F492445

General Info

Members Datasets Scaffolds Average Seq Length
1274 753 1001 92

Family's Representative Sequence

Representative Sequence 3300002239|JGI24034J26672_10002598|JGI24034J26672_100025981
Length 107
Sequence MARSVWKGPFVDGYLLXKAEASRXSGRHEMIRIWSRRSTILPQFVGLTFGVYNGQKHIPVLVTEEMVGHKFGEFAPTRTFYGHSSDRKAKRSSGPATASAGASGGSS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
9 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
10 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
11 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
12 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
13 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
14 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
15 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
16 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
17 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
18 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
19 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
20 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
21 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
23 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
24 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
25 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
26 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
27 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
28 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
29 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
30 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
31 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
32 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
33 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
34 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
35 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
36 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
37 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
38 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
39 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
40 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
41 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
42 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
43 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
44 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
45 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
46 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
47 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
48 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
49 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
50 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
51 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
52 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
53 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
54 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
55 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
56 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
57 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
58 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
59 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
60 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
61 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
62 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
63 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
64 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
65 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
66 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
67 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
68 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
69 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
70 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
71 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
72 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
73 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
74 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
75 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
76 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
77 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
78 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
79 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
80 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
81 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
82 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
83 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
84 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
85 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
86 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
87 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
88 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
89 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
90 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
91 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
92 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
93 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
94 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
95 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
96 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
97 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
98 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
99 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
100 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
101 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
102 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
103 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
104 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
105 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
106 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
107 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
108 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
109 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
110 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
111 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
112 2902330777 Methylobacterium sp. 2A Isolate Unclassified
113 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
114 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
115 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
116 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
117 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
118 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
119 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
120 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
121 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
122 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
123 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
124 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
125 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
126 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
127 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
128 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
129 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
130 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
131 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
132 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
133 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
134 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
135 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
136 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
137 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
138 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
139 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
140 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
141 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
142 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
143 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
144 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
145 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
146 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
147 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
148 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
149 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
150 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
151 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
152 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
153 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
154 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
155 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
156 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
157 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
158 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
159 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
160 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
161 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
162 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
163 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
164 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
165 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
166 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
167 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
168 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
169 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
170 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
171 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
172 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
173 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
174 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
175 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
176 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
177 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
178 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
179 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
180 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
181 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
182 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
183 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
184 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
185 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
186 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
187 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
188 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
189 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
190 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
191 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
192 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
193 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
194 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
195 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
196 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
197 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
198 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
199 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
200 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
201 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
202 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
203 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
204 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
205 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
206 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
207 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
208 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
209 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
210 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
211 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
212 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
213 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
214 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
215 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
216 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
217 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
218 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
219 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
220 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
221 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
222 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
223 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
224 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
225 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
226 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
227 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
228 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
229 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
230 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
231 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
232 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
233 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
234 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
235 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
236 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
237 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
238 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
239 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
240 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
241 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
242 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
243 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
244 3004167301 Mesorhizobium loti 582 Isolate Unclassified
245 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
246 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
247 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
248 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
249 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
250 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
251 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
252 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
253 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
254 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
255 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
256 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
257 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
258 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
259 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
260 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
261 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
262 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
263 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
264 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
265 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
266 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
267 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
268 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
269 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
270 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
271 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
272 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
273 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
274 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
275 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
276 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
277 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
278 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
279 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
280 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
281 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
282 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
283 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
284 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
285 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
286 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
287 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
288 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
289 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
290 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
291 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
292 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
293 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
294 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
295 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
296 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
297 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
298 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
299 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
300 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
301 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
302 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
303 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
304 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
305 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
306 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
307 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
308 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
309 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
310 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
311 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
312 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
313 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
314 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
315 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
316 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
317 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
318 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
319 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
320 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
321 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
322 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
323 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
324 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
325 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
326 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
327 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
328 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
329 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
330 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
331 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
332 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
333 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
334 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
335 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
336 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
337 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
338 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
339 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
340 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
341 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
342 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
343 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
344 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
345 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
346 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
347 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
348 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
349 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
350 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
351 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
352 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
353 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
354 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
355 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
356 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
357 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
358 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
359 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
360 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
361 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
362 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
363 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
364 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
365 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
366 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
367 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
368 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
369 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
370 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
371 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
372 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
373 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
374 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
375 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
376 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
377 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
378 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
379 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
380 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
381 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
383 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
384 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
385 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
386 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
387 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
388 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
389 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
390 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
391 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
392 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
393 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
394 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
395 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
446 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
447 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
448 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
452 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
453 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
454 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
455 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
458 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
459 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
460 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
461 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
462 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
463 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
464 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
465 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
466 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
467 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
468 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
469 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
470 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
471 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
472 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
473 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
474 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
475 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
476 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
480 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
481 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
482 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
483 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
484 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
485 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
486 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
487 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
488 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
489 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
490 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
491 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
492 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
493 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
494 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
495 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
496 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
497 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
498 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
499 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
500 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
501 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
502 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
503 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
504 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
505 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
506 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
507 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
508 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
509 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
510 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
511 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
512 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
513 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
514 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
515 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
516 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
517 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
518 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
519 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
520 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
521 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
522 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
523 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
524 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
525 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
526 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
527 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
528 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
529 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
530 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
531 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
532 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
533 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
534 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
535 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
536 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
537 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
538 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
539 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
540 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
541 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
542 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
543 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
544 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
545 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
546 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
547 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
548 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
549 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
550 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
551 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
552 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
553 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
554 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
555 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
556 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
557 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
558 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
559 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
560 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
561 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
562 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
563 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
564 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
565 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
566 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
567 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
568 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
569 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
570 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
571 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
572 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
573 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
574 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
575 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
576 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
577 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
578 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
579 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
580 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
581 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
582 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
583 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
584 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
585 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
586 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
587 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
588 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
589 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
590 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
591 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
592 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
593 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
594 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
595 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
596 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
597 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
598 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
599 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
600 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
601 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
602 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
603 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
604 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
605 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
606 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
611 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
612 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
613 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
614 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
615 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
616 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
617 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
618 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
619 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
620 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
621 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
622 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
623 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
624 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
625 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
638 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
639 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
640 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
641 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
642 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
646 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
647 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
648 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
650 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
651 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
652 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
653 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
654 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
655 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
656 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
657 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
658 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
659 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
660 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
661 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
662 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
663 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
664 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
665 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
666 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
667 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
668 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
669 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
670 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
671 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
674 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
675 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
676 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
677 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
678 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
679 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
680 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
681 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
682 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
683 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
684 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
685 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
686 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
687 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
688 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
689 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
690 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
691 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
692 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
693 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
694 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
695 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
696 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
697 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
698 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
699 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
700 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
701 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
702 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
703 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
704 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
705 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
706 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
707 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
708 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
709 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
710 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
711 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
712 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
713 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
714 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
726 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
733 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
735 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
736 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
737 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
738 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
739 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
740 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
741 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
742 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
743 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
744 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
745 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
746 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
747 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
748 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
749 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
750 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
751 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
752 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
753 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.7
Metatranscriptomes 4.87
Isolates 21.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 17.58
Rhizoplane 3.69
Rhizosphere 68.45
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10002598 3300002239 Bacteria 2485
2 JGI24742J22300_10073186 3300002244 Bacteria 641
3 JGI25165J46597_1000961 3300003214 Bacteria 19619
4 JGI25153J46596_10008996 3300003215 Bacteria 4702
5 JGI25153J46596_10017054 3300003215 Bacteria 2878
6 JGI26145J50221_1022307 3300003371 Bacteria 617
7 JGI25404J52841_10036354 3300003659 Bacteria 1048
8 JGI25405J52794_10035110 3300003911 Bacteria 1049
9 Ga0070658_10369759 3300005327 Bacteria 1229
10 Ga0070676_10314514 3300005328 Bacteria 1066
11 Ga0070683_100053275 3300005329 Bacteria 3749
12 Ga0070683_100307635 3300005329 Bacteria 1508
13 Ga0070683_100604505 3300005329 Bacteria 1049
14 Ga0070683_101385591 3300005329 Bacteria 676
15 Ga0070683_102230844 3300005329 Bacteria 525
16 Ga0070690_100506659 3300005330 Bacteria 904
17 Ga0070670_101643710 3300005331 Bacteria 591
18 Ga0070680_100099273 3300005336 Bacteria 2416
19 Ga0070680_101502044 3300005336 Bacteria 583
20 Ga0070680_101895307 3300005336 Bacteria 517
21 Ga0068868_100586001 3300005338 Bacteria 986
22 Ga0068868_101793280 3300005338 Bacteria 580
23 Ga0070660_100002390 3300005339 Bacteria 12895
24 Ga0070660_100549482 3300005339 Bacteria 963
25 Ga0070660_100878404 3300005339 Bacteria 755
26 Ga0070689_100820848 3300005340 Bacteria 819
27 Ga0070689_100829538 3300005340 Bacteria 815
28 Ga0070691_10194117 3300005341 Bacteria 1063
29 Ga0070691_10481719 3300005341 Bacteria 714
30 Ga0070687_101399756 3300005343 Bacteria 523
31 Ga0070661_100005946 3300005344 Bacteria 8403
32 Ga0070661_100362416 3300005344 Bacteria 1139
33 Ga0070692_10999567 3300005345 Bacteria 585
34 Ga0070692_11426567 3300005345 Bacteria 501
35 Ga0070675_101376318 3300005354 Bacteria 651
36 Ga0070671_100907260 3300005355 Bacteria 770
37 Ga0070674_102188399 3300005356 Bacteria 505
38 Ga0070688_100032863 3300005365 Bacteria 3133
39 Ga0070659_100438067 3300005366 Bacteria 1107
40 Ga0070659_100449747 3300005366 Bacteria 1092
41 Ga0070659_100521477 3300005366 Bacteria 1014
42 Ga0070659_101645469 3300005366 Bacteria 574
43 Ga0070667_100463754 3300005367 Bacteria 1158
44 Ga0070714_100488863 3300005435 Bacteria 1173
45 Ga0070714_100858022 3300005435 Bacteria 881
46 Ga0070713_100070192 3300005436 Bacteria 2957
47 Ga0070713_100094598 3300005436 Bacteria 2576
48 Ga0070711_100455858 3300005439 Bacteria 1047
49 Ga0070705_100060632 3300005440 Bacteria 2245
50 Ga0070700_100410419 3300005441 Bacteria 1021
51 Ga0070700_101507759 3300005441 Bacteria 572
52 Ga0070694_100087577 3300005444 Bacteria 2179
53 Ga0070663_100231407 3300005455 Bacteria 1455
54 Ga0070678_100573140 3300005456 Bacteria 1005
55 Ga0070678_100610737 3300005456 Bacteria 975
56 Ga0070662_100090344 3300005457 Bacteria 2298
57 Ga0070662_100797369 3300005457 Bacteria 803
58 Ga0070681_10501507 3300005458 Bacteria 1127
59 Ga0070681_10671287 3300005458 Bacteria 951
60 Ga0070681_10783235 3300005458 Bacteria 870
61 Ga0068867_100104315 3300005459 Bacteria 2170
62 Ga0068867_100140882 3300005459 Bacteria 1885
63 Ga0068867_100604780 3300005459 Bacteria 957
64 Ga0068867_101189746 3300005459 Bacteria 700
65 Ga0068867_101427148 3300005459 Bacteria 643
66 Ga0070685_10055693 3300005466 Bacteria 2298
67 Ga0070706_101619094 3300005467 Bacteria 590
68 Ga0070707_100449824 3300005468 Bacteria 1249
69 Ga0070698_100014515 3300005471 Bacteria 8316
70 Ga0070698_101240397 3300005471 Bacteria 695
71 Ga0070698_101367130 3300005471 Bacteria 659
72 Ga0070699_100042312 3300005518 Bacteria 3942
73 Ga0070679_100088987 3300005530 Bacteria 3074
74 Ga0070679_100617320 3300005530 Bacteria 1027
75 Ga0070679_100669570 3300005530 Bacteria 980
76 Ga0070679_101376566 3300005530 Bacteria 652
77 Ga0070679_101423462 3300005530 Bacteria 640
78 Ga0070684_100052119 3300005535 Bacteria 3557
79 Ga0070684_100099335 3300005535 Bacteria 2597
80 Ga0070684_100535134 3300005535 Bacteria 1086
81 Ga0068853_100013375 3300005539 Bacteria 6698
82 Ga0068853_100440329 3300005539 Bacteria 1224
83 Ga0068853_100893954 3300005539 Bacteria 853
84 Ga0070672_100594160 3300005543 Bacteria 964
85 Ga0070686_100449857 3300005544 Bacteria 990
86 Ga0070695_100034730 3300005545 Bacteria 3163
87 Ga0070695_100387782 3300005545 Bacteria 1056
88 Ga0070696_100017763 3300005546 Bacteria 4802
89 Ga0070693_100093838 3300005547 Bacteria 1815
90 Ga0070693_100200155 3300005547 Bacteria 1297
91 Ga0070693_100234644 3300005547 Bacteria 1209
92 Ga0070693_100702385 3300005547 Bacteria 741
93 Ga0070665_100109440 3300005548 Bacteria 2765
94 Ga0070665_102408002 3300005548 Bacteria 529
95 Ga0068855_100006773 3300005563 Bacteria 13899
96 Ga0068855_100169574 3300005563 Bacteria 2472
97 Ga0068855_101431147 3300005563 Bacteria 711
98 Ga0070664_100191442 3300005564 Bacteria 1822
99 Ga0070664_100210188 3300005564 Bacteria 1739
100 Ga0070664_100677457 3300005564 Bacteria 959
101 Ga0070664_101783881 3300005564 Bacteria 584
102 Ga0068857_100043062 3300005577 Bacteria 4005
103 Ga0068857_100403312 3300005577 Bacteria 1272
104 Ga0068857_102476524 3300005577 Bacteria 509
105 Ga0068854_100126535 3300005578 Bacteria 1947
106 Ga0068854_100384219 3300005578 Bacteria 1158
107 Ga0068856_100158389 3300005614 Bacteria 2274
108 Ga0068856_100161436 3300005614 Bacteria 2251
109 Ga0068856_100173262 3300005614 Bacteria 2170
110 Ga0068856_100448749 3300005614 Bacteria 1310
111 Ga0068856_100629195 3300005614 Bacteria 1094
112 Ga0068856_101236971 3300005614 Bacteria 763
113 Ga0068856_101246424 3300005614 Bacteria 759
114 Ga0068852_100790803 3300005616 Bacteria 962
115 Ga0068852_101228875 3300005616 Bacteria 770
116 Ga0068852_101354444 3300005616 Bacteria 734
117 Ga0068852_102728273 3300005616 Bacteria 513
118 Ga0068859_100316849 3300005617 Bacteria 1653
119 Ga0068859_101099278 3300005617 Bacteria 874
120 Ga0068859_101470644 3300005617 Bacteria 752
121 Ga0068864_101459685 3300005618 Bacteria 686
122 Ga0068866_10482550 3300005718 Bacteria 817
123 Ga0068861_100962324 3300005719 Bacteria 812
124 Ga0068861_101696751 3300005719 Bacteria 624
125 Ga0068851_10272997 3300005834 Bacteria 965
126 Ga0068863_100175261 3300005841 Bacteria 2058
127 Ga0068858_100681127 3300005842 Bacteria 1000
128 Ga0068858_101397477 3300005842 Bacteria 689
129 Ga0068860_100151341 3300005843 Bacteria 2234
130 Ga0068860_100845551 3300005843 Bacteria 930
131 Ga0068860_102399265 3300005843 Bacteria 547
132 Ga0068862_100208344 3300005844 Bacteria 1766
133 Ga0068862_100466502 3300005844 Bacteria 1193
134 Ga0068862_101106375 3300005844 Bacteria 788
135 Ga0068862_101423902 3300005844 Bacteria 697
136 Ga0081455_10011198 3300005937 Bacteria 9024
137 Ga0081455_10061752 3300005937 Bacteria 3152
138 Ga0081455_10204364 3300005937 Bacteria 1477
139 Ga0081455_10305810 3300005937 Bacteria 1139
140 Ga0081538_10137999 3300005981 Bacteria 1131
141 Ga0081540_1004248 3300005983 Bacteria 10995
142 Ga0081540_1008438 3300005983 Bacteria 7199
143 Ga0081540_1030792 3300005983 Bacteria 2965
144 Ga0081540_1032087 3300005983 Bacteria 2874
145 Ga0070717_12111438 3300006028 Bacteria 507
146 Ga0075363_100004858 3300006048 Bacteria 5938
147 Ga0075363_100942991 3300006048 Bacteria 530
148 Ga0075364_10052785 3300006051 Bacteria 2657
149 Ga0075364_10095261 3300006051 Bacteria 1979
150 Ga0075364_10216020 3300006051 Bacteria 1300
151 Ga0070716_101275562 3300006173 Bacteria 593
152 Ga0070712_100149925 3300006175 Bacteria 1789
153 Ga0070712_100954403 3300006175 Bacteria 741
154 Ga0075362_10015125 3300006177 Bacteria 3133
155 Ga0075362_10035975 3300006177 Bacteria 2164
156 Ga0075362_10418025 3300006177 Bacteria 678
157 Ga0075367_10201217 3300006178 Bacteria 1244
158 Ga0097621_100585112 3300006237 Bacteria 1019
159 Ga0075370_10003104 3300006353 Bacteria 7840
160 Ga0068871_100063920 3300006358 Bacteria 3011
161 Ga0068871_100502548 3300006358 Bacteria 1093
162 Ga0068871_100548815 3300006358 Bacteria 1046
163 Ga0075428_100038388 3300006844 Bacteria 5270
164 Ga0075428_100712737 3300006844 Bacteria 1069
165 Ga0075428_100958316 3300006844 Bacteria 906
166 Ga0075428_102694369 3300006844 Bacteria 507
167 Ga0075430_100038858 3300006846 Bacteria 4030
168 Ga0075430_100662420 3300006846 Bacteria 861
169 Ga0075430_101286480 3300006846 Bacteria 602
170 Ga0075431_100120442 3300006847 Bacteria 2708
171 Ga0075431_100227691 3300006847 Bacteria 1900
172 Ga0075431_101065795 3300006847 Bacteria 774
173 Ga0075433_10068755 3300006852 Bacteria 3110
174 Ga0075433_10670941 3300006852 Bacteria 909
175 Ga0075433_11115434 3300006852 Bacteria 686
176 Ga0075434_100155197 3300006871 Bacteria 2309
177 Ga0075434_100299829 3300006871 Bacteria 1628
178 Ga0075434_102440008 3300006871 Bacteria 525
179 Ga0075429_100205004 3300006880 Bacteria 1728
180 Ga0075429_100218905 3300006880 Bacteria 1668
181 Ga0075429_100497999 3300006880 Bacteria 1068
182 Ga0068865_100058757 3300006881 Bacteria 2687
183 Ga0068865_100170832 3300006881 Bacteria 1666
184 Ga0075436_100560062 3300006914 Bacteria 840
185 Ga0075436_100922743 3300006914 Bacteria 654
186 Ga0097620_100316858 3300006931 Bacteria 1653
187 Ga0097620_101099276 3300006931 Bacteria 874
188 Ga0097620_101470637 3300006931 Bacteria 752
189 Ga0075435_100257087 3300007076 Bacteria 1487
190 Ga0075435_101173984 3300007076 Bacteria 672
191 Ga0075435_101266269 3300007076 Bacteria 646
192 Ga0075435_101323175 3300007076 Bacteria 631
193 Ga0105240_10598473 3300009093 Bacteria 1214
194 Ga0111539_10060664 3300009094 Bacteria 4482
195 Ga0111539_10079410 3300009094 Bacteria 3860
196 Ga0111539_10146569 3300009094 Bacteria 2764
197 Ga0111539_10851327 3300009094 Bacteria 1061
198 Ga0111539_11186742 3300009094 Bacteria 887
199 Ga0105245_10195049 3300009098 Bacteria 1942
200 Ga0105245_10411966 3300009098 Bacteria 1353
201 Ga0105245_10432327 3300009098 Bacteria 1321
202 Ga0105245_12703522 3300009098 Bacteria 549
203 Ga0105245_12794392 3300009098 Bacteria 541
204 Ga0105245_13151583 3300009098 Bacteria 511
205 Ga0105247_10739742 3300009101 Bacteria 744
206 Ga0114129_10005890 3300009147 Bacteria 17359
207 Ga0114129_10076149 3300009147 Bacteria 4671
208 Ga0114129_10185815 3300009147 Bacteria 2825
209 Ga0114129_10282465 3300009147 Bacteria 2217
210 Ga0114129_10396737 3300009147 Bacteria 1819
211 Ga0105243_10122511 3300009148 Bacteria 2195
212 Ga0105243_10411685 3300009148 Bacteria 1258
213 Ga0105243_10578929 3300009148 Bacteria 1077
214 Ga0105243_10590318 3300009148 Bacteria 1068
215 Ga0105243_10669595 3300009148 Bacteria 1008
216 Ga0105241_10017868 3300009174 Bacteria 5216
217 Ga0105241_10655747 3300009174 Bacteria 954
218 Ga0105242_11117859 3300009176 Bacteria 803
219 Ga0105242_11560480 3300009176 Bacteria 693
220 Ga0105242_11591591 3300009176 Bacteria 687
221 Ga0105248_10140985 3300009177 Bacteria 2719
222 Ga0105248_10284388 3300009177 Bacteria 1862
223 Ga0105248_13286726 3300009177 Bacteria 514
224 Ga0105237_10002619 3300009545 Bacteria 22167
225 Ga0105237_10047955 3300009545 Bacteria 4295
226 Ga0105237_10471743 3300009545 Bacteria 1261
227 Ga0105238_11661901 3300009551 Bacteria 669
228 Ga0105249_11346463 3300009553 Bacteria 786
229 Ga0105239_10102043 3300010375 Bacteria 3175
230 Ga0105239_10291478 3300010375 Bacteria 1838
231 Ga0105239_10541023 3300010375 Bacteria 1326
232 Ga0105239_10658354 3300010375 Bacteria 1196
233 Ga0105239_11736225 3300010375 Bacteria 723
234 Ga0105246_10525059 3300011119 Bacteria 1010
235 Ga0157320_1011992 3300012481 Bacteria 691
236 Ga0157343_1003739 3300012488 Bacteria 909
237 Ga0157322_1029946 3300012490 Bacteria 575
238 Ga0157319_1018783 3300012497 Bacteria 651
239 Ga0157342_1061653 3300012507 Bacteria 552
240 Ga0157327_1009341 3300012512 Bacteria 901
241 Ga0157373_10685601 3300013100 Bacteria 750
242 Ga0157371_10605938 3300013102 Bacteria 815
243 Ga0157370_10422380 3300013104 Bacteria 1226
244 Ga0157370_10601969 3300013104 Bacteria 1006
245 Ga0157369_10124513 3300013105 Bacteria 2733
246 Ga0157369_10675688 3300013105 Bacteria 1064
247 Ga0157374_10218485 3300013296 Bacteria 1870
248 Ga0157374_10368360 3300013296 Bacteria 1430
249 Ga0157374_12710550 3300013296 Bacteria 523
250 Ga0157378_10456063 3300013297 Bacteria 1270
251 Ga0157378_12233764 3300013297 Bacteria 598
252 Ga0157378_12824613 3300013297 Bacteria 538
253 Ga0163162_13074766 3300013306 Bacteria 536
254 Ga0157372_10968208 3300013307 Bacteria 986
255 Ga0157372_11586586 3300013307 Bacteria 753
256 Ga0157375_10288130 3300013308 Bacteria 1805
257 Ga0157375_10321513 3300013308 Bacteria 1712
258 Ga0157375_11633331 3300013308 Bacteria 762
259 Ga0157375_13821583 3300013308 Bacteria 500
260 Ga0157380_11066332 3300014326 Bacteria 845
261 Ga0157380_11336915 3300014326 Bacteria 765
262 Ga0157380_12206039 3300014326 Bacteria 615
263 Ga0157379_11386180 3300014968 Bacteria 681
264 Ga0157376_10180451 3300014969 Bacteria 1929
265 Ga0157376_10223096 3300014969 Bacteria 1747
266 Ga0157376_10770891 3300014969 Bacteria 972
267 Ga0157376_11978993 3300014969 Bacteria 620
268 Ga0182005_1006944 3300015265 Bacteria 3424
269 Ga0182005_1115342 3300015265 Bacteria 761
270 Ga0163161_11989211 3300017792 Bacteria 517
271 Ga0206351_10012725 3300020077 Bacteria 1017
272 Ga0154015_1181558 3300020610 Bacteria 1459
273 Ga0213873_10071188 3300021358 Bacteria 959
274 Ga0213872_10049267 3300021361 Bacteria 1913
275 Ga0213874_10309410 3300021377 Bacteria 596
276 Ga0213876_10112449 3300021384 Bacteria 1445
277 Ga0213875_10000089 3300021388 Bacteria 105772
278 Ga0213875_10376426 3300021388 Bacteria 676
279 Ga0213871_10018399 3300021441 Bacteria 1709
280 Ga0213871_10224361 3300021441 Bacteria 591
281 Ga0224572_1089236 3300024225 Bacteria 569
282 Ga0228598_1072408 3300024227 Bacteria 689
283 Ga0207427_101449 3300025231 Bacteria 8554
284 Ga0209233_1000293 3300025261 Bacteria 63470
285 Ga0209025_1126623 3300025294 Bacteria 751
286 Ga0209758_1000548 3300025297 Bacteria 59657
287 Ga0207426_1073154 3300025302 Bacteria 949
288 Ga0209051_1102276 3300025303 Bacteria 767
289 Ga0207656_10327467 3300025321 Bacteria 762
290 Ga0207688_10905613 3300025901 Bacteria 558
291 Ga0207688_11011188 3300025901 Bacteria 525
292 Ga0207647_10063680 3300025904 Bacteria 2242
293 Ga0207699_10295384 3300025906 Bacteria 1130
294 Ga0207645_10347630 3300025907 Bacteria 992
295 Ga0207705_10001453 3300025909 Bacteria 18913
296 Ga0207705_10359009 3300025909 Bacteria 1123
297 Ga0207705_10563534 3300025909 Bacteria 886
298 Ga0207705_10799814 3300025909 Bacteria 732
299 Ga0207705_10974227 3300025909 Bacteria 656
300 Ga0207684_10588933 3300025910 Bacteria 950
301 Ga0207654_10091223 3300025911 Bacteria 1858
302 Ga0207654_11071908 3300025911 Bacteria 587
303 Ga0207707_10065034 3300025912 Bacteria 3176
304 Ga0207707_10150230 3300025912 Bacteria 2037
305 Ga0207695_10150035 3300025913 Bacteria 2271
306 Ga0207671_10001074 3300025914 Bacteria 33173
307 Ga0207671_10987266 3300025914 Bacteria 664
308 Ga0207663_10419978 3300025916 Bacteria 1026
309 Ga0207663_10808044 3300025916 Bacteria 747
310 Ga0207660_10127508 3300025917 Bacteria 1934
311 Ga0207660_10769704 3300025917 Bacteria 786
312 Ga0207660_11040210 3300025917 Bacteria 668
313 Ga0207660_11161181 3300025917 Bacteria 629
314 Ga0207657_10006791 3300025919 Bacteria 11813
315 Ga0207657_10050665 3300025919 Bacteria 3613
316 Ga0207657_10114000 3300025919 Bacteria 2230
317 Ga0207649_10000194 3300025920 Bacteria 50112
318 Ga0207649_10292325 3300025920 Bacteria 1188
319 Ga0207652_10077820 3300025921 Bacteria 2895
320 Ga0207652_10176407 3300025921 Bacteria 1919
321 Ga0207652_10402790 3300025921 Bacteria 1234
322 Ga0207652_10649732 3300025921 Bacteria 943
323 Ga0207646_10164402 3300025922 Bacteria 2003
324 Ga0207694_10304721 3300025924 Bacteria 1312
325 Ga0207694_10806853 3300025924 Bacteria 793
326 Ga0207650_10445007 3300025925 Bacteria 1078
327 Ga0207659_10653137 3300025926 Bacteria 899
328 Ga0207687_10966340 3300025927 Bacteria 730
329 Ga0207700_10214806 3300025928 Bacteria 1628
330 Ga0207664_10597443 3300025929 Bacteria 991
331 Ga0207664_10629612 3300025929 Bacteria 964
332 Ga0207644_10326829 3300025931 Bacteria 1241
333 Ga0207644_11808892 3300025931 Bacteria 511
334 Ga0207690_10221657 3300025932 Bacteria 1447
335 Ga0207690_10349373 3300025932 Bacteria 1169
336 Ga0207690_10551152 3300025932 Bacteria 937
337 Ga0207706_10083691 3300025933 Bacteria 2805
338 Ga0207709_10062259 3300025935 Bacteria 2335
339 Ga0207670_10386673 3300025936 Bacteria 1116
340 Ga0207670_10584286 3300025936 Bacteria 916
341 Ga0207670_10973312 3300025936 Bacteria 713
342 Ga0207669_10286618 3300025937 Bacteria 1245
343 Ga0207704_10234376 3300025938 Bacteria 1367
344 Ga0207691_11470465 3300025940 Bacteria 558
345 Ga0207711_10432077 3300025941 Bacteria 1225
346 Ga0207711_10501217 3300025941 Bacteria 1132
347 Ga0207661_10061857 3300025944 Bacteria 3026
348 Ga0207661_10242014 3300025944 Bacteria 1601
349 Ga0207661_10281722 3300025944 Bacteria 1486
350 Ga0207679_10330417 3300025945 Bacteria 1323
351 Ga0207679_11336920 3300025945 Bacteria 657
352 Ga0207667_10002756 3300025949 Bacteria 21724
353 Ga0207667_10215153 3300025949 Bacteria 1969
354 Ga0207667_10261322 3300025949 Bacteria 1770
355 Ga0207667_11247038 3300025949 Bacteria 721
356 Ga0207651_10263706 3300025960 Bacteria 1416
357 Ga0207668_10414281 3300025972 Bacteria 1142
358 Ga0207668_11046118 3300025972 Bacteria 731
359 Ga0207640_10107100 3300025981 Bacteria 1973
360 Ga0207640_11565908 3300025981 Bacteria 593
361 Ga0207677_10379112 3300026023 Bacteria 1193
362 Ga0207703_10057141 3300026035 Bacteria 3180
363 Ga0207703_11317563 3300026035 Bacteria 695
364 Ga0207703_11618103 3300026035 Bacteria 623
365 Ga0207639_10009890 3300026041 Bacteria 6587
366 Ga0207639_10121098 3300026041 Bacteria 2150
367 Ga0207678_10022593 3300026067 Bacteria 5509
368 Ga0207708_10110240 3300026075 Bacteria 2136
369 Ga0207708_10554491 3300026075 Bacteria 969
370 Ga0207708_11610985 3300026075 Bacteria 570
371 Ga0207702_10030901 3300026078 Bacteria 4463
372 Ga0207702_10073915 3300026078 Bacteria 2940
373 Ga0207702_10769845 3300026078 Bacteria 951
374 Ga0207702_10997846 3300026078 Bacteria 830
375 Ga0207702_11609110 3300026078 Bacteria 643
376 Ga0207641_10154200 3300026088 Bacteria 2083
377 Ga0207641_10307914 3300026088 Bacteria 1498
378 Ga0207648_10130957 3300026089 Bacteria 2208
379 Ga0207648_10210247 3300026089 Bacteria 1727
380 Ga0207648_10568390 3300026089 Bacteria 1043
381 Ga0207674_10013836 3300026116 Bacteria 8927
382 Ga0207674_10101849 3300026116 Bacteria 2852
383 Ga0207675_100213567 3300026118 Bacteria 1857
384 Ga0207675_101130887 3300026118 Bacteria 803
385 Ga0207675_102476482 3300026118 Bacteria 530
386 Ga0207683_10085243 3300026121 Bacteria 2808
387 Ga0207683_10270036 3300026121 Bacteria 1554
388 Ga0207683_10619623 3300026121 Bacteria 1002
389 Ga0209282_1000032 3300027666 Bacteria 149218
390 Ga0209974_10012559 3300027876 Bacteria 2830
391 Ga0207428_10704774 3300027907 Bacteria 722
392 Ga0268266_10000321 3300028379 Bacteria 75565
393 Ga0268266_10179973 3300028379 Bacteria 1924
394 Ga0268265_10162575 3300028380 Bacteria 1899
395 Ga0268265_10864402 3300028380 Bacteria 886
396 Ga0268265_10951628 3300028380 Bacteria 846
397 Ga0268264_10857827 3300028381 Bacteria 910
398 Ga0265318_10000037 3300028577 Bacteria 138223
399 Ga0307517_10115379 3300028786 Bacteria 2016
400 Ga0265324_10000500 3300029957 Bacteria 27131
401 Ga0307512_10457118 3300030522 Bacteria 513
402 Ga0265762_1174339 3300030760 Bacteria 526
403 Ga0265766_1024028 3300030863 Bacteria 516
404 Ga0265325_10000449 3300031241 Bacteria 29667
405 Ga0265325_10131935 3300031241 Bacteria 1195
406 Ga0265331_10002092 3300031250 Bacteria 13775
407 Ga0265331_10107041 3300031250 Bacteria 1284
408 Ga0265327_10071532 3300031251 Bacteria 1735
409 Ga0265327_10413512 3300031251 Bacteria 585
410 Ga0265316_10040773 3300031344 Bacteria 3721
411 Ga0265316_10316460 3300031344 Bacteria 1134
412 Ga0265316_10497629 3300031344 Bacteria 871
413 Ga0307408_100361446 3300031548 Bacteria 1235
414 Ga0316579_10010091 3300031691 Bacteria 3985
415 Ga0265314_10001521 3300031711 Bacteria 25613
416 Ga0265342_10369250 3300031712 Bacteria 745
417 Ga0307516_10000048 3300031730 Bacteria 130378
418 Ga0307405_10304730 3300031731 Bacteria 1210
419 Ga0307405_10993751 3300031731 Bacteria 715
420 Ga0307405_11571875 3300031731 Bacteria 580
421 Ga0307413_10153805 3300031824 Bacteria 1606
422 Ga0307413_10456558 3300031824 Bacteria 1015
423 Ga0307410_10554150 3300031852 Bacteria 953
424 Ga0307410_10679249 3300031852 Bacteria 866
425 Ga0307410_10722459 3300031852 Bacteria 841
426 Ga0307410_10753272 3300031852 Bacteria 825
427 Ga0307407_10307945 3300031903 Bacteria 1107
428 Ga0307412_10487792 3300031911 Bacteria 1023
429 Ga0307412_11557027 3300031911 Bacteria 602
430 Ga0307416_101573201 3300032002 Bacteria 763
431 Ga0307416_102429323 3300032002 Bacteria 623
432 Ga0307416_102929555 3300032002 Bacteria 571
433 Ga0307414_10123159 3300032004 Bacteria 1997
434 Ga0307414_10324126 3300032004 Bacteria 1312
435 Ga0307414_11146249 3300032004 Bacteria 719
436 Ga0307411_10410308 3300032005 Bacteria 1122
437 Ga0307415_100427324 3300032126 Bacteria 1139
438 Ga0307415_100793929 3300032126 Bacteria 863
439 Ga0307415_100936080 3300032126 Bacteria 801
440 Ga0316583_10116423 3300032133 Bacteria 932
441 Ga0316583_10317123 3300032133 Bacteria 539
442 Ga0316593_10020888 3300032168 Bacteria 2042
443 Ga0316593_10043962 3300032168 Bacteria 1494
444 Ga0316593_10063317 3300032168 Bacteria 1268
445 Ga0316593_10091179 3300032168 Bacteria 1073
446 Ga0316593_10128486 3300032168 Bacteria 913
447 Ga0316593_10164792 3300032168 Bacteria 811
448 Ga0316593_10401167 3300032168 Bacteria 530
449 Ga0316587_1087875 3300033529 Bacteria 591
450 Ga0316596_1042721 3300033541 Bacteria 1193
451 Ga0373928_0041260 3300035084 Bacteria 1060
452 Ga0373928_0214495 3300035084 Bacteria 560
453 Ga0373929_0027794 3300035085 Bacteria 1191
454 Ga0373934_0166095 3300035086 Bacteria 906
455 Ga0373940_0047019 3300035088 Bacteria 1202
456 Ga0373949_0063774 3300035090 Bacteria 953
457 Ga0373951_0059414 3300035091 Bacteria 955
458 Ga0373932_0045214 3300035112 Bacteria 1287
459 Ga0373941_0063200 3300035115 Bacteria 1210
460 Ga0373945_0156320 3300035116 Bacteria 927
461 Ga0373945_0393499 3300035116 Bacteria 606
462 Ga0373960_0004525 3300035121 Bacteria 3192
463 Ga0373943_0005741 3300035170 Bacteria 5569
464 Ga0373943_0966778 3300035170 Bacteria 510
465 Ga0373946_0116740 3300035171 Bacteria 1214
466 Ga0373955_0396895 3300035172 Bacteria 838
467 Ga0373961_0060924 3300035241 Bacteria 1145
468 Ga0316574_0385368 3300035398 Bacteria 884
469 Ga0373931_0028558 3300035691 Bacteria 2857
470 Ga0373931_0198449 3300035691 Bacteria 1197
471 Ga0373931_0205613 3300035691 Bacteria 1178
472 Ga0373931_0395018 3300035691 Bacteria 874
473 Ga0373935_0066301 3300035692 Bacteria 2319
474 Ga0373935_0238773 3300035692 Bacteria 1268
475 Ga0373927_0029560 3300035695 Bacteria 3572
476 Ga0373927_0370766 3300035695 Bacteria 944
477 Ga0373927_0575874 3300035695 Bacteria 744
478 Ga0373927_0711762 3300035695 Bacteria 663
479 Ga0373933_0622290 3300035724 Bacteria 709
480 Ga0373933_0928256 3300035724 Bacteria 573
481 Ga0373947_0093943 3300035725 Bacteria 1875
482 Ga0373947_0271981 3300035725 Bacteria 1125
483 Ga0373947_0556276 3300035725 Bacteria 781
484 Ga0373937_0524014 3300036401 Bacteria 1126
485 Ga0373937_1327369 3300036401 Bacteria 667
486 Ga0316582_0264236 3300036647 Bacteria 1180
487 Ga0316584_0213436 3300036712 Bacteria 1420
488 Ga0316584_0237850 3300036712 Bacteria 1334
489 Ga0373925_0059917 3300037068 Bacteria 2857
490 Ga0373925_0184455 3300037068 Bacteria 1653
491 Ga0395899_0009289 3300037312 Bacteria 7550
492 Ga0395899_0010562 3300037312 Bacteria 7074
493 Ga0395899_0048114 3300037312 Bacteria 3174
494 Ga0395899_0383044 3300037312 Bacteria 934
495 Ga0395900_0009123 3300037418 Bacteria 10158
496 Ga0395900_0025293 3300037418 Bacteria 6078
497 Ga0395900_0079088 3300037418 Bacteria 3378
498 Ga0395900_0088998 3300037418 Bacteria 3174
499 Ga0395900_0168314 3300037418 Bacteria 2232
500 Ga0395900_0187406 3300037418 Bacteria 2100
501 Ga0395900_0237666 3300037418 Bacteria 1829
502 Ga0395900_1299754 3300037418 Bacteria 641
503 Ga0395898_0009501 3300037466 Bacteria 10210
504 Ga0395898_0012796 3300037466 Bacteria 8662
505 Ga0395898_0053632 3300037466 Bacteria 3938
506 Ga0395898_0062833 3300037466 Bacteria 3605
507 Ga0395898_0123226 3300037466 Bacteria 2484
508 Ga0395898_0162999 3300037466 Bacteria 2132
509 Ga0395898_0196913 3300037466 Bacteria 1924
510 Ga0395898_0210988 3300037466 Bacteria 1852
511 Ga0395905_0007439 3300037471 Bacteria 10890
512 Ga0395905_0022623 3300037471 Bacteria 5942
513 Ga0395905_0187513 3300037471 Bacteria 1941
514 Ga0395905_0509100 3300037471 Bacteria 1104
515 Ga0395905_0537049 3300037471 Bacteria 1070
516 Ga0436364_0154708 3300037853 Bacteria 1303
517 Ga0436364_0333324 3300037853 Bacteria 10396
518 Ga0436364_0387099 3300037853 Bacteria 834
519 Ga0436364_1329342 3300037853 Bacteria 1548
520 Ga0395901_0016098 3300038443 Bacteria 7618
521 Ga0395901_0022055 3300038443 Bacteria 6527
522 Ga0395901_0029226 3300038443 Bacteria 5672
523 Ga0395901_0061803 3300038443 Bacteria 3897
524 Ga0395901_0132861 3300038443 Bacteria 2615
525 Ga0395901_1087593 3300038443 Bacteria 771
526 Ga0400483_065380 3300039062 Bacteria 1297
527 Ga0400483_074646 3300039062 Bacteria 2528
528 Ga0400483_079140 3300039062 Bacteria 6427
529 Ga0400483_191914 3300039062 Bacteria 2021
530 Ga0400483_212486 3300039062 Bacteria 1025
531 Ga0436365_0104312 3300039437 Bacteria 1783
532 Ga0436365_0383888 3300039437 Bacteria 1668
533 Ga0436365_0998743 3300039437 Bacteria 1694
534 Ga0436365_1100019 3300039437 Bacteria 628
535 Ga0436365_1356266 3300039437 Bacteria 540
536 Ga0436365_1600671 3300039437 Bacteria 631
537 Ga0436360_0558978 3300039438 Bacteria 2949
538 Ga0436360_1138201 3300039438 Bacteria 879
539 Ga0436360_1332781 3300039438 Bacteria 3795
540 Ga0436361_0316570 3300039447 Bacteria 12614
541 Ga0436361_0700032 3300039447 Bacteria 1014
542 Ga0436363_1628752 3300039450 Bacteria 719
543 Ga0436363_1676224 3300039450 Bacteria 658
544 Ga0436362_0281584 3300039453 Bacteria 569
545 Ga0436362_0377953 3300039453 Bacteria 1179
546 Ga0436362_1042172 3300039453 Bacteria 843
547 Ga0439465_0172218 3300041413 Bacteria 780
548 Ga0451787_362070 3300041441 Bacteria 617
549 Ga0451787_425155 3300041441 Bacteria 541
550 Ga0451793_1804433 3300041452 Bacteria 518
551 Ga0451797_0747974 3300041453 Bacteria 670
552 Ga0451799_09344 3300041454 Bacteria 930
553 Ga0451801_35813 3300041455 Bacteria 1345
554 Ga0451803_08367 3300041457 Bacteria 864
555 Ga0451798_0617325 3300041458 Bacteria 515
556 Ga0451802_1537885 3300041460 Bacteria 955
557 Ga0451805_061040 3300041461 Bacteria 1639
558 Ga0451808_30401 3300041464 Bacteria 588
559 Ga0451839_0695104 3300041496 Bacteria 510
560 Ga0451839_0847847 3300041496 Bacteria 587
561 Ga0451839_1229688 3300041496 Bacteria 678
562 Ga0451843_0055671 3300041509 Bacteria 741
563 Ga0451843_1768234 3300041509 Bacteria 671
564 Ga0439431_0149718 3300041997 Bacteria 663
565 Ga0439431_0173237 3300041997 Bacteria 621
566 Ga0439445_0023544 3300042004 Bacteria 1560
567 Ga0439432_110799 3300042006 Bacteria 817
568 Ga0439449_0108023 3300042007 Bacteria 1030
569 Ga0439452_055235 3300042010 Bacteria 900
570 Ga0439455_0168740 3300042012 Bacteria 628
571 Ga0450914_001376 3300042118 Bacteria 1509
572 Ga0450895_020207 3300042132 Bacteria 615
573 Ga0450905_012598 3300042142 Bacteria 1191
574 Ga0450906_109365 3300042145 Bacteria 507
575 Ga0439446_0054400 3300042156 Bacteria 1200
576 Ga0439459_0073839 3300042438 Bacteria 794
577 Ga0439459_0208381 3300042438 Bacteria 537
578 Ga0439460_0220407 3300042461 Bacteria 650
579 Ga0450893_0021936 3300042532 Bacteria 1104
580 Ga0451577_0018151 3300042876 Bacteria 6483
581 Ga0451577_0761776 3300042876 Bacteria 875
582 Ga0439440_0089182 3300042993 Bacteria 825
583 Ga0453683_0103988 3300044673 Bacteria 1784
584 Ga0453683_0452538 3300044673 Bacteria 830
585 Ga0466965_0331637 3300044683 Bacteria 830
586 Ga0466965_0442654 3300044683 Bacteria 723
587 Ga0466966_0759665 3300044684 Bacteria 584
588 Ga0466964_0239149 3300044706 Bacteria 890
589 Ga0453684_0007381 3300044712 Bacteria 20256
590 Ga0453684_1356476 3300044712 Bacteria 739
591 Ga0466971_0452486 3300044719 Bacteria 630
592 Ga0466968_0056953 3300044735 Bacteria 1679
593 Ga0466970_0371334 3300044765 Bacteria 813
594 Ga0466970_0471772 3300044765 Bacteria 721
595 Ga0466957_0902304 3300044842 Bacteria 632
596 Ga0466960_0051465 3300044901 Bacteria 1990
597 Ga0466960_0079876 3300044901 Bacteria 1646
598 Ga0466960_0410521 3300044901 Bacteria 781
599 Ga0451576_0003979 3300045051 Bacteria 19673
600 Ga0451576_0049923 3300045051 Bacteria 4390
601 Ga0451576_0212441 3300045051 Bacteria 2020
602 Ga0451576_0799428 3300045051 Bacteria 990
603 Ga0466958_0827902 3300045836 Bacteria 604
604 Ga0466967_1475832 3300045976 Bacteria 677
605 Ga0466967_1794277 3300045976 Bacteria 611
606 Ga0466967_1971071 3300045976 Bacteria 581
607 Ga0495617_170429 3300046452 Bacteria 688
608 Ga0495603_0029274 3300046455 Bacteria 3321
609 Ga0495603_0176416 3300046455 Bacteria 1237
610 Ga0495590_0018187 3300046457 Bacteria 2519
611 Ga0495638_0209432 3300046460 Bacteria 1096
612 Ga0495638_0478707 3300046460 Bacteria 631
613 Ga0495641_0039986 3300046461 Bacteria 2183
614 Ga0495580_0315331 3300046472 Bacteria 1063
615 Ga0495580_0587980 3300046472 Bacteria 736
616 Ga0495582_0013538 3300046473 Bacteria 4492
617 Ga0495582_0229562 3300046473 Bacteria 1063
618 Ga0495582_0324047 3300046473 Bacteria 886
619 Ga0495582_0447538 3300046473 Bacteria 746
620 Ga0495582_0550981 3300046473 Bacteria 667
621 Ga0495605_0036527 3300046474 Bacteria 2477
622 Ga0495639_0067778 3300046475 Bacteria 1644
623 Ga0495662_0528191 3300046476 Bacteria 578
624 Ga0495584_0079201 3300046491 Bacteria 1653
625 Ga0495584_0372397 3300046491 Bacteria 725
626 Ga0495584_0515047 3300046491 Bacteria 609
627 Ga0495594_0218487 3300046499 Bacteria 1087
628 Ga0495594_0520465 3300046499 Bacteria 675
629 Ga0495596_0317432 3300046500 Bacteria 606
630 Ga0495616_0100407 3300046513 Bacteria 1358
631 Ga0495630_0196254 3300046517 Bacteria 1540
632 Ga0495630_0405713 3300046517 Bacteria 1044
633 Ga0495631_0252621 3300046518 Bacteria 751
634 Ga0495632_0494389 3300046519 Bacteria 528
635 Ga0495663_0034649 3300046525 Bacteria 1513
636 Ga0495642_0373751 3300046528 Bacteria 627
637 Ga0495642_0412170 3300046528 Bacteria 596
638 Ga0495642_0444367 3300046528 Bacteria 573
639 Ga0495665_0058685 3300046531 Bacteria 2032
640 Ga0495665_0160378 3300046531 Bacteria 1172
641 Ga0495665_0204499 3300046531 Bacteria 1023
642 Ga0495665_0539679 3300046531 Bacteria 586
643 Ga0495586_0053697 3300046535 Bacteria 2183
644 Ga0495609_0091258 3300046538 Bacteria 1325
645 Ga0495597_0068974 3300046542 Bacteria 1527
646 Ga0495597_0079257 3300046542 Bacteria 1407
647 Ga0495622_0237134 3300046557 Bacteria 805
648 Ga0495633_0353752 3300046558 Bacteria 665
649 Ga0495656_0077328 3300046615 Bacteria 1493
650 Ga0495656_0555594 3300046615 Bacteria 612
651 Ga0495656_0754794 3300046615 Bacteria 525
652 Ga0495668_0095498 3300046616 Bacteria 1627
653 Ga0495625_0482409 3300046660 Bacteria 761
654 Ga0495625_0842533 3300046660 Bacteria 530
655 Ga0495659_0059455 3300046664 Bacteria 1408
656 Ga0495659_0376048 3300046664 Bacteria 610
657 Ga0495661_0263467 3300046665 Bacteria 875
658 Ga0495623_0639075 3300046679 Bacteria 550
659 Ga0495647_0146014 3300046681 Bacteria 1011
660 Ga0495658_0015745 3300046683 Bacteria 3883
661 Ga0495658_0258897 3300046683 Bacteria 1095
662 Ga0495669_0133842 3300046684 Bacteria 1168
663 Ga0495613_0169344 3300046689 Bacteria 1551
664 Ga0495613_0821789 3300046689 Bacteria 605
665 Ga0495624_0544032 3300046690 Bacteria 693
666 Ga0495670_0214308 3300046691 Bacteria 1022
667 Ga0495670_0246030 3300046691 Bacteria 953
668 Ga0495671_0356069 3300046692 Bacteria 702
669 Ga0495589_0034414 3300046794 Bacteria 2544
670 Ga0495589_0384693 3300046794 Bacteria 645
671 Ga0495660_0177699 3300046810 Bacteria 1032
672 Ga0495581_0101344 3300047315 Bacteria 1673
673 Ga0495581_0116374 3300047315 Bacteria 1554
674 Ga0495636_0295753 3300047318 Bacteria 757
675 Ga0495672_0102786 3300047320 Bacteria 1547
676 Ga0495672_0158321 3300047320 Bacteria 1167
677 Ga0495676_0344460 3300047321 Bacteria 997
678 Ga0495676_0792558 3300047321 Bacteria 610
679 Ga0495675_0396115 3300047444 Bacteria 806
680 Ga0495677_0380161 3300047445 Bacteria 558
681 Ga0495677_0429704 3300047445 Bacteria 523
682 Ga0495679_051517 3300047446 Bacteria 1234
683 Ga0495684_0112941 3300047471 Bacteria 2048
684 Ga0495626_0036606 3300048091 Bacteria 2337
685 Ga0496100_0300013 3300048903 Bacteria 1202
686 Ga0496100_0952312 3300048903 Bacteria 675
687 Ga0496100_1249570 3300048903 Bacteria 586
688 Ga0496101_0080044 3300048904 Bacteria 2413
689 Ga0496101_0125826 3300048904 Bacteria 1942
690 Ga0496102_0188965 3300048905 Bacteria 1941
691 Ga0496102_0896913 3300048905 Bacteria 808
692 Ga0496103_0337634 3300048906 Bacteria 969
693 Ga0496103_0718279 3300048906 Bacteria 633
694 Ga0496104_0169874 3300048907 Bacteria 2091
695 Ga0496104_0641772 3300048907 Bacteria 971
696 Ga0496105_0098094 3300048908 Bacteria 2420
697 Ga0496106_0042430 3300048909 Bacteria 3412
698 Ga0496106_0201575 3300048909 Bacteria 1584
699 Ga0496106_0446461 3300048909 Bacteria 1039
700 Ga0496107_0209823 3300048910 Bacteria 1448
701 Ga0496108_0061551 3300048911 Bacteria 3159
702 Ga0496108_0314202 3300048911 Bacteria 1365
703 Ga0496108_1097007 3300048911 Bacteria 676
704 Ga0496109_0062553 3300048912 Bacteria 3404
705 Ga0496109_0080328 3300048912 Bacteria 3004
706 Ga0496109_0090762 3300048912 Bacteria 2826
707 Ga0496110_0056619 3300048913 Bacteria 3450
708 Ga0496110_0366619 3300048913 Bacteria 1312
709 Ga0496111_0113884 3300048914 Bacteria 1993
710 Ga0496112_0021255 3300048915 Bacteria 6169
711 Ga0496112_0046863 3300048915 Bacteria 4241
712 Ga0496112_0119112 3300048915 Bacteria 2610
713 Ga0496112_0378328 3300048915 Bacteria 1357
714 Ga0496112_1374904 3300048915 Bacteria 621
715 Ga0496114_0695189 3300048917 Bacteria 892
716 Ga0496114_0755235 3300048917 Bacteria 850
717 Ga0496115_0076081 3300048918 Bacteria 2728
718 Ga0496115_0170521 3300048918 Bacteria 1800
719 Ga0496115_1292279 3300048918 Bacteria 544
720 Ga0496116_0449943 3300048919 Bacteria 552
721 Ga0496121_0208825 3300048924 Bacteria 1385
722 Ga0496121_0211646 3300048924 Bacteria 1373
723 Ga0496121_0300405 3300048924 Bacteria 1090
724 Ga0496124_0209237 3300048927 Bacteria 1477
725 Ga0496126_0713111 3300048929 Bacteria 778
726 Ga0496126_0909978 3300048929 Bacteria 666
727 Ga0501306_011033 3300049127 Bacteria 1146
728 Ga0501306_038222 3300049127 Bacteria 736
729 Ga0501306_063005 3300049127 Bacteria 614
730 Ga0501309_027981 3300049129 Bacteria 820
731 Ga0501309_044312 3300049129 Bacteria 686
732 Ga0501310_008648 3300049130 Bacteria 1109
733 Ga0501305_028967 3300049161 Bacteria 855
734 Ga0501305_041646 3300049161 Bacteria 749
735 Ga0501307_002581 3300049162 Bacteria 1702
736 Ga0501307_028701 3300049162 Bacteria 762
737 Ga0501316_035480 3300049532 Bacteria 681
738 Ga0501318_000576 3300049534 Bacteria 2418
739 Ga0501320_000727 3300049536 Bacteria 2080
740 Ga0501320_001422 3300049536 Bacteria 1758
741 Ga0501320_066417 3300049536 Bacteria 515
742 Ga0501323_027089 3300049539 Bacteria 788
743 Ga0501324_006579 3300049540 Bacteria 983
744 Ga0501327_14510 3300049543 Bacteria 551
745 Ga0501031_0093208 3300049568 Bacteria 1966
746 Ga0501031_0233489 3300049568 Bacteria 1197
747 Ga0501031_0272932 3300049568 Bacteria 1098
748 Ga0501031_0442911 3300049568 Bacteria 839
749 Ga0501032_0015661 3300049569 Bacteria 5345
750 Ga0501032_0035186 3300049569 Bacteria 3426
751 Ga0501032_0295651 3300049569 Bacteria 1047
752 Ga0501032_0845257 3300049569 Bacteria 577
753 Ga0501033_0044470 3300049570 Bacteria 3305
754 Ga0501033_0120539 3300049570 Bacteria 1904
755 Ga0501033_0197703 3300049570 Bacteria 1437
756 Ga0501033_0301892 3300049570 Bacteria 1127
757 Ga0501033_0403347 3300049570 Bacteria 953
758 Ga0501033_0538628 3300049570 Bacteria 805
759 Ga0501034_0000482 3300049571 Bacteria 65380
760 Ga0501034_0049039 3300049571 Bacteria 4261
761 Ga0501034_0109362 3300049571 Bacteria 2755
762 Ga0501034_0151831 3300049571 Bacteria 2292
763 Ga0501034_0405129 3300049571 Bacteria 1286
764 Ga0501034_0475920 3300049571 Bacteria 1164
765 Ga0501034_0476017 3300049571 Bacteria 1164
766 Ga0501034_0757261 3300049571 Bacteria 866
767 Ga0501034_1433094 3300049571 Bacteria 565
768 Ga0501036_0037299 3300049572 Bacteria 4112
769 Ga0501036_0043498 3300049572 Bacteria 3804
770 Ga0501036_0879387 3300049572 Bacteria 736
771 Ga0501036_0940824 3300049572 Bacteria 708
772 Ga0501036_1022627 3300049572 Bacteria 676
773 Ga0501036_1468069 3300049572 Bacteria 552
774 Ga0501037_0016304 3300049573 Bacteria 5468
775 Ga0501037_0054390 3300049573 Bacteria 2927
776 Ga0501037_0276370 3300049573 Bacteria 1171
777 Ga0501037_0536280 3300049573 Bacteria 791
778 Ga0501037_0810173 3300049573 Bacteria 618
779 Ga0501038_0051319 3300049574 Bacteria 3560
780 Ga0501038_0071829 3300049574 Bacteria 2935
781 Ga0501038_0157001 3300049574 Bacteria 1852
782 Ga0501038_0160280 3300049574 Bacteria 1829
783 Ga0501038_0290242 3300049574 Bacteria 1286
784 Ga0501038_0535092 3300049574 Bacteria 893
785 Ga0501038_0978970 3300049574 Bacteria 622
786 Ga0501039_0008725 3300049575 Bacteria 7719
787 Ga0501039_0940187 3300049575 Bacteria 672
788 Ga0501040_0001777 3300049576 Bacteria 13865
789 Ga0501040_0333344 3300049576 Bacteria 1086
790 Ga0501040_0577367 3300049576 Bacteria 812
791 Ga0501040_0747365 3300049576 Bacteria 708
792 Ga0501041_0060253 3300049577 Bacteria 2323
793 Ga0501042_0027487 3300049578 Bacteria 4001
794 Ga0501042_0119502 3300049578 Bacteria 1897
795 Ga0501042_0198415 3300049578 Bacteria 1447
796 Ga0501042_0202009 3300049578 Bacteria 1433
797 Ga0501043_0035339 3300049579 Bacteria 3930
798 Ga0501043_0064389 3300049579 Bacteria 2879
799 Ga0501043_0283443 3300049579 Bacteria 1270
800 Ga0501043_0284177 3300049579 Bacteria 1268
801 Ga0501043_0300674 3300049579 Bacteria 1226
802 Ga0501043_0711707 3300049579 Bacteria 733
803 Ga0501046_0067063 3300049580 Bacteria 2795
804 Ga0501046_0114041 3300049580 Bacteria 2062
805 Ga0501046_0894257 3300049580 Bacteria 620
806 Ga0501047_0035355 3300049581 Bacteria 4826
807 Ga0501047_0366223 3300049581 Bacteria 1276
808 Ga0501047_0396854 3300049581 Bacteria 1213
809 Ga0501047_0561251 3300049581 Bacteria 965
810 Ga0501048_0020171 3300049582 Bacteria 4888
811 Ga0501048_0611238 3300049582 Bacteria 783
812 Ga0501048_0906220 3300049582 Bacteria 634
813 Ga0501048_1128766 3300049582 Bacteria 564
814 Ga0501067_0273044 3300049583 Bacteria 941
815 Ga0501068_0184691 3300049584 Bacteria 1319
816 Ga0501068_0252218 3300049584 Bacteria 1125
817 Ga0501068_0310709 3300049584 Bacteria 1010
818 Ga0501068_0730687 3300049584 Bacteria 648
819 Ga0501069_0000969 3300049585 Bacteria 13657
820 Ga0501069_0030764 3300049585 Bacteria 2949
821 Ga0501069_0172860 3300049585 Bacteria 1247
822 Ga0501069_0238789 3300049585 Bacteria 1059
823 Ga0501070_0043862 3300049586 Bacteria 3721
824 Ga0501070_0046897 3300049586 Bacteria 3594
825 Ga0501070_0070015 3300049586 Bacteria 2904
826 Ga0501071_0020326 3300049587 Bacteria 4613
827 Ga0501071_0585217 3300049587 Bacteria 858
828 Ga0501071_1017905 3300049587 Bacteria 640
829 Ga0501071_1481511 3300049587 Bacteria 524
830 Ga0501072_0158728 3300049588 Bacteria 1804
831 Ga0501072_0625140 3300049588 Bacteria 848
832 Ga0501073_0061696 3300049589 Bacteria 2615
833 Ga0501073_0103447 3300049589 Bacteria 1977
834 Ga0501073_0171716 3300049589 Bacteria 1501
835 Ga0501073_0181298 3300049589 Bacteria 1457
836 Ga0501073_0302090 3300049589 Bacteria 1104
837 Ga0501073_0447129 3300049589 Bacteria 893
838 Ga0501074_0011507 3300049590 Bacteria 6432
839 Ga0501074_0028285 3300049590 Bacteria 4063
840 Ga0501074_0445646 3300049590 Bacteria 918
841 Ga0501074_0649292 3300049590 Bacteria 745
842 Ga0501074_0745184 3300049590 Bacteria 691
843 Ga0501075_0964838 3300049591 Bacteria 648
844 Ga0501075_1379473 3300049591 Bacteria 534
845 Ga0501075_1546443 3300049591 Bacteria 502
846 Ga0501076_0020486 3300049592 Bacteria 5063
847 Ga0501076_0222571 3300049592 Bacteria 1542
848 Ga0501077_0052349 3300049593 Bacteria 2593
849 Ga0501077_0426384 3300049593 Bacteria 849
850 Ga0501206_033539 3300049653 Bacteria 771
851 Ga0501251_046887 3300049681 Bacteria 673
852 Ga0501259_065450 3300049688 Bacteria 769
853 Ga0501261_033554 3300049690 Bacteria 785
854 Ga0501079_0005549 3300049741 Bacteria 9408
855 Ga0501079_0029888 3300049741 Bacteria 4186
856 Ga0501079_0397195 3300049741 Bacteria 1081
857 Ga0501079_1035571 3300049741 Bacteria 647
858 Ga0501080_0046194 3300049742 Bacteria 4056
859 Ga0501080_0219114 3300049742 Bacteria 1742
860 Ga0501080_0371191 3300049742 Bacteria 1290
861 Ga0501080_0380505 3300049742 Bacteria 1272
862 Ga0501080_0840651 3300049742 Bacteria 803
863 Ga0501080_0918823 3300049742 Bacteria 762
864 Ga0501081_0002099 3300049743 Bacteria 12454
865 Ga0501081_1385466 3300049743 Bacteria 534
866 Ga0501083_0018111 3300049744 Bacteria 4910
867 Ga0501266_030623 3300049763 Bacteria 767
868 Ga0501035_0003888 3300049822 Bacteria 14246
869 Ga0501035_0046074 3300049822 Bacteria 3922
870 Ga0501035_0051238 3300049822 Bacteria 3696
871 Ga0501035_0120480 3300049822 Bacteria 2294
872 Ga0501035_0192367 3300049822 Bacteria 1754
873 Ga0501035_1245537 3300049822 Bacteria 576
874 Ga0501035_1476699 3300049822 Bacteria 519
875 Ga0501044_0000222 3300049823 Bacteria 71930
876 Ga0501044_0017505 3300049823 Bacteria 7690
877 Ga0501044_0031615 3300049823 Bacteria 5570
878 Ga0501044_0048954 3300049823 Bacteria 4363
879 Ga0501044_0132345 3300049823 Bacteria 2487
880 Ga0501044_0321313 3300049823 Bacteria 1472
881 Ga0501044_0391300 3300049823 Bacteria 1304
882 Ga0501044_1621238 3300049823 Bacteria 512
883 Ga0501045_0058715 3300049824 Bacteria 2817
884 Ga0501045_0072947 3300049824 Bacteria 2527
885 Ga0501212_080625 3300049851 Bacteria 588
886 nmdc:mga03683_12339_c1 3300050489 Bacteria 3118
887 nmdc:mga03683_127600_c1 3300050489 Bacteria 1136
888 nmdc:mga03683_254847_c1 3300050489 Bacteria 816
889 nmdc:mga03683_30010_c1 3300050489 Bacteria 2173
890 nmdc:mga03683_528534_c1 3300050489 Bacteria 573
891 nmdc:mga03n38_14252_c1 3300050490 Bacteria 3042
892 nmdc:mga03n38_510125_c1 3300050490 Bacteria 676
893 nmdc:mga03n38_520422_c1 3300050490 Bacteria 670
894 nmdc:mga00v17_100631_c1 3300050491 Bacteria 1824
895 nmdc:mga00v17_231521_c1 3300050491 Bacteria 1197
896 nmdc:mga00v17_81837_c1 3300050491 Bacteria 2017
897 nmdc:mga0yw44_11167_c1 3300050492 Bacteria 4621
898 nmdc:mga0yw44_414509_c1 3300050492 Bacteria 912
899 nmdc:mga0yw44_60321_c1 3300050492 Bacteria 2323
900 nmdc:mga0k408_1021_c1 3300050493 Bacteria 15347
901 nmdc:mga06z11_160028_c1 3300050494 Bacteria 1286
902 nmdc:mga06z11_330740_c1 3300050494 Bacteria 910
903 nmdc:mga06z11_365311_c1 3300050494 Bacteria 865
904 nmdc:mga07m45_5559_c1 3300050496 Bacteria 6288
905 nmdc:mga05p37_1676427_c1 3300050507 Bacteria 621
906 nmdc:mga05p37_1773_c1 3300050507 Bacteria 25196
907 nmdc:mga05p37_371627_c1 3300050507 Bacteria 1678
908 nmdc:mga05p37_42475_c1 3300050507 Bacteria 5586
909 nmdc:mga05p37_84457_c1 3300050507 Bacteria 3912
910 nmdc:mga09592_1121654_c1 3300050508 Bacteria 653
911 nmdc:mga09592_1398633_c1 3300050508 Bacteria 572
912 nmdc:mga09592_188680_c1 3300050508 Bacteria 1784
913 nmdc:mga09592_191101_c1 3300050508 Bacteria 1772
914 nmdc:mga09592_952939_c1 3300050508 Bacteria 719
915 nmdc:mga0qj67_44746_c1 3300050509 Bacteria 3491
916 nmdc:mga0qj67_691431_c1 3300050509 Bacteria 812
917 nmdc:mga06r32_10132_c1 3300050510 Bacteria 8509
918 nmdc:mga06r32_164435_c1 3300050510 Bacteria 2202
919 nmdc:mga06r32_1672188_c1 3300050510 Bacteria 574
920 nmdc:mga06r32_489083_c1 3300050510 Bacteria 1208
921 nmdc:mga08y16_1357597_c1 3300050511 Bacteria 675
922 nmdc:mga08y16_136821_c1 3300050511 Bacteria 2546
923 nmdc:mga08y16_93113_c1 3300050511 Bacteria 3140
924 nmdc:mga0n895_468602_c1 3300050512 Bacteria 1271
925 nmdc:mga0rr50_1048462_c1 3300050513 Bacteria 694
926 nmdc:mga0rr50_184851_c1 3300050513 Bacteria 1705
927 nmdc:mga0rr50_700375_c1 3300050513 Bacteria 864
928 nmdc:mga08x19_223453_c1 3300050514 Bacteria 1294
929 nmdc:mga08x19_383583_c1 3300050514 Bacteria 984
930 nmdc:mga0a205_66873_c1 3300050515 Bacteria 3472
931 nmdc:mga0a205_721670_c1 3300050515 Bacteria 846
932 Ga0495612_0040216 3300053078 Bacteria 1904
933 Ga0495655_0129211 3300053083 Bacteria 777
934 Ga0495655_0174731 3300053083 Bacteria 689
935 Ga0495595_0533955 3300053084 Bacteria 599
936 Ga0500641_0002284 3300053096 Bacteria 6803
937 Ga0500555_064131 3300053103 Bacteria 982
938 Ga0500556_0014330 3300053104 Bacteria 2419
939 Ga0500557_052121 3300053105 Bacteria 1314
940 Ga0500562_004084 3300053108 Bacteria 3679
941 Ga0500562_060493 3300053108 Bacteria 1017
942 Ga0500593_225104 3300053117 Bacteria 655
943 Ga0500621_302391 3300053126 Bacteria 511
944 Ga0500655_067673 3300053133 Bacteria 725
945 Ga0500559_0063546 3300053136 Bacteria 1650
946 Ga0500561_0002020 3300053137 Bacteria 3370
947 Ga0500604_0027297 3300053151 Bacteria 1651
948 Ga0500616_0047381 3300053153 Bacteria 2282
949 Ga0500616_0093711 3300053153 Bacteria 1481
950 Ga0500616_0220183 3300053153 Bacteria 828
951 Ga0500622_0036800 3300053156 Bacteria 2557
952 Ga0500627_0055855 3300053158 Bacteria 1730
953 Ga0500634_0207347 3300053161 Bacteria 854
954 Ga0500645_050922 3300053730 Bacteria 1208
955 Ga0501084_0014098 3300054114 Bacteria 6619
956 Ga0501084_0077972 3300054114 Bacteria 2777
957 Ga0501084_0143274 3300054114 Bacteria 2013
958 Ga0501084_0264304 3300054114 Bacteria 1453
959 Ga0501084_1180791 3300054114 Bacteria 642
960 Ga0501084_1547921 3300054114 Bacteria 555
961 Ga0501084_1784546 3300054114 Bacteria 514
962 Ga0590071_138744 3300059421 Bacteria 627
963 Ga0590074_077456 3300059423 Bacteria 632
964 Ga0590075_040918 3300059424 Bacteria 1185
965 Ga0587066_030641 3300059490 Bacteria 957
966 Ga0587070_178161 3300059491 Bacteria 551
967 Ga0587077_073015 3300059493 Bacteria 771
968 Ga0587077_106651 3300059493 Bacteria 681
969 Ga0587083_0028661 3300059505 Bacteria 1091
970 Ga0587085_021339 3300059506 Bacteria 989
971 Ga0587091_006969 3300059511 Bacteria 1611
972 Ga0587091_020521 3300059511 Bacteria 1148
973 Ga0587091_195005 3300059511 Bacteria 541
974 Ga0587095_005287 3300059514 Bacteria 972
975 Ga0587106_008775 3300059605 Bacteria 1269
976 Ga0587106_099560 3300059605 Bacteria 592
977 Ga0587101_139665 3300059623 Bacteria 516
978 Ga0587109_076114 3300059624 Bacteria 734
979 Ga0587115_083426 3300059626 Bacteria 570
980 Ga0587128_035764 3300059630 Bacteria 846
981 Ga0587062_086165 3300059639 Bacteria 591
982 Ga0587068_077236 3300059641 Bacteria 667
983 Ga0587076_008729 3300059645 Bacteria 1423
984 Ga0587078_028397 3300059646 Bacteria 743
985 Ga0587079_010177 3300059647 Bacteria 1484
986 Ga0587100_014968 3300059648 Bacteria 706
987 Ga0587105_009752 3300059651 Bacteria 717
988 Ga0587107_033944 3300059652 Bacteria 792
989 Ga0587124_025483 3300059660 Bacteria 628
990 Ga0587111_0151900 3300060346 Bacteria 623
991 Ga0501082_0006704 3300060353 Bacteria 9961
992 Ga0501082_0019797 3300060353 Bacteria 5804
993 Ga0501082_0269726 3300060353 Bacteria 1481
994 Ga0501082_0353275 3300060353 Bacteria 1282
995 Ga0501082_0653954 3300060353 Bacteria 920
996 Ga0530510_0050130 3300061734 Bacteria 3015
997 Ga0530510_0146352 3300061734 Bacteria 1743
998 Ga0530510_0243345 3300061734 Bacteria 1340
999 Ga0530510_0283034 3300061734 Bacteria 1239
1000 Ga0530510_0812268 3300061734 Bacteria 714
1001 Ga0530510_0948194 3300061734 Bacteria 658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0747365 Ga0501040_0747365_12_335 78
2 3300031344 Ga0265316_10497629 Ga0265316_104976292 83
3 3300042006 Ga0439432_110799 Ga0439432_110799_26_364 83
4 3300042010 Ga0439452_055235 Ga0439452_055235_150_488 83
5 3300049572 Ga0501036_0940824 Ga0501036_0940824_179_517 83
6 3300049590 Ga0501074_0445646 Ga0501074_0445646_332_670 83
7 3300049591 Ga0501075_1546443 Ga0501075_1546443_21_359 83
8 3300049742 Ga0501080_0840651 Ga0501080_0840651_266_604 83
9 3300060353 Ga0501082_0269726 Ga0501082_0269726_449_787 83
10 3300061734 Ga0530510_0283034 Ga0530510_0283034_271_609 83
11 3300046460 Ga0495638_0478707 Ga0495638_0478707_99_371 86
12 3300013308 Ga0157375_10288130 Ga0157375_102881302 87
13 3300046475 Ga0495639_0067778 Ga0495639_0067778_1257_1520 87
14 3300049584 Ga0501068_0310709 Ga0501068_0310709_63_326 87
15 iso_pu_bacteria 2739367655 2739611114 87
16 iso_pu_bacteria 2881927736 2881928705 87
17 iso_pu_bacteria 2887375801 2887376462 87
18 iso_pu_bacteria 2895511927 2895513760 87
19 iso_pu_bacteria 8048746797 8048749963 87
20 3300005547 Ga0070693_100234644 Ga0070693_1002346442 88
21 3300009101 Ga0105247_10739742 Ga0105247_107397422 88
22 3300032002 Ga0307416_102929555 Ga0307416_1029295552 88
23 3300041496 Ga0451839_0695104 Ga0451839_0695104_91_357 88
24 3300045976 Ga0466967_1794277 Ga0466967_1794277_234_581 88
25 iso_pu_bacteria 2503198000 2503202663 88
26 iso_pu_bacteria 2508501123 2509117722 88
27 iso_pu_bacteria 2508501127 2509143593 88
28 iso_pu_bacteria 2509276018 2509372992 88
29 iso_pu_bacteria 2510065059 2510319916 88
30 iso_pu_bacteria 2512875016 2512930563 88
31 iso_pu_bacteria 2512875024 2512958295 88
32 iso_pu_bacteria 2513237164 2514032572 88
33 iso_pu_bacteria 2513237305 2514422083 88
34 iso_pu_bacteria 2588253730 2588516205 88
35 iso_pu_bacteria 2595698237 2596374056 88
36 iso_pu_bacteria 2597489875 2597813652 88
37 iso_pu_bacteria 2599185301 2599939540 88
38 iso_pu_bacteria 2643221551 2643775171 88
39 iso_pu_bacteria 2643221555 2643793617 88
40 iso_pu_bacteria 2643221595 2643987300 88
41 iso_pu_bacteria 2643221627 2644155624 88
42 iso_pu_bacteria 2687453392 2688599061 88
43 iso_pu_bacteria 2693429783 2694631910 88
44 iso_pu_bacteria 2693429784 2694634669 88
45 iso_pu_bacteria 2721755686 2723576065 88
46 iso_pu_bacteria 2756170246 2756677755 88
47 iso_pu_bacteria 2791355123 2792750748 88
48 iso_pu_bacteria 2821443989 2821444052 88
49 iso_pu_bacteria 2834578030 2834579291 88
50 iso_pu_bacteria 2840878972 2840883975 88
51 iso_pu_bacteria 2841734538 2841740454 88
52 iso_pu_bacteria 2842775625 2842778817 88
53 iso_pu_bacteria 2844002411 2844006799 88
54 iso_pu_bacteria 2844009547 2844014460 88
55 iso_pu_bacteria 2847670302 2847670793 88
56 iso_pu_bacteria 2847686936 2847687070 88
57 iso_pu_bacteria 2854681122 2854685322 88
58 iso_pu_bacteria 2856314179 2856316250 88
59 iso_pu_bacteria 2856320880 2856325074 88
60 iso_pu_bacteria 2856328259 2856330568 88
61 iso_pu_bacteria 2856334872 2856340868 88
62 iso_pu_bacteria 2856342000 2856345836 88
63 iso_pu_bacteria 2856349417 2856349738 88
64 iso_pu_bacteria 2856364286 2856369152 88
65 iso_pu_bacteria 2857349434 2857355584 88
66 iso_pu_bacteria 2857367948 2857372578 88
67 iso_pu_bacteria 2869162929 2869168979 88
68 iso_pu_bacteria 2869169390 2869174092 88
69 iso_pu_bacteria 2869234852 2869237164 88
70 iso_pu_bacteria 2869242130 2869243190 88
71 iso_pu_bacteria 2869249662 2869252739 88
72 iso_pu_bacteria 2869256925 2869262744 88
73 iso_pu_bacteria 2869264136 2869270261 88
74 iso_pu_bacteria 2869271264 2869273277 88
75 iso_pu_bacteria 2869278585 2869280904 88
76 iso_pu_bacteria 2869285874 2869288390 88
77 iso_pu_bacteria 2871429161 2871432099 88
78 iso_pu_bacteria 2871435913 2871439290 88
79 iso_pu_bacteria 2871444079 2871448834 88
80 iso_pu_bacteria 2871451962 2871455260 88
81 iso_pu_bacteria 2871459585 2871459677 88
82 iso_pu_bacteria 2871466892 2871470932 88
83 iso_pu_bacteria 2871474448 2871480992 88
84 iso_pu_bacteria 2871481445 2871484310 88
85 iso_pu_bacteria 2871495908 2871500456 88
86 iso_pu_bacteria 2874102143 2874106571 88
87 iso_pu_bacteria 2874109183 2874116549 88
88 iso_pu_bacteria 2874116593 2874120802 88
89 iso_pu_bacteria 2874123672 2874125707 88
90 iso_pu_bacteria 2874131515 2874136983 88
91 iso_pu_bacteria 2874139085 2874141428 88
92 iso_pu_bacteria 2874146452 2874150978 88
93 iso_pu_bacteria 2874155637 2874157317 88
94 iso_pu_bacteria 2874162495 2874163764 88
95 iso_pu_bacteria 2874168670 2874172571 88
96 iso_pu_bacteria 2876363079 2876368091 88
97 iso_pu_bacteria 2876369609 2876377612 88
98 iso_pu_bacteria 2876377896 2876378399 88
99 iso_pu_bacteria 2876386047 2876392722 88
100 iso_pu_bacteria 2876399893 2876400645 88
101 iso_pu_bacteria 2876406927 2876409343 88
102 iso_pu_bacteria 2876413966 2876417007 88
103 iso_pu_bacteria 2876420981 2876427164 88
104 iso_pu_bacteria 2878035449 2878041573 88
105 iso_pu_bacteria 2878730984 2878734409 88
106 iso_pu_bacteria 2878738818 2878743157 88
107 iso_pu_bacteria 2878745973 2878748818 88
108 iso_pu_bacteria 2878760144 2878764545 88
109 iso_pu_bacteria 2878767105 2878771646 88
110 iso_pu_bacteria 2878774303 2878776385 88
111 iso_pu_bacteria 2878781027 2878782384 88
112 iso_pu_bacteria 2878788777 2878796106 88
113 iso_pu_bacteria 2881147464 2881152550 88
114 iso_pu_bacteria 2881155292 2881155977 88
115 iso_pu_bacteria 2881161766 2881161794 88
116 iso_pu_bacteria 2881853255 2881859812 88
117 iso_pu_bacteria 2882632389 2882633061 88
118 iso_pu_bacteria 2885305155 2885310679 88
119 iso_pu_bacteria 2885312484 2885317443 88
120 iso_pu_bacteria 2885326080 2885326857 88
121 iso_pu_bacteria 2885342637 2885344968 88
122 iso_pu_bacteria 2885350715 2885356345 88
123 iso_pu_bacteria 2888337043 2888340695 88
124 iso_pu_bacteria 2888343758 2888347874 88
125 iso_pu_bacteria 2888350351 2888356891 88
126 iso_pu_bacteria 2889010040 2889011938 88
127 iso_pu_bacteria 2889016732 2889023130 88
128 iso_pu_bacteria 2889306138 2889311567 88
129 iso_pu_bacteria 2897803580 2897804182 88
130 iso_pu_bacteria 2898795034 2898796994 88
131 iso_pu_bacteria 2899275550 2899277176 88
132 iso_pu_bacteria 2902330777 2902334107 88
133 iso_pu_bacteria 2902405164 2902411806 88
134 iso_pu_bacteria 2903448605 2903452111 88
135 iso_pu_bacteria 2903492973 2903501556 88
136 iso_pu_bacteria 2903513507 2903521196 88
137 iso_pu_bacteria 2903521522 2903527087 88
138 iso_pu_bacteria 2903528002 2903533314 88
139 iso_pu_bacteria 2903540706 2903545269 88
140 iso_pu_bacteria 2906308376 2906311170 88
141 iso_pu_bacteria 2906321335 2906323937 88
142 iso_pu_bacteria 2906328253 2906328358 88
143 iso_pu_bacteria 2906354277 2906362588 88
144 iso_pu_bacteria 2906363423 2906370621 88
145 iso_pu_bacteria 2906370794 2906374325 88
146 iso_pu_bacteria 2906378014 2906378865 88
147 iso_pu_bacteria 2906386501 2906391760 88
148 iso_pu_bacteria 2906393657 2906398069 88
149 iso_pu_bacteria 2906401398 2906404631 88
150 iso_pu_bacteria 2906408224 2906410575 88
151 iso_pu_bacteria 2906414383 2906416387 88
152 iso_pu_bacteria 2906427513 2906432082 88
153 iso_pu_bacteria 2922130491 2922136225 88
154 iso_pu_bacteria 2922151315 2922154901 88
155 iso_pu_bacteria 2922158528 2922159636 88
156 iso_pu_bacteria 2922172374 2922175803 88
157 iso_pu_bacteria 2922178524 2922182765 88
158 iso_pu_bacteria 2922185730 2922191547 88
159 iso_pu_bacteria 2924710171 2924716985 88
160 iso_pu_bacteria 2924718760 2924724367 88
161 iso_pu_bacteria 2924726620 2924727281 88
162 iso_pu_bacteria 2924733363 2924736135 88
163 iso_pu_bacteria 2924741084 2924744180 88
164 iso_pu_bacteria 2924748358 2924750384 88
165 iso_pu_bacteria 2924754689 2924759039 88
166 iso_pu_bacteria 2924762789 2924763824 88
167 iso_pu_bacteria 2924776078 2924777271 88
168 iso_pu_bacteria 2928125067 2928129947 88
169 iso_pu_bacteria 2937813078 2937813391 88
170 iso_pu_bacteria 2937822353 2937826676 88
171 iso_pu_bacteria 2937836603 2937839992 88
172 iso_pu_bacteria 2937848649 2937853627 88
173 iso_pu_bacteria 2937861824 2937864413 88
174 iso_pu_bacteria 2937868953 2937869775 88
175 iso_pu_bacteria 2937877337 2937879324 88
176 iso_pu_bacteria 2937891427 2937898210 88
177 iso_pu_bacteria 2937972304 2937974942 88
178 iso_pu_bacteria 2937980651 2937986793 88
179 iso_pu_bacteria 2937994558 2937999119 88
180 iso_pu_bacteria 2938014810 2938019866 88
181 iso_pu_bacteria 2939669807 2939671389 88
182 iso_pu_bacteria 2958034702 2958036867 88
183 iso_pu_bacteria 2958041894 2958046316 88
184 iso_pu_bacteria 2958041894 2958050489 88
185 iso_pu_bacteria 2958064165 2958070271 88
186 iso_pu_bacteria 2958071322 2958072569 88
187 iso_pu_bacteria 2958084443 2958086499 88
188 iso_pu_bacteria 2958092219 2958095867 88
189 iso_pu_bacteria 2958100919 2958101585 88
190 iso_pu_bacteria 2958108152 2958112973 88
191 iso_pu_bacteria 2958115193 2958122494 88
192 iso_pu_bacteria 2958122699 2958130105 88
193 iso_pu_bacteria 2958130278 2958132791 88
194 iso_pu_bacteria 2958137437 2958142863 88
195 iso_pu_bacteria 2958144490 2958145628 88
196 iso_pu_bacteria 2958158011 2958162969 88
197 iso_pu_bacteria 2958165035 2958169593 88
198 iso_pu_bacteria 2958172287 2958177802 88
199 iso_pu_bacteria 2958179912 2958182923 88
200 iso_pu_bacteria 2961077736 2961080803 88
201 iso_pu_bacteria 2961127735 2961133185 88
202 iso_pu_bacteria 2961136820 2961139069 88
203 iso_pu_bacteria 2961163497 2961168053 88
204 iso_pu_bacteria 2961183825 2961186462 88
205 iso_pu_bacteria 2963644680 2963648664 88
206 iso_pu_bacteria 2965018300 2965022872 88
207 iso_pu_bacteria 2965025482 2965027343 88
208 iso_pu_bacteria 2965032056 2965032628 88
209 iso_pu_bacteria 2965040258 2965043353 88
210 iso_pu_bacteria 2965047637 2965051449 88
211 iso_pu_bacteria 2965062239 2965066168 88
212 iso_pu_bacteria 2965089291 2965091048 88
213 iso_pu_bacteria 2965102966 2965109560 88
214 iso_pu_bacteria 2965110997 2965118071 88
215 iso_pu_bacteria 2965119406 2965122195 88
216 iso_pu_bacteria 2968016561 2968017458 88
217 iso_pu_bacteria 2968083720 2968083891 88
218 iso_pu_bacteria 2968091066 2968092506 88
219 iso_pu_bacteria 2968097103 2968102406 88
220 iso_pu_bacteria 2968117919 2968122809 88
221 iso_pu_bacteria 2968128360 2968128763 88
222 iso_pu_bacteria 2968138860 2968146577 88
223 iso_pu_bacteria 2968171901 2968176453 88
224 iso_pu_bacteria 2970469710 2970472366 88
225 iso_pu_bacteria 2970489779 2970490913 88
226 iso_pu_bacteria 2970510686 2970513855 88
227 iso_pu_bacteria 2970524798 2970530009 88
228 iso_pu_bacteria 2970532167 2970538681 88
229 iso_pu_bacteria 2970540015 2970546598 88
230 iso_pu_bacteria 2970547951 2970548835 88
231 iso_pu_bacteria 2970554993 2970559392 88
232 iso_pu_bacteria 2970593180 2970595508 88
233 iso_pu_bacteria 2970619444 2970620324 88
234 iso_pu_bacteria 2970627176 2970631992 88
235 iso_pu_bacteria 2977843712 2977845391 88
236 iso_pu_bacteria 2977851361 2977851788 88
237 iso_pu_bacteria 2977858184 2977860269 88
238 iso_pu_bacteria 2977864932 2977871955 88
239 iso_pu_bacteria 2977872689 2977877707 88
240 iso_pu_bacteria 2977898635 2977906633 88
241 iso_pu_bacteria 2977907340 2977911815 88
242 iso_pu_bacteria 2977915119 2977917217 88
243 iso_pu_bacteria 2977922695 2977928130 88
244 iso_pu_bacteria 2977935797 2977939437 88
245 iso_pu_bacteria 2977942078 2977946924 88
246 iso_pu_bacteria 2977950692 2977951365 88
247 iso_pu_bacteria 2977957713 2977958670 88
248 iso_pu_bacteria 2977971508 2977976587 88
249 iso_pu_bacteria 2977986579 2977989490 88
250 iso_pu_bacteria 2979710463 2979716967 88
251 iso_pu_bacteria 2979742915 2979746034 88
252 iso_pu_bacteria 2979764755 2979765768 88
253 iso_pu_bacteria 2979772303 2979777658 88
254 iso_pu_bacteria 2979779861 2979783035 88
255 iso_pu_bacteria 2987636660 2987640718 88
256 iso_pu_bacteria 2987645492 2987647815 88
257 iso_pu_bacteria 2987652177 2987652492 88
258 iso_pu_bacteria 2987659509 2987664067 88
259 iso_pu_bacteria 2987666974 2987670292 88
260 iso_pu_bacteria 2987673487 2987674292 88
261 iso_pu_bacteria 2996341866 2996347145 88
262 iso_pu_bacteria 2996348954 2996351237 88
263 iso_pu_bacteria 2996386984 2996390908 88
264 iso_pu_bacteria 3000135777 3000136167 88
265 iso_pu_bacteria 3004167301 3004170191 88
266 iso_pu_bacteria 3004188549 3004193122 88
267 iso_pu_bacteria 3004195979 3004197761 88
268 iso_pu_bacteria 3004203850 3004208915 88
269 iso_pu_bacteria 3004211236 3004213101 88
270 iso_pu_bacteria 3004218560 3004222136 88
271 iso_pu_bacteria 3004232784 3004239291 88
272 iso_pu_bacteria 3004239961 3004242913 88
273 iso_pu_bacteria 3004248173 3004253242 88
274 iso_pu_bacteria 3004268573 3004273803 88
275 iso_pu_bacteria 3004275668 3004277935 88
276 iso_pu_bacteria 3004289098 3004290230 88
277 iso_pu_bacteria 3004334049 3004340239 88
278 iso_pu_bacteria 637000159 637073558 88
279 iso_pu_bacteria 649633066 649873494 88
280 iso_pu_bacteria 8004300914 8004304431 88
281 iso_pu_bacteria 8004312739 8004316466 88
282 iso_pu_bacteria 8004361976 8004366442 88
283 iso_pu_bacteria 8004387939 8004390921 88
284 iso_pu_bacteria 8004395343 8004402337 88
285 iso_pu_bacteria 8004445564 8004451613 88
286 iso_pu_bacteria 8004633249 8004638924 88
287 iso_pu_bacteria 8004640170 8004643104 88
288 iso_pu_bacteria 8004695233 8004701070 88
289 iso_pu_bacteria 8004703790 8004714454 88
290 iso_pu_bacteria 8004714634 8004717473 88
291 iso_pu_bacteria 8004727605 8004731769 88
292 iso_pu_bacteria 8055617313 8055622007 88
293 3300005614 Ga0068856_100629195 Ga0068856_1006291953 89
294 3300013297 Ga0157378_12824613 Ga0157378_128246132 89
295 3300025917 Ga0207660_10769704 Ga0207660_107697042 89
296 3300037471 Ga0395905_0537049 Ga0395905_0537049_70_348 89
297 3300046615 Ga0495656_0077328 Ga0495656_0077328_1203_1472 89
298 3300049536 Ga0501320_066417 Ga0501320_066417_73_342 89
299 3300049568 Ga0501031_0272932 Ga0501031_0272932_107_484 89
300 3300049571 Ga0501034_1433094 Ga0501034_1433094_217_495 89
301 3300049572 Ga0501036_0043498 Ga0501036_0043498_1110_1487 89
302 3300049573 Ga0501037_0536280 Ga0501037_0536280_82_459 89
303 3300049574 Ga0501038_0071829 Ga0501038_0071829_676_1053 89
304 3300049576 Ga0501040_0001777 Ga0501040_0001777_10536_10913 89
305 3300049577 Ga0501041_0060253 Ga0501041_0060253_1072_1449 89
306 3300049578 Ga0501042_0027487 Ga0501042_0027487_688_1065 89
307 3300049579 Ga0501043_0300674 Ga0501043_0300674_143_520 89
308 3300049580 Ga0501046_0114041 Ga0501046_0114041_1112_1489 89
309 3300049585 Ga0501069_0172860 Ga0501069_0172860_807_1184 89
310 3300049588 Ga0501072_0158728 Ga0501072_0158728_795_1172 89
311 3300049590 Ga0501074_0028285 Ga0501074_0028285_1325_1702 89
312 3300049592 Ga0501076_0020486 Ga0501076_0020486_3575_3952 89
313 3300049593 Ga0501077_0052349 Ga0501077_0052349_1746_2123 89
314 3300049741 Ga0501079_0029888 Ga0501079_0029888_2938_3315 89
315 3300049742 Ga0501080_0046194 Ga0501080_0046194_2363_2740 89
316 3300049743 Ga0501081_0002099 Ga0501081_0002099_9127_9504 89
317 3300049824 Ga0501045_0058715 Ga0501045_0058715_432_809 89
318 3300050508 nmdc:mga09592_1398633_c1 nmdc:mga09592_1398633_c1_40_351 89
319 3300054114 Ga0501084_0014098 Ga0501084_0014098_3513_3890 89
320 3300060353 Ga0501082_0006704 Ga0501082_0006704_2979_3356 89
321 3300003659 JGI25404J52841_10036354 JGI25404J52841_100363542 90
322 3300005329 Ga0070683_100307635 Ga0070683_1003076352 90
323 3300005341 Ga0070691_10481719 Ga0070691_104817192 90
324 3300005355 Ga0070671_100907260 Ga0070671_1009072602 90
325 3300005459 Ga0068867_101427148 Ga0068867_1014271482 90
326 3300005578 Ga0068854_100126535 Ga0068854_1001265352 90
327 3300005841 Ga0068863_100175261 Ga0068863_1001752613 90
328 3300005983 Ga0081540_1008438 Ga0081540_100843814 90
329 3300006175 Ga0070712_100954403 Ga0070712_1009544032 90
330 3300006237 Ga0097621_100585112 Ga0097621_1005851122 90
331 3300006844 Ga0075428_102694369 Ga0075428_1026943691 90
332 3300006846 Ga0075430_101286480 Ga0075430_1012864802 90
333 3300007076 Ga0075435_100257087 Ga0075435_1002570872 90
334 3300009094 Ga0111539_11186742 Ga0111539_111867422 90
335 3300009148 Ga0105243_10578929 Ga0105243_105789292 90
336 3300010375 Ga0105239_10658354 Ga0105239_106583543 90
337 3300012490 Ga0157322_1029946 Ga0157322_10299462 90
338 3300013307 Ga0157372_11586586 Ga0157372_115865862 90
339 3300013308 Ga0157375_11633331 Ga0157375_116333311 90
340 3300014969 Ga0157376_10180451 Ga0157376_101804513 90
341 3300025931 Ga0207644_10326829 Ga0207644_103268293 90
342 3300025936 Ga0207670_10973312 Ga0207670_109733121 90
343 3300025944 Ga0207661_10281722 Ga0207661_102817223 90
344 3300025945 Ga0207679_10330417 Ga0207679_103304171 90
345 3300025981 Ga0207640_10107100 Ga0207640_101071003 90
346 3300026075 Ga0207708_10554491 Ga0207708_105544912 90
347 3300026088 Ga0207641_10154200 Ga0207641_101542003 90
348 3300026089 Ga0207648_10568390 Ga0207648_105683903 90
349 3300028380 Ga0268265_10864402 Ga0268265_108644022 90
350 3300035085 Ga0373929_0027794 Ga0373929_0027794_329_658 90
351 3300035088 Ga0373940_0047019 Ga0373940_0047019_155_484 90
352 3300035090 Ga0373949_0063774 Ga0373949_0063774_121_450 90
353 3300035112 Ga0373932_0045214 Ga0373932_0045214_884_1213 90
354 3300035115 Ga0373941_0063200 Ga0373941_0063200_22_351 90
355 3300035121 Ga0373960_0004525 Ga0373960_0004525_1935_2264 90
356 3300035241 Ga0373961_0060924 Ga0373961_0060924_574_903 90
357 3300035691 Ga0373931_0028558 Ga0373931_0028558_1879_2208 90
358 3300039450 Ga0436363_1628752 Ga0436363_1628752_70_390 90
359 3300041997 Ga0439431_0149718 Ga0439431_0149718_233_559 90
360 3300042156 Ga0439446_0054400 Ga0439446_0054400_101_427 90
361 3300042532 Ga0450893_0021936 Ga0450893_0021936_636_971 90
362 3300042993 Ga0439440_0089182 Ga0439440_0089182_77_412 90
363 3300046557 Ga0495622_0237134 Ga0495622_0237134_266_595 90
364 3300046660 Ga0495625_0842533 Ga0495625_0842533_25_366 90
365 3300048903 Ga0496100_0300013 Ga0496100_0300013_482_811 90
366 3300048903 Ga0496100_0952312 Ga0496100_0952312_198_530 90
367 3300048904 Ga0496101_0125826 Ga0496101_0125826_1406_1735 90
368 3300048905 Ga0496102_0188965 Ga0496102_0188965_332_661 90
369 3300048908 Ga0496105_0098094 Ga0496105_0098094_540_869 90
370 3300048909 Ga0496106_0042430 Ga0496106_0042430_2459_2788 90
371 3300048910 Ga0496107_0209823 Ga0496107_0209823_1104_1433 90
372 3300048915 Ga0496112_0119112 Ga0496112_0119112_434_763 90
373 3300048918 Ga0496115_0076081 Ga0496115_0076081_2096_2425 90
374 3300050510 nmdc:mga06r32_1672188_c1 nmdc:mga06r32_1672188_c1_230_541 90
375 3300050513 nmdc:mga0rr50_184851_c1 nmdc:mga0rr50_184851_c1_735_1088 90
376 3300050514 nmdc:mga08x19_223453_c1 nmdc:mga08x19_223453_c1_414_767 90
377 3300003371 JGI26145J50221_1022307 JGI26145J50221_10223071 91
378 3300005366 Ga0070659_101645469 Ga0070659_1016454691 91
379 3300005444 Ga0070694_100087577 Ga0070694_1000875773 91
380 3300005457 Ga0070662_100090344 Ga0070662_1000903441 91
381 3300005543 Ga0070672_100594160 Ga0070672_1005941602 91
382 3300005545 Ga0070695_100387782 Ga0070695_1003877823 91
383 3300005546 Ga0070696_100017763 Ga0070696_1000177634 91
384 3300005547 Ga0070693_100093838 Ga0070693_1000938382 91
385 3300005563 Ga0068855_101431147 Ga0068855_1014311472 91
386 3300005564 Ga0070664_101783881 Ga0070664_1017838812 91
387 3300005614 Ga0068856_100173262 Ga0068856_1001732623 91
388 3300005616 Ga0068852_101354444 Ga0068852_1013544442 91
389 3300005844 Ga0068862_101106375 Ga0068862_1011063752 91
390 3300006844 Ga0075428_100038388 Ga0075428_1000383884 91
391 3300006846 Ga0075430_100662420 Ga0075430_1006624202 91
392 3300006847 Ga0075431_100120442 Ga0075431_1001204424 91
393 3300006852 Ga0075433_11115434 Ga0075433_111154342 91
394 3300006880 Ga0075429_100205004 Ga0075429_1002050042 91
395 3300009094 Ga0111539_10079410 Ga0111539_100794102 91
396 3300009094 Ga0111539_10146569 Ga0111539_101465693 91
397 3300009098 Ga0105245_13151583 Ga0105245_131515832 91
398 3300009147 Ga0114129_10282465 Ga0114129_102824655 91
399 3300009147 Ga0114129_10396737 Ga0114129_103967374 91
400 3300009177 Ga0105248_13286726 Ga0105248_132867262 91
401 3300012507 Ga0157342_1061653 Ga0157342_10616531 91
402 3300013297 Ga0157378_12233764 Ga0157378_122337642 91
403 3300020077 Ga0206351_10012725 Ga0206351_100127252 91
404 3300024225 Ga0224572_1089236 Ga0224572_10892361 91
405 3300025910 Ga0207684_10588933 Ga0207684_105889331 91
406 3300025931 Ga0207644_11808892 Ga0207644_118088922 91
407 3300025932 Ga0207690_10221657 Ga0207690_102216572 91
408 3300025933 Ga0207706_10083691 Ga0207706_100836912 91
409 3300026078 Ga0207702_10073915 Ga0207702_100739155 91
410 3300027666 Ga0209282_1000032 Ga0209282_1000032158 91
411 3300027876 Ga0209974_10012559 Ga0209974_100125594 91
412 3300027907 Ga0207428_10704774 Ga0207428_107047742 91
413 3300028380 Ga0268265_10162575 Ga0268265_101625753 91
414 3300028786 Ga0307517_10115379 Ga0307517_101153794 91
415 3300029957 Ga0265324_10000500 Ga0265324_1000050039 91
416 3300030522 Ga0307512_10457118 Ga0307512_104571181 91
417 3300030863 Ga0265766_1024028 Ga0265766_10240281 91
418 3300031250 Ga0265331_10107041 Ga0265331_101070412 91
419 3300031251 Ga0265327_10071532 Ga0265327_100715323 91
420 3300031344 Ga0265316_10316460 Ga0265316_103164602 91
421 3300031711 Ga0265314_10001521 Ga0265314_100015217 91
422 3300031712 Ga0265342_10369250 Ga0265342_103692501 91
423 3300031730 Ga0307516_10000048 Ga0307516_1000004827 91
424 3300031731 Ga0307405_10304730 Ga0307405_103047301 91
425 3300031824 Ga0307413_10153805 Ga0307413_101538053 91
426 3300031852 Ga0307410_10722459 Ga0307410_107224592 91
427 3300032002 Ga0307416_102429323 Ga0307416_1024293232 91
428 3300032004 Ga0307414_10123159 Ga0307414_101231594 91
429 3300032004 Ga0307414_11146249 Ga0307414_111462492 91
430 3300032126 Ga0307415_100793929 Ga0307415_1007939292 91
431 3300035084 Ga0373928_0041260 Ga0373928_0041260_609_884 91
432 3300035091 Ga0373951_0059414 Ga0373951_0059414_343_618 91
433 3300035172 Ga0373955_0396895 Ga0373955_0396895_211_549 91
434 3300035398 Ga0316574_0385368 Ga0316574_0385368_115_390 91
435 3300035691 Ga0373931_0205613 Ga0373931_0205613_58_333 91
436 3300035695 Ga0373927_0029560 Ga0373927_0029560_2868_3209 91
437 3300037312 Ga0395899_0383044 Ga0395899_0383044_90_365 91
438 3300037418 Ga0395900_0168314 Ga0395900_0168314_1868_2143 91
439 3300037466 Ga0395898_0196913 Ga0395898_0196913_1464_1739 91
440 3300037471 Ga0395905_0022623 Ga0395905_0022623_3599_3874 91
441 3300037853 Ga0436364_0154708 Ga0436364_0154708_726_1001 91
442 3300038443 Ga0395901_0061803 Ga0395901_0061803_217_492 91
443 3300039437 Ga0436365_0383888 Ga0436365_0383888_868_1155 91
444 3300041441 Ga0451787_362070 Ga0451787_362070_281_556 91
445 3300041453 Ga0451797_0747974 Ga0451797_0747974_27_305 91
446 3300041454 Ga0451799_09344 Ga0451799_09344_113_391 91
447 3300041455 Ga0451801_35813 Ga0451801_35813_609_887 91
448 3300041457 Ga0451803_08367 Ga0451803_08367_199_477 91
449 3300041458 Ga0451798_0617325 Ga0451798_0617325_126_404 91
450 3300041460 Ga0451802_1537885 Ga0451802_1537885_580_858 91
451 3300041461 Ga0451805_061040 Ga0451805_061040_577_855 91
452 3300041464 Ga0451808_30401 Ga0451808_30401_146_424 91
453 3300041496 Ga0451839_0847847 Ga0451839_0847847_269_544 91
454 3300041509 Ga0451843_0055671 Ga0451843_0055671_331_612 91
455 3300041509 Ga0451843_1768234 Ga0451843_1768234_250_525 91
456 3300042012 Ga0439455_0168740 Ga0439455_0168740_63_344 91
457 3300042118 Ga0450914_001376 Ga0450914_001376_125_406 91
458 3300042132 Ga0450895_020207 Ga0450895_020207_68_346 91
459 3300042142 Ga0450905_012598 Ga0450905_012598_783_1064 91
460 3300042876 Ga0451577_0761776 Ga0451577_0761776_220_498 91
461 3300044673 Ga0453683_0103988 Ga0453683_0103988_844_1119 91
462 3300044673 Ga0453683_0452538 Ga0453683_0452538_54_335 91
463 3300044712 Ga0453684_0007381 Ga0453684_0007381_1760_2035 91
464 3300045051 Ga0451576_0049923 Ga0451576_0049923_1085_1363 91
465 3300045051 Ga0451576_0212441 Ga0451576_0212441_61_336 91
466 3300045051 Ga0451576_0799428 Ga0451576_0799428_12_293 91
467 3300046455 Ga0495603_0176416 Ga0495603_0176416_23_364 91
468 3300046457 Ga0495590_0018187 Ga0495590_0018187_1457_1798 91
469 3300046472 Ga0495580_0315331 Ga0495580_0315331_60_401 91
470 3300046491 Ga0495584_0372397 Ga0495584_0372397_263_601 91
471 3300046528 Ga0495642_0412170 Ga0495642_0412170_130_471 91
472 3300046538 Ga0495609_0091258 Ga0495609_0091258_405_743 91
473 3300046542 Ga0495597_0068974 Ga0495597_0068974_226_549 91
474 3300046684 Ga0495669_0133842 Ga0495669_0133842_160_501 91
475 3300047445 Ga0495677_0380161 Ga0495677_0380161_66_404 91
476 3300048904 Ga0496101_0080044 Ga0496101_0080044_158_439 91
477 3300048906 Ga0496103_0718279 Ga0496103_0718279_139_420 91
478 3300048907 Ga0496104_0169874 Ga0496104_0169874_711_992 91
479 3300048909 Ga0496106_0201575 Ga0496106_0201575_351_632 91
480 3300048911 Ga0496108_0061551 Ga0496108_0061551_2529_2810 91
481 3300048912 Ga0496109_0080328 Ga0496109_0080328_288_569 91
482 3300048914 Ga0496111_0113884 Ga0496111_0113884_749_1030 91
483 3300048915 Ga0496112_0021255 Ga0496112_0021255_3383_3664 91
484 3300048915 Ga0496112_0378328 Ga0496112_0378328_105_467 91
485 3300048917 Ga0496114_0695189 Ga0496114_0695189_531_863 91
486 3300048918 Ga0496115_0170521 Ga0496115_0170521_472_804 91
487 3300049127 Ga0501306_063005 Ga0501306_063005_290_571 91
488 3300049543 Ga0501327_14510 Ga0501327_14510_134_412 91
489 3300049569 Ga0501032_0845257 Ga0501032_0845257_43_318 91
490 3300049570 Ga0501033_0120539 Ga0501033_0120539_268_543 91
491 3300049570 Ga0501033_0197703 Ga0501033_0197703_954_1229 91
492 3300049572 Ga0501036_0879387 Ga0501036_0879387_373_717 91
493 3300049573 Ga0501037_0054390 Ga0501037_0054390_537_812 91
494 3300049573 Ga0501037_0810173 Ga0501037_0810173_81_374 91
495 3300049574 Ga0501038_0157001 Ga0501038_0157001_1324_1617 91
496 3300049574 Ga0501038_0160280 Ga0501038_0160280_703_978 91
497 3300049574 Ga0501038_0290242 Ga0501038_0290242_607_951 91
498 3300049578 Ga0501042_0198415 Ga0501042_0198415_941_1234 91
499 3300049578 Ga0501042_0202009 Ga0501042_0202009_295_639 91
500 3300049579 Ga0501043_0064389 Ga0501043_0064389_1580_1855 91
501 3300049579 Ga0501043_0284177 Ga0501043_0284177_582_926 91
502 3300049581 Ga0501047_0561251 Ga0501047_0561251_579_854 91
503 3300049582 Ga0501048_0611238 Ga0501048_0611238_89_433 91
504 3300049584 Ga0501068_0730687 Ga0501068_0730687_166_459 91
505 3300049588 Ga0501072_0625140 Ga0501072_0625140_236_529 91
506 3300049742 Ga0501080_0918823 Ga0501080_0918823_267_560 91
507 3300049822 Ga0501035_0120480 Ga0501035_0120480_1519_1794 91
508 3300049823 Ga0501044_0017505 Ga0501044_0017505_4359_4634 91
509 3300049823 Ga0501044_1621238 Ga0501044_1621238_73_348 91
510 3300049851 Ga0501212_080625 Ga0501212_080625_303_578 91
511 3300050489 nmdc:mga03683_127600_c1 nmdc:mga03683_127600_c1_280_558 91
512 3300050489 nmdc:mga03683_254847_c1 nmdc:mga03683_254847_c1_425_703 91
513 3300050490 nmdc:mga03n38_510125_c1 nmdc:mga03n38_510125_c1_209_487 91
514 3300050490 nmdc:mga03n38_520422_c1 nmdc:mga03n38_520422_c1_149_427 91
515 3300050493 nmdc:mga0k408_1021_c1 nmdc:mga0k408_1021_c1_3032_3310 91
516 3300050494 nmdc:mga06z11_330740_c1 nmdc:mga06z11_330740_c1_541_819 91
517 3300050507 nmdc:mga05p37_84457_c1 nmdc:mga05p37_84457_c1_464_823 91
518 3300050508 nmdc:mga09592_188680_c1 nmdc:mga09592_188680_c1_241_600 91
519 3300050508 nmdc:mga09592_952939_c1 nmdc:mga09592_952939_c1_20_301 91
520 3300050509 nmdc:mga0qj67_44746_c1 nmdc:mga0qj67_44746_c1_3079_3399 91
521 3300050509 nmdc:mga0qj67_691431_c1 nmdc:mga0qj67_691431_c1_276_635 91
522 3300050511 nmdc:mga08y16_136821_c1 nmdc:mga08y16_136821_c1_1392_1733 91
523 3300053126 Ga0500621_302391 Ga0500621_302391_85_363 91
524 3300053137 Ga0500561_0002020 Ga0500561_0002020_2536_2814 91
525 3300053153 Ga0500616_0047381 Ga0500616_0047381_1604_1879 91
526 3300053158 Ga0500627_0055855 Ga0500627_0055855_1015_1293 91
527 3300053161 Ga0500634_0207347 Ga0500634_0207347_398_673 91
528 3300054114 Ga0501084_0143274 Ga0501084_0143274_1367_1660 91
529 3300059493 Ga0587077_073015 Ga0587077_073015_369_650 91
530 3300059623 Ga0587101_139665 Ga0587101_139665_154_429 91
531 3300061734 Ga0530510_0146352 Ga0530510_0146352_973_1266 91
532 3300002244 JGI24742J22300_10073186 JGI24742J22300_100731862 92
533 3300003214 JGI25165J46597_1000961 JGI25165J46597_100096124 92
534 3300005327 Ga0070658_10369759 Ga0070658_103697593 92
535 3300005328 Ga0070676_10314514 Ga0070676_103145142 92
536 3300005329 Ga0070683_100053275 Ga0070683_1000532756 92
537 3300005329 Ga0070683_100604505 Ga0070683_1006045053 92
538 3300005329 Ga0070683_102230844 Ga0070683_1022308442 92
539 3300005331 Ga0070670_101643710 Ga0070670_1016437102 92
540 3300005336 Ga0070680_100099273 Ga0070680_1000992732 92
541 3300005336 Ga0070680_101895307 Ga0070680_1018953071 92
542 3300005338 Ga0068868_101793280 Ga0068868_1017932802 92
543 3300005339 Ga0070660_100002390 Ga0070660_10000239014 92
544 3300005339 Ga0070660_100549482 Ga0070660_1005494822 92
545 3300005340 Ga0070689_100820848 Ga0070689_1008208482 92
546 3300005340 Ga0070689_100829538 Ga0070689_1008295382 92
547 3300005343 Ga0070687_101399756 Ga0070687_1013997562 92
548 3300005344 Ga0070661_100005946 Ga0070661_10000594614 92
549 3300005345 Ga0070692_10999567 Ga0070692_109995672 92
550 3300005354 Ga0070675_101376318 Ga0070675_1013763182 92
551 3300005356 Ga0070674_102188399 Ga0070674_1021883991 92
552 3300005365 Ga0070688_100032863 Ga0070688_1000328636 92
553 3300005366 Ga0070659_100438067 Ga0070659_1004380673 92
554 3300005366 Ga0070659_100449747 Ga0070659_1004497472 92
555 3300005366 Ga0070659_100521477 Ga0070659_1005214773 92
556 3300005436 Ga0070713_100094598 Ga0070713_1000945984 92
557 3300005439 Ga0070711_100455858 Ga0070711_1004558582 92
558 3300005441 Ga0070700_101507759 Ga0070700_1015077592 92
559 3300005455 Ga0070663_100231407 Ga0070663_1002314073 92
560 3300005456 Ga0070678_100573140 Ga0070678_1005731402 92
561 3300005456 Ga0070678_100610737 Ga0070678_1006107372 92
562 3300005458 Ga0070681_10501507 Ga0070681_105015071 92
563 3300005459 Ga0068867_100104315 Ga0068867_1001043152 92
564 3300005459 Ga0068867_100604780 Ga0068867_1006047802 92
565 3300005459 Ga0068867_101189746 Ga0068867_1011897462 92
566 3300005466 Ga0070685_10055693 Ga0070685_100556933 92
567 3300005530 Ga0070679_100669570 Ga0070679_1006695702 92
568 3300005530 Ga0070679_101376566 Ga0070679_1013765662 92
569 3300005530 Ga0070679_101423462 Ga0070679_1014234622 92
570 3300005535 Ga0070684_100052119 Ga0070684_1000521197 92
571 3300005535 Ga0070684_100099335 Ga0070684_1000993355 92
572 3300005535 Ga0070684_100535134 Ga0070684_1005351342 92
573 3300005539 Ga0068853_100013375 Ga0068853_1000133755 92
574 3300005539 Ga0068853_100893954 Ga0068853_1008939542 92
575 3300005547 Ga0070693_100702385 Ga0070693_1007023852 92
576 3300005548 Ga0070665_100109440 Ga0070665_1001094405 92
577 3300005548 Ga0070665_102408002 Ga0070665_1024080022 92
578 3300005563 Ga0068855_100006773 Ga0068855_1000067733 92
579 3300005564 Ga0070664_100191442 Ga0070664_1001914422 92
580 3300005564 Ga0070664_100210188 Ga0070664_1002101881 92
581 3300005564 Ga0070664_100677457 Ga0070664_1006774572 92
582 3300005577 Ga0068857_100043062 Ga0068857_1000430626 92
583 3300005577 Ga0068857_102476524 Ga0068857_1024765242 92
584 3300005578 Ga0068854_100384219 Ga0068854_1003842192 92
585 3300005614 Ga0068856_100158389 Ga0068856_1001583892 92
586 3300005614 Ga0068856_100161436 Ga0068856_1001614362 92
587 3300005614 Ga0068856_101236971 Ga0068856_1012369712 92
588 3300005616 Ga0068852_101228875 Ga0068852_1012288752 92
589 3300005616 Ga0068852_102728273 Ga0068852_1027282732 92
590 3300005617 Ga0068859_100316849 Ga0068859_1003168493 92
591 3300005617 Ga0068859_101470644 Ga0068859_1014706441 92
592 3300005718 Ga0068866_10482550 Ga0068866_104825501 92
593 3300005842 Ga0068858_100681127 Ga0068858_1006811273 92
594 3300005843 Ga0068860_100845551 Ga0068860_1008455513 92
595 3300005843 Ga0068860_102399265 Ga0068860_1023992651 92
596 3300005844 Ga0068862_100466502 Ga0068862_1004665022 92
597 3300005844 Ga0068862_101423902 Ga0068862_1014239022 92
598 3300005937 Ga0081455_10061752 Ga0081455_100617525 92
599 3300006048 Ga0075363_100004858 Ga0075363_1000048584 92
600 3300006051 Ga0075364_10095261 Ga0075364_100952612 92
601 3300006051 Ga0075364_10216020 Ga0075364_102160203 92
602 3300006173 Ga0070716_101275562 Ga0070716_1012755622 92
603 3300006177 Ga0075362_10015125 Ga0075362_100151253 92
604 3300006177 Ga0075362_10418025 Ga0075362_104180252 92
605 3300006178 Ga0075367_10201217 Ga0075367_102012173 92
606 3300006353 Ga0075370_10003104 Ga0075370_100031047 92
607 3300006358 Ga0068871_100502548 Ga0068871_1005025483 92
608 3300006852 Ga0075433_10068755 Ga0075433_100687557 92
609 3300006871 Ga0075434_100299829 Ga0075434_1002998293 92
610 3300006880 Ga0075429_100218905 Ga0075429_1002189052 92
611 3300006881 Ga0068865_100058757 Ga0068865_1000587572 92
612 3300006931 Ga0097620_100316858 Ga0097620_1003168582 92
613 3300006931 Ga0097620_101470637 Ga0097620_1014706371 92
614 3300007076 Ga0075435_101266269 Ga0075435_1012662692 92
615 3300007076 Ga0075435_101323175 Ga0075435_1013231752 92
616 3300009093 Ga0105240_10598473 Ga0105240_105984733 92
617 3300009098 Ga0105245_10195049 Ga0105245_101950493 92
618 3300009098 Ga0105245_10411966 Ga0105245_104119662 92
619 3300009098 Ga0105245_12703522 Ga0105245_127035222 92
620 3300009147 Ga0114129_10076149 Ga0114129_100761492 92
621 3300009148 Ga0105243_10411685 Ga0105243_104116853 92
622 3300009148 Ga0105243_10590318 Ga0105243_105903182 92
623 3300009148 Ga0105243_10669595 Ga0105243_106695952 92
624 3300009174 Ga0105241_10655747 Ga0105241_106557472 92
625 3300009176 Ga0105242_11591591 Ga0105242_115915912 92
626 3300009177 Ga0105248_10140985 Ga0105248_101409853 92
627 3300009545 Ga0105237_10002619 Ga0105237_1000261931 92
628 3300009545 Ga0105237_10471743 Ga0105237_104717432 92
629 3300009553 Ga0105249_11346463 Ga0105249_113464632 92
630 3300010375 Ga0105239_10102043 Ga0105239_101020436 92
631 3300011119 Ga0105246_10525059 Ga0105246_105250592 92
632 3300012481 Ga0157320_1011992 Ga0157320_10119922 92
633 3300012488 Ga0157343_1003739 Ga0157343_10037392 92
634 3300012497 Ga0157319_1018783 Ga0157319_10187832 92
635 3300012512 Ga0157327_1009341 Ga0157327_10093412 92
636 3300013102 Ga0157371_10605938 Ga0157371_106059382 92
637 3300013104 Ga0157370_10422380 Ga0157370_104223802 92
638 3300013104 Ga0157370_10601969 Ga0157370_106019692 92
639 3300013105 Ga0157369_10124513 Ga0157369_101245134 92
640 3300013296 Ga0157374_10218485 Ga0157374_102184853 92
641 3300013296 Ga0157374_12710550 Ga0157374_127105502 92
642 3300013297 Ga0157378_10456063 Ga0157378_104560632 92
643 3300013306 Ga0163162_13074766 Ga0163162_130747662 92
644 3300013308 Ga0157375_10321513 Ga0157375_103215132 92
645 3300013308 Ga0157375_13821583 Ga0157375_138215831 92
646 3300014968 Ga0157379_11386180 Ga0157379_113861802 92
647 3300014969 Ga0157376_10770891 Ga0157376_107708912 92
648 3300014969 Ga0157376_11978993 Ga0157376_119789932 92
649 3300015265 Ga0182005_1006944 Ga0182005_10069442 92
650 3300015265 Ga0182005_1115342 Ga0182005_11153422 92
651 3300017792 Ga0163161_11989211 Ga0163161_119892112 92
652 3300020610 Ga0154015_1181558 Ga0154015_11815582 92
653 3300021388 Ga0213875_10376426 Ga0213875_103764262 92
654 3300021441 Ga0213871_10018399 Ga0213871_100183993 92
655 3300021441 Ga0213871_10224361 Ga0213871_102243612 92
656 3300025231 Ga0207427_101449 Ga0207427_1014498 92
657 3300025261 Ga0209233_1000293 Ga0209233_100029332 92
658 3300025294 Ga0209025_1126623 Ga0209025_11266232 92
659 3300025302 Ga0207426_1073154 Ga0207426_10731543 92
660 3300025303 Ga0209051_1102276 Ga0209051_11022762 92
661 3300025901 Ga0207688_10905613 Ga0207688_109056132 92
662 3300025901 Ga0207688_11011188 Ga0207688_110111882 92
663 3300025904 Ga0207647_10063680 Ga0207647_100636804 92
664 3300025907 Ga0207645_10347630 Ga0207645_103476301 92
665 3300025909 Ga0207705_10001453 Ga0207705_1000145314 92
666 3300025909 Ga0207705_10563534 Ga0207705_105635342 92
667 3300025909 Ga0207705_10974227 Ga0207705_109742272 92
668 3300025911 Ga0207654_11071908 Ga0207654_110719082 92
669 3300025912 Ga0207707_10065034 Ga0207707_100650342 92
670 3300025912 Ga0207707_10150230 Ga0207707_101502302 92
671 3300025914 Ga0207671_10001074 Ga0207671_1000107431 92
672 3300025914 Ga0207671_10987266 Ga0207671_109872661 92
673 3300025916 Ga0207663_10419978 Ga0207663_104199782 92
674 3300025917 Ga0207660_10127508 Ga0207660_101275082 92
675 3300025917 Ga0207660_11161181 Ga0207660_111611812 92
676 3300025919 Ga0207657_10006791 Ga0207657_100067913 92
677 3300025919 Ga0207657_10114000 Ga0207657_101140001 92
678 3300025920 Ga0207649_10000194 Ga0207649_1000019465 92
679 3300025921 Ga0207652_10077820 Ga0207652_100778205 92
680 3300025921 Ga0207652_10176407 Ga0207652_101764072 92
681 3300025921 Ga0207652_10649732 Ga0207652_106497322 92
682 3300025924 Ga0207694_10304721 Ga0207694_103047211 92
683 3300025925 Ga0207650_10445007 Ga0207650_104450073 92
684 3300025926 Ga0207659_10653137 Ga0207659_106531372 92
685 3300025927 Ga0207687_10966340 Ga0207687_109663402 92
686 3300025932 Ga0207690_10349373 Ga0207690_103493732 92
687 3300025932 Ga0207690_10551152 Ga0207690_105511522 92
688 3300025936 Ga0207670_10386673 Ga0207670_103866733 92
689 3300025936 Ga0207670_10584286 Ga0207670_105842862 92
690 3300025938 Ga0207704_10234376 Ga0207704_102343762 92
691 3300025940 Ga0207691_11470465 Ga0207691_114704652 92
692 3300025941 Ga0207711_10501217 Ga0207711_105012172 92
693 3300025944 Ga0207661_10061857 Ga0207661_100618573 92
694 3300025944 Ga0207661_10242014 Ga0207661_102420143 92
695 3300025945 Ga0207679_11336920 Ga0207679_113369202 92
696 3300025949 Ga0207667_10002756 Ga0207667_1000275628 92
697 3300025949 Ga0207667_11247038 Ga0207667_112470382 92
698 3300025960 Ga0207651_10263706 Ga0207651_102637062 92
699 3300025972 Ga0207668_11046118 Ga0207668_110461182 92
700 3300026035 Ga0207703_11317563 Ga0207703_113175632 92
701 3300026035 Ga0207703_11618103 Ga0207703_116181032 92
702 3300026041 Ga0207639_10009890 Ga0207639_1000989012 92
703 3300026041 Ga0207639_10121098 Ga0207639_101210982 92
704 3300026067 Ga0207678_10022593 Ga0207678_1002259313 92
705 3300026075 Ga0207708_10110240 Ga0207708_101102404 92
706 3300026078 Ga0207702_10997846 Ga0207702_109978462 92
707 3300026116 Ga0207674_10013836 Ga0207674_100138363 92
708 3300026116 Ga0207674_10101849 Ga0207674_101018492 92
709 3300026118 Ga0207675_100213567 Ga0207675_1002135673 92
710 3300026118 Ga0207675_102476482 Ga0207675_1024764821 92
711 3300026121 Ga0207683_10085243 Ga0207683_100852434 92
712 3300026121 Ga0207683_10270036 Ga0207683_102700362 92
713 3300026121 Ga0207683_10619623 Ga0207683_106196232 92
714 3300028379 Ga0268266_10000321 Ga0268266_1000032114 92
715 3300028381 Ga0268264_10857827 Ga0268264_108578272 92
716 3300030760 Ga0265762_1174339 Ga0265762_11743392 92
717 3300031241 Ga0265325_10131935 Ga0265325_101319351 92
718 3300031251 Ga0265327_10413512 Ga0265327_104135122 92
719 3300031344 Ga0265316_10040773 Ga0265316_100407739 92
720 3300031548 Ga0307408_100361446 Ga0307408_1003614463 92
721 3300031731 Ga0307405_10993751 Ga0307405_109937512 92
722 3300031731 Ga0307405_11571875 Ga0307405_115718751 92
723 3300031824 Ga0307413_10456558 Ga0307413_104565582 92
724 3300031852 Ga0307410_10554150 Ga0307410_105541502 92
725 3300031852 Ga0307410_10753272 Ga0307410_107532722 92
726 3300031903 Ga0307407_10307945 Ga0307407_103079452 92
727 3300031911 Ga0307412_10487792 Ga0307412_104877922 92
728 3300032002 Ga0307416_101573201 Ga0307416_1015732012 92
729 3300032004 Ga0307414_10324126 Ga0307414_103241263 92
730 3300032005 Ga0307411_10410308 Ga0307411_104103082 92
731 3300032126 Ga0307415_100936080 Ga0307415_1009360802 92
732 3300032133 Ga0316583_10317123 Ga0316583_103171232 92
733 3300032168 Ga0316593_10020888 Ga0316593_100208882 92
734 3300032168 Ga0316593_10043962 Ga0316593_100439622 92
735 3300032168 Ga0316593_10063317 Ga0316593_100633172 92
736 3300032168 Ga0316593_10091179 Ga0316593_100911792 92
737 3300032168 Ga0316593_10128486 Ga0316593_101284862 92
738 3300032168 Ga0316593_10401167 Ga0316593_104011671 92
739 3300033529 Ga0316587_1087875 Ga0316587_10878752 92
740 3300033541 Ga0316596_1042721 Ga0316596_10427213 92
741 3300035725 Ga0373947_0556276 Ga0373947_0556276_35_319 92
742 3300036401 Ga0373937_0524014 Ga0373937_0524014_455_733 92
743 3300036712 Ga0316584_0213436 Ga0316584_0213436_222_500 92
744 3300036712 Ga0316584_0237850 Ga0316584_0237850_31_309 92
745 3300037068 Ga0373925_0059917 Ga0373925_0059917_940_1224 92
746 3300037312 Ga0395899_0009289 Ga0395899_0009289_3891_4169 92
747 3300037418 Ga0395900_0079088 Ga0395900_0079088_3061_3339 92
748 3300037418 Ga0395900_0237666 Ga0395900_0237666_1146_1424 92
749 3300037418 Ga0395900_1299754 Ga0395900_1299754_63_341 92
750 3300037466 Ga0395898_0009501 Ga0395898_0009501_8097_8375 92
751 3300037466 Ga0395898_0062833 Ga0395898_0062833_2274_2552 92
752 3300037466 Ga0395898_0162999 Ga0395898_0162999_1467_1745 92
753 3300037853 Ga0436364_0387099 Ga0436364_0387099_268_546 92
754 3300037853 Ga0436364_1329342 Ga0436364_1329342_543_821 92
755 3300038443 Ga0395901_0029226 Ga0395901_0029226_5058_5336 92
756 3300039062 Ga0400483_065380 Ga0400483_065380_108_386 92
757 3300039062 Ga0400483_074646 Ga0400483_074646_404_682 92
758 3300039062 Ga0400483_079140 Ga0400483_079140_6038_6316 92
759 3300039062 Ga0400483_191914 Ga0400483_191914_1151_1429 92
760 3300039062 Ga0400483_212486 Ga0400483_212486_581_859 92
761 3300039437 Ga0436365_1100019 Ga0436365_1100019_128_406 92
762 3300039437 Ga0436365_1356266 Ga0436365_1356266_124_402 92
763 3300039438 Ga0436360_0558978 Ga0436360_0558978_1579_1857 92
764 3300039438 Ga0436360_1332781 Ga0436360_1332781_182_460 92
765 3300039447 Ga0436361_0700032 Ga0436361_0700032_663_941 92
766 3300039453 Ga0436362_0281584 Ga0436362_0281584_51_329 92
767 3300039453 Ga0436362_1042172 Ga0436362_1042172_138_416 92
768 3300041413 Ga0439465_0172218 Ga0439465_0172218_344_622 92
769 3300041441 Ga0451787_425155 Ga0451787_425155_114_392 92
770 3300041452 Ga0451793_1804433 Ga0451793_1804433_179_457 92
771 3300041496 Ga0451839_1229688 Ga0451839_1229688_198_482 92
772 3300041997 Ga0439431_0173237 Ga0439431_0173237_17_295 92
773 3300042004 Ga0439445_0023544 Ga0439445_0023544_28_306 92
774 3300042007 Ga0439449_0108023 Ga0439449_0108023_172_450 92
775 3300042145 Ga0450906_109365 Ga0450906_109365_36_314 92
776 3300042461 Ga0439460_0220407 Ga0439460_0220407_39_374 92
777 3300044683 Ga0466965_0331637 Ga0466965_0331637_160_438 92
778 3300044683 Ga0466965_0442654 Ga0466965_0442654_373_651 92
779 3300044684 Ga0466966_0759665 Ga0466966_0759665_52_330 92
780 3300044706 Ga0466964_0239149 Ga0466964_0239149_255_533 92
781 3300044719 Ga0466971_0452486 Ga0466971_0452486_47_325 92
782 3300044735 Ga0466968_0056953 Ga0466968_0056953_302_580 92
783 3300044765 Ga0466970_0371334 Ga0466970_0371334_56_334 92
784 3300044765 Ga0466970_0471772 Ga0466970_0471772_241_519 92
785 3300044842 Ga0466957_0902304 Ga0466957_0902304_235_513 92
786 3300044901 Ga0466960_0051465 Ga0466960_0051465_1309_1587 92
787 3300044901 Ga0466960_0079876 Ga0466960_0079876_1138_1416 92
788 3300044901 Ga0466960_0410521 Ga0466960_0410521_213_491 92
789 3300045051 Ga0451576_0003979 Ga0451576_0003979_16322_16600 92
790 3300045836 Ga0466958_0827902 Ga0466958_0827902_96_374 92
791 3300045976 Ga0466967_1475832 Ga0466967_1475832_161_439 92
792 3300045976 Ga0466967_1971071 Ga0466967_1971071_193_471 92
793 3300046461 Ga0495641_0039986 Ga0495641_0039986_370_654 92
794 3300046473 Ga0495582_0324047 Ga0495582_0324047_570_854 92
795 3300046473 Ga0495582_0447538 Ga0495582_0447538_120_398 92
796 3300046473 Ga0495582_0550981 Ga0495582_0550981_103_387 92
797 3300046476 Ga0495662_0528191 Ga0495662_0528191_64_348 92
798 3300046517 Ga0495630_0405713 Ga0495630_0405713_64_348 92
799 3300046531 Ga0495665_0058685 Ga0495665_0058685_1282_1566 92
800 3300046535 Ga0495586_0053697 Ga0495586_0053697_1670_1954 92
801 3300046615 Ga0495656_0754794 Ga0495656_0754794_126_404 92
802 3300046616 Ga0495668_0095498 Ga0495668_0095498_437_715 92
803 3300046683 Ga0495658_0258897 Ga0495658_0258897_465_749 92
804 3300046689 Ga0495613_0821789 Ga0495613_0821789_287_571 92
805 3300046690 Ga0495624_0544032 Ga0495624_0544032_294_578 92
806 3300046691 Ga0495670_0214308 Ga0495670_0214308_147_425 92
807 3300047315 Ga0495581_0116374 Ga0495581_0116374_436_720 92
808 3300047318 Ga0495636_0295753 Ga0495636_0295753_88_423 92
809 3300047320 Ga0495672_0102786 Ga0495672_0102786_515_793 92
810 3300047321 Ga0495676_0344460 Ga0495676_0344460_268_552 92
811 3300047321 Ga0495676_0792558 Ga0495676_0792558_193_477 92
812 3300048903 Ga0496100_1249570 Ga0496100_1249570_165_449 92
813 3300048905 Ga0496102_0896913 Ga0496102_0896913_98_382 92
814 3300048906 Ga0496103_0337634 Ga0496103_0337634_513_797 92
815 3300048907 Ga0496104_0641772 Ga0496104_0641772_586_870 92
816 3300048909 Ga0496106_0446461 Ga0496106_0446461_450_734 92
817 3300048911 Ga0496108_0314202 Ga0496108_0314202_83_367 92
818 3300048911 Ga0496108_1097007 Ga0496108_1097007_369_653 92
819 3300048912 Ga0496109_0062553 Ga0496109_0062553_2200_2484 92
820 3300048912 Ga0496109_0090762 Ga0496109_0090762_935_1219 92
821 3300048913 Ga0496110_0056619 Ga0496110_0056619_28_312 92
822 3300048913 Ga0496110_0366619 Ga0496110_0366619_167_451 92
823 3300048915 Ga0496112_0046863 Ga0496112_0046863_1388_1672 92
824 3300048917 Ga0496114_0755235 Ga0496114_0755235_226_510 92
825 3300048919 Ga0496116_0449943 Ga0496116_0449943_166_444 92
826 3300048924 Ga0496121_0208825 Ga0496121_0208825_97_375 92
827 3300048924 Ga0496121_0211646 Ga0496121_0211646_609_887 92
828 3300048924 Ga0496121_0300405 Ga0496121_0300405_170_448 92
829 3300048927 Ga0496124_0209237 Ga0496124_0209237_532_810 92
830 3300048929 Ga0496126_0713111 Ga0496126_0713111_78_356 92
831 3300048929 Ga0496126_0909978 Ga0496126_0909978_160_438 92
832 3300049127 Ga0501306_011033 Ga0501306_011033_373_651 92
833 3300049127 Ga0501306_038222 Ga0501306_038222_349_627 92
834 3300049129 Ga0501309_027981 Ga0501309_027981_29_307 92
835 3300049129 Ga0501309_044312 Ga0501309_044312_224_502 92
836 3300049130 Ga0501310_008648 Ga0501310_008648_599_877 92
837 3300049161 Ga0501305_028967 Ga0501305_028967_237_515 92
838 3300049161 Ga0501305_041646 Ga0501305_041646_373_651 92
839 3300049162 Ga0501307_002581 Ga0501307_002581_1318_1596 92
840 3300049162 Ga0501307_028701 Ga0501307_028701_64_342 92
841 3300049532 Ga0501316_035480 Ga0501316_035480_152_430 92
842 3300049534 Ga0501318_000576 Ga0501318_000576_990_1268 92
843 3300049536 Ga0501320_000727 Ga0501320_000727_116_394 92
844 3300049536 Ga0501320_001422 Ga0501320_001422_373_651 92
845 3300049539 Ga0501323_027089 Ga0501323_027089_372_650 92
846 3300049540 Ga0501324_006579 Ga0501324_006579_299_577 92
847 3300049568 Ga0501031_0093208 Ga0501031_0093208_464_742 92
848 3300049568 Ga0501031_0233489 Ga0501031_0233489_731_1009 92
849 3300049568 Ga0501031_0442911 Ga0501031_0442911_49_327 92
850 3300049569 Ga0501032_0015661 Ga0501032_0015661_3105_3383 92
851 3300049569 Ga0501032_0035186 Ga0501032_0035186_975_1253 92
852 3300049569 Ga0501032_0295651 Ga0501032_0295651_647_925 92
853 3300049570 Ga0501033_0044470 Ga0501033_0044470_1147_1425 92
854 3300049570 Ga0501033_0301892 Ga0501033_0301892_277_555 92
855 3300049570 Ga0501033_0403347 Ga0501033_0403347_594_872 92
856 3300049570 Ga0501033_0538628 Ga0501033_0538628_349_627 92
857 3300049571 Ga0501034_0000482 Ga0501034_0000482_45149_45427 92
858 3300049571 Ga0501034_0049039 Ga0501034_0049039_2718_2996 92
859 3300049571 Ga0501034_0109362 Ga0501034_0109362_448_726 92
860 3300049571 Ga0501034_0151831 Ga0501034_0151831_1366_1644 92
861 3300049571 Ga0501034_0405129 Ga0501034_0405129_411_689 92
862 3300049571 Ga0501034_0475920 Ga0501034_0475920_679_957 92
863 3300049571 Ga0501034_0476017 Ga0501034_0476017_329_607 92
864 3300049571 Ga0501034_0757261 Ga0501034_0757261_409_687 92
865 3300049572 Ga0501036_0037299 Ga0501036_0037299_1407_1685 92
866 3300049572 Ga0501036_1022627 Ga0501036_1022627_90_368 92
867 3300049572 Ga0501036_1468069 Ga0501036_1468069_132_410 92
868 3300049573 Ga0501037_0016304 Ga0501037_0016304_1263_1541 92
869 3300049573 Ga0501037_0276370 Ga0501037_0276370_478_756 92
870 3300049574 Ga0501038_0051319 Ga0501038_0051319_2136_2414 92
871 3300049574 Ga0501038_0535092 Ga0501038_0535092_364_642 92
872 3300049574 Ga0501038_0978970 Ga0501038_0978970_73_351 92
873 3300049575 Ga0501039_0008725 Ga0501039_0008725_6332_6610 92
874 3300049575 Ga0501039_0940187 Ga0501039_0940187_75_353 92
875 3300049576 Ga0501040_0333344 Ga0501040_0333344_228_506 92
876 3300049576 Ga0501040_0577367 Ga0501040_0577367_325_603 92
877 3300049578 Ga0501042_0119502 Ga0501042_0119502_673_951 92
878 3300049579 Ga0501043_0035339 Ga0501043_0035339_90_368 92
879 3300049579 Ga0501043_0283443 Ga0501043_0283443_941_1219 92
880 3300049579 Ga0501043_0711707 Ga0501043_0711707_132_410 92
881 3300049580 Ga0501046_0067063 Ga0501046_0067063_141_419 92
882 3300049580 Ga0501046_0894257 Ga0501046_0894257_290_568 92
883 3300049581 Ga0501047_0035355 Ga0501047_0035355_1263_1541 92
884 3300049581 Ga0501047_0366223 Ga0501047_0366223_233_511 92
885 3300049581 Ga0501047_0396854 Ga0501047_0396854_547_825 92
886 3300049582 Ga0501048_0020171 Ga0501048_0020171_1533_1811 92
887 3300049582 Ga0501048_0906220 Ga0501048_0906220_302_580 92
888 3300049582 Ga0501048_1128766 Ga0501048_1128766_159_437 92
889 3300049583 Ga0501067_0273044 Ga0501067_0273044_521_799 92
890 3300049584 Ga0501068_0184691 Ga0501068_0184691_802_1092 92
891 3300049584 Ga0501068_0252218 Ga0501068_0252218_20_298 92
892 3300049585 Ga0501069_0000969 Ga0501069_0000969_10275_10553 92
893 3300049585 Ga0501069_0030764 Ga0501069_0030764_1295_1612 92
894 3300049585 Ga0501069_0238789 Ga0501069_0238789_620_898 92
895 3300049586 Ga0501070_0043862 Ga0501070_0043862_2230_2547 92
896 3300049586 Ga0501070_0046897 Ga0501070_0046897_1811_2089 92
897 3300049586 Ga0501070_0070015 Ga0501070_0070015_1407_1685 92
898 3300049587 Ga0501071_0020326 Ga0501071_0020326_2016_2294 92
899 3300049587 Ga0501071_0585217 Ga0501071_0585217_559_837 92
900 3300049587 Ga0501071_1017905 Ga0501071_1017905_245_523 92
901 3300049587 Ga0501071_1481511 Ga0501071_1481511_187_465 92
902 3300049589 Ga0501073_0061696 Ga0501073_0061696_1534_1812 92
903 3300049589 Ga0501073_0103447 Ga0501073_0103447_579_857 92
904 3300049589 Ga0501073_0171716 Ga0501073_0171716_322_600 92
905 3300049589 Ga0501073_0447129 Ga0501073_0447129_169_447 92
906 3300049590 Ga0501074_0011507 Ga0501074_0011507_3105_3383 92
907 3300049590 Ga0501074_0649292 Ga0501074_0649292_107_385 92
908 3300049590 Ga0501074_0745184 Ga0501074_0745184_86_403 92
909 3300049591 Ga0501075_0964838 Ga0501075_0964838_28_306 92
910 3300049593 Ga0501077_0426384 Ga0501077_0426384_92_370 92
911 3300049653 Ga0501206_033539 Ga0501206_033539_386_664 92
912 3300049681 Ga0501251_046887 Ga0501251_046887_355_633 92
913 3300049688 Ga0501259_065450 Ga0501259_065450_39_317 92
914 3300049690 Ga0501261_033554 Ga0501261_033554_22_300 92
915 3300049741 Ga0501079_0005549 Ga0501079_0005549_3962_4240 92
916 3300049741 Ga0501079_1035571 Ga0501079_1035571_169_447 92
917 3300049742 Ga0501080_0219114 Ga0501080_0219114_1180_1497 92
918 3300049742 Ga0501080_0371191 Ga0501080_0371191_359_637 92
919 3300049742 Ga0501080_0380505 Ga0501080_0380505_628_963 92
920 3300049743 Ga0501081_1385466 Ga0501081_1385466_244_522 92
921 3300049744 Ga0501083_0018111 Ga0501083_0018111_3097_3375 92
922 3300049763 Ga0501266_030623 Ga0501266_030623_360_638 92
923 3300049822 Ga0501035_0003888 Ga0501035_0003888_8772_9050 92
924 3300049822 Ga0501035_0046074 Ga0501035_0046074_2822_3100 92
925 3300049822 Ga0501035_0051238 Ga0501035_0051238_804_1082 92
926 3300049822 Ga0501035_0192367 Ga0501035_0192367_1352_1630 92
927 3300049822 Ga0501035_1245537 Ga0501035_1245537_149_427 92
928 3300049822 Ga0501035_1476699 Ga0501035_1476699_142_420 92
929 3300049823 Ga0501044_0000222 Ga0501044_0000222_21130_21408 92
930 3300049823 Ga0501044_0031615 Ga0501044_0031615_2146_2424 92
931 3300049823 Ga0501044_0048954 Ga0501044_0048954_158_436 92
932 3300049823 Ga0501044_0132345 Ga0501044_0132345_1406_1684 92
933 3300049823 Ga0501044_0321313 Ga0501044_0321313_101_379 92
934 3300049823 Ga0501044_0391300 Ga0501044_0391300_898_1176 92
935 3300049824 Ga0501045_0072947 Ga0501045_0072947_392_670 92
936 3300050489 nmdc:mga03683_12339_c1 nmdc:mga03683_12339_c1_2250_2528 92
937 3300050489 nmdc:mga03683_528534_c1 nmdc:mga03683_528534_c1_223_501 92
938 3300050490 nmdc:mga03n38_14252_c1 nmdc:mga03n38_14252_c1_488_766 92
939 3300050491 nmdc:mga00v17_231521_c1 nmdc:mga00v17_231521_c1_735_1013 92
940 3300050491 nmdc:mga00v17_81837_c1 nmdc:mga00v17_81837_c1_1102_1380 92
941 3300050492 nmdc:mga0yw44_11167_c1 nmdc:mga0yw44_11167_c1_1048_1374 92
942 3300050492 nmdc:mga0yw44_60321_c1 nmdc:mga0yw44_60321_c1_1502_1780 92
943 3300050494 nmdc:mga06z11_160028_c1 nmdc:mga06z11_160028_c1_730_1008 92
944 3300050496 nmdc:mga07m45_5559_c1 nmdc:mga07m45_5559_c1_2590_2868 92
945 3300050507 nmdc:mga05p37_42475_c1 nmdc:mga05p37_42475_c1_102_386 92
946 3300050508 nmdc:mga09592_191101_c1 nmdc:mga09592_191101_c1_58_342 92
947 3300050510 nmdc:mga06r32_489083_c1 nmdc:mga06r32_489083_c1_306_644 92
948 3300050511 nmdc:mga08y16_1357597_c1 nmdc:mga08y16_1357597_c1_11_289 92
949 3300050512 nmdc:mga0n895_468602_c1 nmdc:mga0n895_468602_c1_699_1037 92
950 3300050515 nmdc:mga0a205_66873_c1 nmdc:mga0a205_66873_c1_2365_2703 92
951 3300053096 Ga0500641_0002284 Ga0500641_0002284_3548_3826 92
952 3300053103 Ga0500555_064131 Ga0500555_064131_46_324 92
953 3300053104 Ga0500556_0014330 Ga0500556_0014330_1241_1519 92
954 3300053105 Ga0500557_052121 Ga0500557_052121_803_1081 92
955 3300053108 Ga0500562_004084 Ga0500562_004084_2576_2854 92
956 3300053108 Ga0500562_060493 Ga0500562_060493_438_716 92
957 3300053117 Ga0500593_225104 Ga0500593_225104_149_427 92
958 3300053136 Ga0500559_0063546 Ga0500559_0063546_613_891 92
959 3300053151 Ga0500604_0027297 Ga0500604_0027297_308_586 92
960 3300053153 Ga0500616_0093711 Ga0500616_0093711_466_744 92
961 3300053153 Ga0500616_0220183 Ga0500616_0220183_433_711 92
962 3300053156 Ga0500622_0036800 Ga0500622_0036800_956_1234 92
963 3300053730 Ga0500645_050922 Ga0500645_050922_839_1117 92
964 3300054114 Ga0501084_0077972 Ga0501084_0077972_1390_1668 92
965 3300054114 Ga0501084_0264304 Ga0501084_0264304_494_772 92
966 3300054114 Ga0501084_1547921 Ga0501084_1547921_131_409 92
967 3300054114 Ga0501084_1784546 Ga0501084_1784546_59_337 92
968 3300059421 Ga0590071_138744 Ga0590071_138744_18_296 92
969 3300059423 Ga0590074_077456 Ga0590074_077456_135_413 92
970 3300059424 Ga0590075_040918 Ga0590075_040918_569_847 92
971 3300059490 Ga0587066_030641 Ga0587066_030641_427_705 92
972 3300059491 Ga0587070_178161 Ga0587070_178161_149_427 92
973 3300059493 Ga0587077_106651 Ga0587077_106651_320_598 92
974 3300059505 Ga0587083_0028661 Ga0587083_0028661_27_305 92
975 3300059506 Ga0587085_021339 Ga0587085_021339_415_693 92
976 3300059511 Ga0587091_006969 Ga0587091_006969_138_416 92
977 3300059511 Ga0587091_020521 Ga0587091_020521_836_1114 92
978 3300059511 Ga0587091_195005 Ga0587091_195005_173_451 92
979 3300059514 Ga0587095_005287 Ga0587095_005287_376_654 92
980 3300059605 Ga0587106_008775 Ga0587106_008775_349_627 92
981 3300059605 Ga0587106_099560 Ga0587106_099560_288_566 92
982 3300059624 Ga0587109_076114 Ga0587109_076114_427_705 92
983 3300059626 Ga0587115_083426 Ga0587115_083426_214_492 92
984 3300059630 Ga0587128_035764 Ga0587128_035764_356_634 92
985 3300059639 Ga0587062_086165 Ga0587062_086165_126_404 92
986 3300059641 Ga0587068_077236 Ga0587068_077236_116_394 92
987 3300059645 Ga0587076_008729 Ga0587076_008729_388_666 92
988 3300059646 Ga0587078_028397 Ga0587078_028397_410_688 92
989 3300059647 Ga0587079_010177 Ga0587079_010177_853_1131 92
990 3300059648 Ga0587100_014968 Ga0587100_014968_216_494 92
991 3300059651 Ga0587105_009752 Ga0587105_009752_378_656 92
992 3300059652 Ga0587107_033944 Ga0587107_033944_391_669 92
993 3300059660 Ga0587124_025483 Ga0587124_025483_10_288 92
994 3300060346 Ga0587111_0151900 Ga0587111_0151900_290_568 92
995 3300060353 Ga0501082_0019797 Ga0501082_0019797_2491_2769 92
996 3300060353 Ga0501082_0653954 Ga0501082_0653954_366_644 92
997 3300061734 Ga0530510_0050130 Ga0530510_0050130_1764_2099 92
998 3300061734 Ga0530510_0243345 Ga0530510_0243345_908_1186 92
999 3300061734 Ga0530510_0812268 Ga0530510_0812268_112_390 92
1000 3300061734 Ga0530510_0948194 Ga0530510_0948194_203_481 92
1001 3300005330 Ga0070690_100506659 Ga0070690_1005066593 93
1002 3300005336 Ga0070680_101502044 Ga0070680_1015020442 93
1003 3300005338 Ga0068868_100586001 Ga0068868_1005860012 93
1004 3300005339 Ga0070660_100878404 Ga0070660_1008784042 93
1005 3300005341 Ga0070691_10194117 Ga0070691_101941172 93
1006 3300005344 Ga0070661_100362416 Ga0070661_1003624161 93
1007 3300005345 Ga0070692_11426567 Ga0070692_114265671 93
1008 3300005367 Ga0070667_100463754 Ga0070667_1004637541 93
1009 3300005435 Ga0070714_100858022 Ga0070714_1008580222 93
1010 3300005440 Ga0070705_100060632 Ga0070705_1000606324 93
1011 3300005441 Ga0070700_100410419 Ga0070700_1004104192 93
1012 3300005457 Ga0070662_100797369 Ga0070662_1007973692 93
1013 3300005458 Ga0070681_10671287 Ga0070681_106712873 93
1014 3300005458 Ga0070681_10783235 Ga0070681_107832352 93
1015 3300005459 Ga0068867_100140882 Ga0068867_1001408822 93
1016 3300005468 Ga0070707_100449824 Ga0070707_1004498243 93
1017 3300005471 Ga0070698_100014515 Ga0070698_10001451513 93
1018 3300005471 Ga0070698_101240397 Ga0070698_1012403972 93
1019 3300005530 Ga0070679_100088987 Ga0070679_1000889873 93
1020 3300005530 Ga0070679_100617320 Ga0070679_1006173203 93
1021 3300005539 Ga0068853_100440329 Ga0068853_1004403293 93
1022 3300005544 Ga0070686_100449857 Ga0070686_1004498571 93
1023 3300005545 Ga0070695_100034730 Ga0070695_1000347304 93
1024 3300005547 Ga0070693_100200155 Ga0070693_1002001552 93
1025 3300005563 Ga0068855_100169574 Ga0068855_1001695744 93
1026 3300005577 Ga0068857_100403312 Ga0068857_1004033122 93
1027 3300005614 Ga0068856_100448749 Ga0068856_1004487492 93
1028 3300005614 Ga0068856_101246424 Ga0068856_1012464242 93
1029 3300005616 Ga0068852_100790803 Ga0068852_1007908032 93
1030 3300005617 Ga0068859_101099278 Ga0068859_1010992781 93
1031 3300005618 Ga0068864_101459685 Ga0068864_1014596852 93
1032 3300005719 Ga0068861_100962324 Ga0068861_1009623242 93
1033 3300005719 Ga0068861_101696751 Ga0068861_1016967512 93
1034 3300005834 Ga0068851_10272997 Ga0068851_102729972 93
1035 3300005842 Ga0068858_101397477 Ga0068858_1013974771 93
1036 3300005843 Ga0068860_100151341 Ga0068860_1001513411 93
1037 3300005844 Ga0068862_100208344 Ga0068862_1002083442 93
1038 3300005983 Ga0081540_1004248 Ga0081540_10042488 93
1039 3300005983 Ga0081540_1032087 Ga0081540_10320876 93
1040 3300006175 Ga0070712_100149925 Ga0070712_1001499253 93
1041 3300006358 Ga0068871_100063920 Ga0068871_1000639206 93
1042 3300006358 Ga0068871_100548815 Ga0068871_1005488153 93
1043 3300006844 Ga0075428_100958316 Ga0075428_1009583162 93
1044 3300006846 Ga0075430_100038858 Ga0075430_1000388587 93
1045 3300006852 Ga0075433_10670941 Ga0075433_106709412 93
1046 3300006871 Ga0075434_100155197 Ga0075434_1001551972 93
1047 3300006881 Ga0068865_100170832 Ga0068865_1001708322 93
1048 3300006914 Ga0075436_100560062 Ga0075436_1005600622 93
1049 3300006931 Ga0097620_101099276 Ga0097620_1010992761 93
1050 3300007076 Ga0075435_101173984 Ga0075435_1011739842 93
1051 3300009098 Ga0105245_10432327 Ga0105245_104323272 93
1052 3300009098 Ga0105245_12794392 Ga0105245_127943921 93
1053 3300009148 Ga0105243_10122511 Ga0105243_101225114 93
1054 3300009174 Ga0105241_10017868 Ga0105241_1001786811 93
1055 3300009176 Ga0105242_11117859 Ga0105242_111178592 93
1056 3300009176 Ga0105242_11560480 Ga0105242_115604802 93
1057 3300009177 Ga0105248_10284388 Ga0105248_102843883 93
1058 3300009545 Ga0105237_10047955 Ga0105237_100479552 93
1059 3300009551 Ga0105238_11661901 Ga0105238_116619012 93
1060 3300010375 Ga0105239_10291478 Ga0105239_102914782 93
1061 3300010375 Ga0105239_10541023 Ga0105239_105410232 93
1062 3300010375 Ga0105239_11736225 Ga0105239_117362251 93
1063 3300013100 Ga0157373_10685601 Ga0157373_106856012 93
1064 3300013105 Ga0157369_10675688 Ga0157369_106756882 93
1065 3300013296 Ga0157374_10368360 Ga0157374_103683602 93
1066 3300013307 Ga0157372_10968208 Ga0157372_109682082 93
1067 3300014326 Ga0157380_11336915 Ga0157380_113369152 93
1068 3300014326 Ga0157380_12206039 Ga0157380_122060392 93
1069 3300014969 Ga0157376_10223096 Ga0157376_102230964 93
1070 3300024227 Ga0228598_1072408 Ga0228598_10724081 93
1071 3300025321 Ga0207656_10327467 Ga0207656_103274672 93
1072 3300025906 Ga0207699_10295384 Ga0207699_102953842 93
1073 3300025909 Ga0207705_10359009 Ga0207705_103590092 93
1074 3300025909 Ga0207705_10799814 Ga0207705_107998142 93
1075 3300025911 Ga0207654_10091223 Ga0207654_100912232 93
1076 3300025913 Ga0207695_10150035 Ga0207695_101500353 93
1077 3300025917 Ga0207660_11040210 Ga0207660_110402102 93
1078 3300025919 Ga0207657_10050665 Ga0207657_100506651 93
1079 3300025920 Ga0207649_10292325 Ga0207649_102923253 93
1080 3300025921 Ga0207652_10402790 Ga0207652_104027902 93
1081 3300025922 Ga0207646_10164402 Ga0207646_101644022 93
1082 3300025924 Ga0207694_10806853 Ga0207694_108068532 93
1083 3300025928 Ga0207700_10214806 Ga0207700_102148062 93
1084 3300025929 Ga0207664_10597443 Ga0207664_105974432 93
1085 3300025929 Ga0207664_10629612 Ga0207664_106296123 93
1086 3300025935 Ga0207709_10062259 Ga0207709_100622594 93
1087 3300025937 Ga0207669_10286618 Ga0207669_102866182 93
1088 3300025941 Ga0207711_10432077 Ga0207711_104320772 93
1089 3300025949 Ga0207667_10215153 Ga0207667_102151534 93
1090 3300025949 Ga0207667_10261322 Ga0207667_102613222 93
1091 3300025972 Ga0207668_10414281 Ga0207668_104142812 93
1092 3300025981 Ga0207640_11565908 Ga0207640_115659082 93
1093 3300026023 Ga0207677_10379112 Ga0207677_103791123 93
1094 3300026035 Ga0207703_10057141 Ga0207703_100571416 93
1095 3300026075 Ga0207708_11610985 Ga0207708_116109851 93
1096 3300026078 Ga0207702_10030901 Ga0207702_100309012 93
1097 3300026078 Ga0207702_10769845 Ga0207702_107698451 93
1098 3300026078 Ga0207702_11609110 Ga0207702_116091102 93
1099 3300026088 Ga0207641_10307914 Ga0207641_103079143 93
1100 3300026089 Ga0207648_10130957 Ga0207648_101309573 93
1101 3300026089 Ga0207648_10210247 Ga0207648_102102474 93
1102 3300026118 Ga0207675_101130887 Ga0207675_1011308872 93
1103 3300028379 Ga0268266_10179973 Ga0268266_101799732 93
1104 3300028380 Ga0268265_10951628 Ga0268265_109516282 93
1105 3300028577 Ga0265318_10000037 Ga0265318_100000377 93
1106 3300031250 Ga0265331_10002092 Ga0265331_1000209224 93
1107 3300031852 Ga0307410_10679249 Ga0307410_106792492 93
1108 3300035084 Ga0373928_0214495 Ga0373928_0214495_32_322 93
1109 3300035116 Ga0373945_0393499 Ga0373945_0393499_299_595 93
1110 3300035170 Ga0373943_0005741 Ga0373943_0005741_3017_3313 93
1111 3300035691 Ga0373931_0198449 Ga0373931_0198449_432_725 93
1112 3300035691 Ga0373931_0395018 Ga0373931_0395018_260_550 93
1113 3300035692 Ga0373935_0066301 Ga0373935_0066301_1849_2145 93
1114 3300035695 Ga0373927_0370766 Ga0373927_0370766_492_785 93
1115 3300035695 Ga0373927_0711762 Ga0373927_0711762_161_457 93
1116 3300035724 Ga0373933_0622290 Ga0373933_0622290_257_553 93
1117 3300035725 Ga0373947_0271981 Ga0373947_0271981_215_511 93
1118 3300037312 Ga0395899_0010562 Ga0395899_0010562_4631_4918 93
1119 3300037312 Ga0395899_0048114 Ga0395899_0048114_153_440 93
1120 3300037418 Ga0395900_0009123 Ga0395900_0009123_4877_5164 93
1121 3300037418 Ga0395900_0025293 Ga0395900_0025293_1283_1570 93
1122 3300037418 Ga0395900_0187406 Ga0395900_0187406_1063_1350 93
1123 3300037466 Ga0395898_0012796 Ga0395898_0012796_2621_2908 93
1124 3300037466 Ga0395898_0053632 Ga0395898_0053632_2602_2889 93
1125 3300037466 Ga0395898_0123226 Ga0395898_0123226_615_902 93
1126 3300037471 Ga0395905_0007439 Ga0395905_0007439_4337_4624 93
1127 3300037471 Ga0395905_0509100 Ga0395905_0509100_800_1087 93
1128 3300038443 Ga0395901_0016098 Ga0395901_0016098_1231_1518 93
1129 3300038443 Ga0395901_0022055 Ga0395901_0022055_3706_3993 93
1130 3300039437 Ga0436365_1600671 Ga0436365_1600671_260_619 93
1131 3300042876 Ga0451577_0018151 Ga0451577_0018151_4021_4311 93
1132 3300044712 Ga0453684_1356476 Ga0453684_1356476_279_569 93
1133 3300046452 Ga0495617_170429 Ga0495617_170429_35_322 93
1134 3300046455 Ga0495603_0029274 Ga0495603_0029274_2677_2964 93
1135 3300046472 Ga0495580_0587980 Ga0495580_0587980_396_692 93
1136 3300046473 Ga0495582_0229562 Ga0495582_0229562_434_730 93
1137 3300046474 Ga0495605_0036527 Ga0495605_0036527_708_995 93
1138 3300046491 Ga0495584_0079201 Ga0495584_0079201_911_1267 93
1139 3300046491 Ga0495584_0515047 Ga0495584_0515047_57_344 93
1140 3300046499 Ga0495594_0520465 Ga0495594_0520465_316_612 93
1141 3300046500 Ga0495596_0317432 Ga0495596_0317432_232_519 93
1142 3300046513 Ga0495616_0100407 Ga0495616_0100407_902_1189 93
1143 3300046517 Ga0495630_0196254 Ga0495630_0196254_394_675 93
1144 3300046518 Ga0495631_0252621 Ga0495631_0252621_246_533 93
1145 3300046519 Ga0495632_0494389 Ga0495632_0494389_65_352 93
1146 3300046525 Ga0495663_0034649 Ga0495663_0034649_515_802 93
1147 3300046528 Ga0495642_0444367 Ga0495642_0444367_238_525 93
1148 3300046531 Ga0495665_0204499 Ga0495665_0204499_119_415 93
1149 3300046531 Ga0495665_0539679 Ga0495665_0539679_146_439 93
1150 3300046542 Ga0495597_0079257 Ga0495597_0079257_575_862 93
1151 3300046558 Ga0495633_0353752 Ga0495633_0353752_225_512 93
1152 3300046664 Ga0495659_0059455 Ga0495659_0059455_974_1261 93
1153 3300046664 Ga0495659_0376048 Ga0495659_0376048_139_495 93
1154 3300046665 Ga0495661_0263467 Ga0495661_0263467_123_410 93
1155 3300046679 Ga0495623_0639075 Ga0495623_0639075_89_382 93
1156 3300046691 Ga0495670_0246030 Ga0495670_0246030_67_354 93
1157 3300046794 Ga0495589_0034414 Ga0495589_0034414_444_731 93
1158 3300046794 Ga0495589_0384693 Ga0495589_0384693_178_465 93
1159 3300046810 Ga0495660_0177699 Ga0495660_0177699_650_937 93
1160 3300047444 Ga0495675_0396115 Ga0495675_0396115_284_577 93
1161 3300047445 Ga0495677_0429704 Ga0495677_0429704_157_444 93
1162 3300047446 Ga0495679_051517 Ga0495679_051517_714_1001 93
1163 3300047471 Ga0495684_0112941 Ga0495684_0112941_1253_1549 93
1164 3300048091 Ga0495626_0036606 Ga0495626_0036606_617_904 93
1165 3300048915 Ga0496112_1374904 Ga0496112_1374904_112_405 93
1166 3300048918 Ga0496115_1292279 Ga0496115_1292279_107_400 93
1167 3300049589 Ga0501073_0302090 Ga0501073_0302090_596_910 93
1168 3300049741 Ga0501079_0397195 Ga0501079_0397195_345_689 93
1169 3300050510 nmdc:mga06r32_10132_c1 nmdc:mga06r32_10132_c1_6115_6480 93
1170 3300050513 nmdc:mga0rr50_1048462_c1 nmdc:mga0rr50_1048462_c1_190_477 93
1171 3300050514 nmdc:mga08x19_383583_c1 nmdc:mga08x19_383583_c1_315_602 93
1172 3300050515 nmdc:mga0a205_721670_c1 nmdc:mga0a205_721670_c1_93_380 93
1173 3300053078 Ga0495612_0040216 Ga0495612_0040216_935_1231 93
1174 3300053083 Ga0495655_0129211 Ga0495655_0129211_453_740 93
1175 3300053133 Ga0500655_067673 Ga0500655_067673_27_314 93
1176 3300060353 Ga0501082_0353275 Ga0501082_0353275_391_705 93
1177 3300005329 Ga0070683_101385591 Ga0070683_1013855912 94
1178 3300005436 Ga0070713_100070192 Ga0070713_1000701921 94
1179 3300005467 Ga0070706_101619094 Ga0070706_1016190942 94
1180 3300005518 Ga0070699_100042312 Ga0070699_1000423125 94
1181 3300005937 Ga0081455_10204364 Ga0081455_102043643 94
1182 3300005981 Ga0081538_10137999 Ga0081538_101379992 94
1183 3300006051 Ga0075364_10052785 Ga0075364_100527853 94
1184 3300006177 Ga0075362_10035975 Ga0075362_100359754 94
1185 3300006847 Ga0075431_100227691 Ga0075431_1002276913 94
1186 3300006871 Ga0075434_102440008 Ga0075434_1024400082 94
1187 3300009094 Ga0111539_10851327 Ga0111539_108513272 94
1188 3300009147 Ga0114129_10185815 Ga0114129_101858155 94
1189 3300049591 Ga0501075_1379473 Ga0501075_1379473_107_463 94
1190 3300050489 nmdc:mga03683_30010_c1 nmdc:mga03683_30010_c1_1551_1898 94
1191 3300050491 nmdc:mga00v17_100631_c1 nmdc:mga00v17_100631_c1_1099_1446 94
1192 3300050492 nmdc:mga0yw44_414509_c1 nmdc:mga0yw44_414509_c1_178_525 94
1193 3300050507 nmdc:mga05p37_371627_c1 nmdc:mga05p37_371627_c1_917_1264 94
1194 3300050510 nmdc:mga06r32_164435_c1 nmdc:mga06r32_164435_c1_1119_1466 94
1195 3300053084 Ga0495595_0533955 Ga0495595_0533955_116_454 94
1196 3300006844 Ga0075428_100712737 Ga0075428_1007127372 95
1197 3300009147 Ga0114129_10005890 Ga0114129_100058909 95
1198 3300021361 Ga0213872_10049267 Ga0213872_100492673 95
1199 3300025916 Ga0207663_10808044 Ga0207663_108080442 95
1200 3300035116 Ga0373945_0156320 Ga0373945_0156320_176_511 95
1201 3300035170 Ga0373943_0966778 Ga0373943_0966778_35_370 95
1202 3300035171 Ga0373946_0116740 Ga0373946_0116740_467_802 95
1203 3300035692 Ga0373935_0238773 Ga0373935_0238773_762_1097 95
1204 3300035725 Ga0373947_0093943 Ga0373947_0093943_1049_1384 95
1205 3300037068 Ga0373925_0184455 Ga0373925_0184455_1180_1515 95
1206 3300039447 Ga0436361_0316570 Ga0436361_0316570_3333_3695 95
1207 3300039453 Ga0436362_0377953 Ga0436362_0377953_343_705 95
1208 3300042438 Ga0439459_0073839 Ga0439459_0073839_18_350 95
1209 3300046473 Ga0495582_0013538 Ga0495582_0013538_1110_1445 95
1210 3300046499 Ga0495594_0218487 Ga0495594_0218487_336_671 95
1211 3300046531 Ga0495665_0160378 Ga0495665_0160378_23_358 95
1212 3300046681 Ga0495647_0146014 Ga0495647_0146014_202_537 95
1213 3300046683 Ga0495658_0015745 Ga0495658_0015745_2036_2371 95
1214 3300046689 Ga0495613_0169344 Ga0495613_0169344_571_906 95
1215 3300046692 Ga0495671_0356069 Ga0495671_0356069_209_544 95
1216 3300047315 Ga0495581_0101344 Ga0495581_0101344_426_761 95
1217 3300047320 Ga0495672_0158321 Ga0495672_0158321_679_993 95
1218 3300050494 nmdc:mga06z11_365311_c1 nmdc:mga06z11_365311_c1_48_368 95
1219 3300050507 nmdc:mga05p37_1773_c1 nmdc:mga05p37_1773_c1_8683_9048 95
1220 3300050508 nmdc:mga09592_1121654_c1 nmdc:mga09592_1121654_c1_119_484 95
1221 3300005435 Ga0070714_100488863 Ga0070714_1004888631 96
1222 3300006914 Ga0075436_100922743 Ga0075436_1009227431 96
1223 3300006847 Ga0075431_101065795 Ga0075431_1010657952 97
1224 3300021377 Ga0213874_10309410 Ga0213874_103094102 97
1225 3300031241 Ga0265325_10000449 Ga0265325_100004496 97
1226 3300038443 Ga0395901_1087593 Ga0395901_1087593_271_624 97
1227 3300039438 Ga0436360_1138201 Ga0436360_1138201_417_746 97
1228 3300039450 Ga0436363_1676224 Ga0436363_1676224_266_589 97
1229 3300050507 nmdc:mga05p37_1676427_c1 nmdc:mga05p37_1676427_c1_115_480 97
1230 3300003215 JGI25153J46596_10008996 JGI25153J46596_1000899610 98
1231 3300003215 JGI25153J46596_10017054 JGI25153J46596_100170544 98
1232 3300003911 JGI25405J52794_10035110 JGI25405J52794_100351101 98
1233 3300005937 Ga0081455_10011198 Ga0081455_100111985 98
1234 3300006880 Ga0075429_100497999 Ga0075429_1004979991 98
1235 3300014326 Ga0157380_11066332 Ga0157380_110663322 98
1236 3300025297 Ga0209758_1000548 Ga0209758_100054854 98
1237 3300035086 Ga0373934_0166095 Ga0373934_0166095_376_708 98
1238 3300035695 Ga0373927_0575874 Ga0373927_0575874_384_710 98
1239 3300035724 Ga0373933_0928256 Ga0373933_0928256_68_400 98
1240 3300036401 Ga0373937_1327369 Ga0373937_1327369_283_615 98
1241 3300037418 Ga0395900_0088998 Ga0395900_0088998_2793_3146 98
1242 3300037466 Ga0395898_0210988 Ga0395898_0210988_98_451 98
1243 3300037471 Ga0395905_0187513 Ga0395905_0187513_1395_1748 98
1244 3300038443 Ga0395901_0132861 Ga0395901_0132861_1445_1798 98
1245 3300042438 Ga0439459_0208381 Ga0439459_0208381_19_318 98
1246 3300046528 Ga0495642_0373751 Ga0495642_0373751_66_419 98
1247 3300046615 Ga0495656_0555594 Ga0495656_0555594_198_551 98
1248 3300046660 Ga0495625_0482409 Ga0495625_0482409_429_728 98
1249 3300054114 Ga0501084_1180791 Ga0501084_1180791_28_324 98
1250 3300005937 Ga0081455_10305810 Ga0081455_103058101 99
1251 3300006048 Ga0075363_100942991 Ga0075363_1009429912 99
1252 3300021388 Ga0213875_10000089 Ga0213875_10000089113 99
1253 3300037853 Ga0436364_0333324 Ga0436364_0333324_8186_8512 99
1254 3300039437 Ga0436365_0998743 Ga0436365_0998743_824_1150 99
1255 3300046460 Ga0495638_0209432 Ga0495638_0209432_239_562 99
1256 3300005983 Ga0081540_1030792 Ga0081540_10307924 100
1257 3300049589 Ga0501073_0181298 Ga0501073_0181298_55_363 100
1258 3300049592 Ga0501076_0222571 Ga0501076_0222571_1222_1524 100
1259 3300050513 nmdc:mga0rr50_700375_c1 nmdc:mga0rr50_700375_c1_172_543 100
1260 3300031911 Ga0307412_11557027 Ga0307412_115570272 101
1261 3300032126 Ga0307415_100427324 Ga0307415_1004273242 101
1262 3300005471 Ga0070698_101367130 Ga0070698_1013671302 102
1263 3300009094 Ga0111539_10060664 Ga0111539_100606647 102
1264 3300031691 Ga0316579_10010091 Ga0316579_100100915 102
1265 3300032133 Ga0316583_10116423 Ga0316583_101164232 102
1266 3300032168 Ga0316593_10164792 Ga0316593_101647921 102
1267 3300036647 Ga0316582_0264236 Ga0316582_0264236_338_646 102
1268 3300050511 nmdc:mga08y16_93113_c1 nmdc:mga08y16_93113_c1_331_687 102
1269 3300053083 Ga0495655_0174731 Ga0495655_0174731_32_343 103
1270 3300006028 Ga0070717_12111438 Ga0070717_121114381 104
1271 3300021358 Ga0213873_10071188 Ga0213873_100711883 105
1272 3300021384 Ga0213876_10112449 Ga0213876_101124492 105
1273 3300039437 Ga0436365_0104312 Ga0436365_0104312_471_791 105
1274 3300002239 JGI24034J26672_10002598 JGI24034J26672_100025981 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kzx-assembly1.cif.gz_P rabbit 40s ribosomal subunit in complex with eif1. 0.9525 27 81
4v6x-assembly1.cif.gz_AP structure of the human 80s ribosome 0.9525 27 81
6p5n-assembly1.cif.gz_Q structure of a mammalian 80s ribosome in complex with a single translocated israeli acute paralysis virus ires and erf1 0.9344 27 81
5xxu-assembly1.cif.gz_P small subunit of toxoplasma gondii ribosome 0.9301 27 81
7pjy-assembly1.cif.gz_s structure of the 70s-ef-g-gdp ribosome complex with trnas in chimeric state 1 (chi1-ef-g-gdp) 0.9247 3 81
ID Description Score Start End Superfamily
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.909 3 78 3.30.860.10
2qbbS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9044 3 78 3.30.860.10
af_P54018_6_152_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8892 14 81 3.30.860.10
2qowS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8856 3 78 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8769 7 81 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A523UK41-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9424 12 81 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2G9YR56-F1-model_v4 Small ribosomal subunit protein uS19 0.9355 1 83 GO:0000028
GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A5D0IVM7-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9322 7 84 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2G6CAA1-F1-model_v4 Small ribosomal subunit protein uS19 0.9247 1 81 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A6L7KFK3-F1-model_v4 deleted 0.9235 1 81

Feature Viewer

pLDDT pTM Quality
73.88 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map