1 (chi1-ef-g-gdp) | 0.9247 | 3 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kj2S00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.909 | 3 | 78 | 3.30.860.10 |
| 2qbbS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9044 | 3 | 78 | 3.30.860.10 |
| af_P54018_6_152_3.30.860.10 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8892 | 14 | 81 | 3.30.860.10 |
| 2qowS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8856 | 3 | 78 | 3.30.860.10 |
| 5zeus00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8769 | 7 | 81 | 3.30.860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523UK41-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9424 | 12 | 81 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2G9YR56-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9355 | 1 | 83 |
GO:0000028
GO:0003735 GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A5D0IVM7-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9322 | 7 | 84 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2G6CAA1-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9247 | 1 | 81 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A6L7KFK3-F1-model_v4 | deleted | 0.9235 | 1 | 81 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar