F492363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1267 | 737 | 1036 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10100040|Ga0207705_101000402 |
| Length | 253 |
| Sequence | MSAADIEASKAPLMDHLIELRSRLIKALLGFGIAFIFCFFFAKQIYNVLVWPFVWVAGPENSKFIYTALLEYFITQLKLALFGAGFISFPIVATQIYKFVAPGLYKHEKQAFLPYLVATPFFFVLGAALVYFVVLPMLVRFSLGMQQAGSDETAQIQLLPKVGENLSLMMSLIFAFGIAFQLPVILTLLGRIGIVTSKMLRETPPDVLSQCSLAIPLLLLYEGSIIAVGIVEKKAAASNATGTDVSTPANPAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 35 | 2791355199 | |||
| 36 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 37 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 38 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 39 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 40 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 41 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 42 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 43 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 44 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 45 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 46 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 47 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 48 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 49 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 50 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 51 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 52 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 53 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 54 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 55 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 56 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 57 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 58 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 59 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 60 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 61 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 62 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 63 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 64 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 65 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 66 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 69 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 70 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 71 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 72 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 73 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 74 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 75 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 76 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 77 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 78 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 79 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 80 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 81 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 86 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 90 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 91 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 92 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 93 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 94 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 95 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 96 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 97 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 98 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 101 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 102 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 103 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 104 | 2904699407 | |||
| 105 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 106 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 107 | 2906610324 | |||
| 108 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 109 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 110 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 111 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 112 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 113 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 114 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 115 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 116 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 117 | 2922368715 | |||
| 118 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 119 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 120 | 2922425934 | |||
| 121 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 122 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 123 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 124 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 125 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 126 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 127 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 128 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 129 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 130 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 131 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 132 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 133 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 134 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 135 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 136 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 137 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 138 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 139 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 140 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 141 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 142 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 143 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 144 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 145 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 146 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 147 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 148 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 149 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 150 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 151 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 152 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 153 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 154 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 155 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 156 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 157 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 158 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 159 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 160 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 161 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 162 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 163 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 164 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 165 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 166 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 167 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 168 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 169 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 170 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 171 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 172 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 173 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 174 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 175 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 176 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 177 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 178 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 179 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 180 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 181 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 182 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 183 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 184 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 185 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 186 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 187 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 188 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 189 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 190 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 191 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 192 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 193 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 194 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 195 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 196 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 197 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 198 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 199 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 200 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 201 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 202 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 203 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 204 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 205 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 206 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 207 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 208 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 209 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 210 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 211 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 212 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 213 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 214 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 215 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 218 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 219 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 222 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 224 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 225 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 226 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 228 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 229 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 230 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 239 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 243 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 250 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 256 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 257 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 258 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 260 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 261 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 262 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 264 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 265 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 269 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 270 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 272 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 273 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 274 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 276 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 277 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 278 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 279 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 280 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 281 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 282 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 283 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 284 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 285 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 286 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 287 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 288 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 290 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 291 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 292 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 293 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 294 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 295 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 296 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 297 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 298 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 299 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 301 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 302 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 303 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 304 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 305 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 306 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 307 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 308 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 309 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 311 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 312 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 313 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 314 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 315 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 340 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 345 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 346 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 347 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 348 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 349 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 351 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 358 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 360 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 428 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 429 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 430 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 431 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 438 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 442 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 443 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 444 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 445 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 446 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 447 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 448 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 449 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 450 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 451 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 452 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 453 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 454 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 455 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 456 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 457 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 458 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 459 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 460 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 461 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 462 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 463 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 464 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 465 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 466 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 467 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 468 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 469 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 470 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 471 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 472 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 473 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 474 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 475 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 476 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 477 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 478 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 479 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 480 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 481 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 482 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 483 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 484 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 485 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 486 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 487 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 488 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 489 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 490 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 491 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 492 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 493 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 494 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 495 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 496 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 497 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 498 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 499 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 500 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 501 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 502 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 503 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 504 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 505 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 506 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 507 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 575 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 576 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 577 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 578 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 579 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 580 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 581 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 582 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 583 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 584 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 585 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 586 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 587 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 588 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 589 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 590 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 591 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 592 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 593 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 594 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 595 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 596 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 597 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 598 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 599 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 600 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 601 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 611 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 612 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 613 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 615 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 616 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 617 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 618 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 619 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 621 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 623 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 624 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 628 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 631 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 632 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 633 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 634 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 635 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 636 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 637 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 638 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 639 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 640 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 641 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 642 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 643 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 644 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 645 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 646 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 647 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 648 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 653 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 654 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 655 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 656 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 657 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 658 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 659 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 660 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 661 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 662 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 663 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 664 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 665 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 666 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 667 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 668 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 669 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 670 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 671 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 672 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 673 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 674 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 675 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 676 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 677 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 678 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 679 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 680 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 681 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 682 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 683 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 684 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 685 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 686 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 687 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 688 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 689 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 690 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 691 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 692 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 693 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 694 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 695 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 697 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 698 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 699 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 700 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 701 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 702 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 703 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 704 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 705 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 706 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 707 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 708 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 709 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 710 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 711 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 712 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 713 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 714 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 715 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 716 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 717 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 718 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 719 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 720 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 721 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 722 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 723 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 724 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 725 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 726 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 727 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 728 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 729 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 730 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 731 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 732 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 733 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 734 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 735 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 736 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 737 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.09 |
| Metatranscriptomes | 0 |
| Isolates | 17.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.58 |
| Nodule | 14.05 |
| Rhizoplane | 5.45 |
| Rhizosphere | 61.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_100064 | 3300001430 | Bacteria | 4401 |
| 2 | JGI24741J21665_1009996 | 3300001915 | Bacteria | 1718 |
| 3 | JGI24746J21847_1007449 | 3300001977 | Bacteria | 1674 |
| 4 | JGI24739J22299_10017346 | 3300001989 | Bacteria | 2598 |
| 5 | JGI24737J22298_10000724 | 3300001990 | Bacteria | 11627 |
| 6 | JGI24750J21931_1000149 | 3300002070 | Bacteria | 11462 |
| 7 | JGI24745J21846_1000167 | 3300002073 | Bacteria | 5258 |
| 8 | JGI24748J21848_1003041 | 3300002074 | Bacteria | 1909 |
| 9 | JGI24738J21930_10004692 | 3300002075 | Bacteria | 3328 |
| 10 | JGI24744J21845_10010750 | 3300002077 | Bacteria | 1873 |
| 11 | JGI24744J21845_10023526 | 3300002077 | Bacteria | 1206 |
| 12 | JGI24035J26624_1000153 | 3300002126 | Bacteria | 6200 |
| 13 | JGI24034J26672_10002381 | 3300002239 | Bacteria | 2579 |
| 14 | JGI24742J22300_10000767 | 3300002244 | Bacteria | 4885 |
| 15 | JGI24751J29686_10025073 | 3300002459 | Bacteria | 1238 |
| 16 | JGI25153J46596_10004855 | 3300003215 | Bacteria | 7162 |
| 17 | JGI25153J46596_10018477 | 3300003215 | Bacteria | 2706 |
| 18 | JGI25160J50197_1003444 | 3300003354 | Bacteria | 7079 |
| 19 | JGI25404J52841_10018735 | 3300003659 | Bacteria | 1500 |
| 20 | Ga0055531_10007266 | 3300003794 | Bacteria | 6083 |
| 21 | JGI25405J52794_10027767 | 3300003911 | Bacteria | 1166 |
| 22 | JGI25405J52794_10041454 | 3300003911 | Bacteria | 974 |
| 23 | Ga0055543_1015857 | 3300004625 | Bacteria | 1442 |
| 24 | Ga0065165_1004760 | 3300005262 | Bacteria | 8113 |
| 25 | Ga0065165_1005968 | 3300005262 | Bacteria | 6583 |
| 26 | Ga0065712_10072881 | 3300005290 | Bacteria | 4581 |
| 27 | Ga0065715_10091411 | 3300005293 | Bacteria | 5806 |
| 28 | Ga0070658_10019528 | 3300005327 | Bacteria | 5426 |
| 29 | Ga0070658_10060353 | 3300005327 | Bacteria | 3088 |
| 30 | Ga0070658_10084492 | 3300005327 | Bacteria | 2610 |
| 31 | Ga0070658_10210981 | 3300005327 | Bacteria | 1640 |
| 32 | Ga0070676_10000364 | 3300005328 | Bacteria | 20754 |
| 33 | Ga0070683_100000806 | 3300005329 | Bacteria | 23191 |
| 34 | Ga0070690_100013151 | 3300005330 | Bacteria | 4885 |
| 35 | Ga0070670_100014265 | 3300005331 | Bacteria | 6818 |
| 36 | Ga0070670_100294078 | 3300005331 | Bacteria | 1420 |
| 37 | Ga0070677_10000212 | 3300005333 | Bacteria | 20104 |
| 38 | Ga0068869_100000618 | 3300005334 | Bacteria | 20078 |
| 39 | Ga0070666_10072031 | 3300005335 | Bacteria | 2352 |
| 40 | Ga0070680_100069566 | 3300005336 | Bacteria | 2890 |
| 41 | Ga0070680_100129120 | 3300005336 | Bacteria | 2113 |
| 42 | Ga0070682_100001379 | 3300005337 | Bacteria | 13705 |
| 43 | Ga0070682_100125083 | 3300005337 | Bacteria | 1731 |
| 44 | Ga0070682_100310491 | 3300005337 | Bacteria | 1161 |
| 45 | Ga0068868_100088762 | 3300005338 | Bacteria | 2488 |
| 46 | Ga0068868_100168272 | 3300005338 | Bacteria | 1814 |
| 47 | Ga0070660_100001616 | 3300005339 | Bacteria | 15489 |
| 48 | Ga0070660_100140184 | 3300005339 | Bacteria | 1939 |
| 49 | Ga0070660_100271695 | 3300005339 | Bacteria | 1386 |
| 50 | Ga0070689_100000146 | 3300005340 | Bacteria | 40947 |
| 51 | Ga0070689_100012435 | 3300005340 | Bacteria | 6132 |
| 52 | Ga0070689_100209407 | 3300005340 | Bacteria | 1595 |
| 53 | Ga0070691_10010893 | 3300005341 | Bacteria | 4151 |
| 54 | Ga0070687_100000023 | 3300005343 | Bacteria | 48100 |
| 55 | Ga0070687_100149412 | 3300005343 | Bacteria | 1370 |
| 56 | Ga0070661_100000407 | 3300005344 | Bacteria | 33255 |
| 57 | Ga0070692_10000270 | 3300005345 | Bacteria | 14505 |
| 58 | Ga0070668_100085972 | 3300005347 | Bacteria | 2472 |
| 59 | Ga0070668_100151569 | 3300005347 | Bacteria | 1875 |
| 60 | Ga0070669_100028955 | 3300005353 | Bacteria | 3991 |
| 61 | Ga0070675_100000306 | 3300005354 | Bacteria | 32965 |
| 62 | Ga0070671_100001042 | 3300005355 | Bacteria | 20417 |
| 63 | Ga0070671_100074469 | 3300005355 | Bacteria | 2837 |
| 64 | Ga0070671_100387605 | 3300005355 | Bacteria | 1194 |
| 65 | Ga0070674_100005171 | 3300005356 | Bacteria | 7502 |
| 66 | Ga0070674_100053206 | 3300005356 | Bacteria | 2794 |
| 67 | Ga0070674_100140265 | 3300005356 | Bacteria | 1813 |
| 68 | Ga0070674_100467101 | 3300005356 | Bacteria | 1045 |
| 69 | Ga0070673_100001407 | 3300005364 | Bacteria | 14072 |
| 70 | Ga0070673_100241878 | 3300005364 | Bacteria | 1570 |
| 71 | Ga0070688_100006871 | 3300005365 | Bacteria | 6108 |
| 72 | Ga0070688_100109653 | 3300005365 | Bacteria | 1834 |
| 73 | Ga0070659_100001563 | 3300005366 | Bacteria | 16498 |
| 74 | Ga0070659_100109074 | 3300005366 | Bacteria | 2233 |
| 75 | Ga0070659_100266364 | 3300005366 | Bacteria | 1422 |
| 76 | Ga0070667_100000745 | 3300005367 | Bacteria | 31113 |
| 77 | Ga0070703_10002920 | 3300005406 | Bacteria | 4891 |
| 78 | Ga0070709_10022949 | 3300005434 | Bacteria | 3657 |
| 79 | Ga0070709_10063355 | 3300005434 | Bacteria | 2361 |
| 80 | Ga0070709_10371117 | 3300005434 | Bacteria | 1062 |
| 81 | Ga0070714_100050053 | 3300005435 | Bacteria | 3557 |
| 82 | Ga0070714_100072956 | 3300005435 | Bacteria | 2973 |
| 83 | Ga0070713_100081034 | 3300005436 | Bacteria | 2769 |
| 84 | Ga0070710_10036764 | 3300005437 | Bacteria | 2679 |
| 85 | Ga0070710_10043692 | 3300005437 | Bacteria | 2483 |
| 86 | Ga0070701_10000746 | 3300005438 | Bacteria | 11552 |
| 87 | Ga0070711_100002555 | 3300005439 | Bacteria | 10421 |
| 88 | Ga0070711_100091516 | 3300005439 | Bacteria | 2193 |
| 89 | Ga0070711_100132456 | 3300005439 | Bacteria | 1858 |
| 90 | Ga0070705_100080798 | 3300005440 | Bacteria | 1995 |
| 91 | Ga0070700_100003377 | 3300005441 | Bacteria | 8231 |
| 92 | Ga0070700_100114956 | 3300005441 | Bacteria | 1795 |
| 93 | Ga0070694_100003105 | 3300005444 | Bacteria | 9892 |
| 94 | Ga0070708_100229275 | 3300005445 | Bacteria | 1743 |
| 95 | Ga0070663_100016281 | 3300005455 | Bacteria | 4824 |
| 96 | Ga0070663_100019641 | 3300005455 | Bacteria | 4460 |
| 97 | Ga0070663_100031255 | 3300005455 | Bacteria | 3658 |
| 98 | Ga0070663_100102247 | 3300005455 | Bacteria | 2140 |
| 99 | Ga0070663_100340435 | 3300005455 | Bacteria | 1212 |
| 100 | Ga0070678_100042226 | 3300005456 | Bacteria | 3240 |
| 101 | Ga0070678_100117886 | 3300005456 | Bacteria | 2088 |
| 102 | Ga0070678_100137581 | 3300005456 | Bacteria | 1950 |
| 103 | Ga0070678_100272711 | 3300005456 | Bacteria | 1427 |
| 104 | Ga0070678_100733257 | 3300005456 | Bacteria | 893 |
| 105 | Ga0070662_100114670 | 3300005457 | Bacteria | 2057 |
| 106 | Ga0070681_10004011 | 3300005458 | Bacteria | 13893 |
| 107 | Ga0070681_10019499 | 3300005458 | Bacteria | 6790 |
| 108 | Ga0070681_10106630 | 3300005458 | Bacteria | 2743 |
| 109 | Ga0068867_100014124 | 3300005459 | Bacteria | 5657 |
| 110 | Ga0070685_10115279 | 3300005466 | Bacteria | 1661 |
| 111 | Ga0070699_100550967 | 3300005518 | Bacteria | 1050 |
| 112 | Ga0070679_100003609 | 3300005530 | Bacteria | 14140 |
| 113 | Ga0070679_100005467 | 3300005530 | Bacteria | 11781 |
| 114 | Ga0070679_100024249 | 3300005530 | Bacteria | 5944 |
| 115 | Ga0070679_100113511 | 3300005530 | Bacteria | 2695 |
| 116 | Ga0070679_100121585 | 3300005530 | Bacteria | 2595 |
| 117 | Ga0070679_100341474 | 3300005530 | Bacteria | 1445 |
| 118 | Ga0070684_100000454 | 3300005535 | Bacteria | 27974 |
| 119 | Ga0070684_100187988 | 3300005535 | Bacteria | 1879 |
| 120 | Ga0068853_100059818 | 3300005539 | Bacteria | 3291 |
| 121 | Ga0068853_100220550 | 3300005539 | Bacteria | 1732 |
| 122 | Ga0070672_100000045 | 3300005543 | Bacteria | 53368 |
| 123 | Ga0070672_100074421 | 3300005543 | Bacteria | 2709 |
| 124 | Ga0070686_100000480 | 3300005544 | Bacteria | 24146 |
| 125 | Ga0070686_100169798 | 3300005544 | Bacteria | 1542 |
| 126 | Ga0070695_100019377 | 3300005545 | Bacteria | 4143 |
| 127 | Ga0070696_100039744 | 3300005546 | Bacteria | 3248 |
| 128 | Ga0070693_100000286 | 3300005547 | Bacteria | 23758 |
| 129 | Ga0070693_100066630 | 3300005547 | Bacteria | 2108 |
| 130 | Ga0070665_100049034 | 3300005548 | Bacteria | 4238 |
| 131 | Ga0070665_100237145 | 3300005548 | Bacteria | 1824 |
| 132 | Ga0070704_100006095 | 3300005549 | Bacteria | 7078 |
| 133 | Ga0068855_100006104 | 3300005563 | Bacteria | 14691 |
| 134 | Ga0068855_100134934 | 3300005563 | Bacteria | 2816 |
| 135 | Ga0068855_100380655 | 3300005563 | Bacteria | 1549 |
| 136 | Ga0070664_100000899 | 3300005564 | Bacteria | 23157 |
| 137 | Ga0070664_100319756 | 3300005564 | Bacteria | 1406 |
| 138 | Ga0068857_100000623 | 3300005577 | Bacteria | 26056 |
| 139 | Ga0068857_100450183 | 3300005577 | Bacteria | 1203 |
| 140 | Ga0068857_100493915 | 3300005577 | Bacteria | 1148 |
| 141 | Ga0068854_100005892 | 3300005578 | Bacteria | 7763 |
| 142 | Ga0068854_100190683 | 3300005578 | Bacteria | 1606 |
| 143 | Ga0068856_100012141 | 3300005614 | Bacteria | 8343 |
| 144 | Ga0068856_100059599 | 3300005614 | Bacteria | 3770 |
| 145 | Ga0068856_100238473 | 3300005614 | Bacteria | 1834 |
| 146 | Ga0070702_100003379 | 3300005615 | Bacteria | 7127 |
| 147 | Ga0070702_100170330 | 3300005615 | Bacteria | 1416 |
| 148 | Ga0068852_100005047 | 3300005616 | Bacteria | 9387 |
| 149 | Ga0068852_100666308 | 3300005616 | Bacteria | 1049 |
| 150 | Ga0068859_100020794 | 3300005617 | Bacteria | 6587 |
| 151 | Ga0068859_100123228 | 3300005617 | Bacteria | 2659 |
| 152 | Ga0068864_100008403 | 3300005618 | Bacteria | 8516 |
| 153 | Ga0068864_100109286 | 3300005618 | Bacteria | 2461 |
| 154 | Ga0068864_100297727 | 3300005618 | Bacteria | 1509 |
| 155 | Ga0068864_100669224 | 3300005618 | Bacteria | 1012 |
| 156 | Ga0068866_10000346 | 3300005718 | Bacteria | 21828 |
| 157 | Ga0068866_10151449 | 3300005718 | Bacteria | 1344 |
| 158 | Ga0068861_100000045 | 3300005719 | Bacteria | 56440 |
| 159 | Ga0068861_100020032 | 3300005719 | Bacteria | 4784 |
| 160 | Ga0068861_100124839 | 3300005719 | Bacteria | 2081 |
| 161 | Ga0068870_10000213 | 3300005840 | Bacteria | 20950 |
| 162 | Ga0068863_100001919 | 3300005841 | Bacteria | 20657 |
| 163 | Ga0068863_100173882 | 3300005841 | Bacteria | 2066 |
| 164 | Ga0068858_100000307 | 3300005842 | Bacteria | 52034 |
| 165 | Ga0068858_100018465 | 3300005842 | Bacteria | 6529 |
| 166 | Ga0068858_100225095 | 3300005842 | Bacteria | 1777 |
| 167 | Ga0068858_100303146 | 3300005842 | Bacteria | 1524 |
| 168 | Ga0068858_100684166 | 3300005842 | Bacteria | 998 |
| 169 | Ga0068860_100001587 | 3300005843 | Bacteria | 24464 |
| 170 | Ga0068862_100011664 | 3300005844 | Bacteria | 7251 |
| 171 | Ga0068862_100201763 | 3300005844 | Bacteria | 1794 |
| 172 | Ga0068862_100270948 | 3300005844 | Bacteria | 1552 |
| 173 | Ga0068862_100565425 | 3300005844 | Bacteria | 1087 |
| 174 | Ga0081455_10002522 | 3300005937 | Bacteria | 21748 |
| 175 | Ga0081455_10014064 | 3300005937 | Bacteria | 7866 |
| 176 | Ga0081455_10018661 | 3300005937 | Bacteria | 6591 |
| 177 | Ga0081455_10020448 | 3300005937 | Bacteria | 6232 |
| 178 | Ga0081540_1002686 | 3300005983 | Bacteria | 14471 |
| 179 | Ga0081540_1006242 | 3300005983 | Bacteria | 8731 |
| 180 | Ga0081540_1006816 | 3300005983 | Bacteria | 8252 |
| 181 | Ga0081540_1078604 | 3300005983 | Bacteria | 1494 |
| 182 | Ga0081540_1078879 | 3300005983 | Bacteria | 1491 |
| 183 | Ga0081539_10000379 | 3300005985 | Bacteria | 97134 |
| 184 | Ga0070717_10106892 | 3300006028 | Bacteria | 2383 |
| 185 | Ga0075365_10061715 | 3300006038 | Bacteria | 2504 |
| 186 | Ga0075365_10126856 | 3300006038 | Bacteria | 1763 |
| 187 | Ga0075365_10145156 | 3300006038 | Bacteria | 1649 |
| 188 | Ga0075365_10172650 | 3300006038 | Bacteria | 1509 |
| 189 | Ga0075368_10029287 | 3300006042 | Bacteria | 2128 |
| 190 | Ga0075368_10068375 | 3300006042 | Bacteria | 1431 |
| 191 | Ga0075363_100052433 | 3300006048 | Bacteria | 2177 |
| 192 | Ga0075364_10069135 | 3300006051 | Bacteria | 2323 |
| 193 | Ga0075364_10114295 | 3300006051 | Bacteria | 1803 |
| 194 | Ga0070715_10045681 | 3300006163 | Bacteria | 1858 |
| 195 | Ga0070712_100024400 | 3300006175 | Bacteria | 4007 |
| 196 | Ga0070712_100100891 | 3300006175 | Bacteria | 2134 |
| 197 | Ga0075362_10045367 | 3300006177 | Bacteria | 1952 |
| 198 | Ga0075367_10108150 | 3300006178 | Bacteria | 1704 |
| 199 | Ga0075367_10157983 | 3300006178 | Bacteria | 1409 |
| 200 | Ga0075367_10262485 | 3300006178 | Bacteria | 1084 |
| 201 | Ga0075369_10107306 | 3300006186 | Bacteria | 1256 |
| 202 | Ga0075369_10160712 | 3300006186 | Bacteria | 1030 |
| 203 | Ga0075366_10029327 | 3300006195 | Bacteria | 3233 |
| 204 | Ga0075366_10193124 | 3300006195 | Bacteria | 1237 |
| 205 | Ga0097621_100000587 | 3300006237 | Bacteria | 25584 |
| 206 | Ga0097621_100129958 | 3300006237 | Bacteria | 2143 |
| 207 | Ga0075370_10047118 | 3300006353 | Bacteria | 2440 |
| 208 | Ga0075370_10101365 | 3300006353 | Bacteria | 1666 |
| 209 | Ga0068871_100002886 | 3300006358 | Bacteria | 11787 |
| 210 | Ga0075428_100005210 | 3300006844 | Bacteria | 14452 |
| 211 | Ga0075430_100001350 | 3300006846 | Bacteria | 19843 |
| 212 | Ga0075430_100002163 | 3300006846 | Bacteria | 16263 |
| 213 | Ga0075431_100000033 | 3300006847 | Bacteria | 72175 |
| 214 | Ga0075431_100001300 | 3300006847 | Bacteria | 22820 |
| 215 | Ga0075433_10000773 | 3300006852 | Bacteria | 22008 |
| 216 | Ga0075433_10005102 | 3300006852 | Bacteria | 10300 |
| 217 | Ga0075434_100001539 | 3300006871 | Bacteria | 19519 |
| 218 | Ga0075434_100045067 | 3300006871 | Bacteria | 4375 |
| 219 | Ga0075434_100051349 | 3300006871 | Bacteria | 4098 |
| 220 | Ga0075434_100074375 | 3300006871 | Bacteria | 3391 |
| 221 | Ga0075434_100377177 | 3300006871 | Bacteria | 1439 |
| 222 | Ga0075429_100002588 | 3300006880 | Bacteria | 15248 |
| 223 | Ga0068865_100007664 | 3300006881 | Bacteria | 6650 |
| 224 | Ga0068865_100284929 | 3300006881 | Bacteria | 1317 |
| 225 | Ga0068865_100324896 | 3300006881 | Bacteria | 1239 |
| 226 | Ga0097620_100020792 | 3300006931 | Bacteria | 6587 |
| 227 | Ga0097620_100123230 | 3300006931 | Bacteria | 2659 |
| 228 | Ga0099825_1035142 | 3300006941 | Bacteria | 1812 |
| 229 | Ga0099824_1020964 | 3300006942 | Bacteria | 4669 |
| 230 | Ga0099823_1016923 | 3300006944 | Bacteria | 7131 |
| 231 | Ga0075435_100126575 | 3300007076 | Bacteria | 2136 |
| 232 | Ga0099795_10028564 | 3300007788 | Bacteria | 1898 |
| 233 | Ga0105250_10066785 | 3300009092 | Bacteria | 1451 |
| 234 | Ga0105240_10014215 | 3300009093 | Bacteria | 10873 |
| 235 | Ga0105240_10058395 | 3300009093 | Bacteria | 4816 |
| 236 | Ga0105240_10292421 | 3300009093 | Bacteria | 1867 |
| 237 | Ga0105240_10524839 | 3300009093 | Bacteria | 1313 |
| 238 | Ga0105240_10583553 | 3300009093 | Bacteria | 1233 |
| 239 | Ga0111539_10000591 | 3300009094 | Bacteria | 46788 |
| 240 | Ga0111539_10003260 | 3300009094 | Bacteria | 21453 |
| 241 | Ga0111539_10018995 | 3300009094 | Bacteria | 8497 |
| 242 | Ga0111539_10106104 | 3300009094 | Bacteria | 3296 |
| 243 | Ga0111539_11020670 | 3300009094 | Bacteria | 962 |
| 244 | Ga0105245_10001033 | 3300009098 | Bacteria | 25290 |
| 245 | Ga0105247_10020518 | 3300009101 | Bacteria | 3973 |
| 246 | Ga0114129_10001565 | 3300009147 | Bacteria | 31048 |
| 247 | Ga0114129_10002229 | 3300009147 | Bacteria | 26735 |
| 248 | Ga0105243_10000678 | 3300009148 | Bacteria | 33239 |
| 249 | Ga0105243_10103348 | 3300009148 | Bacteria | 2369 |
| 250 | Ga0105243_10153926 | 3300009148 | Bacteria | 1975 |
| 251 | Ga0105241_10008618 | 3300009174 | Bacteria | 7494 |
| 252 | Ga0105241_10043729 | 3300009174 | Bacteria | 3393 |
| 253 | Ga0105241_10525361 | 3300009174 | Bacteria | 1059 |
| 254 | Ga0105242_10002866 | 3300009176 | Bacteria | 13505 |
| 255 | Ga0105242_10194157 | 3300009176 | Bacteria | 1799 |
| 256 | Ga0105242_10327313 | 3300009176 | Bacteria | 1408 |
| 257 | Ga0105242_10353968 | 3300009176 | Bacteria | 1357 |
| 258 | Ga0105248_10042833 | 3300009177 | Bacteria | 5076 |
| 259 | Ga0105248_10140778 | 3300009177 | Bacteria | 2721 |
| 260 | Ga0105237_10014611 | 3300009545 | Bacteria | 8202 |
| 261 | Ga0105237_10078806 | 3300009545 | Bacteria | 3284 |
| 262 | Ga0105238_10055605 | 3300009551 | Bacteria | 3972 |
| 263 | Ga0105238_10067496 | 3300009551 | Bacteria | 3577 |
| 264 | Ga0105238_10316456 | 3300009551 | Bacteria | 1546 |
| 265 | Ga0105249_10000540 | 3300009553 | Bacteria | 34962 |
| 266 | Ga0105239_10013892 | 3300010375 | Bacteria | 8937 |
| 267 | Ga0105239_10024564 | 3300010375 | Bacteria | 6639 |
| 268 | Ga0105239_10108947 | 3300010375 | Bacteria | 3068 |
| 269 | Ga0105239_10253811 | 3300010375 | Bacteria | 1975 |
| 270 | Ga0105246_10010105 | 3300011119 | Bacteria | 5827 |
| 271 | Ga0105246_10027291 | 3300011119 | Bacteria | 3740 |
| 272 | Ga0157371_10096347 | 3300013102 | Bacteria | 2097 |
| 273 | Ga0157371_10228999 | 3300013102 | Bacteria | 1335 |
| 274 | Ga0157370_10085004 | 3300013104 | Bacteria | 2972 |
| 275 | Ga0157370_10319063 | 3300013104 | Bacteria | 1433 |
| 276 | Ga0157374_10460154 | 3300013296 | Bacteria | 1274 |
| 277 | Ga0157374_10758182 | 3300013296 | Bacteria | 985 |
| 278 | Ga0157378_10002535 | 3300013297 | Bacteria | 16255 |
| 279 | Ga0163162_10033221 | 3300013306 | Bacteria | 5125 |
| 280 | Ga0163162_10975414 | 3300013306 | Bacteria | 958 |
| 281 | Ga0157372_10015130 | 3300013307 | Bacteria | 8256 |
| 282 | Ga0157372_10257960 | 3300013307 | Bacteria | 2024 |
| 283 | Ga0157372_10527575 | 3300013307 | Bacteria | 1376 |
| 284 | Ga0157375_10013069 | 3300013308 | Bacteria | 7378 |
| 285 | Ga0157375_10194691 | 3300013308 | Bacteria | 2182 |
| 286 | Ga0163163_10009083 | 3300014325 | Bacteria | 8858 |
| 287 | Ga0163163_10211943 | 3300014325 | Bacteria | 1986 |
| 288 | Ga0163163_10359971 | 3300014325 | Bacteria | 1511 |
| 289 | Ga0157380_10003874 | 3300014326 | Bacteria | 10318 |
| 290 | Ga0157380_10232005 | 3300014326 | Bacteria | 1658 |
| 291 | Ga0157380_10329432 | 3300014326 | Bacteria | 1419 |
| 292 | Ga0182008_10036655 | 3300014497 | Bacteria | 2453 |
| 293 | Ga0157377_10000653 | 3300014745 | Bacteria | 14463 |
| 294 | Ga0157379_10000135 | 3300014968 | Bacteria | 52814 |
| 295 | Ga0157379_10044047 | 3300014968 | Bacteria | 3985 |
| 296 | Ga0157376_10001353 | 3300014969 | Bacteria | 16134 |
| 297 | Ga0157376_10511583 | 3300014969 | Bacteria | 1182 |
| 298 | Ga0163161_10007225 | 3300017792 | Bacteria | 7676 |
| 299 | Ga0214544_1000051 | 3300021320 | Bacteria | 134645 |
| 300 | Ga0214542_1000149 | 3300021321 | Bacteria | 102700 |
| 301 | Ga0214545_1000126 | 3300021324 | Bacteria | 91489 |
| 302 | Ga0214543_1000148 | 3300021327 | Bacteria | 98370 |
| 303 | Ga0213875_10000023 | 3300021388 | Bacteria | 213455 |
| 304 | Ga0213875_10053745 | 3300021388 | Bacteria | 1886 |
| 305 | Ga0209563_102080 | 3300025230 | Bacteria | 4734 |
| 306 | Ga0207425_1009482 | 3300025245 | Bacteria | 2417 |
| 307 | Ga0209677_100663 | 3300025253 | Bacteria | 17947 |
| 308 | Ga0209677_101621 | 3300025253 | Bacteria | 9490 |
| 309 | Ga0209148_1000258 | 3300025254 | Bacteria | 83390 |
| 310 | Ga0209233_1013243 | 3300025261 | Bacteria | 2359 |
| 311 | Ga0209233_1030272 | 3300025261 | Bacteria | 1276 |
| 312 | Ga0207666_1000021 | 3300025271 | Bacteria | 37690 |
| 313 | Ga0209455_1001530 | 3300025272 | Bacteria | 10313 |
| 314 | Ga0207673_1000062 | 3300025290 | Bacteria | 9181 |
| 315 | Ga0209564_1003207 | 3300025295 | Bacteria | 11489 |
| 316 | Ga0209564_1007189 | 3300025295 | Bacteria | 5804 |
| 317 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 318 | Ga0209758_1000188 | 3300025297 | Bacteria | 138749 |
| 319 | Ga0209758_1000521 | 3300025297 | Bacteria | 61693 |
| 320 | Ga0209758_1003026 | 3300025297 | Bacteria | 16041 |
| 321 | Ga0209758_1016841 | 3300025297 | Bacteria | 3685 |
| 322 | Ga0209758_1039249 | 3300025297 | Bacteria | 1803 |
| 323 | Ga0209758_1047475 | 3300025297 | Bacteria | 1535 |
| 324 | Ga0209256_1004268 | 3300025299 | Bacteria | 9134 |
| 325 | Ga0207426_1001694 | 3300025302 | Bacteria | 17003 |
| 326 | Ga0207426_1002095 | 3300025302 | Bacteria | 13759 |
| 327 | Ga0207426_1007289 | 3300025302 | Bacteria | 4649 |
| 328 | Ga0209257_1002487 | 3300025304 | Bacteria | 18212 |
| 329 | Ga0209257_1021911 | 3300025304 | Bacteria | 2300 |
| 330 | Ga0207697_10001014 | 3300025315 | Bacteria | 15717 |
| 331 | Ga0207653_10001128 | 3300025885 | Bacteria | 8743 |
| 332 | Ga0207682_10000796 | 3300025893 | Bacteria | 14565 |
| 333 | Ga0207692_10033251 | 3300025898 | Bacteria | 2486 |
| 334 | Ga0207692_10134914 | 3300025898 | Bacteria | 1398 |
| 335 | Ga0207642_10000764 | 3300025899 | Bacteria | 9951 |
| 336 | Ga0207710_10019312 | 3300025900 | Bacteria | 2908 |
| 337 | Ga0207688_10000017 | 3300025901 | Bacteria | 52729 |
| 338 | Ga0207688_10057579 | 3300025901 | Bacteria | 2185 |
| 339 | Ga0207680_10017854 | 3300025903 | Bacteria | 3756 |
| 340 | Ga0207647_10003774 | 3300025904 | Bacteria | 11329 |
| 341 | Ga0207685_10002303 | 3300025905 | Bacteria | 4340 |
| 342 | Ga0207685_10182282 | 3300025905 | Bacteria | 974 |
| 343 | Ga0207699_10023853 | 3300025906 | Bacteria | 3336 |
| 344 | Ga0207699_10149236 | 3300025906 | Bacteria | 1545 |
| 345 | Ga0207699_10170170 | 3300025906 | Bacteria | 1457 |
| 346 | Ga0207645_10000074 | 3300025907 | Bacteria | 71544 |
| 347 | Ga0207645_10023855 | 3300025907 | Bacteria | 3970 |
| 348 | Ga0207645_10086693 | 3300025907 | Bacteria | 2012 |
| 349 | Ga0207643_10000058 | 3300025908 | Bacteria | 73498 |
| 350 | Ga0207705_10100040 | 3300025909 | Bacteria | 2132 |
| 351 | Ga0207654_10004287 | 3300025911 | Bacteria | 7194 |
| 352 | Ga0207654_10233559 | 3300025911 | Bacteria | 1226 |
| 353 | Ga0207707_10000311 | 3300025912 | Bacteria | 51163 |
| 354 | Ga0207707_10019779 | 3300025912 | Bacteria | 5879 |
| 355 | Ga0207707_10129150 | 3300025912 | Bacteria | 2210 |
| 356 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 357 | Ga0207695_10157011 | 3300025913 | Bacteria | 2209 |
| 358 | Ga0207671_10035837 | 3300025914 | Bacteria | 3679 |
| 359 | Ga0207671_10191532 | 3300025914 | Bacteria | 1595 |
| 360 | Ga0207693_10001855 | 3300025915 | Bacteria | 18519 |
| 361 | Ga0207693_10002979 | 3300025915 | Bacteria | 14660 |
| 362 | Ga0207693_10354384 | 3300025915 | Bacteria | 1148 |
| 363 | Ga0207663_10012968 | 3300025916 | Bacteria | 4520 |
| 364 | Ga0207663_10036931 | 3300025916 | Bacteria | 2941 |
| 365 | Ga0207663_10068961 | 3300025916 | Bacteria | 2273 |
| 366 | Ga0207663_10252136 | 3300025916 | Bacteria | 1299 |
| 367 | Ga0207660_10000578 | 3300025917 | Bacteria | 24655 |
| 368 | Ga0207660_10037039 | 3300025917 | Bacteria | 3396 |
| 369 | Ga0207660_10350955 | 3300025917 | Bacteria | 1182 |
| 370 | Ga0207662_10000069 | 3300025918 | Bacteria | 45774 |
| 371 | Ga0207657_10000721 | 3300025919 | Bacteria | 35100 |
| 372 | Ga0207657_10054457 | 3300025919 | Bacteria | 3459 |
| 373 | Ga0207657_10169565 | 3300025919 | Bacteria | 1769 |
| 374 | Ga0207649_10000282 | 3300025920 | Bacteria | 40055 |
| 375 | Ga0207652_10001198 | 3300025921 | Bacteria | 23347 |
| 376 | Ga0207652_10017328 | 3300025921 | Bacteria | 5894 |
| 377 | Ga0207652_10162753 | 3300025921 | Bacteria | 2000 |
| 378 | Ga0207652_10277686 | 3300025921 | Bacteria | 1511 |
| 379 | Ga0207652_10490708 | 3300025921 | Bacteria | 1106 |
| 380 | Ga0207681_10000806 | 3300025923 | Bacteria | 20631 |
| 381 | Ga0207650_10005569 | 3300025925 | Bacteria | 8597 |
| 382 | Ga0207650_10158976 | 3300025925 | Bacteria | 1789 |
| 383 | Ga0207659_10000039 | 3300025926 | Bacteria | 91685 |
| 384 | Ga0207687_10000458 | 3300025927 | Bacteria | 27761 |
| 385 | Ga0207700_10065675 | 3300025928 | Bacteria | 2769 |
| 386 | Ga0207700_10107159 | 3300025928 | Bacteria | 2242 |
| 387 | Ga0207664_10005104 | 3300025929 | Bacteria | 8943 |
| 388 | Ga0207664_10018448 | 3300025929 | Bacteria | 5138 |
| 389 | Ga0207664_10055368 | 3300025929 | Bacteria | 3147 |
| 390 | Ga0207644_10021949 | 3300025931 | Bacteria | 4354 |
| 391 | Ga0207644_10032996 | 3300025931 | Bacteria | 3616 |
| 392 | Ga0207690_10000303 | 3300025932 | Bacteria | 34378 |
| 393 | Ga0207690_10223537 | 3300025932 | Bacteria | 1442 |
| 394 | Ga0207706_10063888 | 3300025933 | Bacteria | 3241 |
| 395 | Ga0207706_10082263 | 3300025933 | Bacteria | 2830 |
| 396 | Ga0207686_10000540 | 3300025934 | Bacteria | 24486 |
| 397 | Ga0207686_10220270 | 3300025934 | Bacteria | 1370 |
| 398 | Ga0207709_10000894 | 3300025935 | Bacteria | 22532 |
| 399 | Ga0207709_10034192 | 3300025935 | Bacteria | 2994 |
| 400 | Ga0207709_10428152 | 3300025935 | Bacteria | 1018 |
| 401 | Ga0207670_10000200 | 3300025936 | Bacteria | 39476 |
| 402 | Ga0207670_10002609 | 3300025936 | Bacteria | 9481 |
| 403 | Ga0207670_10197046 | 3300025936 | Bacteria | 1528 |
| 404 | Ga0207669_10000098 | 3300025937 | Bacteria | 43800 |
| 405 | Ga0207669_10010480 | 3300025937 | Bacteria | 4465 |
| 406 | Ga0207669_10237642 | 3300025937 | Bacteria | 1348 |
| 407 | Ga0207704_10012394 | 3300025938 | Bacteria | 4233 |
| 408 | Ga0207704_10147818 | 3300025938 | Bacteria | 1654 |
| 409 | Ga0207704_10440512 | 3300025938 | Bacteria | 1038 |
| 410 | Ga0207665_10189776 | 3300025939 | Bacteria | 1492 |
| 411 | Ga0207691_10000169 | 3300025940 | Bacteria | 60909 |
| 412 | Ga0207691_10042900 | 3300025940 | Bacteria | 4169 |
| 413 | Ga0207691_10230390 | 3300025940 | Bacteria | 1604 |
| 414 | Ga0207711_10008085 | 3300025941 | Bacteria | 8803 |
| 415 | Ga0207711_10158772 | 3300025941 | Bacteria | 2045 |
| 416 | Ga0207711_10283371 | 3300025941 | Bacteria | 1526 |
| 417 | Ga0207689_10001003 | 3300025942 | Bacteria | 27128 |
| 418 | Ga0207689_10037986 | 3300025942 | Bacteria | 3990 |
| 419 | Ga0207689_10491258 | 3300025942 | Bacteria | 1028 |
| 420 | Ga0207661_10014106 | 3300025944 | Bacteria | 5848 |
| 421 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 422 | Ga0207667_10054202 | 3300025949 | Bacteria | 4218 |
| 423 | Ga0207667_10401693 | 3300025949 | Bacteria | 1395 |
| 424 | Ga0207667_10485141 | 3300025949 | Bacteria | 1254 |
| 425 | Ga0207651_10000213 | 3300025960 | Bacteria | 24957 |
| 426 | Ga0207712_10000473 | 3300025961 | Bacteria | 33877 |
| 427 | Ga0207668_10000220 | 3300025972 | Bacteria | 38677 |
| 428 | Ga0207668_10421124 | 3300025972 | Bacteria | 1133 |
| 429 | Ga0207640_10000573 | 3300025981 | Bacteria | 21936 |
| 430 | Ga0207658_10120158 | 3300025986 | Bacteria | 2093 |
| 431 | Ga0207677_10000513 | 3300026023 | Bacteria | 24963 |
| 432 | Ga0207703_10086489 | 3300026035 | Bacteria | 2626 |
| 433 | Ga0207703_10314978 | 3300026035 | Bacteria | 1431 |
| 434 | Ga0207639_10003256 | 3300026041 | Bacteria | 10933 |
| 435 | Ga0207639_10165864 | 3300026041 | Bacteria | 1866 |
| 436 | Ga0207678_10003592 | 3300026067 | Bacteria | 13936 |
| 437 | Ga0207678_10131139 | 3300026067 | Bacteria | 2138 |
| 438 | Ga0207678_10140870 | 3300026067 | Bacteria | 2058 |
| 439 | Ga0207678_10141866 | 3300026067 | Bacteria | 2050 |
| 440 | Ga0207708_10000428 | 3300026075 | Bacteria | 32826 |
| 441 | Ga0207702_10005939 | 3300026078 | Bacteria | 10605 |
| 442 | Ga0207702_10180446 | 3300026078 | Bacteria | 1944 |
| 443 | Ga0207702_10455353 | 3300026078 | Bacteria | 1242 |
| 444 | Ga0207641_10002043 | 3300026088 | Bacteria | 19219 |
| 445 | Ga0207641_10082469 | 3300026088 | Bacteria | 2794 |
| 446 | Ga0207648_10028973 | 3300026089 | Bacteria | 4909 |
| 447 | Ga0207648_10067409 | 3300026089 | Bacteria | 3120 |
| 448 | Ga0207648_10109226 | 3300026089 | Bacteria | 2428 |
| 449 | Ga0207676_10001467 | 3300026095 | Bacteria | 17519 |
| 450 | Ga0207674_10000135 | 3300026116 | Bacteria | 85071 |
| 451 | Ga0207674_10481295 | 3300026116 | Bacteria | 1200 |
| 452 | Ga0207675_100000245 | 3300026118 | Bacteria | 51737 |
| 453 | Ga0207675_100122042 | 3300026118 | Bacteria | 2466 |
| 454 | Ga0207675_100262104 | 3300026118 | Bacteria | 1675 |
| 455 | Ga0207683_10000136 | 3300026121 | Bacteria | 60910 |
| 456 | Ga0207683_10149435 | 3300026121 | Bacteria | 2108 |
| 457 | Ga0207698_10000828 | 3300026142 | Bacteria | 17909 |
| 458 | Ga0207698_10151368 | 3300026142 | Bacteria | 2014 |
| 459 | Ga0209973_1000324 | 3300027252 | Bacteria | 3428 |
| 460 | Ga0209389_1000041 | 3300027296 | Bacteria | 123983 |
| 461 | Ga0209389_1000656 | 3300027296 | Bacteria | 21454 |
| 462 | Ga0209589_1000874 | 3300027357 | Bacteria | 45837 |
| 463 | Ga0209489_100178 | 3300027361 | Bacteria | 99953 |
| 464 | Ga0209489_105228 | 3300027361 | Bacteria | 22869 |
| 465 | Ga0209700_100010 | 3300027363 | Bacteria | 395269 |
| 466 | Ga0209970_1004161 | 3300027614 | Bacteria | 2410 |
| 467 | Ga0210002_1000224 | 3300027617 | Bacteria | 7969 |
| 468 | Ga0209971_1038246 | 3300027682 | Bacteria | 1155 |
| 469 | Ga0209966_1002708 | 3300027695 | Bacteria | 2962 |
| 470 | Ga0209998_10019780 | 3300027717 | Bacteria | 1437 |
| 471 | Ga0209974_10003611 | 3300027876 | Bacteria | 5557 |
| 472 | Ga0207428_10000249 | 3300027907 | Bacteria | 73253 |
| 473 | Ga0207428_10000471 | 3300027907 | Bacteria | 48541 |
| 474 | Ga0207428_10003754 | 3300027907 | Bacteria | 14582 |
| 475 | Ga0207428_10264038 | 3300027907 | Bacteria | 1281 |
| 476 | Ga0268266_10007483 | 3300028379 | Bacteria | 9844 |
| 477 | Ga0268266_10236688 | 3300028379 | Bacteria | 1683 |
| 478 | Ga0268266_10691380 | 3300028379 | Bacteria | 983 |
| 479 | Ga0268265_10001888 | 3300028380 | Bacteria | 16660 |
| 480 | Ga0268264_10000693 | 3300028381 | Bacteria | 39190 |
| 481 | Ga0268264_10304830 | 3300028381 | Bacteria | 1501 |
| 482 | Ga0307517_10000139 | 3300028786 | Bacteria | 111985 |
| 483 | Ga0307515_10072230 | 3300028794 | Bacteria | 4662 |
| 484 | Ga0265338_10047667 | 3300028800 | Bacteria | 3911 |
| 485 | Ga0265338_10473270 | 3300028800 | Bacteria | 885 |
| 486 | Ga0265325_10003096 | 3300031241 | Bacteria | 10981 |
| 487 | Ga0265325_10006332 | 3300031241 | Bacteria | 7196 |
| 488 | Ga0265325_10021820 | 3300031241 | Bacteria | 3512 |
| 489 | Ga0265340_10107260 | 3300031247 | Bacteria | 1294 |
| 490 | Ga0265339_10001686 | 3300031249 | Bacteria | 16305 |
| 491 | Ga0265339_10010010 | 3300031249 | Bacteria | 5913 |
| 492 | Ga0265316_10062198 | 3300031344 | Bacteria | 2898 |
| 493 | Ga0265313_10000106 | 3300031595 | Bacteria | 83923 |
| 494 | Ga0265313_10006454 | 3300031595 | Bacteria | 8296 |
| 495 | Ga0265313_10018201 | 3300031595 | Bacteria | 3955 |
| 496 | Ga0265313_10040606 | 3300031595 | Bacteria | 2298 |
| 497 | Ga0307508_10244338 | 3300031616 | Bacteria | 1392 |
| 498 | Ga0316579_10001412 | 3300031691 | Bacteria | 8711 |
| 499 | Ga0265314_10023262 | 3300031711 | Bacteria | 4728 |
| 500 | Ga0265342_10000760 | 3300031712 | Bacteria | 32963 |
| 501 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 502 | Ga0373950_0004083 | 3300034818 | Bacteria | 2125 |
| 503 | Ga0373958_0004047 | 3300034819 | Bacteria | 2148 |
| 504 | Ga0373938_0001584 | 3300034957 | Bacteria | 3655 |
| 505 | Ga0373938_0007424 | 3300034957 | Bacteria | 1928 |
| 506 | Ga0373926_0009755 | 3300035083 | Bacteria | 3208 |
| 507 | Ga0373928_0001828 | 3300035084 | Bacteria | 4148 |
| 508 | Ga0373940_0074425 | 3300035088 | Bacteria | 994 |
| 509 | Ga0373944_0021434 | 3300035089 | Bacteria | 1870 |
| 510 | Ga0373949_0016957 | 3300035090 | Bacteria | 1637 |
| 511 | Ga0373952_0001190 | 3300035092 | Bacteria | 4748 |
| 512 | Ga0373923_0004598 | 3300035111 | Bacteria | 4593 |
| 513 | Ga0373923_0074895 | 3300035111 | Bacteria | 1460 |
| 514 | Ga0373932_0002449 | 3300035112 | Bacteria | 4694 |
| 515 | Ga0373936_0062523 | 3300035113 | Bacteria | 1522 |
| 516 | Ga0373936_0088802 | 3300035113 | Bacteria | 1294 |
| 517 | Ga0373939_0000864 | 3300035114 | Bacteria | 7510 |
| 518 | Ga0373941_0002366 | 3300035115 | Bacteria | 4142 |
| 519 | Ga0373941_0010544 | 3300035115 | Bacteria | 2363 |
| 520 | Ga0373945_0012224 | 3300035116 | Bacteria | 2847 |
| 521 | Ga0373954_0005819 | 3300035118 | Bacteria | 5354 |
| 522 | Ga0373954_0011248 | 3300035118 | Bacteria | 3962 |
| 523 | Ga0373954_0023914 | 3300035118 | Bacteria | 2783 |
| 524 | Ga0373954_0132192 | 3300035118 | Bacteria | 1215 |
| 525 | Ga0373957_0011405 | 3300035120 | Bacteria | 2966 |
| 526 | Ga0373960_0013864 | 3300035121 | Bacteria | 2030 |
| 527 | Ga0373943_0108743 | 3300035170 | Bacteria | 1459 |
| 528 | Ga0373946_0003666 | 3300035171 | Bacteria | 5439 |
| 529 | Ga0373955_0000762 | 3300035172 | Bacteria | 13835 |
| 530 | Ga0373942_0003044 | 3300035207 | Bacteria | 3972 |
| 531 | Ga0373942_0081988 | 3300035207 | Bacteria | 959 |
| 532 | Ga0373961_0003482 | 3300035241 | Bacteria | 3896 |
| 533 | Ga0373962_0003932 | 3300035242 | Bacteria | 3576 |
| 534 | Ga0373924_0042212 | 3300035410 | Bacteria | 1870 |
| 535 | Ga0373924_0049076 | 3300035410 | Bacteria | 1745 |
| 536 | Ga0373931_0013105 | 3300035691 | Bacteria | 4031 |
| 537 | Ga0373931_0029721 | 3300035691 | Bacteria | 2808 |
| 538 | Ga0373931_0082737 | 3300035691 | Bacteria | 1775 |
| 539 | Ga0373931_0324496 | 3300035691 | Bacteria | 957 |
| 540 | Ga0373935_0021704 | 3300035692 | Bacteria | 3932 |
| 541 | Ga0373927_0003031 | 3300035695 | Bacteria | 12185 |
| 542 | Ga0373927_0030686 | 3300035695 | Bacteria | 3506 |
| 543 | Ga0373927_0167979 | 3300035695 | Bacteria | 1438 |
| 544 | Ga0373927_0231721 | 3300035695 | Bacteria | 1213 |
| 545 | Ga0373933_0006917 | 3300035724 | Bacteria | 6180 |
| 546 | Ga0373947_0013182 | 3300035725 | Bacteria | 4738 |
| 547 | Ga0373947_0110999 | 3300035725 | Bacteria | 1733 |
| 548 | Ga0373947_0235271 | 3300035725 | Bacteria | 1207 |
| 549 | Ga0373947_0371578 | 3300035725 | Bacteria | 962 |
| 550 | Ga0373937_0002201 | 3300036401 | Bacteria | 16290 |
| 551 | Ga0373937_0100680 | 3300036401 | Bacteria | 2681 |
| 552 | Ga0373937_0149503 | 3300036401 | Bacteria | 2187 |
| 553 | Ga0373925_0021350 | 3300037068 | Bacteria | 4716 |
| 554 | Ga0373925_0069874 | 3300037068 | Bacteria | 2653 |
| 555 | Ga0373925_0120863 | 3300037068 | Bacteria | 2033 |
| 556 | Ga0373925_0411768 | 3300037068 | Bacteria | 1103 |
| 557 | Ga0395900_0000591 | 3300037418 | Bacteria | 49743 |
| 558 | Ga0395900_0136111 | 3300037418 | Bacteria | 2517 |
| 559 | Ga0395898_0056665 | 3300037466 | Bacteria | 3820 |
| 560 | Ga0395898_0124168 | 3300037466 | Bacteria | 2473 |
| 561 | Ga0395905_0004439 | 3300037471 | Bacteria | 14583 |
| 562 | Ga0395905_0014655 | 3300037471 | Bacteria | 7478 |
| 563 | Ga0395905_0135873 | 3300037471 | Bacteria | 2313 |
| 564 | Ga0395905_0161440 | 3300037471 | Bacteria | 2106 |
| 565 | Ga0395905_0390471 | 3300037471 | Bacteria | 1286 |
| 566 | Ga0436364_0819845 | 3300037853 | Bacteria | 1080 |
| 567 | Ga0436364_1194418 | 3300037853 | Bacteria | 8223 |
| 568 | Ga0436364_1458556 | 3300037853 | Bacteria | 5936 |
| 569 | Ga0395901_0066685 | 3300038443 | Bacteria | 3749 |
| 570 | Ga0395901_0197059 | 3300038443 | Bacteria | 2112 |
| 571 | Ga0395901_0589699 | 3300038443 | Bacteria | 1122 |
| 572 | Ga0395901_0829009 | 3300038443 | Bacteria | 912 |
| 573 | Ga0436365_0156573 | 3300039437 | Bacteria | 1928 |
| 574 | Ga0436365_1283964 | 3300039437 | Bacteria | 3173 |
| 575 | Ga0436365_1447566 | 3300039437 | Bacteria | 986 |
| 576 | Ga0436361_0060531 | 3300039447 | Bacteria | 2133 |
| 577 | Ga0436363_1166084 | 3300039450 | Bacteria | 1467 |
| 578 | Ga0451841_0960603 | 3300041498 | Bacteria | 1485 |
| 579 | Ga0451853_0102419 | 3300041512 | Bacteria | 1089 |
| 580 | Ga0439441_018730 | 3300042001 | Bacteria | 1254 |
| 581 | Ga0466972_0000294 | 3300044658 | Bacteria | 30366 |
| 582 | Ga0466972_0012453 | 3300044658 | Bacteria | 4275 |
| 583 | Ga0466965_0003867 | 3300044683 | Bacteria | 6616 |
| 584 | Ga0466966_0002892 | 3300044684 | Bacteria | 11321 |
| 585 | Ga0466961_0000162 | 3300044693 | Bacteria | 45301 |
| 586 | Ga0466963_0010036 | 3300044694 | Bacteria | 5725 |
| 587 | Ga0466963_0054377 | 3300044694 | Bacteria | 2661 |
| 588 | Ga0466971_0077499 | 3300044719 | Bacteria | 1513 |
| 589 | Ga0466968_0016434 | 3300044735 | Bacteria | 2947 |
| 590 | Ga0466968_0051832 | 3300044735 | Bacteria | 1754 |
| 591 | Ga0466957_0240497 | 3300044842 | Bacteria | 1201 |
| 592 | Ga0466960_0046399 | 3300044901 | Bacteria | 2080 |
| 593 | Ga0466960_0097009 | 3300044901 | Bacteria | 1512 |
| 594 | Ga0466967_0058654 | 3300045976 | Bacteria | 3403 |
| 595 | Ga0466967_0123883 | 3300045976 | Bacteria | 2392 |
| 596 | Ga0466967_0578062 | 3300045976 | Bacteria | 1107 |
| 597 | Ga0495592_0066959 | 3300046454 | Bacteria | 2626 |
| 598 | Ga0495603_0090503 | 3300046455 | Bacteria | 1789 |
| 599 | Ga0495629_0000627 | 3300046459 | Bacteria | 28700 |
| 600 | Ga0495629_0147181 | 3300046459 | Bacteria | 1637 |
| 601 | Ga0495638_0002361 | 3300046460 | Bacteria | 15466 |
| 602 | Ga0495638_0116776 | 3300046460 | Bacteria | 1580 |
| 603 | Ga0495641_0020397 | 3300046461 | Bacteria | 3360 |
| 604 | Ga0495651_0031737 | 3300046462 | Bacteria | 4118 |
| 605 | Ga0495651_0034033 | 3300046462 | Bacteria | 3973 |
| 606 | Ga0495651_0035792 | 3300046462 | Bacteria | 3865 |
| 607 | Ga0495653_0034049 | 3300046463 | Bacteria | 4032 |
| 608 | Ga0495653_0078351 | 3300046463 | Bacteria | 2451 |
| 609 | Ga0495653_0124767 | 3300046463 | Bacteria | 1830 |
| 610 | Ga0495580_0004803 | 3300046472 | Bacteria | 11317 |
| 611 | Ga0495582_0074009 | 3300046473 | Bacteria | 1885 |
| 612 | Ga0495582_0077042 | 3300046473 | Bacteria | 1849 |
| 613 | Ga0495639_0006464 | 3300046475 | Bacteria | 5040 |
| 614 | Ga0495639_0035109 | 3300046475 | Bacteria | 2243 |
| 615 | Ga0495662_0003963 | 3300046476 | Bacteria | 7466 |
| 616 | Ga0495664_0011474 | 3300046477 | Bacteria | 4997 |
| 617 | Ga0495664_0038868 | 3300046477 | Bacteria | 2810 |
| 618 | Ga0495584_0071227 | 3300046491 | Bacteria | 1747 |
| 619 | Ga0495594_0052867 | 3300046499 | Bacteria | 2236 |
| 620 | Ga0495606_0047224 | 3300046507 | Bacteria | 2839 |
| 621 | Ga0495608_0069496 | 3300046511 | Bacteria | 2301 |
| 622 | Ga0495610_0032405 | 3300046512 | Bacteria | 2714 |
| 623 | Ga0495616_0032785 | 3300046513 | Bacteria | 2711 |
| 624 | Ga0495618_0040014 | 3300046514 | Bacteria | 2949 |
| 625 | Ga0495618_0047041 | 3300046514 | Bacteria | 2723 |
| 626 | Ga0495618_0094377 | 3300046514 | Bacteria | 1913 |
| 627 | Ga0495628_0088097 | 3300046516 | Bacteria | 2406 |
| 628 | Ga0495628_0125285 | 3300046516 | Bacteria | 1969 |
| 629 | Ga0495628_0150472 | 3300046516 | Bacteria | 1773 |
| 630 | Ga0495630_0009062 | 3300046517 | Bacteria | 7151 |
| 631 | Ga0495631_0043961 | 3300046518 | Bacteria | 1970 |
| 632 | Ga0495637_0060628 | 3300046520 | Bacteria | 1553 |
| 633 | Ga0495643_0036869 | 3300046522 | Bacteria | 2684 |
| 634 | Ga0495644_0000276 | 3300046523 | Bacteria | 23546 |
| 635 | Ga0495644_0049165 | 3300046523 | Bacteria | 1583 |
| 636 | Ga0495648_0000895 | 3300046524 | Bacteria | 31207 |
| 637 | Ga0495666_0010279 | 3300046526 | Bacteria | 4667 |
| 638 | Ga0495652_0005661 | 3300046529 | Bacteria | 11703 |
| 639 | Ga0495652_0055761 | 3300046529 | Bacteria | 3359 |
| 640 | Ga0495654_0007610 | 3300046530 | Bacteria | 6034 |
| 641 | Ga0495665_0013872 | 3300046531 | Bacteria | 4352 |
| 642 | Ga0495586_0010130 | 3300046535 | Bacteria | 5017 |
| 643 | Ga0495587_0005259 | 3300046536 | Bacteria | 8462 |
| 644 | Ga0495587_0049798 | 3300046536 | Bacteria | 2479 |
| 645 | Ga0495645_0011108 | 3300046543 | Bacteria | 6332 |
| 646 | Ga0495645_0149603 | 3300046543 | Bacteria | 1623 |
| 647 | Ga0495622_0021826 | 3300046557 | Bacteria | 2982 |
| 648 | Ga0495633_0084274 | 3300046558 | Bacteria | 1478 |
| 649 | Ga0495667_0005630 | 3300046559 | Bacteria | 8467 |
| 650 | Ga0495667_0194119 | 3300046559 | Bacteria | 1300 |
| 651 | Ga0495656_0023120 | 3300046615 | Bacteria | 2443 |
| 652 | Ga0495635_0020965 | 3300046663 | Bacteria | 4554 |
| 653 | Ga0495635_0032058 | 3300046663 | Bacteria | 3647 |
| 654 | Ga0495635_0089773 | 3300046663 | Bacteria | 2103 |
| 655 | Ga0495659_0000313 | 3300046664 | Bacteria | 19327 |
| 656 | Ga0495661_0009175 | 3300046665 | Bacteria | 6796 |
| 657 | Ga0495588_0070004 | 3300046674 | Bacteria | 1823 |
| 658 | Ga0495657_0011897 | 3300046675 | Bacteria | 6484 |
| 659 | Ga0495657_0022974 | 3300046675 | Bacteria | 4462 |
| 660 | Ga0495657_0023229 | 3300046675 | Bacteria | 4433 |
| 661 | Ga0495599_0062772 | 3300046678 | Bacteria | 2321 |
| 662 | Ga0495599_0124094 | 3300046678 | Bacteria | 1605 |
| 663 | Ga0495623_0008182 | 3300046679 | Bacteria | 6801 |
| 664 | Ga0495646_0224244 | 3300046680 | Bacteria | 1015 |
| 665 | Ga0495647_0003430 | 3300046681 | Bacteria | 5066 |
| 666 | Ga0495658_0014430 | 3300046683 | Bacteria | 4038 |
| 667 | Ga0495658_0200861 | 3300046683 | Bacteria | 1242 |
| 668 | Ga0495669_0038233 | 3300046684 | Bacteria | 2125 |
| 669 | Ga0495613_0081537 | 3300046689 | Bacteria | 2350 |
| 670 | Ga0495613_0090317 | 3300046689 | Bacteria | 2218 |
| 671 | Ga0495624_0002456 | 3300046690 | Bacteria | 14053 |
| 672 | Ga0495670_0000678 | 3300046691 | Bacteria | 16157 |
| 673 | Ga0495600_0003434 | 3300046809 | Bacteria | 9317 |
| 674 | Ga0495600_0135856 | 3300046809 | Bacteria | 1597 |
| 675 | Ga0495600_0167186 | 3300046809 | Bacteria | 1420 |
| 676 | Ga0495660_0085746 | 3300046810 | Bacteria | 1645 |
| 677 | Ga0495581_0062689 | 3300047315 | Bacteria | 2148 |
| 678 | Ga0495604_0018621 | 3300047317 | Bacteria | 5563 |
| 679 | Ga0495604_0020747 | 3300047317 | Bacteria | 5246 |
| 680 | Ga0495604_0404982 | 3300047317 | Bacteria | 898 |
| 681 | Ga0495636_0182456 | 3300047318 | Bacteria | 953 |
| 682 | Ga0495674_0050910 | 3300047319 | Bacteria | 3653 |
| 683 | Ga0495674_0207364 | 3300047319 | Bacteria | 1624 |
| 684 | Ga0495674_0542810 | 3300047319 | Bacteria | 926 |
| 685 | Ga0495672_0041646 | 3300047320 | Bacteria | 2775 |
| 686 | Ga0495672_0166336 | 3300047320 | Bacteria | 1129 |
| 687 | Ga0495676_0073035 | 3300047321 | Bacteria | 2632 |
| 688 | Ga0495676_0084461 | 3300047321 | Bacteria | 2395 |
| 689 | Ga0495680_0007610 | 3300047322 | Bacteria | 9900 |
| 690 | Ga0495680_0112151 | 3300047322 | Bacteria | 2020 |
| 691 | Ga0495680_0151914 | 3300047322 | Bacteria | 1688 |
| 692 | Ga0495683_0128522 | 3300047323 | Bacteria | 1197 |
| 693 | Ga0495687_007944 | 3300047443 | Bacteria | 6161 |
| 694 | Ga0495675_0034659 | 3300047444 | Bacteria | 3222 |
| 695 | Ga0495675_0102524 | 3300047444 | Bacteria | 1790 |
| 696 | Ga0495684_0003052 | 3300047471 | Bacteria | 13171 |
| 697 | Ga0495684_0333476 | 3300047471 | Bacteria | 1081 |
| 698 | Ga0495686_0065800 | 3300047472 | Bacteria | 2240 |
| 699 | Ga0495593_0022233 | 3300047673 | Bacteria | 3537 |
| 700 | Ga0495602_0066679 | 3300048088 | Bacteria | 3100 |
| 701 | Ga0495602_0083728 | 3300048088 | Bacteria | 2671 |
| 702 | Ga0495602_0216227 | 3300048088 | Bacteria | 1450 |
| 703 | Ga0495602_0230950 | 3300048088 | Bacteria | 1390 |
| 704 | Ga0496100_0002748 | 3300048903 | Bacteria | 8994 |
| 705 | Ga0496100_0145876 | 3300048903 | Bacteria | 1683 |
| 706 | Ga0496100_0176850 | 3300048903 | Bacteria | 1541 |
| 707 | Ga0496100_0424866 | 3300048903 | Bacteria | 1015 |
| 708 | Ga0496101_0001569 | 3300048904 | Bacteria | 13711 |
| 709 | Ga0496101_0014208 | 3300048904 | Bacteria | 5348 |
| 710 | Ga0496101_0018757 | 3300048904 | Bacteria | 4710 |
| 711 | Ga0496102_0004673 | 3300048905 | Bacteria | 11584 |
| 712 | Ga0496102_0182889 | 3300048905 | Bacteria | 1975 |
| 713 | Ga0496102_0192286 | 3300048905 | Bacteria | 1923 |
| 714 | Ga0496102_0367432 | 3300048905 | Bacteria | 1354 |
| 715 | Ga0496102_0445904 | 3300048905 | Bacteria | 1214 |
| 716 | Ga0496103_0000430 | 3300048906 | Bacteria | 36512 |
| 717 | Ga0496103_0021945 | 3300048906 | Bacteria | 3843 |
| 718 | Ga0496103_0119085 | 3300048906 | Bacteria | 1681 |
| 719 | Ga0496104_0006387 | 3300048907 | Bacteria | 10364 |
| 720 | Ga0496104_0021681 | 3300048907 | Bacteria | 5899 |
| 721 | Ga0496104_0031575 | 3300048907 | Bacteria | 4927 |
| 722 | Ga0496104_0060111 | 3300048907 | Bacteria | 3600 |
| 723 | Ga0496104_0067210 | 3300048907 | Bacteria | 3405 |
| 724 | Ga0496104_0069299 | 3300048907 | Bacteria | 3352 |
| 725 | Ga0496104_0793269 | 3300048907 | Bacteria | 853 |
| 726 | Ga0496105_0004848 | 3300048908 | Bacteria | 10161 |
| 727 | Ga0496105_0069961 | 3300048908 | Bacteria | 2901 |
| 728 | Ga0496105_0086814 | 3300048908 | Bacteria | 2585 |
| 729 | Ga0496105_0235190 | 3300048908 | Bacteria | 1488 |
| 730 | Ga0496106_0003028 | 3300048909 | Bacteria | 12522 |
| 731 | Ga0496106_0004478 | 3300048909 | Bacteria | 10360 |
| 732 | Ga0496106_0047456 | 3300048909 | Bacteria | 3232 |
| 733 | Ga0496106_0073888 | 3300048909 | Bacteria | 2609 |
| 734 | Ga0496106_0087642 | 3300048909 | Bacteria | 2399 |
| 735 | Ga0496106_0140126 | 3300048909 | Bacteria | 1902 |
| 736 | Ga0496107_0001244 | 3300048910 | Bacteria | 15566 |
| 737 | Ga0496107_0002796 | 3300048910 | Bacteria | 11515 |
| 738 | Ga0496108_0000361 | 3300048911 | Bacteria | 38318 |
| 739 | Ga0496108_0004686 | 3300048911 | Bacteria | 11026 |
| 740 | Ga0496108_0006618 | 3300048911 | Bacteria | 9394 |
| 741 | Ga0496108_0367337 | 3300048911 | Bacteria | 1256 |
| 742 | Ga0496109_0000338 | 3300048912 | Bacteria | 43692 |
| 743 | Ga0496109_0000472 | 3300048912 | Bacteria | 34231 |
| 744 | Ga0496109_0010107 | 3300048912 | Bacteria | 8050 |
| 745 | Ga0496109_0255002 | 3300048912 | Bacteria | 1652 |
| 746 | Ga0496109_0440555 | 3300048912 | Bacteria | 1231 |
| 747 | Ga0496109_0452267 | 3300048912 | Bacteria | 1213 |
| 748 | Ga0496110_0006849 | 3300048913 | Bacteria | 9056 |
| 749 | Ga0496110_0012004 | 3300048913 | Bacteria | 7117 |
| 750 | Ga0496110_0027225 | 3300048913 | Bacteria | 4900 |
| 751 | Ga0496110_0238317 | 3300048913 | Bacteria | 1655 |
| 752 | Ga0496110_0395632 | 3300048913 | Bacteria | 1260 |
| 753 | Ga0496111_0006431 | 3300048914 | Bacteria | 7627 |
| 754 | Ga0496111_0029782 | 3300048914 | Bacteria | 3878 |
| 755 | Ga0496111_0230583 | 3300048914 | Bacteria | 1375 |
| 756 | Ga0496111_0438685 | 3300048914 | Bacteria | 964 |
| 757 | Ga0496112_0000009 | 3300048915 | Bacteria | 299708 |
| 758 | Ga0496112_0005662 | 3300048915 | Bacteria | 10852 |
| 759 | Ga0496112_0020955 | 3300048915 | Bacteria | 6207 |
| 760 | Ga0496112_0104926 | 3300048915 | Bacteria | 2796 |
| 761 | Ga0496112_0181433 | 3300048915 | Bacteria | 2069 |
| 762 | Ga0496112_0472203 | 3300048915 | Bacteria | 1191 |
| 763 | Ga0496113_0073775 | 3300048916 | Bacteria | 2600 |
| 764 | Ga0496113_0645597 | 3300048916 | Bacteria | 846 |
| 765 | Ga0496114_0062621 | 3300048917 | Bacteria | 3113 |
| 766 | Ga0496114_0066111 | 3300048917 | Bacteria | 3031 |
| 767 | Ga0496114_0183089 | 3300048917 | Bacteria | 1830 |
| 768 | Ga0496115_0001318 | 3300048918 | Bacteria | 17694 |
| 769 | Ga0496115_0059727 | 3300048918 | Bacteria | 3071 |
| 770 | Ga0496115_0262069 | 3300048918 | Bacteria | 1421 |
| 771 | Ga0496116_0019506 | 3300048919 | Bacteria | 5191 |
| 772 | Ga0496117_0074133 | 3300048920 | Bacteria | 2267 |
| 773 | Ga0496118_0019231 | 3300048921 | Bacteria | 6113 |
| 774 | Ga0496118_0074493 | 3300048921 | Bacteria | 2426 |
| 775 | Ga0496118_0112978 | 3300048921 | Bacteria | 1796 |
| 776 | Ga0496119_0056442 | 3300048922 | Bacteria | 2379 |
| 777 | Ga0496120_0008796 | 3300048923 | Bacteria | 7255 |
| 778 | Ga0496121_0000612 | 3300048924 | Bacteria | 66397 |
| 779 | Ga0496121_0022465 | 3300048924 | Bacteria | 6121 |
| 780 | Ga0496121_0023184 | 3300048924 | Bacteria | 5991 |
| 781 | Ga0496121_0030905 | 3300048924 | Bacteria | 4908 |
| 782 | Ga0496121_0050546 | 3300048924 | Bacteria | 3510 |
| 783 | Ga0496121_0064765 | 3300048924 | Bacteria | 2978 |
| 784 | Ga0496121_0083331 | 3300048924 | Bacteria | 2525 |
| 785 | Ga0496121_0118725 | 3300048924 | Bacteria | 2001 |
| 786 | Ga0496122_0047391 | 3300048925 | Bacteria | 3318 |
| 787 | Ga0496123_0008887 | 3300048926 | Bacteria | 9142 |
| 788 | Ga0496123_0158750 | 3300048926 | Bacteria | 1209 |
| 789 | Ga0496124_0200749 | 3300048927 | Bacteria | 1517 |
| 790 | Ga0496124_0226789 | 3300048927 | Bacteria | 1400 |
| 791 | Ga0496125_0000210 | 3300048928 | Bacteria | 121786 |
| 792 | Ga0496125_0003330 | 3300048928 | Bacteria | 19623 |
| 793 | Ga0496126_0026422 | 3300048929 | Bacteria | 5567 |
| 794 | Ga0496126_0146656 | 3300048929 | Bacteria | 2026 |
| 795 | Ga0495682_0048436 | 3300049460 | Bacteria | 1549 |
| 796 | Ga0501031_0025851 | 3300049568 | Bacteria | 3830 |
| 797 | Ga0501031_0134983 | 3300049568 | Bacteria | 1612 |
| 798 | Ga0501032_0018148 | 3300049569 | Bacteria | 4930 |
| 799 | Ga0501032_0035590 | 3300049569 | Bacteria | 3402 |
| 800 | Ga0501032_0041769 | 3300049569 | Bacteria | 3113 |
| 801 | Ga0501032_0067784 | 3300049569 | Bacteria | 2383 |
| 802 | Ga0501033_0009909 | 3300049570 | Bacteria | 7316 |
| 803 | Ga0501033_0042302 | 3300049570 | Bacteria | 3397 |
| 804 | Ga0501033_0095101 | 3300049570 | Bacteria | 2177 |
| 805 | Ga0501033_0187643 | 3300049570 | Bacteria | 1480 |
| 806 | Ga0501034_0002596 | 3300049571 | Bacteria | 21476 |
| 807 | Ga0501034_0009783 | 3300049571 | Bacteria | 10027 |
| 808 | Ga0501034_0097324 | 3300049571 | Bacteria | 2938 |
| 809 | Ga0501034_0099411 | 3300049571 | Bacteria | 2904 |
| 810 | Ga0501034_0110532 | 3300049571 | Bacteria | 2739 |
| 811 | Ga0501034_0117993 | 3300049571 | Bacteria | 2641 |
| 812 | Ga0501034_0144486 | 3300049571 | Bacteria | 2357 |
| 813 | Ga0501034_0273017 | 3300049571 | Bacteria | 1631 |
| 814 | Ga0501034_0516556 | 3300049571 | Bacteria | 1107 |
| 815 | Ga0501034_0916204 | 3300049571 | Bacteria | 764 |
| 816 | Ga0501036_0001532 | 3300049572 | Bacteria | 17851 |
| 817 | Ga0501036_0050872 | 3300049572 | Bacteria | 3508 |
| 818 | Ga0501036_0058130 | 3300049572 | Bacteria | 3276 |
| 819 | Ga0501036_0207410 | 3300049572 | Bacteria | 1647 |
| 820 | Ga0501037_0013311 | 3300049573 | Bacteria | 6062 |
| 821 | Ga0501037_0025878 | 3300049573 | Bacteria | 4333 |
| 822 | Ga0501037_0081305 | 3300049573 | Bacteria | 2349 |
| 823 | Ga0501037_0147553 | 3300049573 | Bacteria | 1682 |
| 824 | Ga0501037_0311244 | 3300049573 | Bacteria | 1092 |
| 825 | Ga0501038_0010082 | 3300049574 | Bacteria | 8651 |
| 826 | Ga0501038_0012938 | 3300049574 | Bacteria | 7612 |
| 827 | Ga0501038_0038331 | 3300049574 | Bacteria | 4197 |
| 828 | Ga0501038_0108288 | 3300049574 | Bacteria | 2304 |
| 829 | Ga0501038_0224258 | 3300049574 | Bacteria | 1498 |
| 830 | Ga0501038_0231496 | 3300049574 | Bacteria | 1470 |
| 831 | Ga0501038_0270661 | 3300049574 | Bacteria | 1339 |
| 832 | Ga0501039_0035803 | 3300049575 | Bacteria | 3831 |
| 833 | Ga0501039_0040108 | 3300049575 | Bacteria | 3615 |
| 834 | Ga0501039_0056584 | 3300049575 | Bacteria | 3038 |
| 835 | Ga0501039_0226396 | 3300049575 | Bacteria | 1470 |
| 836 | Ga0501040_0107057 | 3300049576 | Bacteria | 1954 |
| 837 | Ga0501042_0025312 | 3300049578 | Bacteria | 4167 |
| 838 | Ga0501043_0002556 | 3300049579 | Bacteria | 15379 |
| 839 | Ga0501043_0009082 | 3300049579 | Bacteria | 7820 |
| 840 | Ga0501043_0094198 | 3300049579 | Bacteria | 2354 |
| 841 | Ga0501043_0109394 | 3300049579 | Bacteria | 2170 |
| 842 | Ga0501043_0191030 | 3300049579 | Bacteria | 1592 |
| 843 | Ga0501046_0004314 | 3300049580 | Bacteria | 12941 |
| 844 | Ga0501046_0012848 | 3300049580 | Bacteria | 7122 |
| 845 | Ga0501046_0014686 | 3300049580 | Bacteria | 6595 |
| 846 | Ga0501046_0061399 | 3300049580 | Bacteria | 2939 |
| 847 | Ga0501046_0122369 | 3300049580 | Bacteria | 1979 |
| 848 | Ga0501046_0364972 | 3300049580 | Bacteria | 1047 |
| 849 | Ga0501046_0562744 | 3300049580 | Bacteria | 812 |
| 850 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 851 | Ga0501047_0023438 | 3300049581 | Bacteria | 5925 |
| 852 | Ga0501047_0061353 | 3300049581 | Bacteria | 3628 |
| 853 | Ga0501047_0067292 | 3300049581 | Bacteria | 3452 |
| 854 | Ga0501047_0085578 | 3300049581 | Bacteria | 3029 |
| 855 | Ga0501048_0000552 | 3300049582 | Bacteria | 26436 |
| 856 | Ga0501048_0045728 | 3300049582 | Bacteria | 3126 |
| 857 | Ga0501048_0050197 | 3300049582 | Bacteria | 2971 |
| 858 | Ga0501067_0008523 | 3300049583 | Bacteria | 5685 |
| 859 | Ga0501068_0009795 | 3300049584 | Bacteria | 5368 |
| 860 | Ga0501068_0062319 | 3300049584 | Bacteria | 2267 |
| 861 | Ga0501069_0013334 | 3300049585 | Bacteria | 4382 |
| 862 | Ga0501070_0001743 | 3300049586 | Bacteria | 19221 |
| 863 | Ga0501070_0005586 | 3300049586 | Bacteria | 10729 |
| 864 | Ga0501070_0019942 | 3300049586 | Bacteria | 5622 |
| 865 | Ga0501070_0028771 | 3300049586 | Bacteria | 4658 |
| 866 | Ga0501070_0043035 | 3300049586 | Bacteria | 3759 |
| 867 | Ga0501070_0059296 | 3300049586 | Bacteria | 3173 |
| 868 | Ga0501070_0095010 | 3300049586 | Bacteria | 2467 |
| 869 | Ga0501070_0114425 | 3300049586 | Bacteria | 2228 |
| 870 | Ga0501070_0306670 | 3300049586 | Bacteria | 1292 |
| 871 | Ga0501072_0051161 | 3300049588 | Bacteria | 3253 |
| 872 | Ga0501073_0004769 | 3300049589 | Bacteria | 10177 |
| 873 | Ga0501073_0113684 | 3300049589 | Bacteria | 1877 |
| 874 | Ga0501073_0264887 | 3300049589 | Bacteria | 1186 |
| 875 | Ga0501074_0006720 | 3300049590 | Bacteria | 8296 |
| 876 | Ga0501074_0033032 | 3300049590 | Bacteria | 3750 |
| 877 | Ga0501075_0253713 | 3300049591 | Bacteria | 1341 |
| 878 | Ga0501075_0294180 | 3300049591 | Bacteria | 1237 |
| 879 | Ga0501076_0329261 | 3300049592 | Bacteria | 1253 |
| 880 | Ga0501079_0029988 | 3300049741 | Bacteria | 4178 |
| 881 | Ga0501080_0000234 | 3300049742 | Bacteria | 41793 |
| 882 | Ga0501080_0007431 | 3300049742 | Bacteria | 9890 |
| 883 | Ga0501080_0079884 | 3300049742 | Bacteria | 3040 |
| 884 | Ga0501080_0120298 | 3300049742 | Bacteria | 2434 |
| 885 | Ga0501080_0144297 | 3300049742 | Bacteria | 2200 |
| 886 | Ga0501080_0411693 | 3300049742 | Bacteria | 1215 |
| 887 | Ga0501083_0000533 | 3300049744 | Bacteria | 24315 |
| 888 | Ga0501083_0006493 | 3300049744 | Bacteria | 8293 |
| 889 | Ga0501035_0000654 | 3300049822 | Bacteria | 38184 |
| 890 | Ga0501035_0028842 | 3300049822 | Bacteria | 5063 |
| 891 | Ga0501035_0062938 | 3300049822 | Bacteria | 3300 |
| 892 | Ga0501035_0104058 | 3300049822 | Bacteria | 2489 |
| 893 | Ga0501035_0185598 | 3300049822 | Bacteria | 1790 |
| 894 | Ga0501035_0566022 | 3300049822 | Bacteria | 929 |
| 895 | Ga0501044_0004701 | 3300049823 | Bacteria | 15268 |
| 896 | Ga0501044_0010554 | 3300049823 | Bacteria | 10019 |
| 897 | Ga0501044_0012179 | 3300049823 | Bacteria | 9312 |
| 898 | Ga0501044_0114713 | 3300049823 | Bacteria | 2699 |
| 899 | Ga0501044_0124616 | 3300049823 | Bacteria | 2574 |
| 900 | Ga0501044_0216259 | 3300049823 | Bacteria | 1868 |
| 901 | Ga0501044_0218398 | 3300049823 | Bacteria | 1857 |
| 902 | Ga0501044_0245460 | 3300049823 | Bacteria | 1733 |
| 903 | Ga0501044_0270853 | 3300049823 | Bacteria | 1634 |
| 904 | Ga0501044_0281587 | 3300049823 | Bacteria | 1596 |
| 905 | Ga0501044_0492650 | 3300049823 | Bacteria | 1127 |
| 906 | Ga0501045_0031320 | 3300049824 | Bacteria | 3852 |
| 907 | Ga0501045_0301716 | 3300049824 | Bacteria | 1192 |
| 908 | nmdc:mga03683_35613_c1 | 3300050489 | Bacteria | 2019 |
| 909 | nmdc:mga03n38_115705_c1 | 3300050490 | Bacteria | 1312 |
| 910 | nmdc:mga03n38_44987_c1 | 3300050490 | Bacteria | 1942 |
| 911 | nmdc:mga0yw44_131765_c1 | 3300050492 | Bacteria | 1619 |
| 912 | nmdc:mga0yw44_329581_c1 | 3300050492 | Bacteria | 1026 |
| 913 | nmdc:mga0yw44_59540_c1 | 3300050492 | Bacteria | 2337 |
| 914 | nmdc:mga0yw44_93104_c1 | 3300050492 | Bacteria | 1908 |
| 915 | nmdc:mga0k408_128597_c1 | 3300050493 | Bacteria | 1503 |
| 916 | nmdc:mga0k408_50698_c1 | 3300050493 | Bacteria | 2403 |
| 917 | nmdc:mga0k408_62477_c1 | 3300050493 | Bacteria | 2166 |
| 918 | nmdc:mga06z11_293043_c1 | 3300050494 | Bacteria | 966 |
| 919 | nmdc:mga04h51_126760_c1 | 3300050495 | Bacteria | 956 |
| 920 | nmdc:mga07m45_42634_c1 | 3300050496 | Bacteria | 2544 |
| 921 | nmdc:mga05p37_14_c1 | 3300050507 | Bacteria | 137209 |
| 922 | nmdc:mga05p37_1602_c1 | 3300050507 | Bacteria | 26254 |
| 923 | nmdc:mga05p37_7455_c1 | 3300050507 | Bacteria | 12899 |
| 924 | nmdc:mga09592_266882_c1 | 3300050508 | Bacteria | 1485 |
| 925 | nmdc:mga0qj67_556_c1 | 3300050509 | Bacteria | 25387 |
| 926 | nmdc:mga0qj67_6499_c1 | 3300050509 | Bacteria | 8592 |
| 927 | nmdc:mga06r32_1042_c1 | 3300050510 | Bacteria | 25028 |
| 928 | nmdc:mga06r32_4708_c1 | 3300050510 | Bacteria | 12267 |
| 929 | nmdc:mga08y16_2015_c1 | 3300050511 | Bacteria | 20774 |
| 930 | nmdc:mga08y16_412_c1 | 3300050511 | Bacteria | 39249 |
| 931 | nmdc:mga08y16_4650_c1 | 3300050511 | Bacteria | 14290 |
| 932 | nmdc:mga08y16_58619_c1 | 3300050511 | Bacteria | 4023 |
| 933 | nmdc:mga0n895_115319_c1 | 3300050512 | Bacteria | 2705 |
| 934 | nmdc:mga0n895_1478_c1 | 3300050512 | Bacteria | 17626 |
| 935 | nmdc:mga0n895_4804_c1 | 3300050512 | Bacteria | 11185 |
| 936 | nmdc:mga0n895_543_c1 | 3300050512 | Bacteria | 25826 |
| 937 | nmdc:mga0n895_56244_c1 | 3300050512 | Bacteria | 3875 |
| 938 | nmdc:mga0n895_79859_c1 | 3300050512 | Bacteria | 3258 |
| 939 | nmdc:mga0rr50_112178_c2 | 3300050513 | Bacteria | 1698 |
| 940 | nmdc:mga0rr50_296228_c1 | 3300050513 | Bacteria | 1352 |
| 941 | nmdc:mga0rr50_32680_c1 | 3300050513 | Bacteria | 3710 |
| 942 | nmdc:mga0rr50_69644_c1 | 3300050513 | Bacteria | 2678 |
| 943 | nmdc:mga08x19_111865_c1 | 3300050514 | Bacteria | 1822 |
| 944 | nmdc:mga08x19_207846_c1 | 3300050514 | Bacteria | 1343 |
| 945 | nmdc:mga0a205_114547_c1 | 3300050515 | Bacteria | 2595 |
| 946 | nmdc:mga0a205_20418_c1 | 3300050515 | Bacteria | 6248 |
| 947 | nmdc:mga0a205_416_c1 | 3300050515 | Bacteria | 32776 |
| 948 | nmdc:mga0a205_8969_c1 | 3300050515 | Bacteria | 9116 |
| 949 | nmdc:mga0sz30_223763_c1 | 3300050516 | Bacteria | 837 |
| 950 | nmdc:mga0sz30_32769_c1 | 3300050516 | Bacteria | 2156 |
| 951 | nmdc:mga0sz30_67242_c1 | 3300050516 | Bacteria | 1539 |
| 952 | Ga0495601_0003588 | 3300053077 | Bacteria | 8925 |
| 953 | Ga0495601_0122219 | 3300053077 | Bacteria | 1691 |
| 954 | Ga0495612_0004411 | 3300053078 | Bacteria | 5837 |
| 955 | Ga0495612_0041489 | 3300053078 | Bacteria | 1877 |
| 956 | Ga0495595_0001441 | 3300053084 | Bacteria | 9267 |
| 957 | Ga0495595_0094474 | 3300053084 | Bacteria | 1437 |
| 958 | Ga0495619_0004134 | 3300053085 | Bacteria | 9276 |
| 959 | Ga0495619_0053413 | 3300053085 | Bacteria | 2673 |
| 960 | Ga0495619_0065872 | 3300053085 | Bacteria | 2417 |
| 961 | Ga0495619_0292412 | 3300053085 | Bacteria | 1128 |
| 962 | Ga0500643_000116 | 3300053087 | Bacteria | 83687 |
| 963 | Ga0500643_018322 | 3300053087 | Bacteria | 2326 |
| 964 | Ga0500646_0002674 | 3300053090 | Bacteria | 4605 |
| 965 | Ga0500647_0070088 | 3300053091 | Bacteria | 1686 |
| 966 | Ga0500566_0000050 | 3300053094 | Bacteria | 57809 |
| 967 | Ga0500566_0004414 | 3300053094 | Bacteria | 8399 |
| 968 | Ga0500566_0011997 | 3300053094 | Bacteria | 5102 |
| 969 | Ga0500640_045381 | 3300053095 | Bacteria | 1927 |
| 970 | Ga0500641_0075214 | 3300053096 | Bacteria | 1427 |
| 971 | Ga0500650_0001293 | 3300053098 | Bacteria | 7414 |
| 972 | Ga0500555_001167 | 3300053103 | Bacteria | 8624 |
| 973 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 974 | Ga0500557_000061 | 3300053105 | Bacteria | 44319 |
| 975 | Ga0500562_007630 | 3300053108 | Bacteria | 2728 |
| 976 | Ga0500562_012973 | 3300053108 | Bacteria | 2122 |
| 977 | Ga0500569_018498 | 3300053109 | Bacteria | 1800 |
| 978 | Ga0500569_022053 | 3300053109 | Bacteria | 1691 |
| 979 | Ga0500569_065389 | 3300053109 | Bacteria | 1132 |
| 980 | Ga0500572_000033 | 3300053111 | Bacteria | 43170 |
| 981 | Ga0500572_000604 | 3300053111 | Bacteria | 12092 |
| 982 | Ga0500572_007763 | 3300053111 | Bacteria | 2491 |
| 983 | Ga0500592_000901 | 3300053116 | Bacteria | 4852 |
| 984 | Ga0500595_003180 | 3300053119 | Bacteria | 7773 |
| 985 | Ga0500595_013385 | 3300053119 | Bacteria | 3144 |
| 986 | Ga0500595_028988 | 3300053119 | Bacteria | 1882 |
| 987 | Ga0500607_185278 | 3300053121 | Bacteria | 917 |
| 988 | Ga0500608_005836 | 3300053122 | Bacteria | 4939 |
| 989 | Ga0500614_000469 | 3300053123 | Bacteria | 10467 |
| 990 | Ga0500618_006905 | 3300053125 | Bacteria | 3287 |
| 991 | Ga0500618_009795 | 3300053125 | Bacteria | 2603 |
| 992 | Ga0500642_0000010 | 3300053130 | Bacteria | 272552 |
| 993 | Ga0500642_0000098 | 3300053130 | Bacteria | 42383 |
| 994 | Ga0500652_000817 | 3300053131 | Bacteria | 10418 |
| 995 | Ga0500559_0000142 | 3300053136 | Bacteria | 55814 |
| 996 | Ga0500559_0000638 | 3300053136 | Bacteria | 23672 |
| 997 | Ga0500559_0008402 | 3300053136 | Bacteria | 4525 |
| 998 | Ga0500559_0039339 | 3300053136 | Bacteria | 2056 |
| 999 | Ga0500564_115762 | 3300053138 | Bacteria | 1172 |
| 1000 | Ga0500568_0000427 | 3300053139 | Bacteria | 31670 |
| 1001 | Ga0500568_0003430 | 3300053139 | Bacteria | 8838 |
| 1002 | Ga0500577_0000228 | 3300053142 | Bacteria | 14932 |
| 1003 | Ga0500577_0008280 | 3300053142 | Bacteria | 2958 |
| 1004 | Ga0500586_000703 | 3300053145 | Bacteria | 6870 |
| 1005 | Ga0500603_000424 | 3300053150 | Bacteria | 10966 |
| 1006 | Ga0500604_0006917 | 3300053151 | Bacteria | 3002 |
| 1007 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 1008 | Ga0500616_0007910 | 3300053153 | Bacteria | 6679 |
| 1009 | Ga0500620_025463 | 3300053155 | Bacteria | 1821 |
| 1010 | Ga0500622_0013995 | 3300053156 | Bacteria | 4313 |
| 1011 | Ga0500622_0014627 | 3300053156 | Bacteria | 4208 |
| 1012 | Ga0500627_0001120 | 3300053158 | Bacteria | 7332 |
| 1013 | Ga0500627_0014445 | 3300053158 | Bacteria | 3026 |
| 1014 | Ga0500630_000093 | 3300053159 | Bacteria | 28275 |
| 1015 | Ga0500633_0017870 | 3300053160 | Bacteria | 2090 |
| 1016 | Ga0500634_0031198 | 3300053161 | Bacteria | 2906 |
| 1017 | Ga0500639_000032 | 3300053163 | Bacteria | 69113 |
| 1018 | Ga0500639_012938 | 3300053163 | Bacteria | 4383 |
| 1019 | Ga0500639_092921 | 3300053163 | Bacteria | 1499 |
| 1020 | Ga0500636_0000468 | 3300053177 | Bacteria | 21977 |
| 1021 | Ga0500636_0025189 | 3300053177 | Bacteria | 3515 |
| 1022 | Ga0500636_0025635 | 3300053177 | Bacteria | 3485 |
| 1023 | Ga0500637_0013736 | 3300053178 | Bacteria | 4256 |
| 1024 | Ga0500637_0053774 | 3300053178 | Bacteria | 2299 |
| 1025 | Ga0500637_0101554 | 3300053178 | Bacteria | 1668 |
| 1026 | Ga0500625_016887 | 3300053729 | Bacteria | 3406 |
| 1027 | Ga0500596_000019 | 3300053735 | Bacteria | 23095 |
| 1028 | Ga0500599_000994 | 3300053736 | Bacteria | 3172 |
| 1029 | Ga0500601_000104 | 3300053737 | Bacteria | 17603 |
| 1030 | Ga0500601_001797 | 3300053737 | Bacteria | 2304 |
| 1031 | Ga0501084_0057365 | 3300054114 | Bacteria | 3259 |
| 1032 | Ga0501084_0346575 | 3300054114 | Bacteria | 1255 |
| 1033 | Ga0501082_0009365 | 3300060353 | Bacteria | 8440 |
| 1034 | Ga0501082_0479731 | 3300060353 | Bacteria | 1087 |
| 1035 | Ga0466962_0167636 | 3300061719 | Bacteria | 1069 |
| 1036 | Ga0530510_0325065 | 3300061734 | Bacteria | 1153 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016566248 | 8016573789 | 219 |
| 2 | 3300035113 | Ga0373936_0088802 | Ga0373936_0088802_26_793 | 222 |
| 3 | 3300048923 | Ga0496120_0008796 | Ga0496120_0008796_6456_7229 | 222 |
| 4 | 3300049571 | Ga0501034_0916204 | Ga0501034_0916204_11_739 | 222 |
| 5 | 3300049580 | Ga0501046_0562744 | Ga0501046_0562744_17_748 | 222 |
| 6 | 3300049591 | Ga0501075_0253713 | Ga0501075_0253713_13_720 | 222 |
| 7 | 3300035725 | Ga0373947_0013182 | Ga0373947_0013182_2519_3337 | 224 |
| 8 | 3300037068 | Ga0373925_0120863 | Ga0373925_0120863_762_1580 | 224 |
| 9 | 3300025898 | Ga0207692_10134914 | Ga0207692_101349142 | 227 |
| 10 | 3300006048 | Ga0075363_100052433 | Ga0075363_1000524333 | 230 |
| 11 | 3300006178 | Ga0075367_10108150 | Ga0075367_101081502 | 230 |
| 12 | 3300006353 | Ga0075370_10047118 | Ga0075370_100471182 | 230 |
| 13 | 3300006871 | Ga0075434_100377177 | Ga0075434_1003771772 | 230 |
| 14 | 3300014326 | Ga0157380_10232005 | Ga0157380_102320051 | 230 |
| 15 | 3300050490 | nmdc:mga03n38_44987_c1 | nmdc:mga03n38_44987_c1_659_1474 | 230 |
| 16 | 3300050512 | nmdc:mga0n895_56244_c1 | nmdc:mga0n895_56244_c1_478_1287 | 230 |
| 17 | 3300050513 | nmdc:mga0rr50_32680_c1 | nmdc:mga0rr50_32680_c1_32_841 | 230 |
| 18 | 3300050514 | nmdc:mga08x19_111865_c1 | nmdc:mga08x19_111865_c1_446_1255 | 230 |
| 19 | 3300048924 | Ga0496121_0030905 | Ga0496121_0030905_3136_3945 | 231 |
| 20 | 3300006195 | Ga0075366_10029327 | Ga0075366_100293272 | 232 |
| 21 | 3300049580 | Ga0501046_0122369 | Ga0501046_0122369_592_1413 | 232 |
| 22 | 3300050493 | nmdc:mga0k408_50698_c1 | nmdc:mga0k408_50698_c1_1400_2209 | 232 |
| 23 | 3300005337 | Ga0070682_100125083 | Ga0070682_1001250832 | 233 |
| 24 | 3300005458 | Ga0070681_10019499 | Ga0070681_100194997 | 233 |
| 25 | 3300005530 | Ga0070679_100024249 | Ga0070679_1000242493 | 233 |
| 26 | 3300025912 | Ga0207707_10000311 | Ga0207707_1000031111 | 233 |
| 27 | 3300025917 | Ga0207660_10037039 | Ga0207660_100370393 | 233 |
| 28 | 3300025921 | Ga0207652_10017328 | Ga0207652_100173284 | 233 |
| 29 | 3300005530 | Ga0070679_100113511 | Ga0070679_1001135114 | 234 |
| 30 | 3300009093 | Ga0105240_10583553 | Ga0105240_105835532 | 234 |
| 31 | 3300025921 | Ga0207652_10490708 | Ga0207652_104907082 | 234 |
| 32 | 3300048909 | Ga0496106_0140126 | Ga0496106_0140126_15_824 | 234 |
| 33 | 3300048928 | Ga0496125_0000210 | Ga0496125_0000210_107997_108818 | 234 |
| 34 | 3300049823 | Ga0501044_0270853 | Ga0501044_0270853_727_1545 | 234 |
| 35 | 3300053119 | Ga0500595_003180 | Ga0500595_003180_302_1120 | 234 |
| 36 | 3300005937 | Ga0081455_10014064 | Ga0081455_100140642 | 235 |
| 37 | 3300005983 | Ga0081540_1078879 | Ga0081540_10788792 | 235 |
| 38 | 3300006881 | Ga0068865_100284929 | Ga0068865_1002849292 | 235 |
| 39 | 3300007788 | Ga0099795_10028564 | Ga0099795_100285642 | 235 |
| 40 | 3300009093 | Ga0105240_10292421 | Ga0105240_102924212 | 235 |
| 41 | 3300025911 | Ga0207654_10233559 | Ga0207654_102335592 | 235 |
| 42 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015657 | 235 |
| 43 | 3300045976 | Ga0466967_0578062 | Ga0466967_0578062_231_1040 | 235 |
| 44 | 3300046459 | Ga0495629_0000627 | Ga0495629_0000627_345_1157 | 235 |
| 45 | 3300046462 | Ga0495651_0031737 | Ga0495651_0031737_2463_3269 | 235 |
| 46 | 3300046462 | Ga0495651_0034033 | Ga0495651_0034033_36_848 | 235 |
| 47 | 3300046463 | Ga0495653_0078351 | Ga0495653_0078351_354_1160 | 235 |
| 48 | 3300046477 | Ga0495664_0038868 | Ga0495664_0038868_481_1287 | 235 |
| 49 | 3300046507 | Ga0495606_0047224 | Ga0495606_0047224_916_1728 | 235 |
| 50 | 3300046514 | Ga0495618_0094377 | Ga0495618_0094377_920_1732 | 235 |
| 51 | 3300046516 | Ga0495628_0125285 | Ga0495628_0125285_351_1157 | 235 |
| 52 | 3300046529 | Ga0495652_0005661 | Ga0495652_0005661_10744_11550 | 235 |
| 53 | 3300046543 | Ga0495645_0149603 | Ga0495645_0149603_518_1324 | 235 |
| 54 | 3300046663 | Ga0495635_0089773 | Ga0495635_0089773_1010_1822 | 235 |
| 55 | 3300046675 | Ga0495657_0011897 | Ga0495657_0011897_4112_4918 | 235 |
| 56 | 3300046675 | Ga0495657_0023229 | Ga0495657_0023229_1130_1942 | 235 |
| 57 | 3300046678 | Ga0495599_0124094 | Ga0495599_0124094_597_1403 | 235 |
| 58 | 3300046679 | Ga0495623_0008182 | Ga0495623_0008182_3080_3886 | 235 |
| 59 | 3300046680 | Ga0495646_0224244 | Ga0495646_0224244_114_926 | 235 |
| 60 | 3300046689 | Ga0495613_0081537 | Ga0495613_0081537_1324_2136 | 235 |
| 61 | 3300046809 | Ga0495600_0135856 | Ga0495600_0135856_457_1269 | 235 |
| 62 | 3300046809 | Ga0495600_0167186 | Ga0495600_0167186_193_999 | 235 |
| 63 | 3300047317 | Ga0495604_0020747 | Ga0495604_0020747_3292_4104 | 235 |
| 64 | 3300047319 | Ga0495674_0542810 | Ga0495674_0542810_102_908 | 235 |
| 65 | 3300047320 | Ga0495672_0166336 | Ga0495672_0166336_22_834 | 235 |
| 66 | 3300047321 | Ga0495676_0073035 | Ga0495676_0073035_202_1014 | 235 |
| 67 | 3300047323 | Ga0495683_0128522 | Ga0495683_0128522_11_823 | 235 |
| 68 | 3300048088 | Ga0495602_0066679 | Ga0495602_0066679_788_1600 | 235 |
| 69 | 3300048088 | Ga0495602_0216227 | Ga0495602_0216227_394_1200 | 235 |
| 70 | 3300048907 | Ga0496104_0006387 | Ga0496104_0006387_452_1264 | 235 |
| 71 | 3300048908 | Ga0496105_0004848 | Ga0496105_0004848_3364_4176 | 235 |
| 72 | 3300048915 | Ga0496112_0000009 | Ga0496112_0000009_120264_121079 | 235 |
| 73 | 3300048916 | Ga0496113_0645597 | Ga0496113_0645597_18_830 | 235 |
| 74 | 3300048917 | Ga0496114_0183089 | Ga0496114_0183089_865_1677 | 235 |
| 75 | 3300048922 | Ga0496119_0056442 | Ga0496119_0056442_1132_1944 | 235 |
| 76 | 3300048927 | Ga0496124_0200749 | Ga0496124_0200749_201_1013 | 235 |
| 77 | 3300049460 | Ga0495682_0048436 | Ga0495682_0048436_163_975 | 235 |
| 78 | 3300049568 | Ga0501031_0025851 | Ga0501031_0025851_376_1215 | 235 |
| 79 | 3300049569 | Ga0501032_0035590 | Ga0501032_0035590_1742_2581 | 235 |
| 80 | 3300049570 | Ga0501033_0009909 | Ga0501033_0009909_5656_6495 | 235 |
| 81 | 3300049571 | Ga0501034_0009783 | Ga0501034_0009783_2972_3811 | 235 |
| 82 | 3300049573 | Ga0501037_0081305 | Ga0501037_0081305_719_1558 | 235 |
| 83 | 3300049574 | Ga0501038_0010082 | Ga0501038_0010082_5656_6495 | 235 |
| 84 | 3300049575 | Ga0501039_0035803 | Ga0501039_0035803_2981_3820 | 235 |
| 85 | 3300049579 | Ga0501043_0009082 | Ga0501043_0009082_1426_2265 | 235 |
| 86 | 3300049580 | Ga0501046_0004314 | Ga0501046_0004314_1988_2827 | 235 |
| 87 | 3300049581 | Ga0501047_0023438 | Ga0501047_0023438_2854_3693 | 235 |
| 88 | 3300049582 | Ga0501048_0045728 | Ga0501048_0045728_574_1413 | 235 |
| 89 | 3300049583 | Ga0501067_0008523 | Ga0501067_0008523_629_1468 | 235 |
| 90 | 3300049584 | Ga0501068_0009795 | Ga0501068_0009795_3566_4405 | 235 |
| 91 | 3300049586 | Ga0501070_0028771 | Ga0501070_0028771_3100_3939 | 235 |
| 92 | 3300049589 | Ga0501073_0004769 | Ga0501073_0004769_4726_5565 | 235 |
| 93 | 3300049590 | Ga0501074_0006720 | Ga0501074_0006720_6217_7056 | 235 |
| 94 | 3300049742 | Ga0501080_0144297 | Ga0501080_0144297_720_1559 | 235 |
| 95 | 3300049744 | Ga0501083_0006493 | Ga0501083_0006493_6994_7833 | 235 |
| 96 | 3300049822 | Ga0501035_0062938 | Ga0501035_0062938_720_1559 | 235 |
| 97 | 3300049823 | Ga0501044_0004701 | Ga0501044_0004701_11081_11920 | 235 |
| 98 | 3300049824 | Ga0501045_0031320 | Ga0501045_0031320_492_1331 | 235 |
| 99 | 3300053085 | Ga0495619_0053413 | Ga0495619_0053413_1782_2594 | 235 |
| 100 | 3300053094 | Ga0500566_0000050 | Ga0500566_0000050_20399_21205 | 235 |
| 101 | 3300053111 | Ga0500572_000033 | Ga0500572_000033_32825_33631 | 235 |
| 102 | 3300053111 | Ga0500572_000604 | Ga0500572_000604_5324_6130 | 235 |
| 103 | 3300053119 | Ga0500595_013385 | Ga0500595_013385_1981_2793 | 235 |
| 104 | 3300053123 | Ga0500614_000469 | Ga0500614_000469_2379_3185 | 235 |
| 105 | 3300053136 | Ga0500559_0000142 | Ga0500559_0000142_23426_24232 | 235 |
| 106 | 3300053136 | Ga0500559_0008402 | Ga0500559_0008402_2787_3593 | 235 |
| 107 | 3300053150 | Ga0500603_000424 | Ga0500603_000424_3393_4199 | 235 |
| 108 | 3300053159 | Ga0500630_000093 | Ga0500630_000093_13699_14505 | 235 |
| 109 | 3300053163 | Ga0500639_000032 | Ga0500639_000032_27776_28582 | 235 |
| 110 | 3300053163 | Ga0500639_012938 | Ga0500639_012938_170_976 | 235 |
| 111 | 3300053178 | Ga0500637_0013736 | Ga0500637_0013736_2553_3359 | 235 |
| 112 | 3300053735 | Ga0500596_000019 | Ga0500596_000019_2785_3591 | 235 |
| 113 | 3300053737 | Ga0500601_001797 | Ga0500601_001797_911_1717 | 235 |
| 114 | 3300054114 | Ga0501084_0057365 | Ga0501084_0057365_2284_3123 | 235 |
| 115 | 3300060353 | Ga0501082_0009365 | Ga0501082_0009365_7345_8184 | 235 |
| 116 | 3300005539 | Ga0068853_100220550 | Ga0068853_1002205502 | 236 |
| 117 | 3300005842 | Ga0068858_100303146 | Ga0068858_1003031462 | 236 |
| 118 | 3300005985 | Ga0081539_10000379 | Ga0081539_1000037973 | 236 |
| 119 | 3300009177 | Ga0105248_10140778 | Ga0105248_101407782 | 236 |
| 120 | 3300025906 | Ga0207699_10149236 | Ga0207699_101492362 | 236 |
| 121 | 3300025941 | Ga0207711_10158772 | Ga0207711_101587722 | 236 |
| 122 | 3300026041 | Ga0207639_10165864 | Ga0207639_101658642 | 236 |
| 123 | 3300031616 | Ga0307508_10244338 | Ga0307508_102443382 | 236 |
| 124 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001603 | 236 |
| 125 | 3300035118 | Ga0373954_0023914 | Ga0373954_0023914_1733_2542 | 236 |
| 126 | 3300035118 | Ga0373954_0132192 | Ga0373954_0132192_373_1197 | 236 |
| 127 | 3300035410 | Ga0373924_0049076 | Ga0373924_0049076_530_1354 | 236 |
| 128 | 3300035695 | Ga0373927_0167979 | Ga0373927_0167979_183_989 | 236 |
| 129 | 3300036401 | Ga0373937_0149503 | Ga0373937_0149503_275_1099 | 236 |
| 130 | 3300046514 | Ga0495618_0040014 | Ga0495618_0040014_611_1435 | 236 |
| 131 | 3300046522 | Ga0495643_0036869 | Ga0495643_0036869_698_1522 | 236 |
| 132 | 3300046536 | Ga0495587_0049798 | Ga0495587_0049798_1172_1996 | 236 |
| 133 | 3300046543 | Ga0495645_0011108 | Ga0495645_0011108_387_1211 | 236 |
| 134 | 3300046663 | Ga0495635_0032058 | Ga0495635_0032058_2444_3268 | 236 |
| 135 | 3300047319 | Ga0495674_0050910 | Ga0495674_0050910_2526_3350 | 236 |
| 136 | 3300047322 | Ga0495680_0112151 | Ga0495680_0112151_824_1648 | 236 |
| 137 | 3300047471 | Ga0495684_0333476 | Ga0495684_0333476_140_964 | 236 |
| 138 | 3300048904 | Ga0496101_0018757 | Ga0496101_0018757_3076_3882 | 236 |
| 139 | 3300048905 | Ga0496102_0182889 | Ga0496102_0182889_351_1172 | 236 |
| 140 | 3300048908 | Ga0496105_0086814 | Ga0496105_0086814_1397_2203 | 236 |
| 141 | 3300048909 | Ga0496106_0073888 | Ga0496106_0073888_334_1140 | 236 |
| 142 | 3300048912 | Ga0496109_0440555 | Ga0496109_0440555_61_867 | 236 |
| 143 | 3300048917 | Ga0496114_0062621 | Ga0496114_0062621_1051_1857 | 236 |
| 144 | 3300048918 | Ga0496115_0262069 | Ga0496115_0262069_106_912 | 236 |
| 145 | 3300053085 | Ga0495619_0292412 | Ga0495619_0292412_197_1021 | 236 |
| 146 | 3300053177 | Ga0500636_0025189 | Ga0500636_0025189_1459_2268 | 236 |
| 147 | 3300005337 | Ga0070682_100310491 | Ga0070682_1003104911 | 237 |
| 148 | 3300005455 | Ga0070663_100102247 | Ga0070663_1001022472 | 237 |
| 149 | 3300005616 | Ga0068852_100666308 | Ga0068852_1006663082 | 237 |
| 150 | 3300006177 | Ga0075362_10045367 | Ga0075362_100453672 | 237 |
| 151 | 3300009551 | Ga0105238_10316456 | Ga0105238_103164562 | 237 |
| 152 | 3300028786 | Ga0307517_10000139 | Ga0307517_1000013921 | 237 |
| 153 | 3300035725 | Ga0373947_0110999 | Ga0373947_0110999_585_1391 | 237 |
| 154 | 3300048924 | Ga0496121_0083331 | Ga0496121_0083331_1344_2174 | 237 |
| 155 | 3300050489 | nmdc:mga03683_35613_c1 | nmdc:mga03683_35613_c1_154_966 | 237 |
| 156 | 3300005547 | Ga0070693_100066630 | Ga0070693_1000666301 | 238 |
| 157 | 3300025915 | Ga0207693_10354384 | Ga0207693_103543842 | 238 |
| 158 | 3300044694 | Ga0466963_0054377 | Ga0466963_0054377_1764_2570 | 238 |
| 159 | 3300045976 | Ga0466967_0123883 | Ga0466967_0123883_387_1193 | 238 |
| 160 | 3300046523 | Ga0495644_0049165 | Ga0495644_0049165_427_1254 | 238 |
| 161 | 3300047318 | Ga0495636_0182456 | Ga0495636_0182456_36_863 | 238 |
| 162 | 3300048924 | Ga0496121_0064765 | Ga0496121_0064765_696_1505 | 238 |
| 163 | 3300005327 | Ga0070658_10060353 | Ga0070658_100603532 | 239 |
| 164 | 3300005331 | Ga0070670_100294078 | Ga0070670_1002940782 | 239 |
| 165 | 3300005455 | Ga0070663_100019641 | Ga0070663_1000196413 | 239 |
| 166 | 3300005718 | Ga0068866_10151449 | Ga0068866_101514491 | 239 |
| 167 | 3300005983 | Ga0081540_1006242 | Ga0081540_10062421 | 239 |
| 168 | 3300025909 | Ga0207705_10100040 | Ga0207705_101000402 | 239 |
| 169 | 3300025929 | Ga0207664_10005104 | Ga0207664_100051047 | 239 |
| 170 | 3300026067 | Ga0207678_10140870 | Ga0207678_101408702 | 239 |
| 171 | 3300041512 | Ga0451853_0102419 | Ga0451853_0102419_196_1077 | 239 |
| 172 | 3300046524 | Ga0495648_0000895 | Ga0495648_0000895_30135_30959 | 239 |
| 173 | 3300048913 | Ga0496110_0395632 | Ga0496110_0395632_346_1152 | 239 |
| 174 | 3300005434 | Ga0070709_10371117 | Ga0070709_103711172 | 240 |
| 175 | 3300005437 | Ga0070710_10043692 | Ga0070710_100436922 | 240 |
| 176 | 3300005439 | Ga0070711_100002555 | Ga0070711_1000025556 | 240 |
| 177 | 3300006038 | Ga0075365_10061715 | Ga0075365_100617153 | 240 |
| 178 | 3300009148 | Ga0105243_10103348 | Ga0105243_101033482 | 240 |
| 179 | 3300009176 | Ga0105242_10327313 | Ga0105242_103273132 | 240 |
| 180 | 3300025898 | Ga0207692_10033251 | Ga0207692_100332512 | 240 |
| 181 | 3300025916 | Ga0207663_10012968 | Ga0207663_100129681 | 240 |
| 182 | 3300026078 | Ga0207702_10455353 | Ga0207702_104553532 | 240 |
| 183 | 3300031241 | Ga0265325_10003096 | Ga0265325_100030965 | 240 |
| 184 | 3300031249 | Ga0265339_10001686 | Ga0265339_100016862 | 240 |
| 185 | 3300031344 | Ga0265316_10062198 | Ga0265316_100621982 | 240 |
| 186 | 3300031595 | Ga0265313_10006454 | Ga0265313_100064544 | 240 |
| 187 | 3300037471 | Ga0395905_0135873 | Ga0395905_0135873_1480_2286 | 240 |
| 188 | 3300037853 | Ga0436364_0819845 | Ga0436364_0819845_187_984 | 240 |
| 189 | 3300048903 | Ga0496100_0424866 | Ga0496100_0424866_40_843 | 240 |
| 190 | 3300048905 | Ga0496102_0445904 | Ga0496102_0445904_93_896 | 240 |
| 191 | 3300050492 | nmdc:mga0yw44_59540_c1 | nmdc:mga0yw44_59540_c1_1418_2236 | 240 |
| 192 | 3300053119 | Ga0500595_028988 | Ga0500595_028988_861_1673 | 240 |
| 193 | 3300053121 | Ga0500607_185278 | Ga0500607_185278_36_848 | 240 |
| 194 | 3300053145 | Ga0500586_000703 | Ga0500586_000703_4730_5542 | 240 |
| 195 | 3300003659 | JGI25404J52841_10018735 | JGI25404J52841_100187352 | 241 |
| 196 | 3300005262 | Ga0065165_1004760 | Ga0065165_10047602 | 241 |
| 197 | 3300005455 | Ga0070663_100340435 | Ga0070663_1003404352 | 241 |
| 198 | 3300005564 | Ga0070664_100319756 | Ga0070664_1003197562 | 241 |
| 199 | 3300005983 | Ga0081540_1002686 | Ga0081540_100268610 | 241 |
| 200 | 3300025253 | Ga0209677_100663 | Ga0209677_10066317 | 241 |
| 201 | 3300025261 | Ga0209233_1013243 | Ga0209233_10132432 | 241 |
| 202 | 3300025302 | Ga0207426_1001694 | Ga0207426_100169411 | 241 |
| 203 | 3300025919 | Ga0207657_10169565 | Ga0207657_101695652 | 241 |
| 204 | 3300044658 | Ga0466972_0000294 | Ga0466972_0000294_12876_13685 | 241 |
| 205 | 3300044735 | Ga0466968_0016434 | Ga0466968_0016434_742_1551 | 241 |
| 206 | 3300048907 | Ga0496104_0031575 | Ga0496104_0031575_1180_1971 | 241 |
| 207 | 3300048908 | Ga0496105_0069961 | Ga0496105_0069961_1139_1930 | 241 |
| 208 | 3300048914 | Ga0496111_0438685 | Ga0496111_0438685_34_825 | 241 |
| 209 | 3300048917 | Ga0496114_0066111 | Ga0496114_0066111_1474_2265 | 241 |
| 210 | 3300048918 | Ga0496115_0059727 | Ga0496115_0059727_2232_3023 | 241 |
| 211 | 3300048921 | Ga0496118_0074493 | Ga0496118_0074493_1433_2242 | 241 |
| 212 | 3300048924 | Ga0496121_0023184 | Ga0496121_0023184_2219_3031 | 241 |
| 213 | 3300050516 | nmdc:mga0sz30_223763_c1 | nmdc:mga0sz30_223763_c1_15_788 | 241 |
| 214 | 3300053136 | Ga0500559_0039339 | Ga0500559_0039339_1208_2023 | 241 |
| 215 | 3300053177 | Ga0500636_0000468 | Ga0500636_0000468_17276_18091 | 241 |
| 216 | 3300028800 | Ga0265338_10473270 | Ga0265338_104732701 | 242 |
| 217 | 3300044719 | Ga0466971_0077499 | Ga0466971_0077499_712_1482 | 242 |
| 218 | 3300044842 | Ga0466957_0240497 | Ga0466957_0240497_14_787 | 242 |
| 219 | 3300048907 | Ga0496104_0793269 | Ga0496104_0793269_70_843 | 242 |
| 220 | 3300049576 | Ga0501040_0107057 | Ga0501040_0107057_1166_1933 | 242 |
| 221 | 3300053095 | Ga0500640_045381 | Ga0500640_045381_85_897 | 242 |
| 222 | 3300053096 | Ga0500641_0075214 | Ga0500641_0075214_171_995 | 242 |
| 223 | 3300053111 | Ga0500572_007763 | Ga0500572_007763_879_1691 | 242 |
| 224 | 3300053138 | Ga0500564_115762 | Ga0500564_115762_289_1101 | 242 |
| 225 | 3300053155 | Ga0500620_025463 | Ga0500620_025463_81_893 | 242 |
| 226 | 3300053163 | Ga0500639_092921 | Ga0500639_092921_394_1206 | 242 |
| 227 | 3300053178 | Ga0500637_0101554 | Ga0500637_0101554_332_1144 | 242 |
| 228 | 3300054114 | Ga0501084_0346575 | Ga0501084_0346575_20_787 | 242 |
| 229 | 3300005340 | Ga0070689_100209407 | Ga0070689_1002094072 | 243 |
| 230 | 3300005618 | Ga0068864_100669224 | Ga0068864_1006692242 | 243 |
| 231 | 3300010375 | Ga0105239_10253811 | Ga0105239_102538113 | 243 |
| 232 | 3300011119 | Ga0105246_10027291 | Ga0105246_100272913 | 243 |
| 233 | 3300014968 | Ga0157379_10044047 | Ga0157379_100440472 | 243 |
| 234 | 3300014969 | Ga0157376_10511583 | Ga0157376_105115832 | 243 |
| 235 | 3300025936 | Ga0207670_10197046 | Ga0207670_101970462 | 243 |
| 236 | 3300048903 | Ga0496100_0176850 | Ga0496100_0176850_164_988 | 243 |
| 237 | 3300048909 | Ga0496106_0087642 | Ga0496106_0087642_95_919 | 243 |
| 238 | 3300048911 | Ga0496108_0004686 | Ga0496108_0004686_2595_3419 | 243 |
| 239 | 3300048912 | Ga0496109_0010107 | Ga0496109_0010107_5599_6423 | 243 |
| 240 | 3300053125 | Ga0500618_009795 | Ga0500618_009795_62_889 | 243 |
| 241 | 3300049570 | Ga0501033_0187643 | Ga0501033_0187643_549_1376 | 244 |
| 242 | 3300049571 | Ga0501034_0144486 | Ga0501034_0144486_1485_2312 | 244 |
| 243 | 3300049572 | Ga0501036_0207410 | Ga0501036_0207410_783_1610 | 244 |
| 244 | 3300049574 | Ga0501038_0231496 | Ga0501038_0231496_575_1402 | 244 |
| 245 | 3300049580 | Ga0501046_0364972 | Ga0501046_0364972_66_893 | 244 |
| 246 | 3300053109 | Ga0500569_018498 | Ga0500569_018498_948_1760 | 244 |
| 247 | 3300025230 | Ga0209563_102080 | Ga0209563_1020802 | 245 |
| 248 | 3300025297 | Ga0209758_1016841 | Ga0209758_10168414 | 245 |
| 249 | 3300037466 | Ga0395898_0124168 | Ga0395898_0124168_1580_2398 | 245 |
| 250 | 3300053094 | Ga0500566_0004414 | Ga0500566_0004414_2723_3532 | 245 |
| 251 | 3300014497 | Ga0182008_10036655 | Ga0182008_100366553 | 246 |
| 252 | 3300041498 | Ga0451841_0960603 | Ga0451841_0960603_147_959 | 246 |
| 253 | 3300005578 | Ga0068854_100190683 | Ga0068854_1001906832 | 247 |
| 254 | 3300053142 | Ga0500577_0000228 | Ga0500577_0000228_1884_2696 | 247 |
| 255 | 3300005441 | Ga0070700_100114956 | Ga0070700_1001149562 | 248 |
| 256 | 3300009545 | Ga0105237_10014611 | Ga0105237_100146114 | 248 |
| 257 | 3300053153 | Ga0500616_0007910 | Ga0500616_0007910_2789_3619 | 248 |
| 258 | 3300048924 | Ga0496121_0000612 | Ga0496121_0000612_46014_46841 | 249 |
| 259 | 3300048924 | Ga0496121_0050546 | Ga0496121_0050546_1005_1835 | 249 |
| 260 | 3300049578 | Ga0501042_0025312 | Ga0501042_0025312_1154_1975 | 249 |
| 261 | 3300049822 | Ga0501035_0000654 | Ga0501035_0000654_22436_23278 | 249 |
| 262 | 3300049822 | Ga0501035_0185598 | Ga0501035_0185598_906_1706 | 249 |
| 263 | 3300005338 | Ga0068868_100088762 | Ga0068868_1000887624 | 250 |
| 264 | 3300005455 | Ga0070663_100031255 | Ga0070663_1000312554 | 250 |
| 265 | 3300005456 | Ga0070678_100272711 | Ga0070678_1002727112 | 250 |
| 266 | 3300005563 | Ga0068855_100380655 | Ga0068855_1003806552 | 250 |
| 267 | 3300005614 | Ga0068856_100238473 | Ga0068856_1002384732 | 250 |
| 268 | 3300005617 | Ga0068859_100123228 | Ga0068859_1001232282 | 250 |
| 269 | 3300005618 | Ga0068864_100109286 | Ga0068864_1001092863 | 250 |
| 270 | 3300005719 | Ga0068861_100124839 | Ga0068861_1001248392 | 250 |
| 271 | 3300005842 | Ga0068858_100018465 | Ga0068858_1000184658 | 250 |
| 272 | 3300005844 | Ga0068862_100201763 | Ga0068862_1002017632 | 250 |
| 273 | 3300006042 | Ga0075368_10029287 | Ga0075368_100292873 | 250 |
| 274 | 3300006051 | Ga0075364_10069135 | Ga0075364_100691352 | 250 |
| 275 | 3300006178 | Ga0075367_10157983 | Ga0075367_101579832 | 250 |
| 276 | 3300006871 | Ga0075434_100074375 | Ga0075434_1000743754 | 250 |
| 277 | 3300006931 | Ga0097620_100123230 | Ga0097620_1001232302 | 250 |
| 278 | 3300009174 | Ga0105241_10525361 | Ga0105241_105253611 | 250 |
| 279 | 3300010375 | Ga0105239_10108947 | Ga0105239_101089475 | 250 |
| 280 | 3300013306 | Ga0163162_10975414 | Ga0163162_109754141 | 250 |
| 281 | 3300014325 | Ga0163163_10211943 | Ga0163163_102119432 | 250 |
| 282 | 3300025907 | Ga0207645_10086693 | Ga0207645_100866932 | 250 |
| 283 | 3300025914 | Ga0207671_10035837 | Ga0207671_100358372 | 250 |
| 284 | 3300025942 | Ga0207689_10037986 | Ga0207689_100379865 | 250 |
| 285 | 3300025949 | Ga0207667_10401693 | Ga0207667_104016932 | 250 |
| 286 | 3300026035 | Ga0207703_10086489 | Ga0207703_100864893 | 250 |
| 287 | 3300026078 | Ga0207702_10180446 | Ga0207702_101804462 | 250 |
| 288 | 3300026118 | Ga0207675_100262104 | Ga0207675_1002621042 | 250 |
| 289 | 3300039447 | Ga0436361_0060531 | Ga0436361_0060531_532_1329 | 250 |
| 290 | 3300044658 | Ga0466972_0012453 | Ga0466972_0012453_3378_4190 | 250 |
| 291 | 3300044735 | Ga0466968_0051832 | Ga0466968_0051832_125_937 | 250 |
| 292 | 3300044901 | Ga0466960_0046399 | Ga0466960_0046399_409_1221 | 250 |
| 293 | 3300048903 | Ga0496100_0145876 | Ga0496100_0145876_785_1606 | 250 |
| 294 | 3300048906 | Ga0496103_0119085 | Ga0496103_0119085_541_1362 | 250 |
| 295 | 3300048907 | Ga0496104_0060111 | Ga0496104_0060111_272_1093 | 250 |
| 296 | 3300048907 | Ga0496104_0067210 | Ga0496104_0067210_1400_2221 | 250 |
| 297 | 3300048908 | Ga0496105_0235190 | Ga0496105_0235190_462_1283 | 250 |
| 298 | 3300048909 | Ga0496106_0004478 | Ga0496106_0004478_417_1238 | 250 |
| 299 | 3300048910 | Ga0496107_0001244 | Ga0496107_0001244_3965_4786 | 250 |
| 300 | 3300048911 | Ga0496108_0000361 | Ga0496108_0000361_15346_16167 | 250 |
| 301 | 3300048911 | Ga0496108_0367337 | Ga0496108_0367337_423_1244 | 250 |
| 302 | 3300048912 | Ga0496109_0000472 | Ga0496109_0000472_22050_22871 | 250 |
| 303 | 3300048912 | Ga0496109_0255002 | Ga0496109_0255002_683_1504 | 250 |
| 304 | 3300048913 | Ga0496110_0006849 | Ga0496110_0006849_530_1351 | 250 |
| 305 | 3300048914 | Ga0496111_0029782 | Ga0496111_0029782_684_1505 | 250 |
| 306 | 3300048915 | Ga0496112_0005662 | Ga0496112_0005662_3870_4691 | 250 |
| 307 | 3300048924 | Ga0496121_0118725 | Ga0496121_0118725_895_1716 | 250 |
| 308 | 3300048929 | Ga0496126_0026422 | Ga0496126_0026422_3824_4651 | 250 |
| 309 | 3300049569 | Ga0501032_0067784 | Ga0501032_0067784_868_1698 | 250 |
| 310 | 3300049571 | Ga0501034_0002596 | Ga0501034_0002596_11703_12533 | 250 |
| 311 | 3300049571 | Ga0501034_0516556 | Ga0501034_0516556_24_842 | 250 |
| 312 | 3300049572 | Ga0501036_0001532 | Ga0501036_0001532_4020_4850 | 250 |
| 313 | 3300049572 | Ga0501036_0058130 | Ga0501036_0058130_1882_2700 | 250 |
| 314 | 3300049573 | Ga0501037_0013311 | Ga0501037_0013311_2688_3518 | 250 |
| 315 | 3300049574 | Ga0501038_0224258 | Ga0501038_0224258_308_1138 | 250 |
| 316 | 3300049575 | Ga0501039_0226396 | Ga0501039_0226396_29_847 | 250 |
| 317 | 3300049579 | Ga0501043_0002556 | Ga0501043_0002556_8227_9057 | 250 |
| 318 | 3300049580 | Ga0501046_0012848 | Ga0501046_0012848_6077_6907 | 250 |
| 319 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_143886_144716 | 250 |
| 320 | 3300049582 | Ga0501048_0000552 | Ga0501048_0000552_13911_14741 | 250 |
| 321 | 3300049586 | Ga0501070_0005586 | Ga0501070_0005586_2565_3395 | 250 |
| 322 | 3300049586 | Ga0501070_0095010 | Ga0501070_0095010_610_1428 | 250 |
| 323 | 3300049589 | Ga0501073_0113684 | Ga0501073_0113684_58_888 | 250 |
| 324 | 3300049590 | Ga0501074_0033032 | Ga0501074_0033032_582_1412 | 250 |
| 325 | 3300049742 | Ga0501080_0000234 | Ga0501080_0000234_20675_21505 | 250 |
| 326 | 3300049744 | Ga0501083_0000533 | Ga0501083_0000533_5801_6631 | 250 |
| 327 | 3300049823 | Ga0501044_0114713 | Ga0501044_0114713_1034_1864 | 250 |
| 328 | 3300049823 | Ga0501044_0245460 | Ga0501044_0245460_483_1301 | 250 |
| 329 | 3300050495 | nmdc:mga04h51_126760_c1 | nmdc:mga04h51_126760_c1_58_879 | 250 |
| 330 | 3300050512 | nmdc:mga0n895_79859_c1 | nmdc:mga0n895_79859_c1_65_886 | 250 |
| 331 | iso_pu_bacteria | 2602042107 | 2603858982 | 250 |
| 332 | iso_pu_bacteria | 2857524615 | 2857527915 | 250 |
| 333 | iso_pu_bacteria | 2893066018 | 2893068332 | 250 |
| 334 | iso_pu_bacteria | 2919073203 | 2919075315 | 250 |
| 335 | iso_pu_bacteria | 3005594810 | 3005598648 | 250 |
| 336 | 3300002077 | JGI24744J21845_10023526 | JGI24744J21845_100235261 | 251 |
| 337 | 3300005339 | Ga0070660_100271695 | Ga0070660_1002716951 | 251 |
| 338 | 3300005356 | Ga0070674_100140265 | Ga0070674_1001402653 | 251 |
| 339 | 3300005456 | Ga0070678_100117886 | Ga0070678_1001178862 | 251 |
| 340 | 3300005530 | Ga0070679_100341474 | Ga0070679_1003414741 | 251 |
| 341 | 3300005543 | Ga0070672_100074421 | Ga0070672_1000744214 | 251 |
| 342 | 3300005544 | Ga0070686_100169798 | Ga0070686_1001697982 | 251 |
| 343 | 3300005615 | Ga0070702_100170330 | Ga0070702_1001703303 | 251 |
| 344 | 3300005719 | Ga0068861_100020032 | Ga0068861_1000200325 | 251 |
| 345 | 3300005844 | Ga0068862_100270948 | Ga0068862_1002709482 | 251 |
| 346 | 3300006237 | Ga0097621_100129958 | Ga0097621_1001299581 | 251 |
| 347 | 3300009148 | Ga0105243_10153926 | Ga0105243_101539262 | 251 |
| 348 | 3300009176 | Ga0105242_10194157 | Ga0105242_101941572 | 251 |
| 349 | 3300013308 | Ga0157375_10194691 | Ga0157375_101946912 | 251 |
| 350 | 3300014326 | Ga0157380_10329432 | Ga0157380_103294322 | 251 |
| 351 | 3300025932 | Ga0207690_10223537 | Ga0207690_102235372 | 251 |
| 352 | 3300025933 | Ga0207706_10082263 | Ga0207706_100822632 | 251 |
| 353 | 3300025935 | Ga0207709_10034192 | Ga0207709_100341923 | 251 |
| 354 | 3300025937 | Ga0207669_10237642 | Ga0207669_102376422 | 251 |
| 355 | 3300025940 | Ga0207691_10042900 | Ga0207691_100429004 | 251 |
| 356 | 3300026089 | Ga0207648_10109226 | Ga0207648_101092262 | 251 |
| 357 | 3300026118 | Ga0207675_100122042 | Ga0207675_1001220424 | 251 |
| 358 | 3300026121 | Ga0207683_10149435 | Ga0207683_101494352 | 251 |
| 359 | 3300028381 | Ga0268264_10304830 | Ga0268264_103048301 | 251 |
| 360 | 3300035695 | Ga0373927_0003031 | Ga0373927_0003031_279_1076 | 251 |
| 361 | 3300037068 | Ga0373925_0021350 | Ga0373925_0021350_2074_2898 | 251 |
| 362 | 3300037068 | Ga0373925_0069874 | Ga0373925_0069874_1202_1999 | 251 |
| 363 | 3300046473 | Ga0495582_0077042 | Ga0495582_0077042_130_927 | 251 |
| 364 | 3300046475 | Ga0495639_0035109 | Ga0495639_0035109_10_807 | 251 |
| 365 | 3300046683 | Ga0495658_0200861 | Ga0495658_0200861_349_1146 | 251 |
| 366 | 3300046684 | Ga0495669_0038233 | Ga0495669_0038233_1233_2060 | 251 |
| 367 | 3300047320 | Ga0495672_0041646 | Ga0495672_0041646_630_1460 | 251 |
| 368 | 3300048905 | Ga0496102_0192286 | Ga0496102_0192286_194_1015 | 251 |
| 369 | 3300048912 | Ga0496109_0452267 | Ga0496109_0452267_339_1160 | 251 |
| 370 | 3300048913 | Ga0496110_0238317 | Ga0496110_0238317_469_1290 | 251 |
| 371 | 3300048915 | Ga0496112_0104926 | Ga0496112_0104926_505_1326 | 251 |
| 372 | 3300049568 | Ga0501031_0134983 | Ga0501031_0134983_633_1442 | 251 |
| 373 | 3300049573 | Ga0501037_0147553 | Ga0501037_0147553_296_1117 | 251 |
| 374 | 3300049574 | Ga0501038_0108288 | Ga0501038_0108288_718_1527 | 251 |
| 375 | 3300049580 | Ga0501046_0061399 | Ga0501046_0061399_657_1466 | 251 |
| 376 | 3300049581 | Ga0501047_0085578 | Ga0501047_0085578_588_1397 | 251 |
| 377 | 3300049586 | Ga0501070_0043035 | Ga0501070_0043035_2419_3228 | 251 |
| 378 | 3300049591 | Ga0501075_0294180 | Ga0501075_0294180_250_1071 | 251 |
| 379 | 3300049742 | Ga0501080_0079884 | Ga0501080_0079884_1403_2212 | 251 |
| 380 | 3300049823 | Ga0501044_0010554 | Ga0501044_0010554_2499_3308 | 251 |
| 381 | iso_pu_bacteria | 2507262055 | 2507509193 | 251 |
| 382 | iso_pu_bacteria | 2508501009 | 2508543258 | 251 |
| 383 | iso_pu_bacteria | 2508501042 | 2508690998 | 251 |
| 384 | iso_pu_bacteria | 2508501128 | 2509147449 | 251 |
| 385 | iso_pu_bacteria | 2511231028 | 2511396238 | 251 |
| 386 | iso_pu_bacteria | 2513237092 | 2513627889 | 251 |
| 387 | iso_pu_bacteria | 2513237094 | 2513637748 | 251 |
| 388 | iso_pu_bacteria | 2513237095 | 2513646831 | 251 |
| 389 | iso_pu_bacteria | 2513237096 | 2513654535 | 251 |
| 390 | iso_pu_bacteria | 2513237098 | 2513675526 | 251 |
| 391 | iso_pu_bacteria | 2513237101 | 2513691987 | 251 |
| 392 | iso_pu_bacteria | 2513237102 | 2513702842 | 251 |
| 393 | iso_pu_bacteria | 2513237104 | 2513723124 | 251 |
| 394 | iso_pu_bacteria | 2513237137 | 2513860907 | 251 |
| 395 | iso_pu_bacteria | 2513237139 | 2513874489 | 251 |
| 396 | iso_pu_bacteria | 2513237141 | 2513892839 | 251 |
| 397 | iso_pu_bacteria | 2513237145 | 2513915286 | 251 |
| 398 | iso_pu_bacteria | 2513237161 | 2514013974 | 251 |
| 399 | iso_pu_bacteria | 2515154112 | 2515626601 | 251 |
| 400 | iso_pu_bacteria | 2517093001 | 2517101830 | 251 |
| 401 | iso_pu_bacteria | 2517572143 | 2517892585 | 251 |
| 402 | iso_pu_bacteria | 2524023205 | 2524436753 | 251 |
| 403 | iso_pu_bacteria | 2524023210 | 2524465135 | 251 |
| 404 | iso_pu_bacteria | 2524023228 | 2524539073 | 251 |
| 405 | iso_pu_bacteria | 2528768022 | 2528855761 | 251 |
| 406 | iso_pu_bacteria | 2617270735 | 2617351287 | 251 |
| 407 | iso_pu_bacteria | 2617270741 | 2617376299 | 251 |
| 408 | iso_pu_bacteria | 2643221651 | 2644288443 | 251 |
| 409 | iso_pu_bacteria | 2667528175 | 2671122314 | 251 |
| 410 | iso_pu_bacteria | 2721755755 | 2723845620 | 251 |
| 411 | iso_pu_bacteria | 2744054633 | 2745079176 | 251 |
| 412 | iso_pu_bacteria | 2791355196 | 2793063888 | 251 |
| 413 | iso_pu_bacteria | 2791355197 | 2793068590 | 251 |
| 414 | iso_pu_bacteria | 2791355199 | 2793083779 | 251 |
| 415 | iso_pu_bacteria | 2802429603 | 2805918148 | 251 |
| 416 | iso_pu_bacteria | 2816332527 | 2818242671 | 251 |
| 417 | iso_pu_bacteria | 2824600985 | 2824606744 | 251 |
| 418 | iso_pu_bacteria | 2824609381 | 2824616642 | 251 |
| 419 | iso_pu_bacteria | 2824617872 | 2824621839 | 251 |
| 420 | iso_pu_bacteria | 2824626560 | 2824632542 | 251 |
| 421 | iso_pu_bacteria | 2824635225 | 2824639504 | 251 |
| 422 | iso_pu_bacteria | 2824644064 | 2824651526 | 251 |
| 423 | iso_pu_bacteria | 2824653114 | 2824660981 | 251 |
| 424 | iso_pu_bacteria | 2824661429 | 2824670843 | 251 |
| 425 | iso_pu_bacteria | 2824671348 | 2824677640 | 251 |
| 426 | iso_pu_bacteria | 2824679649 | 2824683265 | 251 |
| 427 | iso_pu_bacteria | 2824687955 | 2824695360 | 251 |
| 428 | iso_pu_bacteria | 2824696289 | 2824702248 | 251 |
| 429 | iso_pu_bacteria | 2824704595 | 2824708770 | 251 |
| 430 | iso_pu_bacteria | 2824714736 | 2824721573 | 251 |
| 431 | iso_pu_bacteria | 2824723954 | 2824729240 | 251 |
| 432 | iso_pu_bacteria | 2824732956 | 2824739719 | 251 |
| 433 | iso_pu_bacteria | 2824746037 | 2824753512 | 251 |
| 434 | iso_pu_bacteria | 2824753945 | 2824761261 | 251 |
| 435 | iso_pu_bacteria | 2824763712 | 2824773187 | 251 |
| 436 | iso_pu_bacteria | 2824773399 | 2824779181 | 251 |
| 437 | iso_pu_bacteria | 2838122688 | 2838126353 | 251 |
| 438 | iso_pu_bacteria | 2841941048 | 2841943569 | 251 |
| 439 | iso_pu_bacteria | 2841949485 | 2841950481 | 251 |
| 440 | iso_pu_bacteria | 2841957949 | 2841958157 | 251 |
| 441 | iso_pu_bacteria | 2841966195 | 2841966795 | 251 |
| 442 | iso_pu_bacteria | 2841974524 | 2841975550 | 251 |
| 443 | iso_pu_bacteria | 2841983080 | 2841988310 | 251 |
| 444 | iso_pu_bacteria | 2842038055 | 2842039601 | 251 |
| 445 | iso_pu_bacteria | 2842045827 | 2842047453 | 251 |
| 446 | iso_pu_bacteria | 2844315083 | 2844318537 | 251 |
| 447 | iso_pu_bacteria | 2847930680 | 2847935471 | 251 |
| 448 | iso_pu_bacteria | 2847939898 | 2847946031 | 251 |
| 449 | iso_pu_bacteria | 2849076700 | 2849079853 | 251 |
| 450 | iso_pu_bacteria | 2857509624 | 2857513746 | 251 |
| 451 | iso_pu_bacteria | 2874590934 | 2874597307 | 251 |
| 452 | iso_pu_bacteria | 2874604998 | 2874609768 | 251 |
| 453 | iso_pu_bacteria | 2874612657 | 2874616344 | 251 |
| 454 | iso_pu_bacteria | 2874620515 | 2874626796 | 251 |
| 455 | iso_pu_bacteria | 2874628541 | 2874631208 | 251 |
| 456 | iso_pu_bacteria | 2874645413 | 2874649360 | 251 |
| 457 | iso_pu_bacteria | 2876761206 | 2876770419 | 251 |
| 458 | iso_pu_bacteria | 2876771140 | 2876777896 | 251 |
| 459 | iso_pu_bacteria | 2876808645 | 2876809344 | 251 |
| 460 | iso_pu_bacteria | 2876818435 | 2876823083 | 251 |
| 461 | iso_pu_bacteria | 2879074833 | 2879078653 | 251 |
| 462 | iso_pu_bacteria | 2879083081 | 2879088501 | 251 |
| 463 | iso_pu_bacteria | 2879099564 | 2879108134 | 251 |
| 464 | iso_pu_bacteria | 2879110137 | 2879118364 | 251 |
| 465 | iso_pu_bacteria | 2879127579 | 2879132870 | 251 |
| 466 | iso_pu_bacteria | 2879142872 | 2879148669 | 251 |
| 467 | iso_pu_bacteria | 2881364244 | 2881366843 | 251 |
| 468 | iso_pu_bacteria | 2881665667 | 2881672157 | 251 |
| 469 | iso_pu_bacteria | 2885366525 | 2885371964 | 251 |
| 470 | iso_pu_bacteria | 2885374607 | 2885379306 | 251 |
| 471 | iso_pu_bacteria | 2885383462 | 2885386308 | 251 |
| 472 | iso_pu_bacteria | 2885409591 | 2885415254 | 251 |
| 473 | iso_pu_bacteria | 2888378607 | 2888383499 | 251 |
| 474 | iso_pu_bacteria | 2888388044 | 2888394448 | 251 |
| 475 | iso_pu_bacteria | 2888419890 | 2888423924 | 251 |
| 476 | iso_pu_bacteria | 2903727486 | 2903730097 | 251 |
| 477 | iso_pu_bacteria | 2903748898 | 2903753541 | 251 |
| 478 | iso_pu_bacteria | 2903768456 | 2903771930 | 251 |
| 479 | iso_pu_bacteria | 2904666416 | 2904668374 | 251 |
| 480 | iso_pu_bacteria | 2904690495 | 2904695939 | 251 |
| 481 | iso_pu_bacteria | 2904699407 | 2904702691 | 251 |
| 482 | iso_pu_bacteria | 2904711408 | 2904717332 | 251 |
| 483 | iso_pu_bacteria | 2906602504 | 2906603482 | 251 |
| 484 | iso_pu_bacteria | 2906610324 | 2906618420 | 251 |
| 485 | iso_pu_bacteria | 2906626472 | 2906632232 | 251 |
| 486 | iso_pu_bacteria | 2906635258 | 2906638719 | 251 |
| 487 | iso_pu_bacteria | 2906643746 | 2906650830 | 251 |
| 488 | iso_pu_bacteria | 2906660503 | 2906664121 | 251 |
| 489 | iso_pu_bacteria | 2908739725 | 2908742908 | 251 |
| 490 | iso_pu_bacteria | 2908756301 | 2908760568 | 251 |
| 491 | iso_pu_bacteria | 2908775508 | 2908779579 | 251 |
| 492 | iso_pu_bacteria | 2922361189 | 2922368296 | 251 |
| 493 | iso_pu_bacteria | 2922368715 | 2922373695 | 251 |
| 494 | iso_pu_bacteria | 2922386360 | 2922388240 | 251 |
| 495 | iso_pu_bacteria | 2922393267 | 2922395804 | 251 |
| 496 | iso_pu_bacteria | 2922425934 | 2922429680 | 251 |
| 497 | iso_pu_bacteria | 2929615660 | 2929617423 | 251 |
| 498 | iso_pu_bacteria | 2929624759 | 2929627128 | 251 |
| 499 | iso_pu_bacteria | 2932784394 | 2932787542 | 251 |
| 500 | iso_pu_bacteria | 2932794094 | 2932800721 | 251 |
| 501 | iso_pu_bacteria | 2932801729 | 2932803340 | 251 |
| 502 | iso_pu_bacteria | 2932809354 | 2932813277 | 251 |
| 503 | iso_pu_bacteria | 2932818245 | 2932820802 | 251 |
| 504 | iso_pu_bacteria | 2932828146 | 2932834825 | 251 |
| 505 | iso_pu_bacteria | 2933577622 | 2933579379 | 251 |
| 506 | iso_pu_bacteria | 2935608549 | 2935611924 | 251 |
| 507 | iso_pu_bacteria | 2935616580 | 2935621790 | 251 |
| 508 | iso_pu_bacteria | 2935630451 | 2935631849 | 251 |
| 509 | iso_pu_bacteria | 2935638405 | 2935642734 | 251 |
| 510 | iso_pu_bacteria | 2935648319 | 2935649549 | 251 |
| 511 | iso_pu_bacteria | 2935656913 | 2935658936 | 251 |
| 512 | iso_pu_bacteria | 2935665750 | 2935667836 | 251 |
| 513 | iso_pu_bacteria | 2935675223 | 2935682328 | 251 |
| 514 | iso_pu_bacteria | 2935684952 | 2935688587 | 251 |
| 515 | iso_pu_bacteria | 2935694250 | 2935695938 | 251 |
| 516 | iso_pu_bacteria | 2935703347 | 2935706677 | 251 |
| 517 | iso_pu_bacteria | 2935713505 | 2935715606 | 251 |
| 518 | iso_pu_bacteria | 2935722832 | 2935725830 | 251 |
| 519 | iso_pu_bacteria | 2935732158 | 2935734425 | 251 |
| 520 | iso_pu_bacteria | 2935741537 | 2935743804 | 251 |
| 521 | iso_pu_bacteria | 2935750917 | 2935754159 | 251 |
| 522 | iso_pu_bacteria | 2935760218 | 2935763198 | 251 |
| 523 | iso_pu_bacteria | 2935769743 | 2935772603 | 251 |
| 524 | iso_pu_bacteria | 2935777560 | 2935783155 | 251 |
| 525 | iso_pu_bacteria | 2935785616 | 2935790896 | 251 |
| 526 | iso_pu_bacteria | 2935793552 | 2935799403 | 251 |
| 527 | iso_pu_bacteria | 2935801545 | 2935806348 | 251 |
| 528 | iso_pu_bacteria | 2935810662 | 2935812949 | 251 |
| 529 | iso_pu_bacteria | 2935819856 | 2935821404 | 251 |
| 530 | iso_pu_bacteria | 2935827899 | 2935830601 | 251 |
| 531 | iso_pu_bacteria | 2935837841 | 2935840630 | 251 |
| 532 | iso_pu_bacteria | 2935847175 | 2935850337 | 251 |
| 533 | iso_pu_bacteria | 2935855204 | 2935860037 | 251 |
| 534 | iso_pu_bacteria | 2935864058 | 2935869328 | 251 |
| 535 | iso_pu_bacteria | 2935873716 | 2935880511 | 251 |
| 536 | iso_pu_bacteria | 2935883170 | 2935886412 | 251 |
| 537 | iso_pu_bacteria | 2935908558 | 2935914382 | 251 |
| 538 | iso_pu_bacteria | 2935916978 | 2935921096 | 251 |
| 539 | iso_pu_bacteria | 2935926038 | 2935932038 | 251 |
| 540 | iso_pu_bacteria | 2935934488 | 2935940635 | 251 |
| 541 | iso_pu_bacteria | 2935942939 | 2935948578 | 251 |
| 542 | iso_pu_bacteria | 2935951376 | 2935956951 | 251 |
| 543 | iso_pu_bacteria | 2935959822 | 2935960281 | 251 |
| 544 | iso_pu_bacteria | 2935967501 | 2935973549 | 251 |
| 545 | iso_pu_bacteria | 2935975950 | 2935977530 | 251 |
| 546 | iso_pu_bacteria | 2935984226 | 2935989998 | 251 |
| 547 | iso_pu_bacteria | 2935992306 | 2935999559 | 251 |
| 548 | iso_pu_bacteria | 2936002035 | 2936006456 | 251 |
| 549 | iso_pu_bacteria | 2936011229 | 2936012969 | 251 |
| 550 | iso_pu_bacteria | 2936019824 | 2936021533 | 251 |
| 551 | iso_pu_bacteria | 2936028420 | 2936030262 | 251 |
| 552 | iso_pu_bacteria | 2936037263 | 2936041537 | 251 |
| 553 | iso_pu_bacteria | 2936046547 | 2936047727 | 251 |
| 554 | iso_pu_bacteria | 2936055302 | 2936057115 | 251 |
| 555 | iso_pu_bacteria | 2940556831 | 2940560465 | 251 |
| 556 | iso_pu_bacteria | 2941507105 | 2941513036 | 251 |
| 557 | iso_pu_bacteria | 2941515067 | 2941521060 | 251 |
| 558 | iso_pu_bacteria | 2941523033 | 2941526076 | 251 |
| 559 | iso_pu_bacteria | 2941531003 | 2941534287 | 251 |
| 560 | iso_pu_bacteria | 2941538514 | 2941541240 | 251 |
| 561 | iso_pu_bacteria | 3005474847 | 3005480016 | 251 |
| 562 | iso_pu_bacteria | 3005483717 | 3005489615 | 251 |
| 563 | iso_pu_bacteria | 3005506211 | 3005509830 | 251 |
| 564 | iso_pu_bacteria | 3005587118 | 3005590057 | 251 |
| 565 | iso_pu_bacteria | 3005710791 | 3005714305 | 251 |
| 566 | iso_pu_bacteria | 3005718088 | 3005721812 | 251 |
| 567 | iso_pu_bacteria | 8006926726 | 8006928993 | 251 |
| 568 | iso_pu_bacteria | 8006933436 | 8006941212 | 251 |
| 569 | iso_pu_bacteria | 8006964411 | 8006967248 | 251 |
| 570 | iso_pu_bacteria | 8006973647 | 8006980582 | 251 |
| 571 | iso_pu_bacteria | 8006984368 | 8006992067 | 251 |
| 572 | iso_pu_bacteria | 8006994254 | 8006997484 | 251 |
| 573 | iso_pu_bacteria | 8016522445 | 8016530202 | 251 |
| 574 | iso_pu_bacteria | 8016530956 | 8016535457 | 251 |
| 575 | iso_pu_bacteria | 8016539877 | 8016548655 | 251 |
| 576 | iso_pu_bacteria | 8016548790 | 8016553476 | 251 |
| 577 | iso_pu_bacteria | 8016557553 | 8016561858 | 251 |
| 578 | iso_pu_bacteria | 8016575299 | 8016577914 | 251 |
| 579 | iso_pu_bacteria | 8016583857 | 8016592560 | 251 |
| 580 | iso_pu_bacteria | 8016595262 | 8016599686 | 251 |
| 581 | iso_pu_bacteria | 8016603502 | 8016611162 | 251 |
| 582 | iso_pu_bacteria | 8016613128 | 8016622474 | 251 |
| 583 | iso_pu_bacteria | 8016622563 | 8016627311 | 251 |
| 584 | iso_pu_bacteria | 8016630954 | 8016631598 | 251 |
| 585 | iso_pu_bacteria | 8017057580 | 8017062418 | 251 |
| 586 | iso_pu_bacteria | 8019530166 | 8019535194 | 251 |
| 587 | iso_pu_bacteria | 8019538911 | 8019544287 | 251 |
| 588 | iso_pu_bacteria | 8019547302 | 8019554412 | 251 |
| 589 | iso_pu_bacteria | 8019565922 | 8019568309 | 251 |
| 590 | iso_pu_bacteria | 8019576017 | 8019581879 | 251 |
| 591 | iso_pu_bacteria | 8019586578 | 8019589560 | 251 |
| 592 | iso_pu_bacteria | 8019608314 | 8019616843 | 251 |
| 593 | iso_pu_bacteria | 8019619141 | 8019627510 | 251 |
| 594 | iso_pu_bacteria | 8019629233 | 8019635060 | 251 |
| 595 | iso_pu_bacteria | 8019638758 | 8019644669 | 251 |
| 596 | iso_pu_bacteria | 8019648815 | 8019657697 | 251 |
| 597 | iso_pu_bacteria | 8019659431 | 8019662902 | 251 |
| 598 | iso_pu_bacteria | 8019668869 | 8019672501 | 251 |
| 599 | iso_pu_bacteria | 8019678201 | 8019683656 | 251 |
| 600 | iso_pu_bacteria | 8019687851 | 8019689409 | 251 |
| 601 | iso_pu_bacteria | 8055742211 | 8055746962 | 251 |
| 602 | iso_pu_bacteria | 8056673599 | 8056674362 | 251 |
| 603 | iso_pu_bacteria | 8056681323 | 8056683275 | 251 |
| 604 | iso_pu_bacteria | 8056689827 | 8056690040 | 251 |
| 605 | iso_pu_bacteria | 8056967851 | 8056972899 | 251 |
| 606 | 3300005983 | Ga0081540_1006816 | Ga0081540_10068168 | 252 |
| 607 | 3300006186 | Ga0075369_10160712 | Ga0075369_101607122 | 252 |
| 608 | 3300009551 | Ga0105238_10067496 | Ga0105238_100674962 | 252 |
| 609 | 3300035691 | Ga0373931_0082737 | Ga0373931_0082737_331_1155 | 252 |
| 610 | 3300049570 | Ga0501033_0095101 | Ga0501033_0095101_1257_2084 | 252 |
| 611 | 3300049574 | Ga0501038_0038331 | Ga0501038_0038331_2732_3559 | 252 |
| 612 | 3300049579 | Ga0501043_0094198 | Ga0501043_0094198_1434_2261 | 252 |
| 613 | 3300049586 | Ga0501070_0001743 | Ga0501070_0001743_10312_11154 | 252 |
| 614 | 3300049742 | Ga0501080_0120298 | Ga0501080_0120298_713_1555 | 252 |
| 615 | 3300049823 | Ga0501044_0124616 | Ga0501044_0124616_1257_2084 | 252 |
| 616 | 3300005983 | Ga0081540_1078604 | Ga0081540_10786042 | 253 |
| 617 | 3300006844 | Ga0075428_100005210 | Ga0075428_1000052104 | 253 |
| 618 | 3300006846 | Ga0075430_100001350 | Ga0075430_1000013509 | 253 |
| 619 | 3300006846 | Ga0075430_100002163 | Ga0075430_10000216310 | 253 |
| 620 | 3300006847 | Ga0075431_100000033 | Ga0075431_10000003372 | 253 |
| 621 | 3300006847 | Ga0075431_100001300 | Ga0075431_10000130010 | 253 |
| 622 | 3300006852 | Ga0075433_10000773 | Ga0075433_100007732 | 253 |
| 623 | 3300006871 | Ga0075434_100051349 | Ga0075434_1000513495 | 253 |
| 624 | 3300006880 | Ga0075429_100002588 | Ga0075429_10000258814 | 253 |
| 625 | 3300009094 | Ga0111539_10000591 | Ga0111539_1000059125 | 253 |
| 626 | 3300009094 | Ga0111539_10003260 | Ga0111539_1000326016 | 253 |
| 627 | 3300009147 | Ga0114129_10001565 | Ga0114129_100015654 | 253 |
| 628 | 3300009147 | Ga0114129_10002229 | Ga0114129_1000222915 | 253 |
| 629 | 3300027907 | Ga0207428_10003754 | Ga0207428_1000375412 | 253 |
| 630 | 3300031595 | Ga0265313_10040606 | Ga0265313_100406064 | 253 |
| 631 | 3300049571 | Ga0501034_0097324 | Ga0501034_0097324_2049_2879 | 253 |
| 632 | 3300049585 | Ga0501069_0013334 | Ga0501069_0013334_1192_2022 | 253 |
| 633 | 3300049588 | Ga0501072_0051161 | Ga0501072_0051161_397_1227 | 253 |
| 634 | 3300050507 | nmdc:mga05p37_14_c1 | nmdc:mga05p37_14_c1_78422_79234 | 253 |
| 635 | 3300050509 | nmdc:mga0qj67_6499_c1 | nmdc:mga0qj67_6499_c1_6521_7333 | 253 |
| 636 | 3300050510 | nmdc:mga06r32_1042_c1 | nmdc:mga06r32_1042_c1_9990_10802 | 253 |
| 637 | 3300050511 | nmdc:mga08y16_412_c1 | nmdc:mga08y16_412_c1_23846_24658 | 253 |
| 638 | 3300005327 | Ga0070658_10019528 | Ga0070658_100195285 | 254 |
| 639 | 3300005327 | Ga0070658_10210981 | Ga0070658_102109812 | 254 |
| 640 | 3300005339 | Ga0070660_100140184 | Ga0070660_1001401842 | 254 |
| 641 | 3300005530 | Ga0070679_100121585 | Ga0070679_1001215851 | 254 |
| 642 | 3300005563 | Ga0068855_100134934 | Ga0068855_1001349344 | 254 |
| 643 | 3300006038 | Ga0075365_10145156 | Ga0075365_101451562 | 254 |
| 644 | 3300009093 | Ga0105240_10014215 | Ga0105240_100142159 | 254 |
| 645 | 3300013102 | Ga0157371_10228999 | Ga0157371_102289992 | 254 |
| 646 | 3300013104 | Ga0157370_10085004 | Ga0157370_100850042 | 254 |
| 647 | 3300025295 | Ga0209564_1003207 | Ga0209564_100320712 | 254 |
| 648 | 3300025295 | Ga0209564_1007189 | Ga0209564_10071892 | 254 |
| 649 | 3300025297 | Ga0209758_1000188 | Ga0209758_100018873 | 254 |
| 650 | 3300025912 | Ga0207707_10129150 | Ga0207707_101291503 | 254 |
| 651 | 3300025917 | Ga0207660_10350955 | Ga0207660_103509552 | 254 |
| 652 | 3300025919 | Ga0207657_10054457 | Ga0207657_100544572 | 254 |
| 653 | 3300025921 | Ga0207652_10277686 | Ga0207652_102776863 | 254 |
| 654 | 3300026067 | Ga0207678_10131139 | Ga0207678_101311393 | 254 |
| 655 | 3300026142 | Ga0207698_10151368 | Ga0207698_101513682 | 254 |
| 656 | 3300027682 | Ga0209971_1038246 | Ga0209971_10382462 | 254 |
| 657 | 3300027695 | Ga0209966_1002708 | Ga0209966_10027082 | 254 |
| 658 | 3300027907 | Ga0207428_10000249 | Ga0207428_1000024935 | 254 |
| 659 | 3300028794 | Ga0307515_10072230 | Ga0307515_100722304 | 254 |
| 660 | 3300031247 | Ga0265340_10107260 | Ga0265340_101072602 | 254 |
| 661 | 3300031595 | Ga0265313_10018201 | Ga0265313_100182014 | 254 |
| 662 | 3300031691 | Ga0316579_10001412 | Ga0316579_1000141210 | 254 |
| 663 | 3300031712 | Ga0265342_10000760 | Ga0265342_100007605 | 254 |
| 664 | 3300035115 | Ga0373941_0002366 | Ga0373941_0002366_1632_2405 | 254 |
| 665 | 3300038443 | Ga0395901_0197059 | Ga0395901_0197059_51_872 | 254 |
| 666 | 3300039437 | Ga0436365_1447566 | Ga0436365_1447566_65_877 | 254 |
| 667 | 3300042001 | Ga0439441_018730 | Ga0439441_018730_310_1128 | 254 |
| 668 | 3300046512 | Ga0495610_0032405 | Ga0495610_0032405_842_1657 | 254 |
| 669 | 3300046513 | Ga0495616_0032785 | Ga0495616_0032785_1257_2072 | 254 |
| 670 | 3300046530 | Ga0495654_0007610 | Ga0495654_0007610_4417_5232 | 254 |
| 671 | 3300046665 | Ga0495661_0009175 | Ga0495661_0009175_4272_5087 | 254 |
| 672 | 3300046810 | Ga0495660_0085746 | Ga0495660_0085746_711_1526 | 254 |
| 673 | 3300047472 | Ga0495686_0065800 | Ga0495686_0065800_353_1168 | 254 |
| 674 | 3300048919 | Ga0496116_0019506 | Ga0496116_0019506_2233_3045 | 254 |
| 675 | 3300048920 | Ga0496117_0074133 | Ga0496117_0074133_608_1420 | 254 |
| 676 | 3300048921 | Ga0496118_0019231 | Ga0496118_0019231_2774_3586 | 254 |
| 677 | 3300048925 | Ga0496122_0047391 | Ga0496122_0047391_2060_2875 | 254 |
| 678 | 3300048926 | Ga0496123_0008887 | Ga0496123_0008887_3689_4504 | 254 |
| 679 | 3300048928 | Ga0496125_0003330 | Ga0496125_0003330_6460_7275 | 254 |
| 680 | 3300048929 | Ga0496126_0146656 | Ga0496126_0146656_307_1122 | 254 |
| 681 | 3300049569 | Ga0501032_0018148 | Ga0501032_0018148_2104_2934 | 254 |
| 682 | 3300049571 | Ga0501034_0110532 | Ga0501034_0110532_653_1483 | 254 |
| 683 | 3300049573 | Ga0501037_0311244 | Ga0501037_0311244_93_911 | 254 |
| 684 | 3300049575 | Ga0501039_0056584 | Ga0501039_0056584_823_1653 | 254 |
| 685 | 3300049580 | Ga0501046_0014686 | Ga0501046_0014686_4887_5717 | 254 |
| 686 | 3300049582 | Ga0501048_0050197 | Ga0501048_0050197_741_1571 | 254 |
| 687 | 3300049586 | Ga0501070_0059296 | Ga0501070_0059296_1090_1908 | 254 |
| 688 | 3300049586 | Ga0501070_0114425 | Ga0501070_0114425_94_924 | 254 |
| 689 | 3300049589 | Ga0501073_0264887 | Ga0501073_0264887_202_1020 | 254 |
| 690 | 3300049822 | Ga0501035_0104058 | Ga0501035_0104058_1434_2264 | 254 |
| 691 | 3300049823 | Ga0501044_0216259 | Ga0501044_0216259_405_1235 | 254 |
| 692 | 3300049823 | Ga0501044_0281587 | Ga0501044_0281587_274_1098 | 254 |
| 693 | 3300050492 | nmdc:mga0yw44_131765_c1 | nmdc:mga0yw44_131765_c1_325_1137 | 254 |
| 694 | 3300050492 | nmdc:mga0yw44_329581_c1 | nmdc:mga0yw44_329581_c1_165_980 | 254 |
| 695 | 3300050507 | nmdc:mga05p37_1602_c1 | nmdc:mga05p37_1602_c1_16142_16960 | 254 |
| 696 | 3300050508 | nmdc:mga09592_266882_c1 | nmdc:mga09592_266882_c1_502_1320 | 254 |
| 697 | 3300050509 | nmdc:mga0qj67_556_c1 | nmdc:mga0qj67_556_c1_8899_9717 | 254 |
| 698 | 3300050510 | nmdc:mga06r32_4708_c1 | nmdc:mga06r32_4708_c1_9295_10113 | 254 |
| 699 | 3300050511 | nmdc:mga08y16_4650_c1 | nmdc:mga08y16_4650_c1_3884_4702 | 254 |
| 700 | 3300050512 | nmdc:mga0n895_1478_c1 | nmdc:mga0n895_1478_c1_12711_13529 | 254 |
| 701 | 3300050515 | nmdc:mga0a205_416_c1 | nmdc:mga0a205_416_c1_11110_11928 | 254 |
| 702 | 3300053087 | Ga0500643_018322 | Ga0500643_018322_1461_2276 | 254 |
| 703 | 3300053090 | Ga0500646_0002674 | Ga0500646_0002674_3727_4542 | 254 |
| 704 | 3300053094 | Ga0500566_0011997 | Ga0500566_0011997_781_1593 | 254 |
| 705 | 3300053098 | Ga0500650_0001293 | Ga0500650_0001293_5505_6320 | 254 |
| 706 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_683089_683904 | 254 |
| 707 | 3300053109 | Ga0500569_022053 | Ga0500569_022053_463_1278 | 254 |
| 708 | 3300053109 | Ga0500569_065389 | Ga0500569_065389_177_992 | 254 |
| 709 | 3300053116 | Ga0500592_000901 | Ga0500592_000901_2567_3382 | 254 |
| 710 | 3300053122 | Ga0500608_005836 | Ga0500608_005836_2447_3259 | 254 |
| 711 | 3300053125 | Ga0500618_006905 | Ga0500618_006905_2439_3251 | 254 |
| 712 | 3300053130 | Ga0500642_0000010 | Ga0500642_0000010_6794_7609 | 254 |
| 713 | 3300053131 | Ga0500652_000817 | Ga0500652_000817_5714_6529 | 254 |
| 714 | 3300053136 | Ga0500559_0000638 | Ga0500559_0000638_19490_20302 | 254 |
| 715 | 3300053139 | Ga0500568_0000427 | Ga0500568_0000427_5800_6615 | 254 |
| 716 | 3300053142 | Ga0500577_0008280 | Ga0500577_0008280_1582_2397 | 254 |
| 717 | 3300053151 | Ga0500604_0006917 | Ga0500604_0006917_536_1351 | 254 |
| 718 | 3300053153 | Ga0500616_0000069 | Ga0500616_0000069_164316_165128 | 254 |
| 719 | 3300053156 | Ga0500622_0013995 | Ga0500622_0013995_2352_3167 | 254 |
| 720 | 3300053158 | Ga0500627_0014445 | Ga0500627_0014445_205_1020 | 254 |
| 721 | 3300053161 | Ga0500634_0031198 | Ga0500634_0031198_1072_1887 | 254 |
| 722 | 3300053177 | Ga0500636_0025635 | Ga0500636_0025635_1549_2361 | 254 |
| 723 | 3300053178 | Ga0500637_0053774 | Ga0500637_0053774_538_1350 | 254 |
| 724 | 3300001430 | JGI24032J14994_100064 | JGI24032J14994_1000642 | 255 |
| 725 | 3300001915 | JGI24741J21665_1009996 | JGI24741J21665_10099962 | 255 |
| 726 | 3300001977 | JGI24746J21847_1007449 | JGI24746J21847_10074492 | 255 |
| 727 | 3300001989 | JGI24739J22299_10017346 | JGI24739J22299_100173462 | 255 |
| 728 | 3300001990 | JGI24737J22298_10000724 | JGI24737J22298_100007249 | 255 |
| 729 | 3300002070 | JGI24750J21931_1000149 | JGI24750J21931_10001497 | 255 |
| 730 | 3300002073 | JGI24745J21846_1000167 | JGI24745J21846_10001673 | 255 |
| 731 | 3300002074 | JGI24748J21848_1003041 | JGI24748J21848_10030412 | 255 |
| 732 | 3300002075 | JGI24738J21930_10004692 | JGI24738J21930_100046922 | 255 |
| 733 | 3300002077 | JGI24744J21845_10010750 | JGI24744J21845_100107503 | 255 |
| 734 | 3300002126 | JGI24035J26624_1000153 | JGI24035J26624_10001535 | 255 |
| 735 | 3300002239 | JGI24034J26672_10002381 | JGI24034J26672_100023814 | 255 |
| 736 | 3300002244 | JGI24742J22300_10000767 | JGI24742J22300_100007676 | 255 |
| 737 | 3300002459 | JGI24751J29686_10025073 | JGI24751J29686_100250732 | 255 |
| 738 | 3300003215 | JGI25153J46596_10004855 | JGI25153J46596_100048556 | 255 |
| 739 | 3300003215 | JGI25153J46596_10018477 | JGI25153J46596_100184772 | 255 |
| 740 | 3300003354 | JGI25160J50197_1003444 | JGI25160J50197_10034447 | 255 |
| 741 | 3300003794 | Ga0055531_10007266 | Ga0055531_100072666 | 255 |
| 742 | 3300003911 | JGI25405J52794_10027767 | JGI25405J52794_100277671 | 255 |
| 743 | 3300003911 | JGI25405J52794_10041454 | JGI25405J52794_100414541 | 255 |
| 744 | 3300004625 | Ga0055543_1015857 | Ga0055543_10158572 | 255 |
| 745 | 3300005262 | Ga0065165_1005968 | Ga0065165_10059689 | 255 |
| 746 | 3300005290 | Ga0065712_10072881 | Ga0065712_100728815 | 255 |
| 747 | 3300005293 | Ga0065715_10091411 | Ga0065715_100914114 | 255 |
| 748 | 3300005327 | Ga0070658_10084492 | Ga0070658_100844922 | 255 |
| 749 | 3300005328 | Ga0070676_10000364 | Ga0070676_100003645 | 255 |
| 750 | 3300005329 | Ga0070683_100000806 | Ga0070683_1000008065 | 255 |
| 751 | 3300005330 | Ga0070690_100013151 | Ga0070690_1000131516 | 255 |
| 752 | 3300005331 | Ga0070670_100014265 | Ga0070670_1000142655 | 255 |
| 753 | 3300005333 | Ga0070677_10000212 | Ga0070677_1000021217 | 255 |
| 754 | 3300005334 | Ga0068869_100000618 | Ga0068869_1000006189 | 255 |
| 755 | 3300005335 | Ga0070666_10072031 | Ga0070666_100720312 | 255 |
| 756 | 3300005336 | Ga0070680_100069566 | Ga0070680_1000695663 | 255 |
| 757 | 3300005336 | Ga0070680_100129120 | Ga0070680_1001291202 | 255 |
| 758 | 3300005337 | Ga0070682_100001379 | Ga0070682_1000013792 | 255 |
| 759 | 3300005338 | Ga0068868_100168272 | Ga0068868_1001682723 | 255 |
| 760 | 3300005339 | Ga0070660_100001616 | Ga0070660_1000016164 | 255 |
| 761 | 3300005340 | Ga0070689_100000146 | Ga0070689_1000001463 | 255 |
| 762 | 3300005340 | Ga0070689_100012435 | Ga0070689_1000124354 | 255 |
| 763 | 3300005341 | Ga0070691_10010893 | Ga0070691_100108933 | 255 |
| 764 | 3300005343 | Ga0070687_100000023 | Ga0070687_10000002351 | 255 |
| 765 | 3300005343 | Ga0070687_100149412 | Ga0070687_1001494121 | 255 |
| 766 | 3300005344 | Ga0070661_100000407 | Ga0070661_1000004076 | 255 |
| 767 | 3300005345 | Ga0070692_10000270 | Ga0070692_1000027016 | 255 |
| 768 | 3300005347 | Ga0070668_100085972 | Ga0070668_1000859723 | 255 |
| 769 | 3300005347 | Ga0070668_100151569 | Ga0070668_1001515692 | 255 |
| 770 | 3300005353 | Ga0070669_100028955 | Ga0070669_1000289553 | 255 |
| 771 | 3300005354 | Ga0070675_100000306 | Ga0070675_10000030635 | 255 |
| 772 | 3300005355 | Ga0070671_100001042 | Ga0070671_1000010424 | 255 |
| 773 | 3300005355 | Ga0070671_100074469 | Ga0070671_1000744692 | 255 |
| 774 | 3300005355 | Ga0070671_100387605 | Ga0070671_1003876051 | 255 |
| 775 | 3300005356 | Ga0070674_100005171 | Ga0070674_1000051712 | 255 |
| 776 | 3300005356 | Ga0070674_100053206 | Ga0070674_1000532063 | 255 |
| 777 | 3300005356 | Ga0070674_100467101 | Ga0070674_1004671011 | 255 |
| 778 | 3300005364 | Ga0070673_100001407 | Ga0070673_1000014076 | 255 |
| 779 | 3300005364 | Ga0070673_100241878 | Ga0070673_1002418781 | 255 |
| 780 | 3300005365 | Ga0070688_100006871 | Ga0070688_1000068716 | 255 |
| 781 | 3300005365 | Ga0070688_100109653 | Ga0070688_1001096532 | 255 |
| 782 | 3300005366 | Ga0070659_100001563 | Ga0070659_10000156319 | 255 |
| 783 | 3300005366 | Ga0070659_100109074 | Ga0070659_1001090742 | 255 |
| 784 | 3300005366 | Ga0070659_100266364 | Ga0070659_1002663642 | 255 |
| 785 | 3300005367 | Ga0070667_100000745 | Ga0070667_1000007454 | 255 |
| 786 | 3300005406 | Ga0070703_10002920 | Ga0070703_100029205 | 255 |
| 787 | 3300005434 | Ga0070709_10022949 | Ga0070709_100229493 | 255 |
| 788 | 3300005434 | Ga0070709_10063355 | Ga0070709_100633554 | 255 |
| 789 | 3300005435 | Ga0070714_100050053 | Ga0070714_1000500534 | 255 |
| 790 | 3300005435 | Ga0070714_100072956 | Ga0070714_1000729563 | 255 |
| 791 | 3300005436 | Ga0070713_100081034 | Ga0070713_1000810342 | 255 |
| 792 | 3300005437 | Ga0070710_10036764 | Ga0070710_100367643 | 255 |
| 793 | 3300005438 | Ga0070701_10000746 | Ga0070701_1000074611 | 255 |
| 794 | 3300005439 | Ga0070711_100091516 | Ga0070711_1000915162 | 255 |
| 795 | 3300005439 | Ga0070711_100132456 | Ga0070711_1001324562 | 255 |
| 796 | 3300005440 | Ga0070705_100080798 | Ga0070705_1000807982 | 255 |
| 797 | 3300005441 | Ga0070700_100003377 | Ga0070700_1000033774 | 255 |
| 798 | 3300005444 | Ga0070694_100003105 | Ga0070694_1000031054 | 255 |
| 799 | 3300005445 | Ga0070708_100229275 | Ga0070708_1002292752 | 255 |
| 800 | 3300005455 | Ga0070663_100016281 | Ga0070663_1000162814 | 255 |
| 801 | 3300005456 | Ga0070678_100042226 | Ga0070678_1000422262 | 255 |
| 802 | 3300005456 | Ga0070678_100137581 | Ga0070678_1001375813 | 255 |
| 803 | 3300005456 | Ga0070678_100733257 | Ga0070678_1007332571 | 255 |
| 804 | 3300005457 | Ga0070662_100114670 | Ga0070662_1001146702 | 255 |
| 805 | 3300005458 | Ga0070681_10004011 | Ga0070681_1000401115 | 255 |
| 806 | 3300005458 | Ga0070681_10106630 | Ga0070681_101066302 | 255 |
| 807 | 3300005459 | Ga0068867_100014124 | Ga0068867_1000141242 | 255 |
| 808 | 3300005466 | Ga0070685_10115279 | Ga0070685_101152791 | 255 |
| 809 | 3300005518 | Ga0070699_100550967 | Ga0070699_1005509671 | 255 |
| 810 | 3300005530 | Ga0070679_100003609 | Ga0070679_1000036094 | 255 |
| 811 | 3300005530 | Ga0070679_100005467 | Ga0070679_1000054674 | 255 |
| 812 | 3300005535 | Ga0070684_100000454 | Ga0070684_10000045433 | 255 |
| 813 | 3300005535 | Ga0070684_100187988 | Ga0070684_1001879881 | 255 |
| 814 | 3300005539 | Ga0068853_100059818 | Ga0068853_1000598183 | 255 |
| 815 | 3300005543 | Ga0070672_100000045 | Ga0070672_10000004518 | 255 |
| 816 | 3300005544 | Ga0070686_100000480 | Ga0070686_10000048015 | 255 |
| 817 | 3300005545 | Ga0070695_100019377 | Ga0070695_1000193773 | 255 |
| 818 | 3300005546 | Ga0070696_100039744 | Ga0070696_1000397442 | 255 |
| 819 | 3300005547 | Ga0070693_100000286 | Ga0070693_1000002866 | 255 |
| 820 | 3300005548 | Ga0070665_100049034 | Ga0070665_1000490342 | 255 |
| 821 | 3300005548 | Ga0070665_100237145 | Ga0070665_1002371452 | 255 |
| 822 | 3300005549 | Ga0070704_100006095 | Ga0070704_1000060954 | 255 |
| 823 | 3300005563 | Ga0068855_100006104 | Ga0068855_10000610414 | 255 |
| 824 | 3300005564 | Ga0070664_100000899 | Ga0070664_10000089916 | 255 |
| 825 | 3300005577 | Ga0068857_100000623 | Ga0068857_10000062332 | 255 |
| 826 | 3300005577 | Ga0068857_100450183 | Ga0068857_1004501832 | 255 |
| 827 | 3300005577 | Ga0068857_100493915 | Ga0068857_1004939152 | 255 |
| 828 | 3300005578 | Ga0068854_100005892 | Ga0068854_1000058928 | 255 |
| 829 | 3300005614 | Ga0068856_100012141 | Ga0068856_1000121418 | 255 |
| 830 | 3300005614 | Ga0068856_100059599 | Ga0068856_1000595993 | 255 |
| 831 | 3300005615 | Ga0070702_100003379 | Ga0070702_1000033796 | 255 |
| 832 | 3300005616 | Ga0068852_100005047 | Ga0068852_1000050475 | 255 |
| 833 | 3300005617 | Ga0068859_100020794 | Ga0068859_1000207947 | 255 |
| 834 | 3300005618 | Ga0068864_100008403 | Ga0068864_1000084038 | 255 |
| 835 | 3300005618 | Ga0068864_100297727 | Ga0068864_1002977272 | 255 |
| 836 | 3300005718 | Ga0068866_10000346 | Ga0068866_1000034626 | 255 |
| 837 | 3300005719 | Ga0068861_100000045 | Ga0068861_10000004546 | 255 |
| 838 | 3300005840 | Ga0068870_10000213 | Ga0068870_1000021310 | 255 |
| 839 | 3300005841 | Ga0068863_100001919 | Ga0068863_1000019199 | 255 |
| 840 | 3300005841 | Ga0068863_100173882 | Ga0068863_1001738821 | 255 |
| 841 | 3300005842 | Ga0068858_100000307 | Ga0068858_10000030759 | 255 |
| 842 | 3300005842 | Ga0068858_100225095 | Ga0068858_1002250952 | 255 |
| 843 | 3300005842 | Ga0068858_100684166 | Ga0068858_1006841662 | 255 |
| 844 | 3300005843 | Ga0068860_100001587 | Ga0068860_10000158730 | 255 |
| 845 | 3300005844 | Ga0068862_100011664 | Ga0068862_1000116643 | 255 |
| 846 | 3300005844 | Ga0068862_100565425 | Ga0068862_1005654252 | 255 |
| 847 | 3300005937 | Ga0081455_10002522 | Ga0081455_100025229 | 255 |
| 848 | 3300005937 | Ga0081455_10018661 | Ga0081455_100186617 | 255 |
| 849 | 3300005937 | Ga0081455_10020448 | Ga0081455_100204487 | 255 |
| 850 | 3300006028 | Ga0070717_10106892 | Ga0070717_101068924 | 255 |
| 851 | 3300006038 | Ga0075365_10126856 | Ga0075365_101268562 | 255 |
| 852 | 3300006038 | Ga0075365_10172650 | Ga0075365_101726502 | 255 |
| 853 | 3300006042 | Ga0075368_10068375 | Ga0075368_100683752 | 255 |
| 854 | 3300006051 | Ga0075364_10114295 | Ga0075364_101142952 | 255 |
| 855 | 3300006163 | Ga0070715_10045681 | Ga0070715_100456812 | 255 |
| 856 | 3300006175 | Ga0070712_100024400 | Ga0070712_1000244004 | 255 |
| 857 | 3300006175 | Ga0070712_100100891 | Ga0070712_1001008911 | 255 |
| 858 | 3300006178 | Ga0075367_10262485 | Ga0075367_102624852 | 255 |
| 859 | 3300006186 | Ga0075369_10107306 | Ga0075369_101073062 | 255 |
| 860 | 3300006195 | Ga0075366_10193124 | Ga0075366_101931241 | 255 |
| 861 | 3300006237 | Ga0097621_100000587 | Ga0097621_10000058718 | 255 |
| 862 | 3300006353 | Ga0075370_10101365 | Ga0075370_101013652 | 255 |
| 863 | 3300006358 | Ga0068871_100002886 | Ga0068871_1000028869 | 255 |
| 864 | 3300006852 | Ga0075433_10005102 | Ga0075433_100051026 | 255 |
| 865 | 3300006871 | Ga0075434_100001539 | Ga0075434_10000153925 | 255 |
| 866 | 3300006871 | Ga0075434_100045067 | Ga0075434_1000450673 | 255 |
| 867 | 3300006881 | Ga0068865_100007664 | Ga0068865_1000076644 | 255 |
| 868 | 3300006881 | Ga0068865_100324896 | Ga0068865_1003248962 | 255 |
| 869 | 3300006931 | Ga0097620_100020792 | Ga0097620_1000207923 | 255 |
| 870 | 3300006941 | Ga0099825_1035142 | Ga0099825_10351422 | 255 |
| 871 | 3300006942 | Ga0099824_1020964 | Ga0099824_10209643 | 255 |
| 872 | 3300006944 | Ga0099823_1016923 | Ga0099823_10169237 | 255 |
| 873 | 3300007076 | Ga0075435_100126575 | Ga0075435_1001265752 | 255 |
| 874 | 3300009092 | Ga0105250_10066785 | Ga0105250_100667852 | 255 |
| 875 | 3300009093 | Ga0105240_10058395 | Ga0105240_100583952 | 255 |
| 876 | 3300009093 | Ga0105240_10524839 | Ga0105240_105248391 | 255 |
| 877 | 3300009094 | Ga0111539_10018995 | Ga0111539_100189958 | 255 |
| 878 | 3300009094 | Ga0111539_10106104 | Ga0111539_101061044 | 255 |
| 879 | 3300009094 | Ga0111539_11020670 | Ga0111539_110206701 | 255 |
| 880 | 3300009098 | Ga0105245_10001033 | Ga0105245_1000103329 | 255 |
| 881 | 3300009101 | Ga0105247_10020518 | Ga0105247_100205183 | 255 |
| 882 | 3300009148 | Ga0105243_10000678 | Ga0105243_1000067833 | 255 |
| 883 | 3300009174 | Ga0105241_10008618 | Ga0105241_100086187 | 255 |
| 884 | 3300009174 | Ga0105241_10043729 | Ga0105241_100437292 | 255 |
| 885 | 3300009176 | Ga0105242_10002866 | Ga0105242_100028664 | 255 |
| 886 | 3300009176 | Ga0105242_10353968 | Ga0105242_103539682 | 255 |
| 887 | 3300009177 | Ga0105248_10042833 | Ga0105248_100428335 | 255 |
| 888 | 3300009545 | Ga0105237_10078806 | Ga0105237_100788063 | 255 |
| 889 | 3300009551 | Ga0105238_10055605 | Ga0105238_100556054 | 255 |
| 890 | 3300009553 | Ga0105249_10000540 | Ga0105249_100005404 | 255 |
| 891 | 3300010375 | Ga0105239_10013892 | Ga0105239_100138929 | 255 |
| 892 | 3300010375 | Ga0105239_10024564 | Ga0105239_100245643 | 255 |
| 893 | 3300011119 | Ga0105246_10010105 | Ga0105246_100101054 | 255 |
| 894 | 3300013102 | Ga0157371_10096347 | Ga0157371_100963474 | 255 |
| 895 | 3300013104 | Ga0157370_10319063 | Ga0157370_103190632 | 255 |
| 896 | 3300013296 | Ga0157374_10460154 | Ga0157374_104601542 | 255 |
| 897 | 3300013296 | Ga0157374_10758182 | Ga0157374_107581821 | 255 |
| 898 | 3300013297 | Ga0157378_10002535 | Ga0157378_1000253511 | 255 |
| 899 | 3300013306 | Ga0163162_10033221 | Ga0163162_100332214 | 255 |
| 900 | 3300013307 | Ga0157372_10015130 | Ga0157372_100151306 | 255 |
| 901 | 3300013307 | Ga0157372_10257960 | Ga0157372_102579602 | 255 |
| 902 | 3300013307 | Ga0157372_10527575 | Ga0157372_105275752 | 255 |
| 903 | 3300013308 | Ga0157375_10013069 | Ga0157375_100130694 | 255 |
| 904 | 3300014325 | Ga0163163_10009083 | Ga0163163_100090839 | 255 |
| 905 | 3300014325 | Ga0163163_10359971 | Ga0163163_103599712 | 255 |
| 906 | 3300014326 | Ga0157380_10003874 | Ga0157380_1000387410 | 255 |
| 907 | 3300014745 | Ga0157377_10000653 | Ga0157377_100006538 | 255 |
| 908 | 3300014968 | Ga0157379_10000135 | Ga0157379_1000013558 | 255 |
| 909 | 3300014969 | Ga0157376_10001353 | Ga0157376_1000135313 | 255 |
| 910 | 3300017792 | Ga0163161_10007225 | Ga0163161_100072258 | 255 |
| 911 | 3300021320 | Ga0214544_1000051 | Ga0214544_100005161 | 255 |
| 912 | 3300021321 | Ga0214542_1000149 | Ga0214542_100014945 | 255 |
| 913 | 3300021324 | Ga0214545_1000126 | Ga0214545_100012615 | 255 |
| 914 | 3300021327 | Ga0214543_1000148 | Ga0214543_100014850 | 255 |
| 915 | 3300021388 | Ga0213875_10000023 | Ga0213875_10000023195 | 255 |
| 916 | 3300021388 | Ga0213875_10053745 | Ga0213875_100537453 | 255 |
| 917 | 3300025245 | Ga0207425_1009482 | Ga0207425_10094824 | 255 |
| 918 | 3300025253 | Ga0209677_101621 | Ga0209677_1016219 | 255 |
| 919 | 3300025254 | Ga0209148_1000258 | Ga0209148_100025864 | 255 |
| 920 | 3300025261 | Ga0209233_1030272 | Ga0209233_10302722 | 255 |
| 921 | 3300025271 | Ga0207666_1000021 | Ga0207666_100002120 | 255 |
| 922 | 3300025272 | Ga0209455_1001530 | Ga0209455_10015308 | 255 |
| 923 | 3300025290 | Ga0207673_1000062 | Ga0207673_10000622 | 255 |
| 924 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021183 | 255 |
| 925 | 3300025297 | Ga0209758_1000521 | Ga0209758_10005218 | 255 |
| 926 | 3300025297 | Ga0209758_1003026 | Ga0209758_100302615 | 255 |
| 927 | 3300025297 | Ga0209758_1039249 | Ga0209758_10392492 | 255 |
| 928 | 3300025297 | Ga0209758_1047475 | Ga0209758_10474752 | 255 |
| 929 | 3300025299 | Ga0209256_1004268 | Ga0209256_10042686 | 255 |
| 930 | 3300025302 | Ga0207426_1002095 | Ga0207426_10020958 | 255 |
| 931 | 3300025302 | Ga0207426_1007289 | Ga0207426_10072892 | 255 |
| 932 | 3300025304 | Ga0209257_1002487 | Ga0209257_10024873 | 255 |
| 933 | 3300025304 | Ga0209257_1021911 | Ga0209257_10219112 | 255 |
| 934 | 3300025315 | Ga0207697_10001014 | Ga0207697_1000101418 | 255 |
| 935 | 3300025885 | Ga0207653_10001128 | Ga0207653_100011284 | 255 |
| 936 | 3300025893 | Ga0207682_10000796 | Ga0207682_100007963 | 255 |
| 937 | 3300025899 | Ga0207642_10000764 | Ga0207642_100007647 | 255 |
| 938 | 3300025900 | Ga0207710_10019312 | Ga0207710_100193122 | 255 |
| 939 | 3300025901 | Ga0207688_10000017 | Ga0207688_100000174 | 255 |
| 940 | 3300025901 | Ga0207688_10057579 | Ga0207688_100575792 | 255 |
| 941 | 3300025903 | Ga0207680_10017854 | Ga0207680_100178542 | 255 |
| 942 | 3300025904 | Ga0207647_10003774 | Ga0207647_1000377411 | 255 |
| 943 | 3300025905 | Ga0207685_10002303 | Ga0207685_100023033 | 255 |
| 944 | 3300025905 | Ga0207685_10182282 | Ga0207685_101822821 | 255 |
| 945 | 3300025906 | Ga0207699_10023853 | Ga0207699_100238532 | 255 |
| 946 | 3300025906 | Ga0207699_10170170 | Ga0207699_101701702 | 255 |
| 947 | 3300025907 | Ga0207645_10000074 | Ga0207645_100000748 | 255 |
| 948 | 3300025907 | Ga0207645_10023855 | Ga0207645_100238556 | 255 |
| 949 | 3300025908 | Ga0207643_10000058 | Ga0207643_1000005817 | 255 |
| 950 | 3300025911 | Ga0207654_10004287 | Ga0207654_100042878 | 255 |
| 951 | 3300025912 | Ga0207707_10019779 | Ga0207707_100197795 | 255 |
| 952 | 3300025913 | Ga0207695_10157011 | Ga0207695_101570112 | 255 |
| 953 | 3300025914 | Ga0207671_10191532 | Ga0207671_101915322 | 255 |
| 954 | 3300025915 | Ga0207693_10001855 | Ga0207693_100018551 | 255 |
| 955 | 3300025915 | Ga0207693_10002979 | Ga0207693_1000297912 | 255 |
| 956 | 3300025916 | Ga0207663_10036931 | Ga0207663_100369313 | 255 |
| 957 | 3300025916 | Ga0207663_10068961 | Ga0207663_100689612 | 255 |
| 958 | 3300025916 | Ga0207663_10252136 | Ga0207663_102521362 | 255 |
| 959 | 3300025917 | Ga0207660_10000578 | Ga0207660_1000057826 | 255 |
| 960 | 3300025918 | Ga0207662_10000069 | Ga0207662_100000692 | 255 |
| 961 | 3300025919 | Ga0207657_10000721 | Ga0207657_1000072138 | 255 |
| 962 | 3300025920 | Ga0207649_10000282 | Ga0207649_1000028242 | 255 |
| 963 | 3300025921 | Ga0207652_10001198 | Ga0207652_1000119817 | 255 |
| 964 | 3300025921 | Ga0207652_10162753 | Ga0207652_101627531 | 255 |
| 965 | 3300025923 | Ga0207681_10000806 | Ga0207681_1000080613 | 255 |
| 966 | 3300025925 | Ga0207650_10005569 | Ga0207650_100055698 | 255 |
| 967 | 3300025925 | Ga0207650_10158976 | Ga0207650_101589763 | 255 |
| 968 | 3300025926 | Ga0207659_10000039 | Ga0207659_1000003978 | 255 |
| 969 | 3300025927 | Ga0207687_10000458 | Ga0207687_100004589 | 255 |
| 970 | 3300025928 | Ga0207700_10065675 | Ga0207700_100656752 | 255 |
| 971 | 3300025928 | Ga0207700_10107159 | Ga0207700_101071591 | 255 |
| 972 | 3300025929 | Ga0207664_10018448 | Ga0207664_100184482 | 255 |
| 973 | 3300025929 | Ga0207664_10055368 | Ga0207664_100553685 | 255 |
| 974 | 3300025931 | Ga0207644_10021949 | Ga0207644_100219493 | 255 |
| 975 | 3300025931 | Ga0207644_10032996 | Ga0207644_100329962 | 255 |
| 976 | 3300025932 | Ga0207690_10000303 | Ga0207690_100003032 | 255 |
| 977 | 3300025933 | Ga0207706_10063888 | Ga0207706_100638884 | 255 |
| 978 | 3300025934 | Ga0207686_10000540 | Ga0207686_1000054012 | 255 |
| 979 | 3300025934 | Ga0207686_10220270 | Ga0207686_102202702 | 255 |
| 980 | 3300025935 | Ga0207709_10000894 | Ga0207709_100008944 | 255 |
| 981 | 3300025935 | Ga0207709_10428152 | Ga0207709_104281521 | 255 |
| 982 | 3300025936 | Ga0207670_10000200 | Ga0207670_100002006 | 255 |
| 983 | 3300025936 | Ga0207670_10002609 | Ga0207670_100026093 | 255 |
| 984 | 3300025937 | Ga0207669_10000098 | Ga0207669_1000009831 | 255 |
| 985 | 3300025937 | Ga0207669_10010480 | Ga0207669_100104806 | 255 |
| 986 | 3300025938 | Ga0207704_10012394 | Ga0207704_100123945 | 255 |
| 987 | 3300025938 | Ga0207704_10147818 | Ga0207704_101478182 | 255 |
| 988 | 3300025938 | Ga0207704_10440512 | Ga0207704_104405122 | 255 |
| 989 | 3300025939 | Ga0207665_10189776 | Ga0207665_101897762 | 255 |
| 990 | 3300025940 | Ga0207691_10000169 | Ga0207691_100001692 | 255 |
| 991 | 3300025940 | Ga0207691_10230390 | Ga0207691_102303902 | 255 |
| 992 | 3300025941 | Ga0207711_10008085 | Ga0207711_100080854 | 255 |
| 993 | 3300025941 | Ga0207711_10283371 | Ga0207711_102833711 | 255 |
| 994 | 3300025942 | Ga0207689_10001003 | Ga0207689_1000100317 | 255 |
| 995 | 3300025942 | Ga0207689_10491258 | Ga0207689_104912582 | 255 |
| 996 | 3300025944 | Ga0207661_10014106 | Ga0207661_100141065 | 255 |
| 997 | 3300025945 | Ga0207679_10000030 | Ga0207679_1000003032 | 255 |
| 998 | 3300025949 | Ga0207667_10054202 | Ga0207667_100542024 | 255 |
| 999 | 3300025949 | Ga0207667_10485141 | Ga0207667_104851412 | 255 |
| 1000 | 3300025960 | Ga0207651_10000213 | Ga0207651_1000021317 | 255 |
| 1001 | 3300025961 | Ga0207712_10000473 | Ga0207712_1000047337 | 255 |
| 1002 | 3300025972 | Ga0207668_10000220 | Ga0207668_1000022032 | 255 |
| 1003 | 3300025972 | Ga0207668_10421124 | Ga0207668_104211241 | 255 |
| 1004 | 3300025981 | Ga0207640_10000573 | Ga0207640_1000057317 | 255 |
| 1005 | 3300025986 | Ga0207658_10120158 | Ga0207658_101201583 | 255 |
| 1006 | 3300026023 | Ga0207677_10000513 | Ga0207677_1000051323 | 255 |
| 1007 | 3300026035 | Ga0207703_10314978 | Ga0207703_103149782 | 255 |
| 1008 | 3300026041 | Ga0207639_10003256 | Ga0207639_1000325610 | 255 |
| 1009 | 3300026067 | Ga0207678_10003592 | Ga0207678_1000359215 | 255 |
| 1010 | 3300026067 | Ga0207678_10141866 | Ga0207678_101418661 | 255 |
| 1011 | 3300026075 | Ga0207708_10000428 | Ga0207708_100004284 | 255 |
| 1012 | 3300026078 | Ga0207702_10005939 | Ga0207702_100059392 | 255 |
| 1013 | 3300026088 | Ga0207641_10002043 | Ga0207641_100020435 | 255 |
| 1014 | 3300026088 | Ga0207641_10082469 | Ga0207641_100824691 | 255 |
| 1015 | 3300026089 | Ga0207648_10028973 | Ga0207648_100289736 | 255 |
| 1016 | 3300026089 | Ga0207648_10067409 | Ga0207648_100674092 | 255 |
| 1017 | 3300026095 | Ga0207676_10001467 | Ga0207676_1000146711 | 255 |
| 1018 | 3300026116 | Ga0207674_10000135 | Ga0207674_1000013570 | 255 |
| 1019 | 3300026116 | Ga0207674_10481295 | Ga0207674_104812952 | 255 |
| 1020 | 3300026118 | Ga0207675_100000245 | Ga0207675_10000024558 | 255 |
| 1021 | 3300026121 | Ga0207683_10000136 | Ga0207683_1000013667 | 255 |
| 1022 | 3300026142 | Ga0207698_10000828 | Ga0207698_100008287 | 255 |
| 1023 | 3300027252 | Ga0209973_1000324 | Ga0209973_10003242 | 255 |
| 1024 | 3300027296 | Ga0209389_1000041 | Ga0209389_1000041111 | 255 |
| 1025 | 3300027296 | Ga0209389_1000656 | Ga0209389_100065614 | 255 |
| 1026 | 3300027357 | Ga0209589_1000874 | Ga0209589_100087434 | 255 |
| 1027 | 3300027361 | Ga0209489_100178 | Ga0209489_10017893 | 255 |
| 1028 | 3300027361 | Ga0209489_105228 | Ga0209489_10522818 | 255 |
| 1029 | 3300027363 | Ga0209700_100010 | Ga0209700_100010406 | 255 |
| 1030 | 3300027614 | Ga0209970_1004161 | Ga0209970_10041612 | 255 |
| 1031 | 3300027617 | Ga0210002_1000224 | Ga0210002_10002244 | 255 |
| 1032 | 3300027717 | Ga0209998_10019780 | Ga0209998_100197801 | 255 |
| 1033 | 3300027876 | Ga0209974_10003611 | Ga0209974_100036114 | 255 |
| 1034 | 3300027907 | Ga0207428_10000471 | Ga0207428_1000047114 | 255 |
| 1035 | 3300027907 | Ga0207428_10264038 | Ga0207428_102640382 | 255 |
| 1036 | 3300028379 | Ga0268266_10007483 | Ga0268266_100074832 | 255 |
| 1037 | 3300028379 | Ga0268266_10236688 | Ga0268266_102366882 | 255 |
| 1038 | 3300028379 | Ga0268266_10691380 | Ga0268266_106913801 | 255 |
| 1039 | 3300028380 | Ga0268265_10001888 | Ga0268265_100018883 | 255 |
| 1040 | 3300028381 | Ga0268264_10000693 | Ga0268264_1000069334 | 255 |
| 1041 | 3300028800 | Ga0265338_10047667 | Ga0265338_100476675 | 255 |
| 1042 | 3300031241 | Ga0265325_10006332 | Ga0265325_100063328 | 255 |
| 1043 | 3300031241 | Ga0265325_10021820 | Ga0265325_100218205 | 255 |
| 1044 | 3300031249 | Ga0265339_10010010 | Ga0265339_100100104 | 255 |
| 1045 | 3300031595 | Ga0265313_10000106 | Ga0265313_1000010639 | 255 |
| 1046 | 3300031711 | Ga0265314_10023262 | Ga0265314_100232626 | 255 |
| 1047 | 3300034818 | Ga0373950_0004083 | Ga0373950_0004083_484_1302 | 255 |
| 1048 | 3300034819 | Ga0373958_0004047 | Ga0373958_0004047_736_1554 | 255 |
| 1049 | 3300034957 | Ga0373938_0001584 | Ga0373938_0001584_2388_3206 | 255 |
| 1050 | 3300034957 | Ga0373938_0007424 | Ga0373938_0007424_676_1488 | 255 |
| 1051 | 3300035083 | Ga0373926_0009755 | Ga0373926_0009755_180_998 | 255 |
| 1052 | 3300035084 | Ga0373928_0001828 | Ga0373928_0001828_3290_4108 | 255 |
| 1053 | 3300035088 | Ga0373940_0074425 | Ga0373940_0074425_128_946 | 255 |
| 1054 | 3300035089 | Ga0373944_0021434 | Ga0373944_0021434_27_845 | 255 |
| 1055 | 3300035090 | Ga0373949_0016957 | Ga0373949_0016957_561_1379 | 255 |
| 1056 | 3300035092 | Ga0373952_0001190 | Ga0373952_0001190_505_1323 | 255 |
| 1057 | 3300035111 | Ga0373923_0004598 | Ga0373923_0004598_2900_3718 | 255 |
| 1058 | 3300035111 | Ga0373923_0074895 | Ga0373923_0074895_427_1230 | 255 |
| 1059 | 3300035112 | Ga0373932_0002449 | Ga0373932_0002449_3503_4321 | 255 |
| 1060 | 3300035113 | Ga0373936_0062523 | Ga0373936_0062523_201_1019 | 255 |
| 1061 | 3300035114 | Ga0373939_0000864 | Ga0373939_0000864_226_1044 | 255 |
| 1062 | 3300035115 | Ga0373941_0010544 | Ga0373941_0010544_852_1670 | 255 |
| 1063 | 3300035116 | Ga0373945_0012224 | Ga0373945_0012224_622_1440 | 255 |
| 1064 | 3300035118 | Ga0373954_0005819 | Ga0373954_0005819_2682_3500 | 255 |
| 1065 | 3300035118 | Ga0373954_0011248 | Ga0373954_0011248_2729_3547 | 255 |
| 1066 | 3300035120 | Ga0373957_0011405 | Ga0373957_0011405_1293_2111 | 255 |
| 1067 | 3300035121 | Ga0373960_0013864 | Ga0373960_0013864_759_1577 | 255 |
| 1068 | 3300035170 | Ga0373943_0108743 | Ga0373943_0108743_301_1119 | 255 |
| 1069 | 3300035171 | Ga0373946_0003666 | Ga0373946_0003666_260_1078 | 255 |
| 1070 | 3300035172 | Ga0373955_0000762 | Ga0373955_0000762_4042_4860 | 255 |
| 1071 | 3300035207 | Ga0373942_0003044 | Ga0373942_0003044_2545_3363 | 255 |
| 1072 | 3300035207 | Ga0373942_0081988 | Ga0373942_0081988_95_907 | 255 |
| 1073 | 3300035241 | Ga0373961_0003482 | Ga0373961_0003482_1587_2405 | 255 |
| 1074 | 3300035242 | Ga0373962_0003932 | Ga0373962_0003932_2091_2909 | 255 |
| 1075 | 3300035410 | Ga0373924_0042212 | Ga0373924_0042212_767_1585 | 255 |
| 1076 | 3300035691 | Ga0373931_0013105 | Ga0373931_0013105_1776_2594 | 255 |
| 1077 | 3300035691 | Ga0373931_0029721 | Ga0373931_0029721_816_1631 | 255 |
| 1078 | 3300035691 | Ga0373931_0324496 | Ga0373931_0324496_78_914 | 255 |
| 1079 | 3300035692 | Ga0373935_0021704 | Ga0373935_0021704_2814_3632 | 255 |
| 1080 | 3300035695 | Ga0373927_0030686 | Ga0373927_0030686_300_1118 | 255 |
| 1081 | 3300035695 | Ga0373927_0231721 | Ga0373927_0231721_22_837 | 255 |
| 1082 | 3300035724 | Ga0373933_0006917 | Ga0373933_0006917_3938_4756 | 255 |
| 1083 | 3300035725 | Ga0373947_0235271 | Ga0373947_0235271_340_1158 | 255 |
| 1084 | 3300035725 | Ga0373947_0371578 | Ga0373947_0371578_89_904 | 255 |
| 1085 | 3300036401 | Ga0373937_0002201 | Ga0373937_0002201_3085_3903 | 255 |
| 1086 | 3300036401 | Ga0373937_0100680 | Ga0373937_0100680_1447_2265 | 255 |
| 1087 | 3300037068 | Ga0373925_0411768 | Ga0373925_0411768_92_910 | 255 |
| 1088 | 3300037418 | Ga0395900_0000591 | Ga0395900_0000591_15395_16207 | 255 |
| 1089 | 3300037418 | Ga0395900_0136111 | Ga0395900_0136111_1095_1901 | 255 |
| 1090 | 3300037466 | Ga0395898_0056665 | Ga0395898_0056665_312_1124 | 255 |
| 1091 | 3300037471 | Ga0395905_0004439 | Ga0395905_0004439_12232_13044 | 255 |
| 1092 | 3300037471 | Ga0395905_0014655 | Ga0395905_0014655_6512_7321 | 255 |
| 1093 | 3300037471 | Ga0395905_0161440 | Ga0395905_0161440_428_1234 | 255 |
| 1094 | 3300037471 | Ga0395905_0390471 | Ga0395905_0390471_349_1161 | 255 |
| 1095 | 3300037853 | Ga0436364_1194418 | Ga0436364_1194418_4646_5446 | 255 |
| 1096 | 3300037853 | Ga0436364_1458556 | Ga0436364_1458556_3480_4289 | 255 |
| 1097 | 3300038443 | Ga0395901_0066685 | Ga0395901_0066685_1397_2209 | 255 |
| 1098 | 3300038443 | Ga0395901_0589699 | Ga0395901_0589699_144_956 | 255 |
| 1099 | 3300038443 | Ga0395901_0829009 | Ga0395901_0829009_73_885 | 255 |
| 1100 | 3300039437 | Ga0436365_0156573 | Ga0436365_0156573_303_1103 | 255 |
| 1101 | 3300039437 | Ga0436365_1283964 | Ga0436365_1283964_752_1561 | 255 |
| 1102 | 3300039450 | Ga0436363_1166084 | Ga0436363_1166084_631_1443 | 255 |
| 1103 | 3300044683 | Ga0466965_0003867 | Ga0466965_0003867_5747_6562 | 255 |
| 1104 | 3300044684 | Ga0466966_0002892 | Ga0466966_0002892_808_1620 | 255 |
| 1105 | 3300044693 | Ga0466961_0000162 | Ga0466961_0000162_43254_44066 | 255 |
| 1106 | 3300044694 | Ga0466963_0010036 | Ga0466963_0010036_655_1467 | 255 |
| 1107 | 3300044901 | Ga0466960_0097009 | Ga0466960_0097009_20_832 | 255 |
| 1108 | 3300045976 | Ga0466967_0058654 | Ga0466967_0058654_2177_2989 | 255 |
| 1109 | 3300046454 | Ga0495592_0066959 | Ga0495592_0066959_1481_2299 | 255 |
| 1110 | 3300046455 | Ga0495603_0090503 | Ga0495603_0090503_360_1178 | 255 |
| 1111 | 3300046459 | Ga0495629_0147181 | Ga0495629_0147181_612_1430 | 255 |
| 1112 | 3300046460 | Ga0495638_0002361 | Ga0495638_0002361_4689_5498 | 255 |
| 1113 | 3300046460 | Ga0495638_0116776 | Ga0495638_0116776_101_934 | 255 |
| 1114 | 3300046461 | Ga0495641_0020397 | Ga0495641_0020397_479_1297 | 255 |
| 1115 | 3300046462 | Ga0495651_0035792 | Ga0495651_0035792_1432_2250 | 255 |
| 1116 | 3300046463 | Ga0495653_0034049 | Ga0495653_0034049_933_1751 | 255 |
| 1117 | 3300046463 | Ga0495653_0124767 | Ga0495653_0124767_810_1628 | 255 |
| 1118 | 3300046472 | Ga0495580_0004803 | Ga0495580_0004803_8861_9679 | 255 |
| 1119 | 3300046473 | Ga0495582_0074009 | Ga0495582_0074009_898_1716 | 255 |
| 1120 | 3300046475 | Ga0495639_0006464 | Ga0495639_0006464_190_1008 | 255 |
| 1121 | 3300046476 | Ga0495662_0003963 | Ga0495662_0003963_4030_4848 | 255 |
| 1122 | 3300046477 | Ga0495664_0011474 | Ga0495664_0011474_4106_4924 | 255 |
| 1123 | 3300046491 | Ga0495584_0071227 | Ga0495584_0071227_50_868 | 255 |
| 1124 | 3300046499 | Ga0495594_0052867 | Ga0495594_0052867_1160_1978 | 255 |
| 1125 | 3300046511 | Ga0495608_0069496 | Ga0495608_0069496_1102_1920 | 255 |
| 1126 | 3300046514 | Ga0495618_0047041 | Ga0495618_0047041_207_1025 | 255 |
| 1127 | 3300046516 | Ga0495628_0088097 | Ga0495628_0088097_166_981 | 255 |
| 1128 | 3300046516 | Ga0495628_0150472 | Ga0495628_0150472_462_1280 | 255 |
| 1129 | 3300046517 | Ga0495630_0009062 | Ga0495630_0009062_3835_4653 | 255 |
| 1130 | 3300046518 | Ga0495631_0043961 | Ga0495631_0043961_197_1015 | 255 |
| 1131 | 3300046520 | Ga0495637_0060628 | Ga0495637_0060628_659_1477 | 255 |
| 1132 | 3300046523 | Ga0495644_0000276 | Ga0495644_0000276_8262_9080 | 255 |
| 1133 | 3300046526 | Ga0495666_0010279 | Ga0495666_0010279_2680_3498 | 255 |
| 1134 | 3300046529 | Ga0495652_0055761 | Ga0495652_0055761_278_1096 | 255 |
| 1135 | 3300046531 | Ga0495665_0013872 | Ga0495665_0013872_1952_2770 | 255 |
| 1136 | 3300046535 | Ga0495586_0010130 | Ga0495586_0010130_4034_4852 | 255 |
| 1137 | 3300046536 | Ga0495587_0005259 | Ga0495587_0005259_7233_8051 | 255 |
| 1138 | 3300046557 | Ga0495622_0021826 | Ga0495622_0021826_1140_1958 | 255 |
| 1139 | 3300046558 | Ga0495633_0084274 | Ga0495633_0084274_257_1075 | 255 |
| 1140 | 3300046559 | Ga0495667_0005630 | Ga0495667_0005630_2640_3458 | 255 |
| 1141 | 3300046559 | Ga0495667_0194119 | Ga0495667_0194119_333_1151 | 255 |
| 1142 | 3300046615 | Ga0495656_0023120 | Ga0495656_0023120_1043_1861 | 255 |
| 1143 | 3300046663 | Ga0495635_0020965 | Ga0495635_0020965_2032_2850 | 255 |
| 1144 | 3300046664 | Ga0495659_0000313 | Ga0495659_0000313_4871_5689 | 255 |
| 1145 | 3300046674 | Ga0495588_0070004 | Ga0495588_0070004_245_1063 | 255 |
| 1146 | 3300046675 | Ga0495657_0022974 | Ga0495657_0022974_470_1288 | 255 |
| 1147 | 3300046678 | Ga0495599_0062772 | Ga0495599_0062772_1454_2272 | 255 |
| 1148 | 3300046681 | Ga0495647_0003430 | Ga0495647_0003430_898_1716 | 255 |
| 1149 | 3300046683 | Ga0495658_0014430 | Ga0495658_0014430_64_882 | 255 |
| 1150 | 3300046689 | Ga0495613_0090317 | Ga0495613_0090317_92_910 | 255 |
| 1151 | 3300046690 | Ga0495624_0002456 | Ga0495624_0002456_8861_9679 | 255 |
| 1152 | 3300046691 | Ga0495670_0000678 | Ga0495670_0000678_2651_3469 | 255 |
| 1153 | 3300046809 | Ga0495600_0003434 | Ga0495600_0003434_4644_5462 | 255 |
| 1154 | 3300047315 | Ga0495581_0062689 | Ga0495581_0062689_364_1182 | 255 |
| 1155 | 3300047317 | Ga0495604_0018621 | Ga0495604_0018621_2524_3342 | 255 |
| 1156 | 3300047317 | Ga0495604_0404982 | Ga0495604_0404982_68_883 | 255 |
| 1157 | 3300047319 | Ga0495674_0207364 | Ga0495674_0207364_195_1013 | 255 |
| 1158 | 3300047321 | Ga0495676_0084461 | Ga0495676_0084461_418_1236 | 255 |
| 1159 | 3300047322 | Ga0495680_0007610 | Ga0495680_0007610_4345_5163 | 255 |
| 1160 | 3300047322 | Ga0495680_0151914 | Ga0495680_0151914_736_1551 | 255 |
| 1161 | 3300047443 | Ga0495687_007944 | Ga0495687_007944_1717_2529 | 255 |
| 1162 | 3300047444 | Ga0495675_0034659 | Ga0495675_0034659_1537_2355 | 255 |
| 1163 | 3300047444 | Ga0495675_0102524 | Ga0495675_0102524_98_916 | 255 |
| 1164 | 3300047471 | Ga0495684_0003052 | Ga0495684_0003052_2991_3809 | 255 |
| 1165 | 3300047673 | Ga0495593_0022233 | Ga0495593_0022233_2651_3469 | 255 |
| 1166 | 3300048088 | Ga0495602_0083728 | Ga0495602_0083728_1130_1948 | 255 |
| 1167 | 3300048088 | Ga0495602_0230950 | Ga0495602_0230950_474_1289 | 255 |
| 1168 | 3300048903 | Ga0496100_0002748 | Ga0496100_0002748_3704_4522 | 255 |
| 1169 | 3300048904 | Ga0496101_0001569 | Ga0496101_0001569_485_1303 | 255 |
| 1170 | 3300048904 | Ga0496101_0014208 | Ga0496101_0014208_3114_3926 | 255 |
| 1171 | 3300048905 | Ga0496102_0004673 | Ga0496102_0004673_1532_2350 | 255 |
| 1172 | 3300048905 | Ga0496102_0367432 | Ga0496102_0367432_185_997 | 255 |
| 1173 | 3300048906 | Ga0496103_0000430 | Ga0496103_0000430_32406_33224 | 255 |
| 1174 | 3300048906 | Ga0496103_0021945 | Ga0496103_0021945_97_909 | 255 |
| 1175 | 3300048907 | Ga0496104_0021681 | Ga0496104_0021681_4136_4948 | 255 |
| 1176 | 3300048907 | Ga0496104_0069299 | Ga0496104_0069299_793_1605 | 255 |
| 1177 | 3300048909 | Ga0496106_0003028 | Ga0496106_0003028_1763_2581 | 255 |
| 1178 | 3300048909 | Ga0496106_0047456 | Ga0496106_0047456_1930_2742 | 255 |
| 1179 | 3300048910 | Ga0496107_0002796 | Ga0496107_0002796_7976_8794 | 255 |
| 1180 | 3300048911 | Ga0496108_0006618 | Ga0496108_0006618_4124_4936 | 255 |
| 1181 | 3300048912 | Ga0496109_0000338 | Ga0496109_0000338_3342_4160 | 255 |
| 1182 | 3300048913 | Ga0496110_0012004 | Ga0496110_0012004_5941_6759 | 255 |
| 1183 | 3300048913 | Ga0496110_0027225 | Ga0496110_0027225_265_1077 | 255 |
| 1184 | 3300048914 | Ga0496111_0006431 | Ga0496111_0006431_5284_6096 | 255 |
| 1185 | 3300048914 | Ga0496111_0230583 | Ga0496111_0230583_143_961 | 255 |
| 1186 | 3300048915 | Ga0496112_0020955 | Ga0496112_0020955_61_873 | 255 |
| 1187 | 3300048915 | Ga0496112_0181433 | Ga0496112_0181433_234_1052 | 255 |
| 1188 | 3300048915 | Ga0496112_0472203 | Ga0496112_0472203_200_1012 | 255 |
| 1189 | 3300048916 | Ga0496113_0073775 | Ga0496113_0073775_126_938 | 255 |
| 1190 | 3300048918 | Ga0496115_0001318 | Ga0496115_0001318_5618_6436 | 255 |
| 1191 | 3300048921 | Ga0496118_0112978 | Ga0496118_0112978_127_939 | 255 |
| 1192 | 3300048924 | Ga0496121_0022465 | Ga0496121_0022465_3249_4061 | 255 |
| 1193 | 3300048926 | Ga0496123_0158750 | Ga0496123_0158750_121_933 | 255 |
| 1194 | 3300048927 | Ga0496124_0226789 | Ga0496124_0226789_333_1145 | 255 |
| 1195 | 3300049569 | Ga0501032_0041769 | Ga0501032_0041769_1149_1979 | 255 |
| 1196 | 3300049570 | Ga0501033_0042302 | Ga0501033_0042302_207_1037 | 255 |
| 1197 | 3300049571 | Ga0501034_0099411 | Ga0501034_0099411_601_1443 | 255 |
| 1198 | 3300049571 | Ga0501034_0117993 | Ga0501034_0117993_485_1282 | 255 |
| 1199 | 3300049571 | Ga0501034_0273017 | Ga0501034_0273017_94_924 | 255 |
| 1200 | 3300049572 | Ga0501036_0050872 | Ga0501036_0050872_2406_3236 | 255 |
| 1201 | 3300049573 | Ga0501037_0025878 | Ga0501037_0025878_3297_4127 | 255 |
| 1202 | 3300049574 | Ga0501038_0012938 | Ga0501038_0012938_2206_3048 | 255 |
| 1203 | 3300049574 | Ga0501038_0270661 | Ga0501038_0270661_186_1037 | 255 |
| 1204 | 3300049575 | Ga0501039_0040108 | Ga0501039_0040108_2299_3129 | 255 |
| 1205 | 3300049579 | Ga0501043_0109394 | Ga0501043_0109394_600_1451 | 255 |
| 1206 | 3300049579 | Ga0501043_0191030 | Ga0501043_0191030_608_1438 | 255 |
| 1207 | 3300049581 | Ga0501047_0061353 | Ga0501047_0061353_1301_2152 | 255 |
| 1208 | 3300049581 | Ga0501047_0067292 | Ga0501047_0067292_476_1306 | 255 |
| 1209 | 3300049584 | Ga0501068_0062319 | Ga0501068_0062319_506_1336 | 255 |
| 1210 | 3300049586 | Ga0501070_0019942 | Ga0501070_0019942_4585_5436 | 255 |
| 1211 | 3300049586 | Ga0501070_0306670 | Ga0501070_0306670_283_1113 | 255 |
| 1212 | 3300049592 | Ga0501076_0329261 | Ga0501076_0329261_41_847 | 255 |
| 1213 | 3300049741 | Ga0501079_0029988 | Ga0501079_0029988_3104_3934 | 255 |
| 1214 | 3300049742 | Ga0501080_0007431 | Ga0501080_0007431_655_1506 | 255 |
| 1215 | 3300049742 | Ga0501080_0411693 | Ga0501080_0411693_62_892 | 255 |
| 1216 | 3300049822 | Ga0501035_0028842 | Ga0501035_0028842_3724_4554 | 255 |
| 1217 | 3300049822 | Ga0501035_0566022 | Ga0501035_0566022_34_885 | 255 |
| 1218 | 3300049823 | Ga0501044_0012179 | Ga0501044_0012179_7448_8290 | 255 |
| 1219 | 3300049823 | Ga0501044_0218398 | Ga0501044_0218398_148_999 | 255 |
| 1220 | 3300049823 | Ga0501044_0492650 | Ga0501044_0492650_15_845 | 255 |
| 1221 | 3300049824 | Ga0501045_0301716 | Ga0501045_0301716_298_1116 | 255 |
| 1222 | 3300050490 | nmdc:mga03n38_115705_c1 | nmdc:mga03n38_115705_c1_238_1050 | 255 |
| 1223 | 3300050492 | nmdc:mga0yw44_93104_c1 | nmdc:mga0yw44_93104_c1_446_1258 | 255 |
| 1224 | 3300050493 | nmdc:mga0k408_128597_c1 | nmdc:mga0k408_128597_c1_464_1288 | 255 |
| 1225 | 3300050493 | nmdc:mga0k408_62477_c1 | nmdc:mga0k408_62477_c1_497_1315 | 255 |
| 1226 | 3300050494 | nmdc:mga06z11_293043_c1 | nmdc:mga06z11_293043_c1_103_918 | 255 |
| 1227 | 3300050496 | nmdc:mga07m45_42634_c1 | nmdc:mga07m45_42634_c1_807_1625 | 255 |
| 1228 | 3300050507 | nmdc:mga05p37_7455_c1 | nmdc:mga05p37_7455_c1_9432_10250 | 255 |
| 1229 | 3300050511 | nmdc:mga08y16_2015_c1 | nmdc:mga08y16_2015_c1_19393_20211 | 255 |
| 1230 | 3300050511 | nmdc:mga08y16_58619_c1 | nmdc:mga08y16_58619_c1_2210_3007 | 255 |
| 1231 | 3300050512 | nmdc:mga0n895_115319_c1 | nmdc:mga0n895_115319_c1_1368_2186 | 255 |
| 1232 | 3300050512 | nmdc:mga0n895_4804_c1 | nmdc:mga0n895_4804_c1_930_1727 | 255 |
| 1233 | 3300050512 | nmdc:mga0n895_543_c1 | nmdc:mga0n895_543_c1_12163_12981 | 255 |
| 1234 | 3300050513 | nmdc:mga0rr50_112178_c2 | nmdc:mga0rr50_112178_c2_486_1304 | 255 |
| 1235 | 3300050513 | nmdc:mga0rr50_296228_c1 | nmdc:mga0rr50_296228_c1_384_1181 | 255 |
| 1236 | 3300050513 | nmdc:mga0rr50_69644_c1 | nmdc:mga0rr50_69644_c1_476_1294 | 255 |
| 1237 | 3300050514 | nmdc:mga08x19_207846_c1 | nmdc:mga08x19_207846_c1_444_1262 | 255 |
| 1238 | 3300050515 | nmdc:mga0a205_114547_c1 | nmdc:mga0a205_114547_c1_542_1360 | 255 |
| 1239 | 3300050515 | nmdc:mga0a205_20418_c1 | nmdc:mga0a205_20418_c1_5195_5992 | 255 |
| 1240 | 3300050515 | nmdc:mga0a205_8969_c1 | nmdc:mga0a205_8969_c1_5082_5900 | 255 |
| 1241 | 3300050516 | nmdc:mga0sz30_32769_c1 | nmdc:mga0sz30_32769_c1_81_899 | 255 |
| 1242 | 3300050516 | nmdc:mga0sz30_67242_c1 | nmdc:mga0sz30_67242_c1_659_1471 | 255 |
| 1243 | 3300053077 | Ga0495601_0003588 | Ga0495601_0003588_5897_6715 | 255 |
| 1244 | 3300053077 | Ga0495601_0122219 | Ga0495601_0122219_810_1628 | 255 |
| 1245 | 3300053078 | Ga0495612_0004411 | Ga0495612_0004411_2222_3040 | 255 |
| 1246 | 3300053078 | Ga0495612_0041489 | Ga0495612_0041489_100_915 | 255 |
| 1247 | 3300053084 | Ga0495595_0001441 | Ga0495595_0001441_2354_3172 | 255 |
| 1248 | 3300053084 | Ga0495595_0094474 | Ga0495595_0094474_207_1025 | 255 |
| 1249 | 3300053085 | Ga0495619_0004134 | Ga0495619_0004134_4655_5473 | 255 |
| 1250 | 3300053085 | Ga0495619_0065872 | Ga0495619_0065872_967_1785 | 255 |
| 1251 | 3300053087 | Ga0500643_000116 | Ga0500643_000116_17584_18393 | 255 |
| 1252 | 3300053091 | Ga0500647_0070088 | Ga0500647_0070088_136_948 | 255 |
| 1253 | 3300053103 | Ga0500555_001167 | Ga0500555_001167_3391_4200 | 255 |
| 1254 | 3300053105 | Ga0500557_000061 | Ga0500557_000061_26862_27674 | 255 |
| 1255 | 3300053108 | Ga0500562_007630 | Ga0500562_007630_1325_2134 | 255 |
| 1256 | 3300053108 | Ga0500562_012973 | Ga0500562_012973_304_1140 | 255 |
| 1257 | 3300053130 | Ga0500642_0000098 | Ga0500642_0000098_3668_4480 | 255 |
| 1258 | 3300053139 | Ga0500568_0003430 | Ga0500568_0003430_1490_2299 | 255 |
| 1259 | 3300053156 | Ga0500622_0014627 | Ga0500622_0014627_3241_4050 | 255 |
| 1260 | 3300053158 | Ga0500627_0001120 | Ga0500627_0001120_1674_2483 | 255 |
| 1261 | 3300053160 | Ga0500633_0017870 | Ga0500633_0017870_221_1030 | 255 |
| 1262 | 3300053729 | Ga0500625_016887 | Ga0500625_016887_752_1564 | 255 |
| 1263 | 3300053736 | Ga0500599_000994 | Ga0500599_000994_184_993 | 255 |
| 1264 | 3300053737 | Ga0500601_000104 | Ga0500601_000104_6509_7321 | 255 |
| 1265 | 3300060353 | Ga0501082_0479731 | Ga0501082_0479731_93_902 | 255 |
| 1266 | 3300061719 | Ga0466962_0167636 | Ga0466962_0167636_31_843 | 255 |
| 1267 | 3300061734 | Ga0530510_0325065 | Ga0530510_0325065_67_885 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4htt-assembly2.cif.gz_B | crystal structure of twin arginine translocase receptor- tatc in ddm | 0.8444 | 16 | 242 |
| 4htt-assembly2.cif.gz_B | crystal structure of twin arginine translocase receptor- tatc in ddm | 0.8238 | 16 | 242 |
| 4hts-assembly1.cif.gz_A | crystal structure of twin arginine translocase receptor- tatc | 0.8099 | 16 | 247 |
| 4hts-assembly1.cif.gz_A | crystal structure of twin arginine translocase receptor- tatc | 0.7972 | 16 | 247 |
| 7ap5-assembly1.cif.gz_AAA | crystal structure of phycoerythrin from cyanobacterium nostoc sp. wr13 contains multiple stacks of hexameric assemblies which resemble the rods of phycobilisome. | 0.3124 | 2 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B3WFV1_75_234_1.10.490.10 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.4295 | 119 | 252 | 1.10.490.10 |
| af_A3KFU9_372_573_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.4081 | 42 | 252 | 1.20.1640.10 |
| af_A3KFU9_372_573_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.3937 | 42 | 252 | 1.20.1640.10 |
| af_B3WFV1_75_234_1.10.490.10 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.3669 | 119 | 252 | 1.10.490.10 |
| af_A0A1D6N0I3_20_174_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3657 | 119 | 249 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382I530-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9453 | 114 | 252 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A523G1K8-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9375 | 12 | 250 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A2U3D5V5-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9351 | 9 | 250 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A2D6FWT3-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.9328 | 12 | 250 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
| AF-A0A528AGZ7-F1-model_v4 | Sec-independent protein translocase protein TatC | 0.93 | 15 | 252 |
GO:0009977
GO:0033281 GO:0043953 GO:0065002 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar