F492363

General Info

Members Datasets Scaffolds Average Seq Length
1267 737 1036 259

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10100040|Ga0207705_101000402
Length 253
Sequence MSAADIEASKAPLMDHLIELRSRLIKALLGFGIAFIFCFFFAKQIYNVLVWPFVWVAGPENSKFIYTALLEYFITQLKLALFGAGFISFPIVATQIYKFVAPGLYKHEKQAFLPYLVATPFFFVLGAALVYFVVLPMLVRFSLGMQQAGSDETAQIQLLPKVGENLSLMMSLIFAFGIAFQLPVILTLLGRIGIVTSKMLRETPPDVLSQCSLAIPLLLLYEGSIIAVGIVEKKAAASNATGTDVSTPANPAE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
52 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
53 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
69 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
70 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
102 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
103 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
104 2904699407
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906610324
108 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
109 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
110 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
111 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
112 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2922425934
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
124 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
125 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
126 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
127 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
128 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
129 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
130 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
131 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
134 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
135 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
136 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
137 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
138 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
139 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
140 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
141 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
142 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
143 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
144 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
145 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
147 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
148 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
149 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
150 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
151 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
152 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
153 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
154 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
155 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
156 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
157 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
158 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
159 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
160 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
161 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
164 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
165 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
166 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
167 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
168 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
169 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
170 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
171 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
174 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
175 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
176 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
179 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
180 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
181 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
182 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
183 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
184 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
185 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
186 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
187 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
188 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
189 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
190 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
191 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
192 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
193 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
194 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
195 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
196 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
197 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
198 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
199 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
200 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
201 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
202 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
203 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
204 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
205 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
206 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
207 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
208 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
209 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
210 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
211 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
212 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
213 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
214 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
215 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
216 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
217 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
218 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
219 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
220 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
221 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
222 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
223 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
224 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
225 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
226 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
227 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
228 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
229 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
230 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
231 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
232 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
233 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
234 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
235 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
236 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
237 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
238 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
239 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
240 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
241 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
242 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
243 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
244 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
245 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
246 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
247 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
248 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
249 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
250 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
251 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
252 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
253 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
254 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
255 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
256 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
257 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
258 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
259 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
260 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
261 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
262 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
263 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
264 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
265 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
266 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
267 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
268 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
269 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
270 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
271 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
272 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
273 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
274 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
275 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
276 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
277 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
278 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
279 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
280 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
281 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
282 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
283 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
284 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
285 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
286 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
287 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
288 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
289 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
290 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
291 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
292 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
293 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
294 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
295 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
296 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
297 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
298 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
299 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
300 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
301 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
302 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
303 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
304 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
305 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
306 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
307 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
308 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
309 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
310 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
311 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
312 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
313 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
314 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
315 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
316 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
317 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
318 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
319 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
320 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
321 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
322 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
323 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
324 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
325 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
326 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
327 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
328 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
329 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
330 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
331 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
332 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
333 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
334 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
335 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
336 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
337 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
338 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
339 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
340 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
341 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
342 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
343 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
344 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
345 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
346 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
347 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
348 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
349 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
351 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
354 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
357 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
359 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
360 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
361 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
427 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
428 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
429 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
430 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
431 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
432 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
433 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
434 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
435 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
437 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
438 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
442 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
443 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
444 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
445 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
446 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
447 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
448 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
449 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
450 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
451 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
452 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
453 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
454 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
455 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
456 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
457 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
458 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
459 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
460 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
461 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
462 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
463 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
464 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
465 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
466 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
467 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
468 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
469 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
470 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
471 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
472 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
473 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
474 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
475 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
476 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
477 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
478 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
479 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
480 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
481 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
482 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
483 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
484 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
485 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
486 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
487 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
488 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
489 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
490 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
491 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
492 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
493 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
494 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
495 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
496 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
497 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
498 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
499 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
500 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
501 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
502 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
503 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
504 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
505 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
506 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
507 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
508 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
509 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
510 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
511 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
512 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
513 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
514 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
515 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
516 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
517 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
518 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
519 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
520 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
521 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
522 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
523 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
524 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
525 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
526 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
527 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
528 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
529 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
530 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
531 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
532 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
533 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
534 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
535 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
536 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
537 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
538 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
539 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
540 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
541 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
542 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
543 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
544 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
545 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
546 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
547 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
548 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
549 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
550 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
551 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
552 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
553 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
554 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
555 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
556 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
557 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
558 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
559 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
560 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
561 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
562 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
563 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
564 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
565 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
566 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
567 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
568 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
569 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
570 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
571 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
572 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
573 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
574 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
575 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
576 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
577 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
578 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
579 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
580 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
581 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
582 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
583 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
584 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
585 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
586 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
587 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
588 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
589 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
590 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
591 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
592 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
593 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
594 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
595 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
596 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
597 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
598 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
599 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
600 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
601 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
602 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
605 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
612 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
613 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
617 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
618 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
619 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
620 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
621 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
622 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
623 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
624 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
625 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
626 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
627 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
628 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
631 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
632 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
633 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
634 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
635 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
636 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
637 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
638 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
639 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
640 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
641 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
642 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
643 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
644 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
645 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
646 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
647 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
648 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
649 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
650 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
651 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
652 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
653 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
654 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
655 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
656 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
657 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
658 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
659 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
660 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
661 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
662 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
663 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
664 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
665 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
666 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
667 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
668 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
669 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
670 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
671 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
672 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
673 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
674 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
675 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
676 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
677 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
678 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
679 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
680 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
681 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
682 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
683 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
684 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
685 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
686 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
687 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
688 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
689 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
690 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
691 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
692 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
693 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
694 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
695 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
696 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
697 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
698 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
699 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
700 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
701 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
702 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
703 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
704 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
705 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
706 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
707 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
708 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
709 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
710 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
711 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
712 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
713 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
714 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
715 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
716 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
717 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
718 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
719 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
720 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
721 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
722 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
723 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
724 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
725 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
726 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
727 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
728 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
729 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
730 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
731 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
732 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
733 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
734 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
735 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
736 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
737 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.09
Metatranscriptomes 0
Isolates 17.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 14.05
Rhizoplane 5.45
Rhizosphere 61.88
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_100064 3300001430 Bacteria 4401
2 JGI24741J21665_1009996 3300001915 Bacteria 1718
3 JGI24746J21847_1007449 3300001977 Bacteria 1674
4 JGI24739J22299_10017346 3300001989 Bacteria 2598
5 JGI24737J22298_10000724 3300001990 Bacteria 11627
6 JGI24750J21931_1000149 3300002070 Bacteria 11462
7 JGI24745J21846_1000167 3300002073 Bacteria 5258
8 JGI24748J21848_1003041 3300002074 Bacteria 1909
9 JGI24738J21930_10004692 3300002075 Bacteria 3328
10 JGI24744J21845_10010750 3300002077 Bacteria 1873
11 JGI24744J21845_10023526 3300002077 Bacteria 1206
12 JGI24035J26624_1000153 3300002126 Bacteria 6200
13 JGI24034J26672_10002381 3300002239 Bacteria 2579
14 JGI24742J22300_10000767 3300002244 Bacteria 4885
15 JGI24751J29686_10025073 3300002459 Bacteria 1238
16 JGI25153J46596_10004855 3300003215 Bacteria 7162
17 JGI25153J46596_10018477 3300003215 Bacteria 2706
18 JGI25160J50197_1003444 3300003354 Bacteria 7079
19 JGI25404J52841_10018735 3300003659 Bacteria 1500
20 Ga0055531_10007266 3300003794 Bacteria 6083
21 JGI25405J52794_10027767 3300003911 Bacteria 1166
22 JGI25405J52794_10041454 3300003911 Bacteria 974
23 Ga0055543_1015857 3300004625 Bacteria 1442
24 Ga0065165_1004760 3300005262 Bacteria 8113
25 Ga0065165_1005968 3300005262 Bacteria 6583
26 Ga0065712_10072881 3300005290 Bacteria 4581
27 Ga0065715_10091411 3300005293 Bacteria 5806
28 Ga0070658_10019528 3300005327 Bacteria 5426
29 Ga0070658_10060353 3300005327 Bacteria 3088
30 Ga0070658_10084492 3300005327 Bacteria 2610
31 Ga0070658_10210981 3300005327 Bacteria 1640
32 Ga0070676_10000364 3300005328 Bacteria 20754
33 Ga0070683_100000806 3300005329 Bacteria 23191
34 Ga0070690_100013151 3300005330 Bacteria 4885
35 Ga0070670_100014265 3300005331 Bacteria 6818
36 Ga0070670_100294078 3300005331 Bacteria 1420
37 Ga0070677_10000212 3300005333 Bacteria 20104
38 Ga0068869_100000618 3300005334 Bacteria 20078
39 Ga0070666_10072031 3300005335 Bacteria 2352
40 Ga0070680_100069566 3300005336 Bacteria 2890
41 Ga0070680_100129120 3300005336 Bacteria 2113
42 Ga0070682_100001379 3300005337 Bacteria 13705
43 Ga0070682_100125083 3300005337 Bacteria 1731
44 Ga0070682_100310491 3300005337 Bacteria 1161
45 Ga0068868_100088762 3300005338 Bacteria 2488
46 Ga0068868_100168272 3300005338 Bacteria 1814
47 Ga0070660_100001616 3300005339 Bacteria 15489
48 Ga0070660_100140184 3300005339 Bacteria 1939
49 Ga0070660_100271695 3300005339 Bacteria 1386
50 Ga0070689_100000146 3300005340 Bacteria 40947
51 Ga0070689_100012435 3300005340 Bacteria 6132
52 Ga0070689_100209407 3300005340 Bacteria 1595
53 Ga0070691_10010893 3300005341 Bacteria 4151
54 Ga0070687_100000023 3300005343 Bacteria 48100
55 Ga0070687_100149412 3300005343 Bacteria 1370
56 Ga0070661_100000407 3300005344 Bacteria 33255
57 Ga0070692_10000270 3300005345 Bacteria 14505
58 Ga0070668_100085972 3300005347 Bacteria 2472
59 Ga0070668_100151569 3300005347 Bacteria 1875
60 Ga0070669_100028955 3300005353 Bacteria 3991
61 Ga0070675_100000306 3300005354 Bacteria 32965
62 Ga0070671_100001042 3300005355 Bacteria 20417
63 Ga0070671_100074469 3300005355 Bacteria 2837
64 Ga0070671_100387605 3300005355 Bacteria 1194
65 Ga0070674_100005171 3300005356 Bacteria 7502
66 Ga0070674_100053206 3300005356 Bacteria 2794
67 Ga0070674_100140265 3300005356 Bacteria 1813
68 Ga0070674_100467101 3300005356 Bacteria 1045
69 Ga0070673_100001407 3300005364 Bacteria 14072
70 Ga0070673_100241878 3300005364 Bacteria 1570
71 Ga0070688_100006871 3300005365 Bacteria 6108
72 Ga0070688_100109653 3300005365 Bacteria 1834
73 Ga0070659_100001563 3300005366 Bacteria 16498
74 Ga0070659_100109074 3300005366 Bacteria 2233
75 Ga0070659_100266364 3300005366 Bacteria 1422
76 Ga0070667_100000745 3300005367 Bacteria 31113
77 Ga0070703_10002920 3300005406 Bacteria 4891
78 Ga0070709_10022949 3300005434 Bacteria 3657
79 Ga0070709_10063355 3300005434 Bacteria 2361
80 Ga0070709_10371117 3300005434 Bacteria 1062
81 Ga0070714_100050053 3300005435 Bacteria 3557
82 Ga0070714_100072956 3300005435 Bacteria 2973
83 Ga0070713_100081034 3300005436 Bacteria 2769
84 Ga0070710_10036764 3300005437 Bacteria 2679
85 Ga0070710_10043692 3300005437 Bacteria 2483
86 Ga0070701_10000746 3300005438 Bacteria 11552
87 Ga0070711_100002555 3300005439 Bacteria 10421
88 Ga0070711_100091516 3300005439 Bacteria 2193
89 Ga0070711_100132456 3300005439 Bacteria 1858
90 Ga0070705_100080798 3300005440 Bacteria 1995
91 Ga0070700_100003377 3300005441 Bacteria 8231
92 Ga0070700_100114956 3300005441 Bacteria 1795
93 Ga0070694_100003105 3300005444 Bacteria 9892
94 Ga0070708_100229275 3300005445 Bacteria 1743
95 Ga0070663_100016281 3300005455 Bacteria 4824
96 Ga0070663_100019641 3300005455 Bacteria 4460
97 Ga0070663_100031255 3300005455 Bacteria 3658
98 Ga0070663_100102247 3300005455 Bacteria 2140
99 Ga0070663_100340435 3300005455 Bacteria 1212
100 Ga0070678_100042226 3300005456 Bacteria 3240
101 Ga0070678_100117886 3300005456 Bacteria 2088
102 Ga0070678_100137581 3300005456 Bacteria 1950
103 Ga0070678_100272711 3300005456 Bacteria 1427
104 Ga0070678_100733257 3300005456 Bacteria 893
105 Ga0070662_100114670 3300005457 Bacteria 2057
106 Ga0070681_10004011 3300005458 Bacteria 13893
107 Ga0070681_10019499 3300005458 Bacteria 6790
108 Ga0070681_10106630 3300005458 Bacteria 2743
109 Ga0068867_100014124 3300005459 Bacteria 5657
110 Ga0070685_10115279 3300005466 Bacteria 1661
111 Ga0070699_100550967 3300005518 Bacteria 1050
112 Ga0070679_100003609 3300005530 Bacteria 14140
113 Ga0070679_100005467 3300005530 Bacteria 11781
114 Ga0070679_100024249 3300005530 Bacteria 5944
115 Ga0070679_100113511 3300005530 Bacteria 2695
116 Ga0070679_100121585 3300005530 Bacteria 2595
117 Ga0070679_100341474 3300005530 Bacteria 1445
118 Ga0070684_100000454 3300005535 Bacteria 27974
119 Ga0070684_100187988 3300005535 Bacteria 1879
120 Ga0068853_100059818 3300005539 Bacteria 3291
121 Ga0068853_100220550 3300005539 Bacteria 1732
122 Ga0070672_100000045 3300005543 Bacteria 53368
123 Ga0070672_100074421 3300005543 Bacteria 2709
124 Ga0070686_100000480 3300005544 Bacteria 24146
125 Ga0070686_100169798 3300005544 Bacteria 1542
126 Ga0070695_100019377 3300005545 Bacteria 4143
127 Ga0070696_100039744 3300005546 Bacteria 3248
128 Ga0070693_100000286 3300005547 Bacteria 23758
129 Ga0070693_100066630 3300005547 Bacteria 2108
130 Ga0070665_100049034 3300005548 Bacteria 4238
131 Ga0070665_100237145 3300005548 Bacteria 1824
132 Ga0070704_100006095 3300005549 Bacteria 7078
133 Ga0068855_100006104 3300005563 Bacteria 14691
134 Ga0068855_100134934 3300005563 Bacteria 2816
135 Ga0068855_100380655 3300005563 Bacteria 1549
136 Ga0070664_100000899 3300005564 Bacteria 23157
137 Ga0070664_100319756 3300005564 Bacteria 1406
138 Ga0068857_100000623 3300005577 Bacteria 26056
139 Ga0068857_100450183 3300005577 Bacteria 1203
140 Ga0068857_100493915 3300005577 Bacteria 1148
141 Ga0068854_100005892 3300005578 Bacteria 7763
142 Ga0068854_100190683 3300005578 Bacteria 1606
143 Ga0068856_100012141 3300005614 Bacteria 8343
144 Ga0068856_100059599 3300005614 Bacteria 3770
145 Ga0068856_100238473 3300005614 Bacteria 1834
146 Ga0070702_100003379 3300005615 Bacteria 7127
147 Ga0070702_100170330 3300005615 Bacteria 1416
148 Ga0068852_100005047 3300005616 Bacteria 9387
149 Ga0068852_100666308 3300005616 Bacteria 1049
150 Ga0068859_100020794 3300005617 Bacteria 6587
151 Ga0068859_100123228 3300005617 Bacteria 2659
152 Ga0068864_100008403 3300005618 Bacteria 8516
153 Ga0068864_100109286 3300005618 Bacteria 2461
154 Ga0068864_100297727 3300005618 Bacteria 1509
155 Ga0068864_100669224 3300005618 Bacteria 1012
156 Ga0068866_10000346 3300005718 Bacteria 21828
157 Ga0068866_10151449 3300005718 Bacteria 1344
158 Ga0068861_100000045 3300005719 Bacteria 56440
159 Ga0068861_100020032 3300005719 Bacteria 4784
160 Ga0068861_100124839 3300005719 Bacteria 2081
161 Ga0068870_10000213 3300005840 Bacteria 20950
162 Ga0068863_100001919 3300005841 Bacteria 20657
163 Ga0068863_100173882 3300005841 Bacteria 2066
164 Ga0068858_100000307 3300005842 Bacteria 52034
165 Ga0068858_100018465 3300005842 Bacteria 6529
166 Ga0068858_100225095 3300005842 Bacteria 1777
167 Ga0068858_100303146 3300005842 Bacteria 1524
168 Ga0068858_100684166 3300005842 Bacteria 998
169 Ga0068860_100001587 3300005843 Bacteria 24464
170 Ga0068862_100011664 3300005844 Bacteria 7251
171 Ga0068862_100201763 3300005844 Bacteria 1794
172 Ga0068862_100270948 3300005844 Bacteria 1552
173 Ga0068862_100565425 3300005844 Bacteria 1087
174 Ga0081455_10002522 3300005937 Bacteria 21748
175 Ga0081455_10014064 3300005937 Bacteria 7866
176 Ga0081455_10018661 3300005937 Bacteria 6591
177 Ga0081455_10020448 3300005937 Bacteria 6232
178 Ga0081540_1002686 3300005983 Bacteria 14471
179 Ga0081540_1006242 3300005983 Bacteria 8731
180 Ga0081540_1006816 3300005983 Bacteria 8252
181 Ga0081540_1078604 3300005983 Bacteria 1494
182 Ga0081540_1078879 3300005983 Bacteria 1491
183 Ga0081539_10000379 3300005985 Bacteria 97134
184 Ga0070717_10106892 3300006028 Bacteria 2383
185 Ga0075365_10061715 3300006038 Bacteria 2504
186 Ga0075365_10126856 3300006038 Bacteria 1763
187 Ga0075365_10145156 3300006038 Bacteria 1649
188 Ga0075365_10172650 3300006038 Bacteria 1509
189 Ga0075368_10029287 3300006042 Bacteria 2128
190 Ga0075368_10068375 3300006042 Bacteria 1431
191 Ga0075363_100052433 3300006048 Bacteria 2177
192 Ga0075364_10069135 3300006051 Bacteria 2323
193 Ga0075364_10114295 3300006051 Bacteria 1803
194 Ga0070715_10045681 3300006163 Bacteria 1858
195 Ga0070712_100024400 3300006175 Bacteria 4007
196 Ga0070712_100100891 3300006175 Bacteria 2134
197 Ga0075362_10045367 3300006177 Bacteria 1952
198 Ga0075367_10108150 3300006178 Bacteria 1704
199 Ga0075367_10157983 3300006178 Bacteria 1409
200 Ga0075367_10262485 3300006178 Bacteria 1084
201 Ga0075369_10107306 3300006186 Bacteria 1256
202 Ga0075369_10160712 3300006186 Bacteria 1030
203 Ga0075366_10029327 3300006195 Bacteria 3233
204 Ga0075366_10193124 3300006195 Bacteria 1237
205 Ga0097621_100000587 3300006237 Bacteria 25584
206 Ga0097621_100129958 3300006237 Bacteria 2143
207 Ga0075370_10047118 3300006353 Bacteria 2440
208 Ga0075370_10101365 3300006353 Bacteria 1666
209 Ga0068871_100002886 3300006358 Bacteria 11787
210 Ga0075428_100005210 3300006844 Bacteria 14452
211 Ga0075430_100001350 3300006846 Bacteria 19843
212 Ga0075430_100002163 3300006846 Bacteria 16263
213 Ga0075431_100000033 3300006847 Bacteria 72175
214 Ga0075431_100001300 3300006847 Bacteria 22820
215 Ga0075433_10000773 3300006852 Bacteria 22008
216 Ga0075433_10005102 3300006852 Bacteria 10300
217 Ga0075434_100001539 3300006871 Bacteria 19519
218 Ga0075434_100045067 3300006871 Bacteria 4375
219 Ga0075434_100051349 3300006871 Bacteria 4098
220 Ga0075434_100074375 3300006871 Bacteria 3391
221 Ga0075434_100377177 3300006871 Bacteria 1439
222 Ga0075429_100002588 3300006880 Bacteria 15248
223 Ga0068865_100007664 3300006881 Bacteria 6650
224 Ga0068865_100284929 3300006881 Bacteria 1317
225 Ga0068865_100324896 3300006881 Bacteria 1239
226 Ga0097620_100020792 3300006931 Bacteria 6587
227 Ga0097620_100123230 3300006931 Bacteria 2659
228 Ga0099825_1035142 3300006941 Bacteria 1812
229 Ga0099824_1020964 3300006942 Bacteria 4669
230 Ga0099823_1016923 3300006944 Bacteria 7131
231 Ga0075435_100126575 3300007076 Bacteria 2136
232 Ga0099795_10028564 3300007788 Bacteria 1898
233 Ga0105250_10066785 3300009092 Bacteria 1451
234 Ga0105240_10014215 3300009093 Bacteria 10873
235 Ga0105240_10058395 3300009093 Bacteria 4816
236 Ga0105240_10292421 3300009093 Bacteria 1867
237 Ga0105240_10524839 3300009093 Bacteria 1313
238 Ga0105240_10583553 3300009093 Bacteria 1233
239 Ga0111539_10000591 3300009094 Bacteria 46788
240 Ga0111539_10003260 3300009094 Bacteria 21453
241 Ga0111539_10018995 3300009094 Bacteria 8497
242 Ga0111539_10106104 3300009094 Bacteria 3296
243 Ga0111539_11020670 3300009094 Bacteria 962
244 Ga0105245_10001033 3300009098 Bacteria 25290
245 Ga0105247_10020518 3300009101 Bacteria 3973
246 Ga0114129_10001565 3300009147 Bacteria 31048
247 Ga0114129_10002229 3300009147 Bacteria 26735
248 Ga0105243_10000678 3300009148 Bacteria 33239
249 Ga0105243_10103348 3300009148 Bacteria 2369
250 Ga0105243_10153926 3300009148 Bacteria 1975
251 Ga0105241_10008618 3300009174 Bacteria 7494
252 Ga0105241_10043729 3300009174 Bacteria 3393
253 Ga0105241_10525361 3300009174 Bacteria 1059
254 Ga0105242_10002866 3300009176 Bacteria 13505
255 Ga0105242_10194157 3300009176 Bacteria 1799
256 Ga0105242_10327313 3300009176 Bacteria 1408
257 Ga0105242_10353968 3300009176 Bacteria 1357
258 Ga0105248_10042833 3300009177 Bacteria 5076
259 Ga0105248_10140778 3300009177 Bacteria 2721
260 Ga0105237_10014611 3300009545 Bacteria 8202
261 Ga0105237_10078806 3300009545 Bacteria 3284
262 Ga0105238_10055605 3300009551 Bacteria 3972
263 Ga0105238_10067496 3300009551 Bacteria 3577
264 Ga0105238_10316456 3300009551 Bacteria 1546
265 Ga0105249_10000540 3300009553 Bacteria 34962
266 Ga0105239_10013892 3300010375 Bacteria 8937
267 Ga0105239_10024564 3300010375 Bacteria 6639
268 Ga0105239_10108947 3300010375 Bacteria 3068
269 Ga0105239_10253811 3300010375 Bacteria 1975
270 Ga0105246_10010105 3300011119 Bacteria 5827
271 Ga0105246_10027291 3300011119 Bacteria 3740
272 Ga0157371_10096347 3300013102 Bacteria 2097
273 Ga0157371_10228999 3300013102 Bacteria 1335
274 Ga0157370_10085004 3300013104 Bacteria 2972
275 Ga0157370_10319063 3300013104 Bacteria 1433
276 Ga0157374_10460154 3300013296 Bacteria 1274
277 Ga0157374_10758182 3300013296 Bacteria 985
278 Ga0157378_10002535 3300013297 Bacteria 16255
279 Ga0163162_10033221 3300013306 Bacteria 5125
280 Ga0163162_10975414 3300013306 Bacteria 958
281 Ga0157372_10015130 3300013307 Bacteria 8256
282 Ga0157372_10257960 3300013307 Bacteria 2024
283 Ga0157372_10527575 3300013307 Bacteria 1376
284 Ga0157375_10013069 3300013308 Bacteria 7378
285 Ga0157375_10194691 3300013308 Bacteria 2182
286 Ga0163163_10009083 3300014325 Bacteria 8858
287 Ga0163163_10211943 3300014325 Bacteria 1986
288 Ga0163163_10359971 3300014325 Bacteria 1511
289 Ga0157380_10003874 3300014326 Bacteria 10318
290 Ga0157380_10232005 3300014326 Bacteria 1658
291 Ga0157380_10329432 3300014326 Bacteria 1419
292 Ga0182008_10036655 3300014497 Bacteria 2453
293 Ga0157377_10000653 3300014745 Bacteria 14463
294 Ga0157379_10000135 3300014968 Bacteria 52814
295 Ga0157379_10044047 3300014968 Bacteria 3985
296 Ga0157376_10001353 3300014969 Bacteria 16134
297 Ga0157376_10511583 3300014969 Bacteria 1182
298 Ga0163161_10007225 3300017792 Bacteria 7676
299 Ga0214544_1000051 3300021320 Bacteria 134645
300 Ga0214542_1000149 3300021321 Bacteria 102700
301 Ga0214545_1000126 3300021324 Bacteria 91489
302 Ga0214543_1000148 3300021327 Bacteria 98370
303 Ga0213875_10000023 3300021388 Bacteria 213455
304 Ga0213875_10053745 3300021388 Bacteria 1886
305 Ga0209563_102080 3300025230 Bacteria 4734
306 Ga0207425_1009482 3300025245 Bacteria 2417
307 Ga0209677_100663 3300025253 Bacteria 17947
308 Ga0209677_101621 3300025253 Bacteria 9490
309 Ga0209148_1000258 3300025254 Bacteria 83390
310 Ga0209233_1013243 3300025261 Bacteria 2359
311 Ga0209233_1030272 3300025261 Bacteria 1276
312 Ga0207666_1000021 3300025271 Bacteria 37690
313 Ga0209455_1001530 3300025272 Bacteria 10313
314 Ga0207673_1000062 3300025290 Bacteria 9181
315 Ga0209564_1003207 3300025295 Bacteria 11489
316 Ga0209564_1007189 3300025295 Bacteria 5804
317 Ga0209758_1000021 3300025297 Bacteria 697691
318 Ga0209758_1000188 3300025297 Bacteria 138749
319 Ga0209758_1000521 3300025297 Bacteria 61693
320 Ga0209758_1003026 3300025297 Bacteria 16041
321 Ga0209758_1016841 3300025297 Bacteria 3685
322 Ga0209758_1039249 3300025297 Bacteria 1803
323 Ga0209758_1047475 3300025297 Bacteria 1535
324 Ga0209256_1004268 3300025299 Bacteria 9134
325 Ga0207426_1001694 3300025302 Bacteria 17003
326 Ga0207426_1002095 3300025302 Bacteria 13759
327 Ga0207426_1007289 3300025302 Bacteria 4649
328 Ga0209257_1002487 3300025304 Bacteria 18212
329 Ga0209257_1021911 3300025304 Bacteria 2300
330 Ga0207697_10001014 3300025315 Bacteria 15717
331 Ga0207653_10001128 3300025885 Bacteria 8743
332 Ga0207682_10000796 3300025893 Bacteria 14565
333 Ga0207692_10033251 3300025898 Bacteria 2486
334 Ga0207692_10134914 3300025898 Bacteria 1398
335 Ga0207642_10000764 3300025899 Bacteria 9951
336 Ga0207710_10019312 3300025900 Bacteria 2908
337 Ga0207688_10000017 3300025901 Bacteria 52729
338 Ga0207688_10057579 3300025901 Bacteria 2185
339 Ga0207680_10017854 3300025903 Bacteria 3756
340 Ga0207647_10003774 3300025904 Bacteria 11329
341 Ga0207685_10002303 3300025905 Bacteria 4340
342 Ga0207685_10182282 3300025905 Bacteria 974
343 Ga0207699_10023853 3300025906 Bacteria 3336
344 Ga0207699_10149236 3300025906 Bacteria 1545
345 Ga0207699_10170170 3300025906 Bacteria 1457
346 Ga0207645_10000074 3300025907 Bacteria 71544
347 Ga0207645_10023855 3300025907 Bacteria 3970
348 Ga0207645_10086693 3300025907 Bacteria 2012
349 Ga0207643_10000058 3300025908 Bacteria 73498
350 Ga0207705_10100040 3300025909 Bacteria 2132
351 Ga0207654_10004287 3300025911 Bacteria 7194
352 Ga0207654_10233559 3300025911 Bacteria 1226
353 Ga0207707_10000311 3300025912 Bacteria 51163
354 Ga0207707_10019779 3300025912 Bacteria 5879
355 Ga0207707_10129150 3300025912 Bacteria 2210
356 Ga0207695_10000015 3300025913 Bacteria 803205
357 Ga0207695_10157011 3300025913 Bacteria 2209
358 Ga0207671_10035837 3300025914 Bacteria 3679
359 Ga0207671_10191532 3300025914 Bacteria 1595
360 Ga0207693_10001855 3300025915 Bacteria 18519
361 Ga0207693_10002979 3300025915 Bacteria 14660
362 Ga0207693_10354384 3300025915 Bacteria 1148
363 Ga0207663_10012968 3300025916 Bacteria 4520
364 Ga0207663_10036931 3300025916 Bacteria 2941
365 Ga0207663_10068961 3300025916 Bacteria 2273
366 Ga0207663_10252136 3300025916 Bacteria 1299
367 Ga0207660_10000578 3300025917 Bacteria 24655
368 Ga0207660_10037039 3300025917 Bacteria 3396
369 Ga0207660_10350955 3300025917 Bacteria 1182
370 Ga0207662_10000069 3300025918 Bacteria 45774
371 Ga0207657_10000721 3300025919 Bacteria 35100
372 Ga0207657_10054457 3300025919 Bacteria 3459
373 Ga0207657_10169565 3300025919 Bacteria 1769
374 Ga0207649_10000282 3300025920 Bacteria 40055
375 Ga0207652_10001198 3300025921 Bacteria 23347
376 Ga0207652_10017328 3300025921 Bacteria 5894
377 Ga0207652_10162753 3300025921 Bacteria 2000
378 Ga0207652_10277686 3300025921 Bacteria 1511
379 Ga0207652_10490708 3300025921 Bacteria 1106
380 Ga0207681_10000806 3300025923 Bacteria 20631
381 Ga0207650_10005569 3300025925 Bacteria 8597
382 Ga0207650_10158976 3300025925 Bacteria 1789
383 Ga0207659_10000039 3300025926 Bacteria 91685
384 Ga0207687_10000458 3300025927 Bacteria 27761
385 Ga0207700_10065675 3300025928 Bacteria 2769
386 Ga0207700_10107159 3300025928 Bacteria 2242
387 Ga0207664_10005104 3300025929 Bacteria 8943
388 Ga0207664_10018448 3300025929 Bacteria 5138
389 Ga0207664_10055368 3300025929 Bacteria 3147
390 Ga0207644_10021949 3300025931 Bacteria 4354
391 Ga0207644_10032996 3300025931 Bacteria 3616
392 Ga0207690_10000303 3300025932 Bacteria 34378
393 Ga0207690_10223537 3300025932 Bacteria 1442
394 Ga0207706_10063888 3300025933 Bacteria 3241
395 Ga0207706_10082263 3300025933 Bacteria 2830
396 Ga0207686_10000540 3300025934 Bacteria 24486
397 Ga0207686_10220270 3300025934 Bacteria 1370
398 Ga0207709_10000894 3300025935 Bacteria 22532
399 Ga0207709_10034192 3300025935 Bacteria 2994
400 Ga0207709_10428152 3300025935 Bacteria 1018
401 Ga0207670_10000200 3300025936 Bacteria 39476
402 Ga0207670_10002609 3300025936 Bacteria 9481
403 Ga0207670_10197046 3300025936 Bacteria 1528
404 Ga0207669_10000098 3300025937 Bacteria 43800
405 Ga0207669_10010480 3300025937 Bacteria 4465
406 Ga0207669_10237642 3300025937 Bacteria 1348
407 Ga0207704_10012394 3300025938 Bacteria 4233
408 Ga0207704_10147818 3300025938 Bacteria 1654
409 Ga0207704_10440512 3300025938 Bacteria 1038
410 Ga0207665_10189776 3300025939 Bacteria 1492
411 Ga0207691_10000169 3300025940 Bacteria 60909
412 Ga0207691_10042900 3300025940 Bacteria 4169
413 Ga0207691_10230390 3300025940 Bacteria 1604
414 Ga0207711_10008085 3300025941 Bacteria 8803
415 Ga0207711_10158772 3300025941 Bacteria 2045
416 Ga0207711_10283371 3300025941 Bacteria 1526
417 Ga0207689_10001003 3300025942 Bacteria 27128
418 Ga0207689_10037986 3300025942 Bacteria 3990
419 Ga0207689_10491258 3300025942 Bacteria 1028
420 Ga0207661_10014106 3300025944 Bacteria 5848
421 Ga0207679_10000030 3300025945 Bacteria 169351
422 Ga0207667_10054202 3300025949 Bacteria 4218
423 Ga0207667_10401693 3300025949 Bacteria 1395
424 Ga0207667_10485141 3300025949 Bacteria 1254
425 Ga0207651_10000213 3300025960 Bacteria 24957
426 Ga0207712_10000473 3300025961 Bacteria 33877
427 Ga0207668_10000220 3300025972 Bacteria 38677
428 Ga0207668_10421124 3300025972 Bacteria 1133
429 Ga0207640_10000573 3300025981 Bacteria 21936
430 Ga0207658_10120158 3300025986 Bacteria 2093
431 Ga0207677_10000513 3300026023 Bacteria 24963
432 Ga0207703_10086489 3300026035 Bacteria 2626
433 Ga0207703_10314978 3300026035 Bacteria 1431
434 Ga0207639_10003256 3300026041 Bacteria 10933
435 Ga0207639_10165864 3300026041 Bacteria 1866
436 Ga0207678_10003592 3300026067 Bacteria 13936
437 Ga0207678_10131139 3300026067 Bacteria 2138
438 Ga0207678_10140870 3300026067 Bacteria 2058
439 Ga0207678_10141866 3300026067 Bacteria 2050
440 Ga0207708_10000428 3300026075 Bacteria 32826
441 Ga0207702_10005939 3300026078 Bacteria 10605
442 Ga0207702_10180446 3300026078 Bacteria 1944
443 Ga0207702_10455353 3300026078 Bacteria 1242
444 Ga0207641_10002043 3300026088 Bacteria 19219
445 Ga0207641_10082469 3300026088 Bacteria 2794
446 Ga0207648_10028973 3300026089 Bacteria 4909
447 Ga0207648_10067409 3300026089 Bacteria 3120
448 Ga0207648_10109226 3300026089 Bacteria 2428
449 Ga0207676_10001467 3300026095 Bacteria 17519
450 Ga0207674_10000135 3300026116 Bacteria 85071
451 Ga0207674_10481295 3300026116 Bacteria 1200
452 Ga0207675_100000245 3300026118 Bacteria 51737
453 Ga0207675_100122042 3300026118 Bacteria 2466
454 Ga0207675_100262104 3300026118 Bacteria 1675
455 Ga0207683_10000136 3300026121 Bacteria 60910
456 Ga0207683_10149435 3300026121 Bacteria 2108
457 Ga0207698_10000828 3300026142 Bacteria 17909
458 Ga0207698_10151368 3300026142 Bacteria 2014
459 Ga0209973_1000324 3300027252 Bacteria 3428
460 Ga0209389_1000041 3300027296 Bacteria 123983
461 Ga0209389_1000656 3300027296 Bacteria 21454
462 Ga0209589_1000874 3300027357 Bacteria 45837
463 Ga0209489_100178 3300027361 Bacteria 99953
464 Ga0209489_105228 3300027361 Bacteria 22869
465 Ga0209700_100010 3300027363 Bacteria 395269
466 Ga0209970_1004161 3300027614 Bacteria 2410
467 Ga0210002_1000224 3300027617 Bacteria 7969
468 Ga0209971_1038246 3300027682 Bacteria 1155
469 Ga0209966_1002708 3300027695 Bacteria 2962
470 Ga0209998_10019780 3300027717 Bacteria 1437
471 Ga0209974_10003611 3300027876 Bacteria 5557
472 Ga0207428_10000249 3300027907 Bacteria 73253
473 Ga0207428_10000471 3300027907 Bacteria 48541
474 Ga0207428_10003754 3300027907 Bacteria 14582
475 Ga0207428_10264038 3300027907 Bacteria 1281
476 Ga0268266_10007483 3300028379 Bacteria 9844
477 Ga0268266_10236688 3300028379 Bacteria 1683
478 Ga0268266_10691380 3300028379 Bacteria 983
479 Ga0268265_10001888 3300028380 Bacteria 16660
480 Ga0268264_10000693 3300028381 Bacteria 39190
481 Ga0268264_10304830 3300028381 Bacteria 1501
482 Ga0307517_10000139 3300028786 Bacteria 111985
483 Ga0307515_10072230 3300028794 Bacteria 4662
484 Ga0265338_10047667 3300028800 Bacteria 3911
485 Ga0265338_10473270 3300028800 Bacteria 885
486 Ga0265325_10003096 3300031241 Bacteria 10981
487 Ga0265325_10006332 3300031241 Bacteria 7196
488 Ga0265325_10021820 3300031241 Bacteria 3512
489 Ga0265340_10107260 3300031247 Bacteria 1294
490 Ga0265339_10001686 3300031249 Bacteria 16305
491 Ga0265339_10010010 3300031249 Bacteria 5913
492 Ga0265316_10062198 3300031344 Bacteria 2898
493 Ga0265313_10000106 3300031595 Bacteria 83923
494 Ga0265313_10006454 3300031595 Bacteria 8296
495 Ga0265313_10018201 3300031595 Bacteria 3955
496 Ga0265313_10040606 3300031595 Bacteria 2298
497 Ga0307508_10244338 3300031616 Bacteria 1392
498 Ga0316579_10001412 3300031691 Bacteria 8711
499 Ga0265314_10023262 3300031711 Bacteria 4728
500 Ga0265342_10000760 3300031712 Bacteria 32963
501 Ga0315911_1000001 3300033442 Bacteria 1088602
502 Ga0373950_0004083 3300034818 Bacteria 2125
503 Ga0373958_0004047 3300034819 Bacteria 2148
504 Ga0373938_0001584 3300034957 Bacteria 3655
505 Ga0373938_0007424 3300034957 Bacteria 1928
506 Ga0373926_0009755 3300035083 Bacteria 3208
507 Ga0373928_0001828 3300035084 Bacteria 4148
508 Ga0373940_0074425 3300035088 Bacteria 994
509 Ga0373944_0021434 3300035089 Bacteria 1870
510 Ga0373949_0016957 3300035090 Bacteria 1637
511 Ga0373952_0001190 3300035092 Bacteria 4748
512 Ga0373923_0004598 3300035111 Bacteria 4593
513 Ga0373923_0074895 3300035111 Bacteria 1460
514 Ga0373932_0002449 3300035112 Bacteria 4694
515 Ga0373936_0062523 3300035113 Bacteria 1522
516 Ga0373936_0088802 3300035113 Bacteria 1294
517 Ga0373939_0000864 3300035114 Bacteria 7510
518 Ga0373941_0002366 3300035115 Bacteria 4142
519 Ga0373941_0010544 3300035115 Bacteria 2363
520 Ga0373945_0012224 3300035116 Bacteria 2847
521 Ga0373954_0005819 3300035118 Bacteria 5354
522 Ga0373954_0011248 3300035118 Bacteria 3962
523 Ga0373954_0023914 3300035118 Bacteria 2783
524 Ga0373954_0132192 3300035118 Bacteria 1215
525 Ga0373957_0011405 3300035120 Bacteria 2966
526 Ga0373960_0013864 3300035121 Bacteria 2030
527 Ga0373943_0108743 3300035170 Bacteria 1459
528 Ga0373946_0003666 3300035171 Bacteria 5439
529 Ga0373955_0000762 3300035172 Bacteria 13835
530 Ga0373942_0003044 3300035207 Bacteria 3972
531 Ga0373942_0081988 3300035207 Bacteria 959
532 Ga0373961_0003482 3300035241 Bacteria 3896
533 Ga0373962_0003932 3300035242 Bacteria 3576
534 Ga0373924_0042212 3300035410 Bacteria 1870
535 Ga0373924_0049076 3300035410 Bacteria 1745
536 Ga0373931_0013105 3300035691 Bacteria 4031
537 Ga0373931_0029721 3300035691 Bacteria 2808
538 Ga0373931_0082737 3300035691 Bacteria 1775
539 Ga0373931_0324496 3300035691 Bacteria 957
540 Ga0373935_0021704 3300035692 Bacteria 3932
541 Ga0373927_0003031 3300035695 Bacteria 12185
542 Ga0373927_0030686 3300035695 Bacteria 3506
543 Ga0373927_0167979 3300035695 Bacteria 1438
544 Ga0373927_0231721 3300035695 Bacteria 1213
545 Ga0373933_0006917 3300035724 Bacteria 6180
546 Ga0373947_0013182 3300035725 Bacteria 4738
547 Ga0373947_0110999 3300035725 Bacteria 1733
548 Ga0373947_0235271 3300035725 Bacteria 1207
549 Ga0373947_0371578 3300035725 Bacteria 962
550 Ga0373937_0002201 3300036401 Bacteria 16290
551 Ga0373937_0100680 3300036401 Bacteria 2681
552 Ga0373937_0149503 3300036401 Bacteria 2187
553 Ga0373925_0021350 3300037068 Bacteria 4716
554 Ga0373925_0069874 3300037068 Bacteria 2653
555 Ga0373925_0120863 3300037068 Bacteria 2033
556 Ga0373925_0411768 3300037068 Bacteria 1103
557 Ga0395900_0000591 3300037418 Bacteria 49743
558 Ga0395900_0136111 3300037418 Bacteria 2517
559 Ga0395898_0056665 3300037466 Bacteria 3820
560 Ga0395898_0124168 3300037466 Bacteria 2473
561 Ga0395905_0004439 3300037471 Bacteria 14583
562 Ga0395905_0014655 3300037471 Bacteria 7478
563 Ga0395905_0135873 3300037471 Bacteria 2313
564 Ga0395905_0161440 3300037471 Bacteria 2106
565 Ga0395905_0390471 3300037471 Bacteria 1286
566 Ga0436364_0819845 3300037853 Bacteria 1080
567 Ga0436364_1194418 3300037853 Bacteria 8223
568 Ga0436364_1458556 3300037853 Bacteria 5936
569 Ga0395901_0066685 3300038443 Bacteria 3749
570 Ga0395901_0197059 3300038443 Bacteria 2112
571 Ga0395901_0589699 3300038443 Bacteria 1122
572 Ga0395901_0829009 3300038443 Bacteria 912
573 Ga0436365_0156573 3300039437 Bacteria 1928
574 Ga0436365_1283964 3300039437 Bacteria 3173
575 Ga0436365_1447566 3300039437 Bacteria 986
576 Ga0436361_0060531 3300039447 Bacteria 2133
577 Ga0436363_1166084 3300039450 Bacteria 1467
578 Ga0451841_0960603 3300041498 Bacteria 1485
579 Ga0451853_0102419 3300041512 Bacteria 1089
580 Ga0439441_018730 3300042001 Bacteria 1254
581 Ga0466972_0000294 3300044658 Bacteria 30366
582 Ga0466972_0012453 3300044658 Bacteria 4275
583 Ga0466965_0003867 3300044683 Bacteria 6616
584 Ga0466966_0002892 3300044684 Bacteria 11321
585 Ga0466961_0000162 3300044693 Bacteria 45301
586 Ga0466963_0010036 3300044694 Bacteria 5725
587 Ga0466963_0054377 3300044694 Bacteria 2661
588 Ga0466971_0077499 3300044719 Bacteria 1513
589 Ga0466968_0016434 3300044735 Bacteria 2947
590 Ga0466968_0051832 3300044735 Bacteria 1754
591 Ga0466957_0240497 3300044842 Bacteria 1201
592 Ga0466960_0046399 3300044901 Bacteria 2080
593 Ga0466960_0097009 3300044901 Bacteria 1512
594 Ga0466967_0058654 3300045976 Bacteria 3403
595 Ga0466967_0123883 3300045976 Bacteria 2392
596 Ga0466967_0578062 3300045976 Bacteria 1107
597 Ga0495592_0066959 3300046454 Bacteria 2626
598 Ga0495603_0090503 3300046455 Bacteria 1789
599 Ga0495629_0000627 3300046459 Bacteria 28700
600 Ga0495629_0147181 3300046459 Bacteria 1637
601 Ga0495638_0002361 3300046460 Bacteria 15466
602 Ga0495638_0116776 3300046460 Bacteria 1580
603 Ga0495641_0020397 3300046461 Bacteria 3360
604 Ga0495651_0031737 3300046462 Bacteria 4118
605 Ga0495651_0034033 3300046462 Bacteria 3973
606 Ga0495651_0035792 3300046462 Bacteria 3865
607 Ga0495653_0034049 3300046463 Bacteria 4032
608 Ga0495653_0078351 3300046463 Bacteria 2451
609 Ga0495653_0124767 3300046463 Bacteria 1830
610 Ga0495580_0004803 3300046472 Bacteria 11317
611 Ga0495582_0074009 3300046473 Bacteria 1885
612 Ga0495582_0077042 3300046473 Bacteria 1849
613 Ga0495639_0006464 3300046475 Bacteria 5040
614 Ga0495639_0035109 3300046475 Bacteria 2243
615 Ga0495662_0003963 3300046476 Bacteria 7466
616 Ga0495664_0011474 3300046477 Bacteria 4997
617 Ga0495664_0038868 3300046477 Bacteria 2810
618 Ga0495584_0071227 3300046491 Bacteria 1747
619 Ga0495594_0052867 3300046499 Bacteria 2236
620 Ga0495606_0047224 3300046507 Bacteria 2839
621 Ga0495608_0069496 3300046511 Bacteria 2301
622 Ga0495610_0032405 3300046512 Bacteria 2714
623 Ga0495616_0032785 3300046513 Bacteria 2711
624 Ga0495618_0040014 3300046514 Bacteria 2949
625 Ga0495618_0047041 3300046514 Bacteria 2723
626 Ga0495618_0094377 3300046514 Bacteria 1913
627 Ga0495628_0088097 3300046516 Bacteria 2406
628 Ga0495628_0125285 3300046516 Bacteria 1969
629 Ga0495628_0150472 3300046516 Bacteria 1773
630 Ga0495630_0009062 3300046517 Bacteria 7151
631 Ga0495631_0043961 3300046518 Bacteria 1970
632 Ga0495637_0060628 3300046520 Bacteria 1553
633 Ga0495643_0036869 3300046522 Bacteria 2684
634 Ga0495644_0000276 3300046523 Bacteria 23546
635 Ga0495644_0049165 3300046523 Bacteria 1583
636 Ga0495648_0000895 3300046524 Bacteria 31207
637 Ga0495666_0010279 3300046526 Bacteria 4667
638 Ga0495652_0005661 3300046529 Bacteria 11703
639 Ga0495652_0055761 3300046529 Bacteria 3359
640 Ga0495654_0007610 3300046530 Bacteria 6034
641 Ga0495665_0013872 3300046531 Bacteria 4352
642 Ga0495586_0010130 3300046535 Bacteria 5017
643 Ga0495587_0005259 3300046536 Bacteria 8462
644 Ga0495587_0049798 3300046536 Bacteria 2479
645 Ga0495645_0011108 3300046543 Bacteria 6332
646 Ga0495645_0149603 3300046543 Bacteria 1623
647 Ga0495622_0021826 3300046557 Bacteria 2982
648 Ga0495633_0084274 3300046558 Bacteria 1478
649 Ga0495667_0005630 3300046559 Bacteria 8467
650 Ga0495667_0194119 3300046559 Bacteria 1300
651 Ga0495656_0023120 3300046615 Bacteria 2443
652 Ga0495635_0020965 3300046663 Bacteria 4554
653 Ga0495635_0032058 3300046663 Bacteria 3647
654 Ga0495635_0089773 3300046663 Bacteria 2103
655 Ga0495659_0000313 3300046664 Bacteria 19327
656 Ga0495661_0009175 3300046665 Bacteria 6796
657 Ga0495588_0070004 3300046674 Bacteria 1823
658 Ga0495657_0011897 3300046675 Bacteria 6484
659 Ga0495657_0022974 3300046675 Bacteria 4462
660 Ga0495657_0023229 3300046675 Bacteria 4433
661 Ga0495599_0062772 3300046678 Bacteria 2321
662 Ga0495599_0124094 3300046678 Bacteria 1605
663 Ga0495623_0008182 3300046679 Bacteria 6801
664 Ga0495646_0224244 3300046680 Bacteria 1015
665 Ga0495647_0003430 3300046681 Bacteria 5066
666 Ga0495658_0014430 3300046683 Bacteria 4038
667 Ga0495658_0200861 3300046683 Bacteria 1242
668 Ga0495669_0038233 3300046684 Bacteria 2125
669 Ga0495613_0081537 3300046689 Bacteria 2350
670 Ga0495613_0090317 3300046689 Bacteria 2218
671 Ga0495624_0002456 3300046690 Bacteria 14053
672 Ga0495670_0000678 3300046691 Bacteria 16157
673 Ga0495600_0003434 3300046809 Bacteria 9317
674 Ga0495600_0135856 3300046809 Bacteria 1597
675 Ga0495600_0167186 3300046809 Bacteria 1420
676 Ga0495660_0085746 3300046810 Bacteria 1645
677 Ga0495581_0062689 3300047315 Bacteria 2148
678 Ga0495604_0018621 3300047317 Bacteria 5563
679 Ga0495604_0020747 3300047317 Bacteria 5246
680 Ga0495604_0404982 3300047317 Bacteria 898
681 Ga0495636_0182456 3300047318 Bacteria 953
682 Ga0495674_0050910 3300047319 Bacteria 3653
683 Ga0495674_0207364 3300047319 Bacteria 1624
684 Ga0495674_0542810 3300047319 Bacteria 926
685 Ga0495672_0041646 3300047320 Bacteria 2775
686 Ga0495672_0166336 3300047320 Bacteria 1129
687 Ga0495676_0073035 3300047321 Bacteria 2632
688 Ga0495676_0084461 3300047321 Bacteria 2395
689 Ga0495680_0007610 3300047322 Bacteria 9900
690 Ga0495680_0112151 3300047322 Bacteria 2020
691 Ga0495680_0151914 3300047322 Bacteria 1688
692 Ga0495683_0128522 3300047323 Bacteria 1197
693 Ga0495687_007944 3300047443 Bacteria 6161
694 Ga0495675_0034659 3300047444 Bacteria 3222
695 Ga0495675_0102524 3300047444 Bacteria 1790
696 Ga0495684_0003052 3300047471 Bacteria 13171
697 Ga0495684_0333476 3300047471 Bacteria 1081
698 Ga0495686_0065800 3300047472 Bacteria 2240
699 Ga0495593_0022233 3300047673 Bacteria 3537
700 Ga0495602_0066679 3300048088 Bacteria 3100
701 Ga0495602_0083728 3300048088 Bacteria 2671
702 Ga0495602_0216227 3300048088 Bacteria 1450
703 Ga0495602_0230950 3300048088 Bacteria 1390
704 Ga0496100_0002748 3300048903 Bacteria 8994
705 Ga0496100_0145876 3300048903 Bacteria 1683
706 Ga0496100_0176850 3300048903 Bacteria 1541
707 Ga0496100_0424866 3300048903 Bacteria 1015
708 Ga0496101_0001569 3300048904 Bacteria 13711
709 Ga0496101_0014208 3300048904 Bacteria 5348
710 Ga0496101_0018757 3300048904 Bacteria 4710
711 Ga0496102_0004673 3300048905 Bacteria 11584
712 Ga0496102_0182889 3300048905 Bacteria 1975
713 Ga0496102_0192286 3300048905 Bacteria 1923
714 Ga0496102_0367432 3300048905 Bacteria 1354
715 Ga0496102_0445904 3300048905 Bacteria 1214
716 Ga0496103_0000430 3300048906 Bacteria 36512
717 Ga0496103_0021945 3300048906 Bacteria 3843
718 Ga0496103_0119085 3300048906 Bacteria 1681
719 Ga0496104_0006387 3300048907 Bacteria 10364
720 Ga0496104_0021681 3300048907 Bacteria 5899
721 Ga0496104_0031575 3300048907 Bacteria 4927
722 Ga0496104_0060111 3300048907 Bacteria 3600
723 Ga0496104_0067210 3300048907 Bacteria 3405
724 Ga0496104_0069299 3300048907 Bacteria 3352
725 Ga0496104_0793269 3300048907 Bacteria 853
726 Ga0496105_0004848 3300048908 Bacteria 10161
727 Ga0496105_0069961 3300048908 Bacteria 2901
728 Ga0496105_0086814 3300048908 Bacteria 2585
729 Ga0496105_0235190 3300048908 Bacteria 1488
730 Ga0496106_0003028 3300048909 Bacteria 12522
731 Ga0496106_0004478 3300048909 Bacteria 10360
732 Ga0496106_0047456 3300048909 Bacteria 3232
733 Ga0496106_0073888 3300048909 Bacteria 2609
734 Ga0496106_0087642 3300048909 Bacteria 2399
735 Ga0496106_0140126 3300048909 Bacteria 1902
736 Ga0496107_0001244 3300048910 Bacteria 15566
737 Ga0496107_0002796 3300048910 Bacteria 11515
738 Ga0496108_0000361 3300048911 Bacteria 38318
739 Ga0496108_0004686 3300048911 Bacteria 11026
740 Ga0496108_0006618 3300048911 Bacteria 9394
741 Ga0496108_0367337 3300048911 Bacteria 1256
742 Ga0496109_0000338 3300048912 Bacteria 43692
743 Ga0496109_0000472 3300048912 Bacteria 34231
744 Ga0496109_0010107 3300048912 Bacteria 8050
745 Ga0496109_0255002 3300048912 Bacteria 1652
746 Ga0496109_0440555 3300048912 Bacteria 1231
747 Ga0496109_0452267 3300048912 Bacteria 1213
748 Ga0496110_0006849 3300048913 Bacteria 9056
749 Ga0496110_0012004 3300048913 Bacteria 7117
750 Ga0496110_0027225 3300048913 Bacteria 4900
751 Ga0496110_0238317 3300048913 Bacteria 1655
752 Ga0496110_0395632 3300048913 Bacteria 1260
753 Ga0496111_0006431 3300048914 Bacteria 7627
754 Ga0496111_0029782 3300048914 Bacteria 3878
755 Ga0496111_0230583 3300048914 Bacteria 1375
756 Ga0496111_0438685 3300048914 Bacteria 964
757 Ga0496112_0000009 3300048915 Bacteria 299708
758 Ga0496112_0005662 3300048915 Bacteria 10852
759 Ga0496112_0020955 3300048915 Bacteria 6207
760 Ga0496112_0104926 3300048915 Bacteria 2796
761 Ga0496112_0181433 3300048915 Bacteria 2069
762 Ga0496112_0472203 3300048915 Bacteria 1191
763 Ga0496113_0073775 3300048916 Bacteria 2600
764 Ga0496113_0645597 3300048916 Bacteria 846
765 Ga0496114_0062621 3300048917 Bacteria 3113
766 Ga0496114_0066111 3300048917 Bacteria 3031
767 Ga0496114_0183089 3300048917 Bacteria 1830
768 Ga0496115_0001318 3300048918 Bacteria 17694
769 Ga0496115_0059727 3300048918 Bacteria 3071
770 Ga0496115_0262069 3300048918 Bacteria 1421
771 Ga0496116_0019506 3300048919 Bacteria 5191
772 Ga0496117_0074133 3300048920 Bacteria 2267
773 Ga0496118_0019231 3300048921 Bacteria 6113
774 Ga0496118_0074493 3300048921 Bacteria 2426
775 Ga0496118_0112978 3300048921 Bacteria 1796
776 Ga0496119_0056442 3300048922 Bacteria 2379
777 Ga0496120_0008796 3300048923 Bacteria 7255
778 Ga0496121_0000612 3300048924 Bacteria 66397
779 Ga0496121_0022465 3300048924 Bacteria 6121
780 Ga0496121_0023184 3300048924 Bacteria 5991
781 Ga0496121_0030905 3300048924 Bacteria 4908
782 Ga0496121_0050546 3300048924 Bacteria 3510
783 Ga0496121_0064765 3300048924 Bacteria 2978
784 Ga0496121_0083331 3300048924 Bacteria 2525
785 Ga0496121_0118725 3300048924 Bacteria 2001
786 Ga0496122_0047391 3300048925 Bacteria 3318
787 Ga0496123_0008887 3300048926 Bacteria 9142
788 Ga0496123_0158750 3300048926 Bacteria 1209
789 Ga0496124_0200749 3300048927 Bacteria 1517
790 Ga0496124_0226789 3300048927 Bacteria 1400
791 Ga0496125_0000210 3300048928 Bacteria 121786
792 Ga0496125_0003330 3300048928 Bacteria 19623
793 Ga0496126_0026422 3300048929 Bacteria 5567
794 Ga0496126_0146656 3300048929 Bacteria 2026
795 Ga0495682_0048436 3300049460 Bacteria 1549
796 Ga0501031_0025851 3300049568 Bacteria 3830
797 Ga0501031_0134983 3300049568 Bacteria 1612
798 Ga0501032_0018148 3300049569 Bacteria 4930
799 Ga0501032_0035590 3300049569 Bacteria 3402
800 Ga0501032_0041769 3300049569 Bacteria 3113
801 Ga0501032_0067784 3300049569 Bacteria 2383
802 Ga0501033_0009909 3300049570 Bacteria 7316
803 Ga0501033_0042302 3300049570 Bacteria 3397
804 Ga0501033_0095101 3300049570 Bacteria 2177
805 Ga0501033_0187643 3300049570 Bacteria 1480
806 Ga0501034_0002596 3300049571 Bacteria 21476
807 Ga0501034_0009783 3300049571 Bacteria 10027
808 Ga0501034_0097324 3300049571 Bacteria 2938
809 Ga0501034_0099411 3300049571 Bacteria 2904
810 Ga0501034_0110532 3300049571 Bacteria 2739
811 Ga0501034_0117993 3300049571 Bacteria 2641
812 Ga0501034_0144486 3300049571 Bacteria 2357
813 Ga0501034_0273017 3300049571 Bacteria 1631
814 Ga0501034_0516556 3300049571 Bacteria 1107
815 Ga0501034_0916204 3300049571 Bacteria 764
816 Ga0501036_0001532 3300049572 Bacteria 17851
817 Ga0501036_0050872 3300049572 Bacteria 3508
818 Ga0501036_0058130 3300049572 Bacteria 3276
819 Ga0501036_0207410 3300049572 Bacteria 1647
820 Ga0501037_0013311 3300049573 Bacteria 6062
821 Ga0501037_0025878 3300049573 Bacteria 4333
822 Ga0501037_0081305 3300049573 Bacteria 2349
823 Ga0501037_0147553 3300049573 Bacteria 1682
824 Ga0501037_0311244 3300049573 Bacteria 1092
825 Ga0501038_0010082 3300049574 Bacteria 8651
826 Ga0501038_0012938 3300049574 Bacteria 7612
827 Ga0501038_0038331 3300049574 Bacteria 4197
828 Ga0501038_0108288 3300049574 Bacteria 2304
829 Ga0501038_0224258 3300049574 Bacteria 1498
830 Ga0501038_0231496 3300049574 Bacteria 1470
831 Ga0501038_0270661 3300049574 Bacteria 1339
832 Ga0501039_0035803 3300049575 Bacteria 3831
833 Ga0501039_0040108 3300049575 Bacteria 3615
834 Ga0501039_0056584 3300049575 Bacteria 3038
835 Ga0501039_0226396 3300049575 Bacteria 1470
836 Ga0501040_0107057 3300049576 Bacteria 1954
837 Ga0501042_0025312 3300049578 Bacteria 4167
838 Ga0501043_0002556 3300049579 Bacteria 15379
839 Ga0501043_0009082 3300049579 Bacteria 7820
840 Ga0501043_0094198 3300049579 Bacteria 2354
841 Ga0501043_0109394 3300049579 Bacteria 2170
842 Ga0501043_0191030 3300049579 Bacteria 1592
843 Ga0501046_0004314 3300049580 Bacteria 12941
844 Ga0501046_0012848 3300049580 Bacteria 7122
845 Ga0501046_0014686 3300049580 Bacteria 6595
846 Ga0501046_0061399 3300049580 Bacteria 2939
847 Ga0501046_0122369 3300049580 Bacteria 1979
848 Ga0501046_0364972 3300049580 Bacteria 1047
849 Ga0501046_0562744 3300049580 Bacteria 812
850 Ga0501047_0000010 3300049581 Bacteria 429357
851 Ga0501047_0023438 3300049581 Bacteria 5925
852 Ga0501047_0061353 3300049581 Bacteria 3628
853 Ga0501047_0067292 3300049581 Bacteria 3452
854 Ga0501047_0085578 3300049581 Bacteria 3029
855 Ga0501048_0000552 3300049582 Bacteria 26436
856 Ga0501048_0045728 3300049582 Bacteria 3126
857 Ga0501048_0050197 3300049582 Bacteria 2971
858 Ga0501067_0008523 3300049583 Bacteria 5685
859 Ga0501068_0009795 3300049584 Bacteria 5368
860 Ga0501068_0062319 3300049584 Bacteria 2267
861 Ga0501069_0013334 3300049585 Bacteria 4382
862 Ga0501070_0001743 3300049586 Bacteria 19221
863 Ga0501070_0005586 3300049586 Bacteria 10729
864 Ga0501070_0019942 3300049586 Bacteria 5622
865 Ga0501070_0028771 3300049586 Bacteria 4658
866 Ga0501070_0043035 3300049586 Bacteria 3759
867 Ga0501070_0059296 3300049586 Bacteria 3173
868 Ga0501070_0095010 3300049586 Bacteria 2467
869 Ga0501070_0114425 3300049586 Bacteria 2228
870 Ga0501070_0306670 3300049586 Bacteria 1292
871 Ga0501072_0051161 3300049588 Bacteria 3253
872 Ga0501073_0004769 3300049589 Bacteria 10177
873 Ga0501073_0113684 3300049589 Bacteria 1877
874 Ga0501073_0264887 3300049589 Bacteria 1186
875 Ga0501074_0006720 3300049590 Bacteria 8296
876 Ga0501074_0033032 3300049590 Bacteria 3750
877 Ga0501075_0253713 3300049591 Bacteria 1341
878 Ga0501075_0294180 3300049591 Bacteria 1237
879 Ga0501076_0329261 3300049592 Bacteria 1253
880 Ga0501079_0029988 3300049741 Bacteria 4178
881 Ga0501080_0000234 3300049742 Bacteria 41793
882 Ga0501080_0007431 3300049742 Bacteria 9890
883 Ga0501080_0079884 3300049742 Bacteria 3040
884 Ga0501080_0120298 3300049742 Bacteria 2434
885 Ga0501080_0144297 3300049742 Bacteria 2200
886 Ga0501080_0411693 3300049742 Bacteria 1215
887 Ga0501083_0000533 3300049744 Bacteria 24315
888 Ga0501083_0006493 3300049744 Bacteria 8293
889 Ga0501035_0000654 3300049822 Bacteria 38184
890 Ga0501035_0028842 3300049822 Bacteria 5063
891 Ga0501035_0062938 3300049822 Bacteria 3300
892 Ga0501035_0104058 3300049822 Bacteria 2489
893 Ga0501035_0185598 3300049822 Bacteria 1790
894 Ga0501035_0566022 3300049822 Bacteria 929
895 Ga0501044_0004701 3300049823 Bacteria 15268
896 Ga0501044_0010554 3300049823 Bacteria 10019
897 Ga0501044_0012179 3300049823 Bacteria 9312
898 Ga0501044_0114713 3300049823 Bacteria 2699
899 Ga0501044_0124616 3300049823 Bacteria 2574
900 Ga0501044_0216259 3300049823 Bacteria 1868
901 Ga0501044_0218398 3300049823 Bacteria 1857
902 Ga0501044_0245460 3300049823 Bacteria 1733
903 Ga0501044_0270853 3300049823 Bacteria 1634
904 Ga0501044_0281587 3300049823 Bacteria 1596
905 Ga0501044_0492650 3300049823 Bacteria 1127
906 Ga0501045_0031320 3300049824 Bacteria 3852
907 Ga0501045_0301716 3300049824 Bacteria 1192
908 nmdc:mga03683_35613_c1 3300050489 Bacteria 2019
909 nmdc:mga03n38_115705_c1 3300050490 Bacteria 1312
910 nmdc:mga03n38_44987_c1 3300050490 Bacteria 1942
911 nmdc:mga0yw44_131765_c1 3300050492 Bacteria 1619
912 nmdc:mga0yw44_329581_c1 3300050492 Bacteria 1026
913 nmdc:mga0yw44_59540_c1 3300050492 Bacteria 2337
914 nmdc:mga0yw44_93104_c1 3300050492 Bacteria 1908
915 nmdc:mga0k408_128597_c1 3300050493 Bacteria 1503
916 nmdc:mga0k408_50698_c1 3300050493 Bacteria 2403
917 nmdc:mga0k408_62477_c1 3300050493 Bacteria 2166
918 nmdc:mga06z11_293043_c1 3300050494 Bacteria 966
919 nmdc:mga04h51_126760_c1 3300050495 Bacteria 956
920 nmdc:mga07m45_42634_c1 3300050496 Bacteria 2544
921 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
922 nmdc:mga05p37_1602_c1 3300050507 Bacteria 26254
923 nmdc:mga05p37_7455_c1 3300050507 Bacteria 12899
924 nmdc:mga09592_266882_c1 3300050508 Bacteria 1485
925 nmdc:mga0qj67_556_c1 3300050509 Bacteria 25387
926 nmdc:mga0qj67_6499_c1 3300050509 Bacteria 8592
927 nmdc:mga06r32_1042_c1 3300050510 Bacteria 25028
928 nmdc:mga06r32_4708_c1 3300050510 Bacteria 12267
929 nmdc:mga08y16_2015_c1 3300050511 Bacteria 20774
930 nmdc:mga08y16_412_c1 3300050511 Bacteria 39249
931 nmdc:mga08y16_4650_c1 3300050511 Bacteria 14290
932 nmdc:mga08y16_58619_c1 3300050511 Bacteria 4023
933 nmdc:mga0n895_115319_c1 3300050512 Bacteria 2705
934 nmdc:mga0n895_1478_c1 3300050512 Bacteria 17626
935 nmdc:mga0n895_4804_c1 3300050512 Bacteria 11185
936 nmdc:mga0n895_543_c1 3300050512 Bacteria 25826
937 nmdc:mga0n895_56244_c1 3300050512 Bacteria 3875
938 nmdc:mga0n895_79859_c1 3300050512 Bacteria 3258
939 nmdc:mga0rr50_112178_c2 3300050513 Bacteria 1698
940 nmdc:mga0rr50_296228_c1 3300050513 Bacteria 1352
941 nmdc:mga0rr50_32680_c1 3300050513 Bacteria 3710
942 nmdc:mga0rr50_69644_c1 3300050513 Bacteria 2678
943 nmdc:mga08x19_111865_c1 3300050514 Bacteria 1822
944 nmdc:mga08x19_207846_c1 3300050514 Bacteria 1343
945 nmdc:mga0a205_114547_c1 3300050515 Bacteria 2595
946 nmdc:mga0a205_20418_c1 3300050515 Bacteria 6248
947 nmdc:mga0a205_416_c1 3300050515 Bacteria 32776
948 nmdc:mga0a205_8969_c1 3300050515 Bacteria 9116
949 nmdc:mga0sz30_223763_c1 3300050516 Bacteria 837
950 nmdc:mga0sz30_32769_c1 3300050516 Bacteria 2156
951 nmdc:mga0sz30_67242_c1 3300050516 Bacteria 1539
952 Ga0495601_0003588 3300053077 Bacteria 8925
953 Ga0495601_0122219 3300053077 Bacteria 1691
954 Ga0495612_0004411 3300053078 Bacteria 5837
955 Ga0495612_0041489 3300053078 Bacteria 1877
956 Ga0495595_0001441 3300053084 Bacteria 9267
957 Ga0495595_0094474 3300053084 Bacteria 1437
958 Ga0495619_0004134 3300053085 Bacteria 9276
959 Ga0495619_0053413 3300053085 Bacteria 2673
960 Ga0495619_0065872 3300053085 Bacteria 2417
961 Ga0495619_0292412 3300053085 Bacteria 1128
962 Ga0500643_000116 3300053087 Bacteria 83687
963 Ga0500643_018322 3300053087 Bacteria 2326
964 Ga0500646_0002674 3300053090 Bacteria 4605
965 Ga0500647_0070088 3300053091 Bacteria 1686
966 Ga0500566_0000050 3300053094 Bacteria 57809
967 Ga0500566_0004414 3300053094 Bacteria 8399
968 Ga0500566_0011997 3300053094 Bacteria 5102
969 Ga0500640_045381 3300053095 Bacteria 1927
970 Ga0500641_0075214 3300053096 Bacteria 1427
971 Ga0500650_0001293 3300053098 Bacteria 7414
972 Ga0500555_001167 3300053103 Bacteria 8624
973 Ga0500556_0000002 3300053104 Bacteria 773626
974 Ga0500557_000061 3300053105 Bacteria 44319
975 Ga0500562_007630 3300053108 Bacteria 2728
976 Ga0500562_012973 3300053108 Bacteria 2122
977 Ga0500569_018498 3300053109 Bacteria 1800
978 Ga0500569_022053 3300053109 Bacteria 1691
979 Ga0500569_065389 3300053109 Bacteria 1132
980 Ga0500572_000033 3300053111 Bacteria 43170
981 Ga0500572_000604 3300053111 Bacteria 12092
982 Ga0500572_007763 3300053111 Bacteria 2491
983 Ga0500592_000901 3300053116 Bacteria 4852
984 Ga0500595_003180 3300053119 Bacteria 7773
985 Ga0500595_013385 3300053119 Bacteria 3144
986 Ga0500595_028988 3300053119 Bacteria 1882
987 Ga0500607_185278 3300053121 Bacteria 917
988 Ga0500608_005836 3300053122 Bacteria 4939
989 Ga0500614_000469 3300053123 Bacteria 10467
990 Ga0500618_006905 3300053125 Bacteria 3287
991 Ga0500618_009795 3300053125 Bacteria 2603
992 Ga0500642_0000010 3300053130 Bacteria 272552
993 Ga0500642_0000098 3300053130 Bacteria 42383
994 Ga0500652_000817 3300053131 Bacteria 10418
995 Ga0500559_0000142 3300053136 Bacteria 55814
996 Ga0500559_0000638 3300053136 Bacteria 23672
997 Ga0500559_0008402 3300053136 Bacteria 4525
998 Ga0500559_0039339 3300053136 Bacteria 2056
999 Ga0500564_115762 3300053138 Bacteria 1172
1000 Ga0500568_0000427 3300053139 Bacteria 31670
1001 Ga0500568_0003430 3300053139 Bacteria 8838
1002 Ga0500577_0000228 3300053142 Bacteria 14932
1003 Ga0500577_0008280 3300053142 Bacteria 2958
1004 Ga0500586_000703 3300053145 Bacteria 6870
1005 Ga0500603_000424 3300053150 Bacteria 10966
1006 Ga0500604_0006917 3300053151 Bacteria 3002
1007 Ga0500616_0000069 3300053153 Bacteria 234334
1008 Ga0500616_0007910 3300053153 Bacteria 6679
1009 Ga0500620_025463 3300053155 Bacteria 1821
1010 Ga0500622_0013995 3300053156 Bacteria 4313
1011 Ga0500622_0014627 3300053156 Bacteria 4208
1012 Ga0500627_0001120 3300053158 Bacteria 7332
1013 Ga0500627_0014445 3300053158 Bacteria 3026
1014 Ga0500630_000093 3300053159 Bacteria 28275
1015 Ga0500633_0017870 3300053160 Bacteria 2090
1016 Ga0500634_0031198 3300053161 Bacteria 2906
1017 Ga0500639_000032 3300053163 Bacteria 69113
1018 Ga0500639_012938 3300053163 Bacteria 4383
1019 Ga0500639_092921 3300053163 Bacteria 1499
1020 Ga0500636_0000468 3300053177 Bacteria 21977
1021 Ga0500636_0025189 3300053177 Bacteria 3515
1022 Ga0500636_0025635 3300053177 Bacteria 3485
1023 Ga0500637_0013736 3300053178 Bacteria 4256
1024 Ga0500637_0053774 3300053178 Bacteria 2299
1025 Ga0500637_0101554 3300053178 Bacteria 1668
1026 Ga0500625_016887 3300053729 Bacteria 3406
1027 Ga0500596_000019 3300053735 Bacteria 23095
1028 Ga0500599_000994 3300053736 Bacteria 3172
1029 Ga0500601_000104 3300053737 Bacteria 17603
1030 Ga0500601_001797 3300053737 Bacteria 2304
1031 Ga0501084_0057365 3300054114 Bacteria 3259
1032 Ga0501084_0346575 3300054114 Bacteria 1255
1033 Ga0501082_0009365 3300060353 Bacteria 8440
1034 Ga0501082_0479731 3300060353 Bacteria 1087
1035 Ga0466962_0167636 3300061719 Bacteria 1069
1036 Ga0530510_0325065 3300061734 Bacteria 1153

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016566248 8016573789 219
2 3300035113 Ga0373936_0088802 Ga0373936_0088802_26_793 222
3 3300048923 Ga0496120_0008796 Ga0496120_0008796_6456_7229 222
4 3300049571 Ga0501034_0916204 Ga0501034_0916204_11_739 222
5 3300049580 Ga0501046_0562744 Ga0501046_0562744_17_748 222
6 3300049591 Ga0501075_0253713 Ga0501075_0253713_13_720 222
7 3300035725 Ga0373947_0013182 Ga0373947_0013182_2519_3337 224
8 3300037068 Ga0373925_0120863 Ga0373925_0120863_762_1580 224
9 3300025898 Ga0207692_10134914 Ga0207692_101349142 227
10 3300006048 Ga0075363_100052433 Ga0075363_1000524333 230
11 3300006178 Ga0075367_10108150 Ga0075367_101081502 230
12 3300006353 Ga0075370_10047118 Ga0075370_100471182 230
13 3300006871 Ga0075434_100377177 Ga0075434_1003771772 230
14 3300014326 Ga0157380_10232005 Ga0157380_102320051 230
15 3300050490 nmdc:mga03n38_44987_c1 nmdc:mga03n38_44987_c1_659_1474 230
16 3300050512 nmdc:mga0n895_56244_c1 nmdc:mga0n895_56244_c1_478_1287 230
17 3300050513 nmdc:mga0rr50_32680_c1 nmdc:mga0rr50_32680_c1_32_841 230
18 3300050514 nmdc:mga08x19_111865_c1 nmdc:mga08x19_111865_c1_446_1255 230
19 3300048924 Ga0496121_0030905 Ga0496121_0030905_3136_3945 231
20 3300006195 Ga0075366_10029327 Ga0075366_100293272 232
21 3300049580 Ga0501046_0122369 Ga0501046_0122369_592_1413 232
22 3300050493 nmdc:mga0k408_50698_c1 nmdc:mga0k408_50698_c1_1400_2209 232
23 3300005337 Ga0070682_100125083 Ga0070682_1001250832 233
24 3300005458 Ga0070681_10019499 Ga0070681_100194997 233
25 3300005530 Ga0070679_100024249 Ga0070679_1000242493 233
26 3300025912 Ga0207707_10000311 Ga0207707_1000031111 233
27 3300025917 Ga0207660_10037039 Ga0207660_100370393 233
28 3300025921 Ga0207652_10017328 Ga0207652_100173284 233
29 3300005530 Ga0070679_100113511 Ga0070679_1001135114 234
30 3300009093 Ga0105240_10583553 Ga0105240_105835532 234
31 3300025921 Ga0207652_10490708 Ga0207652_104907082 234
32 3300048909 Ga0496106_0140126 Ga0496106_0140126_15_824 234
33 3300048928 Ga0496125_0000210 Ga0496125_0000210_107997_108818 234
34 3300049823 Ga0501044_0270853 Ga0501044_0270853_727_1545 234
35 3300053119 Ga0500595_003180 Ga0500595_003180_302_1120 234
36 3300005937 Ga0081455_10014064 Ga0081455_100140642 235
37 3300005983 Ga0081540_1078879 Ga0081540_10788792 235
38 3300006881 Ga0068865_100284929 Ga0068865_1002849292 235
39 3300007788 Ga0099795_10028564 Ga0099795_100285642 235
40 3300009093 Ga0105240_10292421 Ga0105240_102924212 235
41 3300025911 Ga0207654_10233559 Ga0207654_102335592 235
42 3300025913 Ga0207695_10000015 Ga0207695_10000015657 235
43 3300045976 Ga0466967_0578062 Ga0466967_0578062_231_1040 235
44 3300046459 Ga0495629_0000627 Ga0495629_0000627_345_1157 235
45 3300046462 Ga0495651_0031737 Ga0495651_0031737_2463_3269 235
46 3300046462 Ga0495651_0034033 Ga0495651_0034033_36_848 235
47 3300046463 Ga0495653_0078351 Ga0495653_0078351_354_1160 235
48 3300046477 Ga0495664_0038868 Ga0495664_0038868_481_1287 235
49 3300046507 Ga0495606_0047224 Ga0495606_0047224_916_1728 235
50 3300046514 Ga0495618_0094377 Ga0495618_0094377_920_1732 235
51 3300046516 Ga0495628_0125285 Ga0495628_0125285_351_1157 235
52 3300046529 Ga0495652_0005661 Ga0495652_0005661_10744_11550 235
53 3300046543 Ga0495645_0149603 Ga0495645_0149603_518_1324 235
54 3300046663 Ga0495635_0089773 Ga0495635_0089773_1010_1822 235
55 3300046675 Ga0495657_0011897 Ga0495657_0011897_4112_4918 235
56 3300046675 Ga0495657_0023229 Ga0495657_0023229_1130_1942 235
57 3300046678 Ga0495599_0124094 Ga0495599_0124094_597_1403 235
58 3300046679 Ga0495623_0008182 Ga0495623_0008182_3080_3886 235
59 3300046680 Ga0495646_0224244 Ga0495646_0224244_114_926 235
60 3300046689 Ga0495613_0081537 Ga0495613_0081537_1324_2136 235
61 3300046809 Ga0495600_0135856 Ga0495600_0135856_457_1269 235
62 3300046809 Ga0495600_0167186 Ga0495600_0167186_193_999 235
63 3300047317 Ga0495604_0020747 Ga0495604_0020747_3292_4104 235
64 3300047319 Ga0495674_0542810 Ga0495674_0542810_102_908 235
65 3300047320 Ga0495672_0166336 Ga0495672_0166336_22_834 235
66 3300047321 Ga0495676_0073035 Ga0495676_0073035_202_1014 235
67 3300047323 Ga0495683_0128522 Ga0495683_0128522_11_823 235
68 3300048088 Ga0495602_0066679 Ga0495602_0066679_788_1600 235
69 3300048088 Ga0495602_0216227 Ga0495602_0216227_394_1200 235
70 3300048907 Ga0496104_0006387 Ga0496104_0006387_452_1264 235
71 3300048908 Ga0496105_0004848 Ga0496105_0004848_3364_4176 235
72 3300048915 Ga0496112_0000009 Ga0496112_0000009_120264_121079 235
73 3300048916 Ga0496113_0645597 Ga0496113_0645597_18_830 235
74 3300048917 Ga0496114_0183089 Ga0496114_0183089_865_1677 235
75 3300048922 Ga0496119_0056442 Ga0496119_0056442_1132_1944 235
76 3300048927 Ga0496124_0200749 Ga0496124_0200749_201_1013 235
77 3300049460 Ga0495682_0048436 Ga0495682_0048436_163_975 235
78 3300049568 Ga0501031_0025851 Ga0501031_0025851_376_1215 235
79 3300049569 Ga0501032_0035590 Ga0501032_0035590_1742_2581 235
80 3300049570 Ga0501033_0009909 Ga0501033_0009909_5656_6495 235
81 3300049571 Ga0501034_0009783 Ga0501034_0009783_2972_3811 235
82 3300049573 Ga0501037_0081305 Ga0501037_0081305_719_1558 235
83 3300049574 Ga0501038_0010082 Ga0501038_0010082_5656_6495 235
84 3300049575 Ga0501039_0035803 Ga0501039_0035803_2981_3820 235
85 3300049579 Ga0501043_0009082 Ga0501043_0009082_1426_2265 235
86 3300049580 Ga0501046_0004314 Ga0501046_0004314_1988_2827 235
87 3300049581 Ga0501047_0023438 Ga0501047_0023438_2854_3693 235
88 3300049582 Ga0501048_0045728 Ga0501048_0045728_574_1413 235
89 3300049583 Ga0501067_0008523 Ga0501067_0008523_629_1468 235
90 3300049584 Ga0501068_0009795 Ga0501068_0009795_3566_4405 235
91 3300049586 Ga0501070_0028771 Ga0501070_0028771_3100_3939 235
92 3300049589 Ga0501073_0004769 Ga0501073_0004769_4726_5565 235
93 3300049590 Ga0501074_0006720 Ga0501074_0006720_6217_7056 235
94 3300049742 Ga0501080_0144297 Ga0501080_0144297_720_1559 235
95 3300049744 Ga0501083_0006493 Ga0501083_0006493_6994_7833 235
96 3300049822 Ga0501035_0062938 Ga0501035_0062938_720_1559 235
97 3300049823 Ga0501044_0004701 Ga0501044_0004701_11081_11920 235
98 3300049824 Ga0501045_0031320 Ga0501045_0031320_492_1331 235
99 3300053085 Ga0495619_0053413 Ga0495619_0053413_1782_2594 235
100 3300053094 Ga0500566_0000050 Ga0500566_0000050_20399_21205 235
101 3300053111 Ga0500572_000033 Ga0500572_000033_32825_33631 235
102 3300053111 Ga0500572_000604 Ga0500572_000604_5324_6130 235
103 3300053119 Ga0500595_013385 Ga0500595_013385_1981_2793 235
104 3300053123 Ga0500614_000469 Ga0500614_000469_2379_3185 235
105 3300053136 Ga0500559_0000142 Ga0500559_0000142_23426_24232 235
106 3300053136 Ga0500559_0008402 Ga0500559_0008402_2787_3593 235
107 3300053150 Ga0500603_000424 Ga0500603_000424_3393_4199 235
108 3300053159 Ga0500630_000093 Ga0500630_000093_13699_14505 235
109 3300053163 Ga0500639_000032 Ga0500639_000032_27776_28582 235
110 3300053163 Ga0500639_012938 Ga0500639_012938_170_976 235
111 3300053178 Ga0500637_0013736 Ga0500637_0013736_2553_3359 235
112 3300053735 Ga0500596_000019 Ga0500596_000019_2785_3591 235
113 3300053737 Ga0500601_001797 Ga0500601_001797_911_1717 235
114 3300054114 Ga0501084_0057365 Ga0501084_0057365_2284_3123 235
115 3300060353 Ga0501082_0009365 Ga0501082_0009365_7345_8184 235
116 3300005539 Ga0068853_100220550 Ga0068853_1002205502 236
117 3300005842 Ga0068858_100303146 Ga0068858_1003031462 236
118 3300005985 Ga0081539_10000379 Ga0081539_1000037973 236
119 3300009177 Ga0105248_10140778 Ga0105248_101407782 236
120 3300025906 Ga0207699_10149236 Ga0207699_101492362 236
121 3300025941 Ga0207711_10158772 Ga0207711_101587722 236
122 3300026041 Ga0207639_10165864 Ga0207639_101658642 236
123 3300031616 Ga0307508_10244338 Ga0307508_102443382 236
124 3300033442 Ga0315911_1000001 Ga0315911_1000001603 236
125 3300035118 Ga0373954_0023914 Ga0373954_0023914_1733_2542 236
126 3300035118 Ga0373954_0132192 Ga0373954_0132192_373_1197 236
127 3300035410 Ga0373924_0049076 Ga0373924_0049076_530_1354 236
128 3300035695 Ga0373927_0167979 Ga0373927_0167979_183_989 236
129 3300036401 Ga0373937_0149503 Ga0373937_0149503_275_1099 236
130 3300046514 Ga0495618_0040014 Ga0495618_0040014_611_1435 236
131 3300046522 Ga0495643_0036869 Ga0495643_0036869_698_1522 236
132 3300046536 Ga0495587_0049798 Ga0495587_0049798_1172_1996 236
133 3300046543 Ga0495645_0011108 Ga0495645_0011108_387_1211 236
134 3300046663 Ga0495635_0032058 Ga0495635_0032058_2444_3268 236
135 3300047319 Ga0495674_0050910 Ga0495674_0050910_2526_3350 236
136 3300047322 Ga0495680_0112151 Ga0495680_0112151_824_1648 236
137 3300047471 Ga0495684_0333476 Ga0495684_0333476_140_964 236
138 3300048904 Ga0496101_0018757 Ga0496101_0018757_3076_3882 236
139 3300048905 Ga0496102_0182889 Ga0496102_0182889_351_1172 236
140 3300048908 Ga0496105_0086814 Ga0496105_0086814_1397_2203 236
141 3300048909 Ga0496106_0073888 Ga0496106_0073888_334_1140 236
142 3300048912 Ga0496109_0440555 Ga0496109_0440555_61_867 236
143 3300048917 Ga0496114_0062621 Ga0496114_0062621_1051_1857 236
144 3300048918 Ga0496115_0262069 Ga0496115_0262069_106_912 236
145 3300053085 Ga0495619_0292412 Ga0495619_0292412_197_1021 236
146 3300053177 Ga0500636_0025189 Ga0500636_0025189_1459_2268 236
147 3300005337 Ga0070682_100310491 Ga0070682_1003104911 237
148 3300005455 Ga0070663_100102247 Ga0070663_1001022472 237
149 3300005616 Ga0068852_100666308 Ga0068852_1006663082 237
150 3300006177 Ga0075362_10045367 Ga0075362_100453672 237
151 3300009551 Ga0105238_10316456 Ga0105238_103164562 237
152 3300028786 Ga0307517_10000139 Ga0307517_1000013921 237
153 3300035725 Ga0373947_0110999 Ga0373947_0110999_585_1391 237
154 3300048924 Ga0496121_0083331 Ga0496121_0083331_1344_2174 237
155 3300050489 nmdc:mga03683_35613_c1 nmdc:mga03683_35613_c1_154_966 237
156 3300005547 Ga0070693_100066630 Ga0070693_1000666301 238
157 3300025915 Ga0207693_10354384 Ga0207693_103543842 238
158 3300044694 Ga0466963_0054377 Ga0466963_0054377_1764_2570 238
159 3300045976 Ga0466967_0123883 Ga0466967_0123883_387_1193 238
160 3300046523 Ga0495644_0049165 Ga0495644_0049165_427_1254 238
161 3300047318 Ga0495636_0182456 Ga0495636_0182456_36_863 238
162 3300048924 Ga0496121_0064765 Ga0496121_0064765_696_1505 238
163 3300005327 Ga0070658_10060353 Ga0070658_100603532 239
164 3300005331 Ga0070670_100294078 Ga0070670_1002940782 239
165 3300005455 Ga0070663_100019641 Ga0070663_1000196413 239
166 3300005718 Ga0068866_10151449 Ga0068866_101514491 239
167 3300005983 Ga0081540_1006242 Ga0081540_10062421 239
168 3300025909 Ga0207705_10100040 Ga0207705_101000402 239
169 3300025929 Ga0207664_10005104 Ga0207664_100051047 239
170 3300026067 Ga0207678_10140870 Ga0207678_101408702 239
171 3300041512 Ga0451853_0102419 Ga0451853_0102419_196_1077 239
172 3300046524 Ga0495648_0000895 Ga0495648_0000895_30135_30959 239
173 3300048913 Ga0496110_0395632 Ga0496110_0395632_346_1152 239
174 3300005434 Ga0070709_10371117 Ga0070709_103711172 240
175 3300005437 Ga0070710_10043692 Ga0070710_100436922 240
176 3300005439 Ga0070711_100002555 Ga0070711_1000025556 240
177 3300006038 Ga0075365_10061715 Ga0075365_100617153 240
178 3300009148 Ga0105243_10103348 Ga0105243_101033482 240
179 3300009176 Ga0105242_10327313 Ga0105242_103273132 240
180 3300025898 Ga0207692_10033251 Ga0207692_100332512 240
181 3300025916 Ga0207663_10012968 Ga0207663_100129681 240
182 3300026078 Ga0207702_10455353 Ga0207702_104553532 240
183 3300031241 Ga0265325_10003096 Ga0265325_100030965 240
184 3300031249 Ga0265339_10001686 Ga0265339_100016862 240
185 3300031344 Ga0265316_10062198 Ga0265316_100621982 240
186 3300031595 Ga0265313_10006454 Ga0265313_100064544 240
187 3300037471 Ga0395905_0135873 Ga0395905_0135873_1480_2286 240
188 3300037853 Ga0436364_0819845 Ga0436364_0819845_187_984 240
189 3300048903 Ga0496100_0424866 Ga0496100_0424866_40_843 240
190 3300048905 Ga0496102_0445904 Ga0496102_0445904_93_896 240
191 3300050492 nmdc:mga0yw44_59540_c1 nmdc:mga0yw44_59540_c1_1418_2236 240
192 3300053119 Ga0500595_028988 Ga0500595_028988_861_1673 240
193 3300053121 Ga0500607_185278 Ga0500607_185278_36_848 240
194 3300053145 Ga0500586_000703 Ga0500586_000703_4730_5542 240
195 3300003659 JGI25404J52841_10018735 JGI25404J52841_100187352 241
196 3300005262 Ga0065165_1004760 Ga0065165_10047602 241
197 3300005455 Ga0070663_100340435 Ga0070663_1003404352 241
198 3300005564 Ga0070664_100319756 Ga0070664_1003197562 241
199 3300005983 Ga0081540_1002686 Ga0081540_100268610 241
200 3300025253 Ga0209677_100663 Ga0209677_10066317 241
201 3300025261 Ga0209233_1013243 Ga0209233_10132432 241
202 3300025302 Ga0207426_1001694 Ga0207426_100169411 241
203 3300025919 Ga0207657_10169565 Ga0207657_101695652 241
204 3300044658 Ga0466972_0000294 Ga0466972_0000294_12876_13685 241
205 3300044735 Ga0466968_0016434 Ga0466968_0016434_742_1551 241
206 3300048907 Ga0496104_0031575 Ga0496104_0031575_1180_1971 241
207 3300048908 Ga0496105_0069961 Ga0496105_0069961_1139_1930 241
208 3300048914 Ga0496111_0438685 Ga0496111_0438685_34_825 241
209 3300048917 Ga0496114_0066111 Ga0496114_0066111_1474_2265 241
210 3300048918 Ga0496115_0059727 Ga0496115_0059727_2232_3023 241
211 3300048921 Ga0496118_0074493 Ga0496118_0074493_1433_2242 241
212 3300048924 Ga0496121_0023184 Ga0496121_0023184_2219_3031 241
213 3300050516 nmdc:mga0sz30_223763_c1 nmdc:mga0sz30_223763_c1_15_788 241
214 3300053136 Ga0500559_0039339 Ga0500559_0039339_1208_2023 241
215 3300053177 Ga0500636_0000468 Ga0500636_0000468_17276_18091 241
216 3300028800 Ga0265338_10473270 Ga0265338_104732701 242
217 3300044719 Ga0466971_0077499 Ga0466971_0077499_712_1482 242
218 3300044842 Ga0466957_0240497 Ga0466957_0240497_14_787 242
219 3300048907 Ga0496104_0793269 Ga0496104_0793269_70_843 242
220 3300049576 Ga0501040_0107057 Ga0501040_0107057_1166_1933 242
221 3300053095 Ga0500640_045381 Ga0500640_045381_85_897 242
222 3300053096 Ga0500641_0075214 Ga0500641_0075214_171_995 242
223 3300053111 Ga0500572_007763 Ga0500572_007763_879_1691 242
224 3300053138 Ga0500564_115762 Ga0500564_115762_289_1101 242
225 3300053155 Ga0500620_025463 Ga0500620_025463_81_893 242
226 3300053163 Ga0500639_092921 Ga0500639_092921_394_1206 242
227 3300053178 Ga0500637_0101554 Ga0500637_0101554_332_1144 242
228 3300054114 Ga0501084_0346575 Ga0501084_0346575_20_787 242
229 3300005340 Ga0070689_100209407 Ga0070689_1002094072 243
230 3300005618 Ga0068864_100669224 Ga0068864_1006692242 243
231 3300010375 Ga0105239_10253811 Ga0105239_102538113 243
232 3300011119 Ga0105246_10027291 Ga0105246_100272913 243
233 3300014968 Ga0157379_10044047 Ga0157379_100440472 243
234 3300014969 Ga0157376_10511583 Ga0157376_105115832 243
235 3300025936 Ga0207670_10197046 Ga0207670_101970462 243
236 3300048903 Ga0496100_0176850 Ga0496100_0176850_164_988 243
237 3300048909 Ga0496106_0087642 Ga0496106_0087642_95_919 243
238 3300048911 Ga0496108_0004686 Ga0496108_0004686_2595_3419 243
239 3300048912 Ga0496109_0010107 Ga0496109_0010107_5599_6423 243
240 3300053125 Ga0500618_009795 Ga0500618_009795_62_889 243
241 3300049570 Ga0501033_0187643 Ga0501033_0187643_549_1376 244
242 3300049571 Ga0501034_0144486 Ga0501034_0144486_1485_2312 244
243 3300049572 Ga0501036_0207410 Ga0501036_0207410_783_1610 244
244 3300049574 Ga0501038_0231496 Ga0501038_0231496_575_1402 244
245 3300049580 Ga0501046_0364972 Ga0501046_0364972_66_893 244
246 3300053109 Ga0500569_018498 Ga0500569_018498_948_1760 244
247 3300025230 Ga0209563_102080 Ga0209563_1020802 245
248 3300025297 Ga0209758_1016841 Ga0209758_10168414 245
249 3300037466 Ga0395898_0124168 Ga0395898_0124168_1580_2398 245
250 3300053094 Ga0500566_0004414 Ga0500566_0004414_2723_3532 245
251 3300014497 Ga0182008_10036655 Ga0182008_100366553 246
252 3300041498 Ga0451841_0960603 Ga0451841_0960603_147_959 246
253 3300005578 Ga0068854_100190683 Ga0068854_1001906832 247
254 3300053142 Ga0500577_0000228 Ga0500577_0000228_1884_2696 247
255 3300005441 Ga0070700_100114956 Ga0070700_1001149562 248
256 3300009545 Ga0105237_10014611 Ga0105237_100146114 248
257 3300053153 Ga0500616_0007910 Ga0500616_0007910_2789_3619 248
258 3300048924 Ga0496121_0000612 Ga0496121_0000612_46014_46841 249
259 3300048924 Ga0496121_0050546 Ga0496121_0050546_1005_1835 249
260 3300049578 Ga0501042_0025312 Ga0501042_0025312_1154_1975 249
261 3300049822 Ga0501035_0000654 Ga0501035_0000654_22436_23278 249
262 3300049822 Ga0501035_0185598 Ga0501035_0185598_906_1706 249
263 3300005338 Ga0068868_100088762 Ga0068868_1000887624 250
264 3300005455 Ga0070663_100031255 Ga0070663_1000312554 250
265 3300005456 Ga0070678_100272711 Ga0070678_1002727112 250
266 3300005563 Ga0068855_100380655 Ga0068855_1003806552 250
267 3300005614 Ga0068856_100238473 Ga0068856_1002384732 250
268 3300005617 Ga0068859_100123228 Ga0068859_1001232282 250
269 3300005618 Ga0068864_100109286 Ga0068864_1001092863 250
270 3300005719 Ga0068861_100124839 Ga0068861_1001248392 250
271 3300005842 Ga0068858_100018465 Ga0068858_1000184658 250
272 3300005844 Ga0068862_100201763 Ga0068862_1002017632 250
273 3300006042 Ga0075368_10029287 Ga0075368_100292873 250
274 3300006051 Ga0075364_10069135 Ga0075364_100691352 250
275 3300006178 Ga0075367_10157983 Ga0075367_101579832 250
276 3300006871 Ga0075434_100074375 Ga0075434_1000743754 250
277 3300006931 Ga0097620_100123230 Ga0097620_1001232302 250
278 3300009174 Ga0105241_10525361 Ga0105241_105253611 250
279 3300010375 Ga0105239_10108947 Ga0105239_101089475 250
280 3300013306 Ga0163162_10975414 Ga0163162_109754141 250
281 3300014325 Ga0163163_10211943 Ga0163163_102119432 250
282 3300025907 Ga0207645_10086693 Ga0207645_100866932 250
283 3300025914 Ga0207671_10035837 Ga0207671_100358372 250
284 3300025942 Ga0207689_10037986 Ga0207689_100379865 250
285 3300025949 Ga0207667_10401693 Ga0207667_104016932 250
286 3300026035 Ga0207703_10086489 Ga0207703_100864893 250
287 3300026078 Ga0207702_10180446 Ga0207702_101804462 250
288 3300026118 Ga0207675_100262104 Ga0207675_1002621042 250
289 3300039447 Ga0436361_0060531 Ga0436361_0060531_532_1329 250
290 3300044658 Ga0466972_0012453 Ga0466972_0012453_3378_4190 250
291 3300044735 Ga0466968_0051832 Ga0466968_0051832_125_937 250
292 3300044901 Ga0466960_0046399 Ga0466960_0046399_409_1221 250
293 3300048903 Ga0496100_0145876 Ga0496100_0145876_785_1606 250
294 3300048906 Ga0496103_0119085 Ga0496103_0119085_541_1362 250
295 3300048907 Ga0496104_0060111 Ga0496104_0060111_272_1093 250
296 3300048907 Ga0496104_0067210 Ga0496104_0067210_1400_2221 250
297 3300048908 Ga0496105_0235190 Ga0496105_0235190_462_1283 250
298 3300048909 Ga0496106_0004478 Ga0496106_0004478_417_1238 250
299 3300048910 Ga0496107_0001244 Ga0496107_0001244_3965_4786 250
300 3300048911 Ga0496108_0000361 Ga0496108_0000361_15346_16167 250
301 3300048911 Ga0496108_0367337 Ga0496108_0367337_423_1244 250
302 3300048912 Ga0496109_0000472 Ga0496109_0000472_22050_22871 250
303 3300048912 Ga0496109_0255002 Ga0496109_0255002_683_1504 250
304 3300048913 Ga0496110_0006849 Ga0496110_0006849_530_1351 250
305 3300048914 Ga0496111_0029782 Ga0496111_0029782_684_1505 250
306 3300048915 Ga0496112_0005662 Ga0496112_0005662_3870_4691 250
307 3300048924 Ga0496121_0118725 Ga0496121_0118725_895_1716 250
308 3300048929 Ga0496126_0026422 Ga0496126_0026422_3824_4651 250
309 3300049569 Ga0501032_0067784 Ga0501032_0067784_868_1698 250
310 3300049571 Ga0501034_0002596 Ga0501034_0002596_11703_12533 250
311 3300049571 Ga0501034_0516556 Ga0501034_0516556_24_842 250
312 3300049572 Ga0501036_0001532 Ga0501036_0001532_4020_4850 250
313 3300049572 Ga0501036_0058130 Ga0501036_0058130_1882_2700 250
314 3300049573 Ga0501037_0013311 Ga0501037_0013311_2688_3518 250
315 3300049574 Ga0501038_0224258 Ga0501038_0224258_308_1138 250
316 3300049575 Ga0501039_0226396 Ga0501039_0226396_29_847 250
317 3300049579 Ga0501043_0002556 Ga0501043_0002556_8227_9057 250
318 3300049580 Ga0501046_0012848 Ga0501046_0012848_6077_6907 250
319 3300049581 Ga0501047_0000010 Ga0501047_0000010_143886_144716 250
320 3300049582 Ga0501048_0000552 Ga0501048_0000552_13911_14741 250
321 3300049586 Ga0501070_0005586 Ga0501070_0005586_2565_3395 250
322 3300049586 Ga0501070_0095010 Ga0501070_0095010_610_1428 250
323 3300049589 Ga0501073_0113684 Ga0501073_0113684_58_888 250
324 3300049590 Ga0501074_0033032 Ga0501074_0033032_582_1412 250
325 3300049742 Ga0501080_0000234 Ga0501080_0000234_20675_21505 250
326 3300049744 Ga0501083_0000533 Ga0501083_0000533_5801_6631 250
327 3300049823 Ga0501044_0114713 Ga0501044_0114713_1034_1864 250
328 3300049823 Ga0501044_0245460 Ga0501044_0245460_483_1301 250
329 3300050495 nmdc:mga04h51_126760_c1 nmdc:mga04h51_126760_c1_58_879 250
330 3300050512 nmdc:mga0n895_79859_c1 nmdc:mga0n895_79859_c1_65_886 250
331 iso_pu_bacteria 2602042107 2603858982 250
332 iso_pu_bacteria 2857524615 2857527915 250
333 iso_pu_bacteria 2893066018 2893068332 250
334 iso_pu_bacteria 2919073203 2919075315 250
335 iso_pu_bacteria 3005594810 3005598648 250
336 3300002077 JGI24744J21845_10023526 JGI24744J21845_100235261 251
337 3300005339 Ga0070660_100271695 Ga0070660_1002716951 251
338 3300005356 Ga0070674_100140265 Ga0070674_1001402653 251
339 3300005456 Ga0070678_100117886 Ga0070678_1001178862 251
340 3300005530 Ga0070679_100341474 Ga0070679_1003414741 251
341 3300005543 Ga0070672_100074421 Ga0070672_1000744214 251
342 3300005544 Ga0070686_100169798 Ga0070686_1001697982 251
343 3300005615 Ga0070702_100170330 Ga0070702_1001703303 251
344 3300005719 Ga0068861_100020032 Ga0068861_1000200325 251
345 3300005844 Ga0068862_100270948 Ga0068862_1002709482 251
346 3300006237 Ga0097621_100129958 Ga0097621_1001299581 251
347 3300009148 Ga0105243_10153926 Ga0105243_101539262 251
348 3300009176 Ga0105242_10194157 Ga0105242_101941572 251
349 3300013308 Ga0157375_10194691 Ga0157375_101946912 251
350 3300014326 Ga0157380_10329432 Ga0157380_103294322 251
351 3300025932 Ga0207690_10223537 Ga0207690_102235372 251
352 3300025933 Ga0207706_10082263 Ga0207706_100822632 251
353 3300025935 Ga0207709_10034192 Ga0207709_100341923 251
354 3300025937 Ga0207669_10237642 Ga0207669_102376422 251
355 3300025940 Ga0207691_10042900 Ga0207691_100429004 251
356 3300026089 Ga0207648_10109226 Ga0207648_101092262 251
357 3300026118 Ga0207675_100122042 Ga0207675_1001220424 251
358 3300026121 Ga0207683_10149435 Ga0207683_101494352 251
359 3300028381 Ga0268264_10304830 Ga0268264_103048301 251
360 3300035695 Ga0373927_0003031 Ga0373927_0003031_279_1076 251
361 3300037068 Ga0373925_0021350 Ga0373925_0021350_2074_2898 251
362 3300037068 Ga0373925_0069874 Ga0373925_0069874_1202_1999 251
363 3300046473 Ga0495582_0077042 Ga0495582_0077042_130_927 251
364 3300046475 Ga0495639_0035109 Ga0495639_0035109_10_807 251
365 3300046683 Ga0495658_0200861 Ga0495658_0200861_349_1146 251
366 3300046684 Ga0495669_0038233 Ga0495669_0038233_1233_2060 251
367 3300047320 Ga0495672_0041646 Ga0495672_0041646_630_1460 251
368 3300048905 Ga0496102_0192286 Ga0496102_0192286_194_1015 251
369 3300048912 Ga0496109_0452267 Ga0496109_0452267_339_1160 251
370 3300048913 Ga0496110_0238317 Ga0496110_0238317_469_1290 251
371 3300048915 Ga0496112_0104926 Ga0496112_0104926_505_1326 251
372 3300049568 Ga0501031_0134983 Ga0501031_0134983_633_1442 251
373 3300049573 Ga0501037_0147553 Ga0501037_0147553_296_1117 251
374 3300049574 Ga0501038_0108288 Ga0501038_0108288_718_1527 251
375 3300049580 Ga0501046_0061399 Ga0501046_0061399_657_1466 251
376 3300049581 Ga0501047_0085578 Ga0501047_0085578_588_1397 251
377 3300049586 Ga0501070_0043035 Ga0501070_0043035_2419_3228 251
378 3300049591 Ga0501075_0294180 Ga0501075_0294180_250_1071 251
379 3300049742 Ga0501080_0079884 Ga0501080_0079884_1403_2212 251
380 3300049823 Ga0501044_0010554 Ga0501044_0010554_2499_3308 251
381 iso_pu_bacteria 2507262055 2507509193 251
382 iso_pu_bacteria 2508501009 2508543258 251
383 iso_pu_bacteria 2508501042 2508690998 251
384 iso_pu_bacteria 2508501128 2509147449 251
385 iso_pu_bacteria 2511231028 2511396238 251
386 iso_pu_bacteria 2513237092 2513627889 251
387 iso_pu_bacteria 2513237094 2513637748 251
388 iso_pu_bacteria 2513237095 2513646831 251
389 iso_pu_bacteria 2513237096 2513654535 251
390 iso_pu_bacteria 2513237098 2513675526 251
391 iso_pu_bacteria 2513237101 2513691987 251
392 iso_pu_bacteria 2513237102 2513702842 251
393 iso_pu_bacteria 2513237104 2513723124 251
394 iso_pu_bacteria 2513237137 2513860907 251
395 iso_pu_bacteria 2513237139 2513874489 251
396 iso_pu_bacteria 2513237141 2513892839 251
397 iso_pu_bacteria 2513237145 2513915286 251
398 iso_pu_bacteria 2513237161 2514013974 251
399 iso_pu_bacteria 2515154112 2515626601 251
400 iso_pu_bacteria 2517093001 2517101830 251
401 iso_pu_bacteria 2517572143 2517892585 251
402 iso_pu_bacteria 2524023205 2524436753 251
403 iso_pu_bacteria 2524023210 2524465135 251
404 iso_pu_bacteria 2524023228 2524539073 251
405 iso_pu_bacteria 2528768022 2528855761 251
406 iso_pu_bacteria 2617270735 2617351287 251
407 iso_pu_bacteria 2617270741 2617376299 251
408 iso_pu_bacteria 2643221651 2644288443 251
409 iso_pu_bacteria 2667528175 2671122314 251
410 iso_pu_bacteria 2721755755 2723845620 251
411 iso_pu_bacteria 2744054633 2745079176 251
412 iso_pu_bacteria 2791355196 2793063888 251
413 iso_pu_bacteria 2791355197 2793068590 251
414 iso_pu_bacteria 2791355199 2793083779 251
415 iso_pu_bacteria 2802429603 2805918148 251
416 iso_pu_bacteria 2816332527 2818242671 251
417 iso_pu_bacteria 2824600985 2824606744 251
418 iso_pu_bacteria 2824609381 2824616642 251
419 iso_pu_bacteria 2824617872 2824621839 251
420 iso_pu_bacteria 2824626560 2824632542 251
421 iso_pu_bacteria 2824635225 2824639504 251
422 iso_pu_bacteria 2824644064 2824651526 251
423 iso_pu_bacteria 2824653114 2824660981 251
424 iso_pu_bacteria 2824661429 2824670843 251
425 iso_pu_bacteria 2824671348 2824677640 251
426 iso_pu_bacteria 2824679649 2824683265 251
427 iso_pu_bacteria 2824687955 2824695360 251
428 iso_pu_bacteria 2824696289 2824702248 251
429 iso_pu_bacteria 2824704595 2824708770 251
430 iso_pu_bacteria 2824714736 2824721573 251
431 iso_pu_bacteria 2824723954 2824729240 251
432 iso_pu_bacteria 2824732956 2824739719 251
433 iso_pu_bacteria 2824746037 2824753512 251
434 iso_pu_bacteria 2824753945 2824761261 251
435 iso_pu_bacteria 2824763712 2824773187 251
436 iso_pu_bacteria 2824773399 2824779181 251
437 iso_pu_bacteria 2838122688 2838126353 251
438 iso_pu_bacteria 2841941048 2841943569 251
439 iso_pu_bacteria 2841949485 2841950481 251
440 iso_pu_bacteria 2841957949 2841958157 251
441 iso_pu_bacteria 2841966195 2841966795 251
442 iso_pu_bacteria 2841974524 2841975550 251
443 iso_pu_bacteria 2841983080 2841988310 251
444 iso_pu_bacteria 2842038055 2842039601 251
445 iso_pu_bacteria 2842045827 2842047453 251
446 iso_pu_bacteria 2844315083 2844318537 251
447 iso_pu_bacteria 2847930680 2847935471 251
448 iso_pu_bacteria 2847939898 2847946031 251
449 iso_pu_bacteria 2849076700 2849079853 251
450 iso_pu_bacteria 2857509624 2857513746 251
451 iso_pu_bacteria 2874590934 2874597307 251
452 iso_pu_bacteria 2874604998 2874609768 251
453 iso_pu_bacteria 2874612657 2874616344 251
454 iso_pu_bacteria 2874620515 2874626796 251
455 iso_pu_bacteria 2874628541 2874631208 251
456 iso_pu_bacteria 2874645413 2874649360 251
457 iso_pu_bacteria 2876761206 2876770419 251
458 iso_pu_bacteria 2876771140 2876777896 251
459 iso_pu_bacteria 2876808645 2876809344 251
460 iso_pu_bacteria 2876818435 2876823083 251
461 iso_pu_bacteria 2879074833 2879078653 251
462 iso_pu_bacteria 2879083081 2879088501 251
463 iso_pu_bacteria 2879099564 2879108134 251
464 iso_pu_bacteria 2879110137 2879118364 251
465 iso_pu_bacteria 2879127579 2879132870 251
466 iso_pu_bacteria 2879142872 2879148669 251
467 iso_pu_bacteria 2881364244 2881366843 251
468 iso_pu_bacteria 2881665667 2881672157 251
469 iso_pu_bacteria 2885366525 2885371964 251
470 iso_pu_bacteria 2885374607 2885379306 251
471 iso_pu_bacteria 2885383462 2885386308 251
472 iso_pu_bacteria 2885409591 2885415254 251
473 iso_pu_bacteria 2888378607 2888383499 251
474 iso_pu_bacteria 2888388044 2888394448 251
475 iso_pu_bacteria 2888419890 2888423924 251
476 iso_pu_bacteria 2903727486 2903730097 251
477 iso_pu_bacteria 2903748898 2903753541 251
478 iso_pu_bacteria 2903768456 2903771930 251
479 iso_pu_bacteria 2904666416 2904668374 251
480 iso_pu_bacteria 2904690495 2904695939 251
481 iso_pu_bacteria 2904699407 2904702691 251
482 iso_pu_bacteria 2904711408 2904717332 251
483 iso_pu_bacteria 2906602504 2906603482 251
484 iso_pu_bacteria 2906610324 2906618420 251
485 iso_pu_bacteria 2906626472 2906632232 251
486 iso_pu_bacteria 2906635258 2906638719 251
487 iso_pu_bacteria 2906643746 2906650830 251
488 iso_pu_bacteria 2906660503 2906664121 251
489 iso_pu_bacteria 2908739725 2908742908 251
490 iso_pu_bacteria 2908756301 2908760568 251
491 iso_pu_bacteria 2908775508 2908779579 251
492 iso_pu_bacteria 2922361189 2922368296 251
493 iso_pu_bacteria 2922368715 2922373695 251
494 iso_pu_bacteria 2922386360 2922388240 251
495 iso_pu_bacteria 2922393267 2922395804 251
496 iso_pu_bacteria 2922425934 2922429680 251
497 iso_pu_bacteria 2929615660 2929617423 251
498 iso_pu_bacteria 2929624759 2929627128 251
499 iso_pu_bacteria 2932784394 2932787542 251
500 iso_pu_bacteria 2932794094 2932800721 251
501 iso_pu_bacteria 2932801729 2932803340 251
502 iso_pu_bacteria 2932809354 2932813277 251
503 iso_pu_bacteria 2932818245 2932820802 251
504 iso_pu_bacteria 2932828146 2932834825 251
505 iso_pu_bacteria 2933577622 2933579379 251
506 iso_pu_bacteria 2935608549 2935611924 251
507 iso_pu_bacteria 2935616580 2935621790 251
508 iso_pu_bacteria 2935630451 2935631849 251
509 iso_pu_bacteria 2935638405 2935642734 251
510 iso_pu_bacteria 2935648319 2935649549 251
511 iso_pu_bacteria 2935656913 2935658936 251
512 iso_pu_bacteria 2935665750 2935667836 251
513 iso_pu_bacteria 2935675223 2935682328 251
514 iso_pu_bacteria 2935684952 2935688587 251
515 iso_pu_bacteria 2935694250 2935695938 251
516 iso_pu_bacteria 2935703347 2935706677 251
517 iso_pu_bacteria 2935713505 2935715606 251
518 iso_pu_bacteria 2935722832 2935725830 251
519 iso_pu_bacteria 2935732158 2935734425 251
520 iso_pu_bacteria 2935741537 2935743804 251
521 iso_pu_bacteria 2935750917 2935754159 251
522 iso_pu_bacteria 2935760218 2935763198 251
523 iso_pu_bacteria 2935769743 2935772603 251
524 iso_pu_bacteria 2935777560 2935783155 251
525 iso_pu_bacteria 2935785616 2935790896 251
526 iso_pu_bacteria 2935793552 2935799403 251
527 iso_pu_bacteria 2935801545 2935806348 251
528 iso_pu_bacteria 2935810662 2935812949 251
529 iso_pu_bacteria 2935819856 2935821404 251
530 iso_pu_bacteria 2935827899 2935830601 251
531 iso_pu_bacteria 2935837841 2935840630 251
532 iso_pu_bacteria 2935847175 2935850337 251
533 iso_pu_bacteria 2935855204 2935860037 251
534 iso_pu_bacteria 2935864058 2935869328 251
535 iso_pu_bacteria 2935873716 2935880511 251
536 iso_pu_bacteria 2935883170 2935886412 251
537 iso_pu_bacteria 2935908558 2935914382 251
538 iso_pu_bacteria 2935916978 2935921096 251
539 iso_pu_bacteria 2935926038 2935932038 251
540 iso_pu_bacteria 2935934488 2935940635 251
541 iso_pu_bacteria 2935942939 2935948578 251
542 iso_pu_bacteria 2935951376 2935956951 251
543 iso_pu_bacteria 2935959822 2935960281 251
544 iso_pu_bacteria 2935967501 2935973549 251
545 iso_pu_bacteria 2935975950 2935977530 251
546 iso_pu_bacteria 2935984226 2935989998 251
547 iso_pu_bacteria 2935992306 2935999559 251
548 iso_pu_bacteria 2936002035 2936006456 251
549 iso_pu_bacteria 2936011229 2936012969 251
550 iso_pu_bacteria 2936019824 2936021533 251
551 iso_pu_bacteria 2936028420 2936030262 251
552 iso_pu_bacteria 2936037263 2936041537 251
553 iso_pu_bacteria 2936046547 2936047727 251
554 iso_pu_bacteria 2936055302 2936057115 251
555 iso_pu_bacteria 2940556831 2940560465 251
556 iso_pu_bacteria 2941507105 2941513036 251
557 iso_pu_bacteria 2941515067 2941521060 251
558 iso_pu_bacteria 2941523033 2941526076 251
559 iso_pu_bacteria 2941531003 2941534287 251
560 iso_pu_bacteria 2941538514 2941541240 251
561 iso_pu_bacteria 3005474847 3005480016 251
562 iso_pu_bacteria 3005483717 3005489615 251
563 iso_pu_bacteria 3005506211 3005509830 251
564 iso_pu_bacteria 3005587118 3005590057 251
565 iso_pu_bacteria 3005710791 3005714305 251
566 iso_pu_bacteria 3005718088 3005721812 251
567 iso_pu_bacteria 8006926726 8006928993 251
568 iso_pu_bacteria 8006933436 8006941212 251
569 iso_pu_bacteria 8006964411 8006967248 251
570 iso_pu_bacteria 8006973647 8006980582 251
571 iso_pu_bacteria 8006984368 8006992067 251
572 iso_pu_bacteria 8006994254 8006997484 251
573 iso_pu_bacteria 8016522445 8016530202 251
574 iso_pu_bacteria 8016530956 8016535457 251
575 iso_pu_bacteria 8016539877 8016548655 251
576 iso_pu_bacteria 8016548790 8016553476 251
577 iso_pu_bacteria 8016557553 8016561858 251
578 iso_pu_bacteria 8016575299 8016577914 251
579 iso_pu_bacteria 8016583857 8016592560 251
580 iso_pu_bacteria 8016595262 8016599686 251
581 iso_pu_bacteria 8016603502 8016611162 251
582 iso_pu_bacteria 8016613128 8016622474 251
583 iso_pu_bacteria 8016622563 8016627311 251
584 iso_pu_bacteria 8016630954 8016631598 251
585 iso_pu_bacteria 8017057580 8017062418 251
586 iso_pu_bacteria 8019530166 8019535194 251
587 iso_pu_bacteria 8019538911 8019544287 251
588 iso_pu_bacteria 8019547302 8019554412 251
589 iso_pu_bacteria 8019565922 8019568309 251
590 iso_pu_bacteria 8019576017 8019581879 251
591 iso_pu_bacteria 8019586578 8019589560 251
592 iso_pu_bacteria 8019608314 8019616843 251
593 iso_pu_bacteria 8019619141 8019627510 251
594 iso_pu_bacteria 8019629233 8019635060 251
595 iso_pu_bacteria 8019638758 8019644669 251
596 iso_pu_bacteria 8019648815 8019657697 251
597 iso_pu_bacteria 8019659431 8019662902 251
598 iso_pu_bacteria 8019668869 8019672501 251
599 iso_pu_bacteria 8019678201 8019683656 251
600 iso_pu_bacteria 8019687851 8019689409 251
601 iso_pu_bacteria 8055742211 8055746962 251
602 iso_pu_bacteria 8056673599 8056674362 251
603 iso_pu_bacteria 8056681323 8056683275 251
604 iso_pu_bacteria 8056689827 8056690040 251
605 iso_pu_bacteria 8056967851 8056972899 251
606 3300005983 Ga0081540_1006816 Ga0081540_10068168 252
607 3300006186 Ga0075369_10160712 Ga0075369_101607122 252
608 3300009551 Ga0105238_10067496 Ga0105238_100674962 252
609 3300035691 Ga0373931_0082737 Ga0373931_0082737_331_1155 252
610 3300049570 Ga0501033_0095101 Ga0501033_0095101_1257_2084 252
611 3300049574 Ga0501038_0038331 Ga0501038_0038331_2732_3559 252
612 3300049579 Ga0501043_0094198 Ga0501043_0094198_1434_2261 252
613 3300049586 Ga0501070_0001743 Ga0501070_0001743_10312_11154 252
614 3300049742 Ga0501080_0120298 Ga0501080_0120298_713_1555 252
615 3300049823 Ga0501044_0124616 Ga0501044_0124616_1257_2084 252
616 3300005983 Ga0081540_1078604 Ga0081540_10786042 253
617 3300006844 Ga0075428_100005210 Ga0075428_1000052104 253
618 3300006846 Ga0075430_100001350 Ga0075430_1000013509 253
619 3300006846 Ga0075430_100002163 Ga0075430_10000216310 253
620 3300006847 Ga0075431_100000033 Ga0075431_10000003372 253
621 3300006847 Ga0075431_100001300 Ga0075431_10000130010 253
622 3300006852 Ga0075433_10000773 Ga0075433_100007732 253
623 3300006871 Ga0075434_100051349 Ga0075434_1000513495 253
624 3300006880 Ga0075429_100002588 Ga0075429_10000258814 253
625 3300009094 Ga0111539_10000591 Ga0111539_1000059125 253
626 3300009094 Ga0111539_10003260 Ga0111539_1000326016 253
627 3300009147 Ga0114129_10001565 Ga0114129_100015654 253
628 3300009147 Ga0114129_10002229 Ga0114129_1000222915 253
629 3300027907 Ga0207428_10003754 Ga0207428_1000375412 253
630 3300031595 Ga0265313_10040606 Ga0265313_100406064 253
631 3300049571 Ga0501034_0097324 Ga0501034_0097324_2049_2879 253
632 3300049585 Ga0501069_0013334 Ga0501069_0013334_1192_2022 253
633 3300049588 Ga0501072_0051161 Ga0501072_0051161_397_1227 253
634 3300050507 nmdc:mga05p37_14_c1 nmdc:mga05p37_14_c1_78422_79234 253
635 3300050509 nmdc:mga0qj67_6499_c1 nmdc:mga0qj67_6499_c1_6521_7333 253
636 3300050510 nmdc:mga06r32_1042_c1 nmdc:mga06r32_1042_c1_9990_10802 253
637 3300050511 nmdc:mga08y16_412_c1 nmdc:mga08y16_412_c1_23846_24658 253
638 3300005327 Ga0070658_10019528 Ga0070658_100195285 254
639 3300005327 Ga0070658_10210981 Ga0070658_102109812 254
640 3300005339 Ga0070660_100140184 Ga0070660_1001401842 254
641 3300005530 Ga0070679_100121585 Ga0070679_1001215851 254
642 3300005563 Ga0068855_100134934 Ga0068855_1001349344 254
643 3300006038 Ga0075365_10145156 Ga0075365_101451562 254
644 3300009093 Ga0105240_10014215 Ga0105240_100142159 254
645 3300013102 Ga0157371_10228999 Ga0157371_102289992 254
646 3300013104 Ga0157370_10085004 Ga0157370_100850042 254
647 3300025295 Ga0209564_1003207 Ga0209564_100320712 254
648 3300025295 Ga0209564_1007189 Ga0209564_10071892 254
649 3300025297 Ga0209758_1000188 Ga0209758_100018873 254
650 3300025912 Ga0207707_10129150 Ga0207707_101291503 254
651 3300025917 Ga0207660_10350955 Ga0207660_103509552 254
652 3300025919 Ga0207657_10054457 Ga0207657_100544572 254
653 3300025921 Ga0207652_10277686 Ga0207652_102776863 254
654 3300026067 Ga0207678_10131139 Ga0207678_101311393 254
655 3300026142 Ga0207698_10151368 Ga0207698_101513682 254
656 3300027682 Ga0209971_1038246 Ga0209971_10382462 254
657 3300027695 Ga0209966_1002708 Ga0209966_10027082 254
658 3300027907 Ga0207428_10000249 Ga0207428_1000024935 254
659 3300028794 Ga0307515_10072230 Ga0307515_100722304 254
660 3300031247 Ga0265340_10107260 Ga0265340_101072602 254
661 3300031595 Ga0265313_10018201 Ga0265313_100182014 254
662 3300031691 Ga0316579_10001412 Ga0316579_1000141210 254
663 3300031712 Ga0265342_10000760 Ga0265342_100007605 254
664 3300035115 Ga0373941_0002366 Ga0373941_0002366_1632_2405 254
665 3300038443 Ga0395901_0197059 Ga0395901_0197059_51_872 254
666 3300039437 Ga0436365_1447566 Ga0436365_1447566_65_877 254
667 3300042001 Ga0439441_018730 Ga0439441_018730_310_1128 254
668 3300046512 Ga0495610_0032405 Ga0495610_0032405_842_1657 254
669 3300046513 Ga0495616_0032785 Ga0495616_0032785_1257_2072 254
670 3300046530 Ga0495654_0007610 Ga0495654_0007610_4417_5232 254
671 3300046665 Ga0495661_0009175 Ga0495661_0009175_4272_5087 254
672 3300046810 Ga0495660_0085746 Ga0495660_0085746_711_1526 254
673 3300047472 Ga0495686_0065800 Ga0495686_0065800_353_1168 254
674 3300048919 Ga0496116_0019506 Ga0496116_0019506_2233_3045 254
675 3300048920 Ga0496117_0074133 Ga0496117_0074133_608_1420 254
676 3300048921 Ga0496118_0019231 Ga0496118_0019231_2774_3586 254
677 3300048925 Ga0496122_0047391 Ga0496122_0047391_2060_2875 254
678 3300048926 Ga0496123_0008887 Ga0496123_0008887_3689_4504 254
679 3300048928 Ga0496125_0003330 Ga0496125_0003330_6460_7275 254
680 3300048929 Ga0496126_0146656 Ga0496126_0146656_307_1122 254
681 3300049569 Ga0501032_0018148 Ga0501032_0018148_2104_2934 254
682 3300049571 Ga0501034_0110532 Ga0501034_0110532_653_1483 254
683 3300049573 Ga0501037_0311244 Ga0501037_0311244_93_911 254
684 3300049575 Ga0501039_0056584 Ga0501039_0056584_823_1653 254
685 3300049580 Ga0501046_0014686 Ga0501046_0014686_4887_5717 254
686 3300049582 Ga0501048_0050197 Ga0501048_0050197_741_1571 254
687 3300049586 Ga0501070_0059296 Ga0501070_0059296_1090_1908 254
688 3300049586 Ga0501070_0114425 Ga0501070_0114425_94_924 254
689 3300049589 Ga0501073_0264887 Ga0501073_0264887_202_1020 254
690 3300049822 Ga0501035_0104058 Ga0501035_0104058_1434_2264 254
691 3300049823 Ga0501044_0216259 Ga0501044_0216259_405_1235 254
692 3300049823 Ga0501044_0281587 Ga0501044_0281587_274_1098 254
693 3300050492 nmdc:mga0yw44_131765_c1 nmdc:mga0yw44_131765_c1_325_1137 254
694 3300050492 nmdc:mga0yw44_329581_c1 nmdc:mga0yw44_329581_c1_165_980 254
695 3300050507 nmdc:mga05p37_1602_c1 nmdc:mga05p37_1602_c1_16142_16960 254
696 3300050508 nmdc:mga09592_266882_c1 nmdc:mga09592_266882_c1_502_1320 254
697 3300050509 nmdc:mga0qj67_556_c1 nmdc:mga0qj67_556_c1_8899_9717 254
698 3300050510 nmdc:mga06r32_4708_c1 nmdc:mga06r32_4708_c1_9295_10113 254
699 3300050511 nmdc:mga08y16_4650_c1 nmdc:mga08y16_4650_c1_3884_4702 254
700 3300050512 nmdc:mga0n895_1478_c1 nmdc:mga0n895_1478_c1_12711_13529 254
701 3300050515 nmdc:mga0a205_416_c1 nmdc:mga0a205_416_c1_11110_11928 254
702 3300053087 Ga0500643_018322 Ga0500643_018322_1461_2276 254
703 3300053090 Ga0500646_0002674 Ga0500646_0002674_3727_4542 254
704 3300053094 Ga0500566_0011997 Ga0500566_0011997_781_1593 254
705 3300053098 Ga0500650_0001293 Ga0500650_0001293_5505_6320 254
706 3300053104 Ga0500556_0000002 Ga0500556_0000002_683089_683904 254
707 3300053109 Ga0500569_022053 Ga0500569_022053_463_1278 254
708 3300053109 Ga0500569_065389 Ga0500569_065389_177_992 254
709 3300053116 Ga0500592_000901 Ga0500592_000901_2567_3382 254
710 3300053122 Ga0500608_005836 Ga0500608_005836_2447_3259 254
711 3300053125 Ga0500618_006905 Ga0500618_006905_2439_3251 254
712 3300053130 Ga0500642_0000010 Ga0500642_0000010_6794_7609 254
713 3300053131 Ga0500652_000817 Ga0500652_000817_5714_6529 254
714 3300053136 Ga0500559_0000638 Ga0500559_0000638_19490_20302 254
715 3300053139 Ga0500568_0000427 Ga0500568_0000427_5800_6615 254
716 3300053142 Ga0500577_0008280 Ga0500577_0008280_1582_2397 254
717 3300053151 Ga0500604_0006917 Ga0500604_0006917_536_1351 254
718 3300053153 Ga0500616_0000069 Ga0500616_0000069_164316_165128 254
719 3300053156 Ga0500622_0013995 Ga0500622_0013995_2352_3167 254
720 3300053158 Ga0500627_0014445 Ga0500627_0014445_205_1020 254
721 3300053161 Ga0500634_0031198 Ga0500634_0031198_1072_1887 254
722 3300053177 Ga0500636_0025635 Ga0500636_0025635_1549_2361 254
723 3300053178 Ga0500637_0053774 Ga0500637_0053774_538_1350 254
724 3300001430 JGI24032J14994_100064 JGI24032J14994_1000642 255
725 3300001915 JGI24741J21665_1009996 JGI24741J21665_10099962 255
726 3300001977 JGI24746J21847_1007449 JGI24746J21847_10074492 255
727 3300001989 JGI24739J22299_10017346 JGI24739J22299_100173462 255
728 3300001990 JGI24737J22298_10000724 JGI24737J22298_100007249 255
729 3300002070 JGI24750J21931_1000149 JGI24750J21931_10001497 255
730 3300002073 JGI24745J21846_1000167 JGI24745J21846_10001673 255
731 3300002074 JGI24748J21848_1003041 JGI24748J21848_10030412 255
732 3300002075 JGI24738J21930_10004692 JGI24738J21930_100046922 255
733 3300002077 JGI24744J21845_10010750 JGI24744J21845_100107503 255
734 3300002126 JGI24035J26624_1000153 JGI24035J26624_10001535 255
735 3300002239 JGI24034J26672_10002381 JGI24034J26672_100023814 255
736 3300002244 JGI24742J22300_10000767 JGI24742J22300_100007676 255
737 3300002459 JGI24751J29686_10025073 JGI24751J29686_100250732 255
738 3300003215 JGI25153J46596_10004855 JGI25153J46596_100048556 255
739 3300003215 JGI25153J46596_10018477 JGI25153J46596_100184772 255
740 3300003354 JGI25160J50197_1003444 JGI25160J50197_10034447 255
741 3300003794 Ga0055531_10007266 Ga0055531_100072666 255
742 3300003911 JGI25405J52794_10027767 JGI25405J52794_100277671 255
743 3300003911 JGI25405J52794_10041454 JGI25405J52794_100414541 255
744 3300004625 Ga0055543_1015857 Ga0055543_10158572 255
745 3300005262 Ga0065165_1005968 Ga0065165_10059689 255
746 3300005290 Ga0065712_10072881 Ga0065712_100728815 255
747 3300005293 Ga0065715_10091411 Ga0065715_100914114 255
748 3300005327 Ga0070658_10084492 Ga0070658_100844922 255
749 3300005328 Ga0070676_10000364 Ga0070676_100003645 255
750 3300005329 Ga0070683_100000806 Ga0070683_1000008065 255
751 3300005330 Ga0070690_100013151 Ga0070690_1000131516 255
752 3300005331 Ga0070670_100014265 Ga0070670_1000142655 255
753 3300005333 Ga0070677_10000212 Ga0070677_1000021217 255
754 3300005334 Ga0068869_100000618 Ga0068869_1000006189 255
755 3300005335 Ga0070666_10072031 Ga0070666_100720312 255
756 3300005336 Ga0070680_100069566 Ga0070680_1000695663 255
757 3300005336 Ga0070680_100129120 Ga0070680_1001291202 255
758 3300005337 Ga0070682_100001379 Ga0070682_1000013792 255
759 3300005338 Ga0068868_100168272 Ga0068868_1001682723 255
760 3300005339 Ga0070660_100001616 Ga0070660_1000016164 255
761 3300005340 Ga0070689_100000146 Ga0070689_1000001463 255
762 3300005340 Ga0070689_100012435 Ga0070689_1000124354 255
763 3300005341 Ga0070691_10010893 Ga0070691_100108933 255
764 3300005343 Ga0070687_100000023 Ga0070687_10000002351 255
765 3300005343 Ga0070687_100149412 Ga0070687_1001494121 255
766 3300005344 Ga0070661_100000407 Ga0070661_1000004076 255
767 3300005345 Ga0070692_10000270 Ga0070692_1000027016 255
768 3300005347 Ga0070668_100085972 Ga0070668_1000859723 255
769 3300005347 Ga0070668_100151569 Ga0070668_1001515692 255
770 3300005353 Ga0070669_100028955 Ga0070669_1000289553 255
771 3300005354 Ga0070675_100000306 Ga0070675_10000030635 255
772 3300005355 Ga0070671_100001042 Ga0070671_1000010424 255
773 3300005355 Ga0070671_100074469 Ga0070671_1000744692 255
774 3300005355 Ga0070671_100387605 Ga0070671_1003876051 255
775 3300005356 Ga0070674_100005171 Ga0070674_1000051712 255
776 3300005356 Ga0070674_100053206 Ga0070674_1000532063 255
777 3300005356 Ga0070674_100467101 Ga0070674_1004671011 255
778 3300005364 Ga0070673_100001407 Ga0070673_1000014076 255
779 3300005364 Ga0070673_100241878 Ga0070673_1002418781 255
780 3300005365 Ga0070688_100006871 Ga0070688_1000068716 255
781 3300005365 Ga0070688_100109653 Ga0070688_1001096532 255
782 3300005366 Ga0070659_100001563 Ga0070659_10000156319 255
783 3300005366 Ga0070659_100109074 Ga0070659_1001090742 255
784 3300005366 Ga0070659_100266364 Ga0070659_1002663642 255
785 3300005367 Ga0070667_100000745 Ga0070667_1000007454 255
786 3300005406 Ga0070703_10002920 Ga0070703_100029205 255
787 3300005434 Ga0070709_10022949 Ga0070709_100229493 255
788 3300005434 Ga0070709_10063355 Ga0070709_100633554 255
789 3300005435 Ga0070714_100050053 Ga0070714_1000500534 255
790 3300005435 Ga0070714_100072956 Ga0070714_1000729563 255
791 3300005436 Ga0070713_100081034 Ga0070713_1000810342 255
792 3300005437 Ga0070710_10036764 Ga0070710_100367643 255
793 3300005438 Ga0070701_10000746 Ga0070701_1000074611 255
794 3300005439 Ga0070711_100091516 Ga0070711_1000915162 255
795 3300005439 Ga0070711_100132456 Ga0070711_1001324562 255
796 3300005440 Ga0070705_100080798 Ga0070705_1000807982 255
797 3300005441 Ga0070700_100003377 Ga0070700_1000033774 255
798 3300005444 Ga0070694_100003105 Ga0070694_1000031054 255
799 3300005445 Ga0070708_100229275 Ga0070708_1002292752 255
800 3300005455 Ga0070663_100016281 Ga0070663_1000162814 255
801 3300005456 Ga0070678_100042226 Ga0070678_1000422262 255
802 3300005456 Ga0070678_100137581 Ga0070678_1001375813 255
803 3300005456 Ga0070678_100733257 Ga0070678_1007332571 255
804 3300005457 Ga0070662_100114670 Ga0070662_1001146702 255
805 3300005458 Ga0070681_10004011 Ga0070681_1000401115 255
806 3300005458 Ga0070681_10106630 Ga0070681_101066302 255
807 3300005459 Ga0068867_100014124 Ga0068867_1000141242 255
808 3300005466 Ga0070685_10115279 Ga0070685_101152791 255
809 3300005518 Ga0070699_100550967 Ga0070699_1005509671 255
810 3300005530 Ga0070679_100003609 Ga0070679_1000036094 255
811 3300005530 Ga0070679_100005467 Ga0070679_1000054674 255
812 3300005535 Ga0070684_100000454 Ga0070684_10000045433 255
813 3300005535 Ga0070684_100187988 Ga0070684_1001879881 255
814 3300005539 Ga0068853_100059818 Ga0068853_1000598183 255
815 3300005543 Ga0070672_100000045 Ga0070672_10000004518 255
816 3300005544 Ga0070686_100000480 Ga0070686_10000048015 255
817 3300005545 Ga0070695_100019377 Ga0070695_1000193773 255
818 3300005546 Ga0070696_100039744 Ga0070696_1000397442 255
819 3300005547 Ga0070693_100000286 Ga0070693_1000002866 255
820 3300005548 Ga0070665_100049034 Ga0070665_1000490342 255
821 3300005548 Ga0070665_100237145 Ga0070665_1002371452 255
822 3300005549 Ga0070704_100006095 Ga0070704_1000060954 255
823 3300005563 Ga0068855_100006104 Ga0068855_10000610414 255
824 3300005564 Ga0070664_100000899 Ga0070664_10000089916 255
825 3300005577 Ga0068857_100000623 Ga0068857_10000062332 255
826 3300005577 Ga0068857_100450183 Ga0068857_1004501832 255
827 3300005577 Ga0068857_100493915 Ga0068857_1004939152 255
828 3300005578 Ga0068854_100005892 Ga0068854_1000058928 255
829 3300005614 Ga0068856_100012141 Ga0068856_1000121418 255
830 3300005614 Ga0068856_100059599 Ga0068856_1000595993 255
831 3300005615 Ga0070702_100003379 Ga0070702_1000033796 255
832 3300005616 Ga0068852_100005047 Ga0068852_1000050475 255
833 3300005617 Ga0068859_100020794 Ga0068859_1000207947 255
834 3300005618 Ga0068864_100008403 Ga0068864_1000084038 255
835 3300005618 Ga0068864_100297727 Ga0068864_1002977272 255
836 3300005718 Ga0068866_10000346 Ga0068866_1000034626 255
837 3300005719 Ga0068861_100000045 Ga0068861_10000004546 255
838 3300005840 Ga0068870_10000213 Ga0068870_1000021310 255
839 3300005841 Ga0068863_100001919 Ga0068863_1000019199 255
840 3300005841 Ga0068863_100173882 Ga0068863_1001738821 255
841 3300005842 Ga0068858_100000307 Ga0068858_10000030759 255
842 3300005842 Ga0068858_100225095 Ga0068858_1002250952 255
843 3300005842 Ga0068858_100684166 Ga0068858_1006841662 255
844 3300005843 Ga0068860_100001587 Ga0068860_10000158730 255
845 3300005844 Ga0068862_100011664 Ga0068862_1000116643 255
846 3300005844 Ga0068862_100565425 Ga0068862_1005654252 255
847 3300005937 Ga0081455_10002522 Ga0081455_100025229 255
848 3300005937 Ga0081455_10018661 Ga0081455_100186617 255
849 3300005937 Ga0081455_10020448 Ga0081455_100204487 255
850 3300006028 Ga0070717_10106892 Ga0070717_101068924 255
851 3300006038 Ga0075365_10126856 Ga0075365_101268562 255
852 3300006038 Ga0075365_10172650 Ga0075365_101726502 255
853 3300006042 Ga0075368_10068375 Ga0075368_100683752 255
854 3300006051 Ga0075364_10114295 Ga0075364_101142952 255
855 3300006163 Ga0070715_10045681 Ga0070715_100456812 255
856 3300006175 Ga0070712_100024400 Ga0070712_1000244004 255
857 3300006175 Ga0070712_100100891 Ga0070712_1001008911 255
858 3300006178 Ga0075367_10262485 Ga0075367_102624852 255
859 3300006186 Ga0075369_10107306 Ga0075369_101073062 255
860 3300006195 Ga0075366_10193124 Ga0075366_101931241 255
861 3300006237 Ga0097621_100000587 Ga0097621_10000058718 255
862 3300006353 Ga0075370_10101365 Ga0075370_101013652 255
863 3300006358 Ga0068871_100002886 Ga0068871_1000028869 255
864 3300006852 Ga0075433_10005102 Ga0075433_100051026 255
865 3300006871 Ga0075434_100001539 Ga0075434_10000153925 255
866 3300006871 Ga0075434_100045067 Ga0075434_1000450673 255
867 3300006881 Ga0068865_100007664 Ga0068865_1000076644 255
868 3300006881 Ga0068865_100324896 Ga0068865_1003248962 255
869 3300006931 Ga0097620_100020792 Ga0097620_1000207923 255
870 3300006941 Ga0099825_1035142 Ga0099825_10351422 255
871 3300006942 Ga0099824_1020964 Ga0099824_10209643 255
872 3300006944 Ga0099823_1016923 Ga0099823_10169237 255
873 3300007076 Ga0075435_100126575 Ga0075435_1001265752 255
874 3300009092 Ga0105250_10066785 Ga0105250_100667852 255
875 3300009093 Ga0105240_10058395 Ga0105240_100583952 255
876 3300009093 Ga0105240_10524839 Ga0105240_105248391 255
877 3300009094 Ga0111539_10018995 Ga0111539_100189958 255
878 3300009094 Ga0111539_10106104 Ga0111539_101061044 255
879 3300009094 Ga0111539_11020670 Ga0111539_110206701 255
880 3300009098 Ga0105245_10001033 Ga0105245_1000103329 255
881 3300009101 Ga0105247_10020518 Ga0105247_100205183 255
882 3300009148 Ga0105243_10000678 Ga0105243_1000067833 255
883 3300009174 Ga0105241_10008618 Ga0105241_100086187 255
884 3300009174 Ga0105241_10043729 Ga0105241_100437292 255
885 3300009176 Ga0105242_10002866 Ga0105242_100028664 255
886 3300009176 Ga0105242_10353968 Ga0105242_103539682 255
887 3300009177 Ga0105248_10042833 Ga0105248_100428335 255
888 3300009545 Ga0105237_10078806 Ga0105237_100788063 255
889 3300009551 Ga0105238_10055605 Ga0105238_100556054 255
890 3300009553 Ga0105249_10000540 Ga0105249_100005404 255
891 3300010375 Ga0105239_10013892 Ga0105239_100138929 255
892 3300010375 Ga0105239_10024564 Ga0105239_100245643 255
893 3300011119 Ga0105246_10010105 Ga0105246_100101054 255
894 3300013102 Ga0157371_10096347 Ga0157371_100963474 255
895 3300013104 Ga0157370_10319063 Ga0157370_103190632 255
896 3300013296 Ga0157374_10460154 Ga0157374_104601542 255
897 3300013296 Ga0157374_10758182 Ga0157374_107581821 255
898 3300013297 Ga0157378_10002535 Ga0157378_1000253511 255
899 3300013306 Ga0163162_10033221 Ga0163162_100332214 255
900 3300013307 Ga0157372_10015130 Ga0157372_100151306 255
901 3300013307 Ga0157372_10257960 Ga0157372_102579602 255
902 3300013307 Ga0157372_10527575 Ga0157372_105275752 255
903 3300013308 Ga0157375_10013069 Ga0157375_100130694 255
904 3300014325 Ga0163163_10009083 Ga0163163_100090839 255
905 3300014325 Ga0163163_10359971 Ga0163163_103599712 255
906 3300014326 Ga0157380_10003874 Ga0157380_1000387410 255
907 3300014745 Ga0157377_10000653 Ga0157377_100006538 255
908 3300014968 Ga0157379_10000135 Ga0157379_1000013558 255
909 3300014969 Ga0157376_10001353 Ga0157376_1000135313 255
910 3300017792 Ga0163161_10007225 Ga0163161_100072258 255
911 3300021320 Ga0214544_1000051 Ga0214544_100005161 255
912 3300021321 Ga0214542_1000149 Ga0214542_100014945 255
913 3300021324 Ga0214545_1000126 Ga0214545_100012615 255
914 3300021327 Ga0214543_1000148 Ga0214543_100014850 255
915 3300021388 Ga0213875_10000023 Ga0213875_10000023195 255
916 3300021388 Ga0213875_10053745 Ga0213875_100537453 255
917 3300025245 Ga0207425_1009482 Ga0207425_10094824 255
918 3300025253 Ga0209677_101621 Ga0209677_1016219 255
919 3300025254 Ga0209148_1000258 Ga0209148_100025864 255
920 3300025261 Ga0209233_1030272 Ga0209233_10302722 255
921 3300025271 Ga0207666_1000021 Ga0207666_100002120 255
922 3300025272 Ga0209455_1001530 Ga0209455_10015308 255
923 3300025290 Ga0207673_1000062 Ga0207673_10000622 255
924 3300025297 Ga0209758_1000021 Ga0209758_1000021183 255
925 3300025297 Ga0209758_1000521 Ga0209758_10005218 255
926 3300025297 Ga0209758_1003026 Ga0209758_100302615 255
927 3300025297 Ga0209758_1039249 Ga0209758_10392492 255
928 3300025297 Ga0209758_1047475 Ga0209758_10474752 255
929 3300025299 Ga0209256_1004268 Ga0209256_10042686 255
930 3300025302 Ga0207426_1002095 Ga0207426_10020958 255
931 3300025302 Ga0207426_1007289 Ga0207426_10072892 255
932 3300025304 Ga0209257_1002487 Ga0209257_10024873 255
933 3300025304 Ga0209257_1021911 Ga0209257_10219112 255
934 3300025315 Ga0207697_10001014 Ga0207697_1000101418 255
935 3300025885 Ga0207653_10001128 Ga0207653_100011284 255
936 3300025893 Ga0207682_10000796 Ga0207682_100007963 255
937 3300025899 Ga0207642_10000764 Ga0207642_100007647 255
938 3300025900 Ga0207710_10019312 Ga0207710_100193122 255
939 3300025901 Ga0207688_10000017 Ga0207688_100000174 255
940 3300025901 Ga0207688_10057579 Ga0207688_100575792 255
941 3300025903 Ga0207680_10017854 Ga0207680_100178542 255
942 3300025904 Ga0207647_10003774 Ga0207647_1000377411 255
943 3300025905 Ga0207685_10002303 Ga0207685_100023033 255
944 3300025905 Ga0207685_10182282 Ga0207685_101822821 255
945 3300025906 Ga0207699_10023853 Ga0207699_100238532 255
946 3300025906 Ga0207699_10170170 Ga0207699_101701702 255
947 3300025907 Ga0207645_10000074 Ga0207645_100000748 255
948 3300025907 Ga0207645_10023855 Ga0207645_100238556 255
949 3300025908 Ga0207643_10000058 Ga0207643_1000005817 255
950 3300025911 Ga0207654_10004287 Ga0207654_100042878 255
951 3300025912 Ga0207707_10019779 Ga0207707_100197795 255
952 3300025913 Ga0207695_10157011 Ga0207695_101570112 255
953 3300025914 Ga0207671_10191532 Ga0207671_101915322 255
954 3300025915 Ga0207693_10001855 Ga0207693_100018551 255
955 3300025915 Ga0207693_10002979 Ga0207693_1000297912 255
956 3300025916 Ga0207663_10036931 Ga0207663_100369313 255
957 3300025916 Ga0207663_10068961 Ga0207663_100689612 255
958 3300025916 Ga0207663_10252136 Ga0207663_102521362 255
959 3300025917 Ga0207660_10000578 Ga0207660_1000057826 255
960 3300025918 Ga0207662_10000069 Ga0207662_100000692 255
961 3300025919 Ga0207657_10000721 Ga0207657_1000072138 255
962 3300025920 Ga0207649_10000282 Ga0207649_1000028242 255
963 3300025921 Ga0207652_10001198 Ga0207652_1000119817 255
964 3300025921 Ga0207652_10162753 Ga0207652_101627531 255
965 3300025923 Ga0207681_10000806 Ga0207681_1000080613 255
966 3300025925 Ga0207650_10005569 Ga0207650_100055698 255
967 3300025925 Ga0207650_10158976 Ga0207650_101589763 255
968 3300025926 Ga0207659_10000039 Ga0207659_1000003978 255
969 3300025927 Ga0207687_10000458 Ga0207687_100004589 255
970 3300025928 Ga0207700_10065675 Ga0207700_100656752 255
971 3300025928 Ga0207700_10107159 Ga0207700_101071591 255
972 3300025929 Ga0207664_10018448 Ga0207664_100184482 255
973 3300025929 Ga0207664_10055368 Ga0207664_100553685 255
974 3300025931 Ga0207644_10021949 Ga0207644_100219493 255
975 3300025931 Ga0207644_10032996 Ga0207644_100329962 255
976 3300025932 Ga0207690_10000303 Ga0207690_100003032 255
977 3300025933 Ga0207706_10063888 Ga0207706_100638884 255
978 3300025934 Ga0207686_10000540 Ga0207686_1000054012 255
979 3300025934 Ga0207686_10220270 Ga0207686_102202702 255
980 3300025935 Ga0207709_10000894 Ga0207709_100008944 255
981 3300025935 Ga0207709_10428152 Ga0207709_104281521 255
982 3300025936 Ga0207670_10000200 Ga0207670_100002006 255
983 3300025936 Ga0207670_10002609 Ga0207670_100026093 255
984 3300025937 Ga0207669_10000098 Ga0207669_1000009831 255
985 3300025937 Ga0207669_10010480 Ga0207669_100104806 255
986 3300025938 Ga0207704_10012394 Ga0207704_100123945 255
987 3300025938 Ga0207704_10147818 Ga0207704_101478182 255
988 3300025938 Ga0207704_10440512 Ga0207704_104405122 255
989 3300025939 Ga0207665_10189776 Ga0207665_101897762 255
990 3300025940 Ga0207691_10000169 Ga0207691_100001692 255
991 3300025940 Ga0207691_10230390 Ga0207691_102303902 255
992 3300025941 Ga0207711_10008085 Ga0207711_100080854 255
993 3300025941 Ga0207711_10283371 Ga0207711_102833711 255
994 3300025942 Ga0207689_10001003 Ga0207689_1000100317 255
995 3300025942 Ga0207689_10491258 Ga0207689_104912582 255
996 3300025944 Ga0207661_10014106 Ga0207661_100141065 255
997 3300025945 Ga0207679_10000030 Ga0207679_1000003032 255
998 3300025949 Ga0207667_10054202 Ga0207667_100542024 255
999 3300025949 Ga0207667_10485141 Ga0207667_104851412 255
1000 3300025960 Ga0207651_10000213 Ga0207651_1000021317 255
1001 3300025961 Ga0207712_10000473 Ga0207712_1000047337 255
1002 3300025972 Ga0207668_10000220 Ga0207668_1000022032 255
1003 3300025972 Ga0207668_10421124 Ga0207668_104211241 255
1004 3300025981 Ga0207640_10000573 Ga0207640_1000057317 255
1005 3300025986 Ga0207658_10120158 Ga0207658_101201583 255
1006 3300026023 Ga0207677_10000513 Ga0207677_1000051323 255
1007 3300026035 Ga0207703_10314978 Ga0207703_103149782 255
1008 3300026041 Ga0207639_10003256 Ga0207639_1000325610 255
1009 3300026067 Ga0207678_10003592 Ga0207678_1000359215 255
1010 3300026067 Ga0207678_10141866 Ga0207678_101418661 255
1011 3300026075 Ga0207708_10000428 Ga0207708_100004284 255
1012 3300026078 Ga0207702_10005939 Ga0207702_100059392 255
1013 3300026088 Ga0207641_10002043 Ga0207641_100020435 255
1014 3300026088 Ga0207641_10082469 Ga0207641_100824691 255
1015 3300026089 Ga0207648_10028973 Ga0207648_100289736 255
1016 3300026089 Ga0207648_10067409 Ga0207648_100674092 255
1017 3300026095 Ga0207676_10001467 Ga0207676_1000146711 255
1018 3300026116 Ga0207674_10000135 Ga0207674_1000013570 255
1019 3300026116 Ga0207674_10481295 Ga0207674_104812952 255
1020 3300026118 Ga0207675_100000245 Ga0207675_10000024558 255
1021 3300026121 Ga0207683_10000136 Ga0207683_1000013667 255
1022 3300026142 Ga0207698_10000828 Ga0207698_100008287 255
1023 3300027252 Ga0209973_1000324 Ga0209973_10003242 255
1024 3300027296 Ga0209389_1000041 Ga0209389_1000041111 255
1025 3300027296 Ga0209389_1000656 Ga0209389_100065614 255
1026 3300027357 Ga0209589_1000874 Ga0209589_100087434 255
1027 3300027361 Ga0209489_100178 Ga0209489_10017893 255
1028 3300027361 Ga0209489_105228 Ga0209489_10522818 255
1029 3300027363 Ga0209700_100010 Ga0209700_100010406 255
1030 3300027614 Ga0209970_1004161 Ga0209970_10041612 255
1031 3300027617 Ga0210002_1000224 Ga0210002_10002244 255
1032 3300027717 Ga0209998_10019780 Ga0209998_100197801 255
1033 3300027876 Ga0209974_10003611 Ga0209974_100036114 255
1034 3300027907 Ga0207428_10000471 Ga0207428_1000047114 255
1035 3300027907 Ga0207428_10264038 Ga0207428_102640382 255
1036 3300028379 Ga0268266_10007483 Ga0268266_100074832 255
1037 3300028379 Ga0268266_10236688 Ga0268266_102366882 255
1038 3300028379 Ga0268266_10691380 Ga0268266_106913801 255
1039 3300028380 Ga0268265_10001888 Ga0268265_100018883 255
1040 3300028381 Ga0268264_10000693 Ga0268264_1000069334 255
1041 3300028800 Ga0265338_10047667 Ga0265338_100476675 255
1042 3300031241 Ga0265325_10006332 Ga0265325_100063328 255
1043 3300031241 Ga0265325_10021820 Ga0265325_100218205 255
1044 3300031249 Ga0265339_10010010 Ga0265339_100100104 255
1045 3300031595 Ga0265313_10000106 Ga0265313_1000010639 255
1046 3300031711 Ga0265314_10023262 Ga0265314_100232626 255
1047 3300034818 Ga0373950_0004083 Ga0373950_0004083_484_1302 255
1048 3300034819 Ga0373958_0004047 Ga0373958_0004047_736_1554 255
1049 3300034957 Ga0373938_0001584 Ga0373938_0001584_2388_3206 255
1050 3300034957 Ga0373938_0007424 Ga0373938_0007424_676_1488 255
1051 3300035083 Ga0373926_0009755 Ga0373926_0009755_180_998 255
1052 3300035084 Ga0373928_0001828 Ga0373928_0001828_3290_4108 255
1053 3300035088 Ga0373940_0074425 Ga0373940_0074425_128_946 255
1054 3300035089 Ga0373944_0021434 Ga0373944_0021434_27_845 255
1055 3300035090 Ga0373949_0016957 Ga0373949_0016957_561_1379 255
1056 3300035092 Ga0373952_0001190 Ga0373952_0001190_505_1323 255
1057 3300035111 Ga0373923_0004598 Ga0373923_0004598_2900_3718 255
1058 3300035111 Ga0373923_0074895 Ga0373923_0074895_427_1230 255
1059 3300035112 Ga0373932_0002449 Ga0373932_0002449_3503_4321 255
1060 3300035113 Ga0373936_0062523 Ga0373936_0062523_201_1019 255
1061 3300035114 Ga0373939_0000864 Ga0373939_0000864_226_1044 255
1062 3300035115 Ga0373941_0010544 Ga0373941_0010544_852_1670 255
1063 3300035116 Ga0373945_0012224 Ga0373945_0012224_622_1440 255
1064 3300035118 Ga0373954_0005819 Ga0373954_0005819_2682_3500 255
1065 3300035118 Ga0373954_0011248 Ga0373954_0011248_2729_3547 255
1066 3300035120 Ga0373957_0011405 Ga0373957_0011405_1293_2111 255
1067 3300035121 Ga0373960_0013864 Ga0373960_0013864_759_1577 255
1068 3300035170 Ga0373943_0108743 Ga0373943_0108743_301_1119 255
1069 3300035171 Ga0373946_0003666 Ga0373946_0003666_260_1078 255
1070 3300035172 Ga0373955_0000762 Ga0373955_0000762_4042_4860 255
1071 3300035207 Ga0373942_0003044 Ga0373942_0003044_2545_3363 255
1072 3300035207 Ga0373942_0081988 Ga0373942_0081988_95_907 255
1073 3300035241 Ga0373961_0003482 Ga0373961_0003482_1587_2405 255
1074 3300035242 Ga0373962_0003932 Ga0373962_0003932_2091_2909 255
1075 3300035410 Ga0373924_0042212 Ga0373924_0042212_767_1585 255
1076 3300035691 Ga0373931_0013105 Ga0373931_0013105_1776_2594 255
1077 3300035691 Ga0373931_0029721 Ga0373931_0029721_816_1631 255
1078 3300035691 Ga0373931_0324496 Ga0373931_0324496_78_914 255
1079 3300035692 Ga0373935_0021704 Ga0373935_0021704_2814_3632 255
1080 3300035695 Ga0373927_0030686 Ga0373927_0030686_300_1118 255
1081 3300035695 Ga0373927_0231721 Ga0373927_0231721_22_837 255
1082 3300035724 Ga0373933_0006917 Ga0373933_0006917_3938_4756 255
1083 3300035725 Ga0373947_0235271 Ga0373947_0235271_340_1158 255
1084 3300035725 Ga0373947_0371578 Ga0373947_0371578_89_904 255
1085 3300036401 Ga0373937_0002201 Ga0373937_0002201_3085_3903 255
1086 3300036401 Ga0373937_0100680 Ga0373937_0100680_1447_2265 255
1087 3300037068 Ga0373925_0411768 Ga0373925_0411768_92_910 255
1088 3300037418 Ga0395900_0000591 Ga0395900_0000591_15395_16207 255
1089 3300037418 Ga0395900_0136111 Ga0395900_0136111_1095_1901 255
1090 3300037466 Ga0395898_0056665 Ga0395898_0056665_312_1124 255
1091 3300037471 Ga0395905_0004439 Ga0395905_0004439_12232_13044 255
1092 3300037471 Ga0395905_0014655 Ga0395905_0014655_6512_7321 255
1093 3300037471 Ga0395905_0161440 Ga0395905_0161440_428_1234 255
1094 3300037471 Ga0395905_0390471 Ga0395905_0390471_349_1161 255
1095 3300037853 Ga0436364_1194418 Ga0436364_1194418_4646_5446 255
1096 3300037853 Ga0436364_1458556 Ga0436364_1458556_3480_4289 255
1097 3300038443 Ga0395901_0066685 Ga0395901_0066685_1397_2209 255
1098 3300038443 Ga0395901_0589699 Ga0395901_0589699_144_956 255
1099 3300038443 Ga0395901_0829009 Ga0395901_0829009_73_885 255
1100 3300039437 Ga0436365_0156573 Ga0436365_0156573_303_1103 255
1101 3300039437 Ga0436365_1283964 Ga0436365_1283964_752_1561 255
1102 3300039450 Ga0436363_1166084 Ga0436363_1166084_631_1443 255
1103 3300044683 Ga0466965_0003867 Ga0466965_0003867_5747_6562 255
1104 3300044684 Ga0466966_0002892 Ga0466966_0002892_808_1620 255
1105 3300044693 Ga0466961_0000162 Ga0466961_0000162_43254_44066 255
1106 3300044694 Ga0466963_0010036 Ga0466963_0010036_655_1467 255
1107 3300044901 Ga0466960_0097009 Ga0466960_0097009_20_832 255
1108 3300045976 Ga0466967_0058654 Ga0466967_0058654_2177_2989 255
1109 3300046454 Ga0495592_0066959 Ga0495592_0066959_1481_2299 255
1110 3300046455 Ga0495603_0090503 Ga0495603_0090503_360_1178 255
1111 3300046459 Ga0495629_0147181 Ga0495629_0147181_612_1430 255
1112 3300046460 Ga0495638_0002361 Ga0495638_0002361_4689_5498 255
1113 3300046460 Ga0495638_0116776 Ga0495638_0116776_101_934 255
1114 3300046461 Ga0495641_0020397 Ga0495641_0020397_479_1297 255
1115 3300046462 Ga0495651_0035792 Ga0495651_0035792_1432_2250 255
1116 3300046463 Ga0495653_0034049 Ga0495653_0034049_933_1751 255
1117 3300046463 Ga0495653_0124767 Ga0495653_0124767_810_1628 255
1118 3300046472 Ga0495580_0004803 Ga0495580_0004803_8861_9679 255
1119 3300046473 Ga0495582_0074009 Ga0495582_0074009_898_1716 255
1120 3300046475 Ga0495639_0006464 Ga0495639_0006464_190_1008 255
1121 3300046476 Ga0495662_0003963 Ga0495662_0003963_4030_4848 255
1122 3300046477 Ga0495664_0011474 Ga0495664_0011474_4106_4924 255
1123 3300046491 Ga0495584_0071227 Ga0495584_0071227_50_868 255
1124 3300046499 Ga0495594_0052867 Ga0495594_0052867_1160_1978 255
1125 3300046511 Ga0495608_0069496 Ga0495608_0069496_1102_1920 255
1126 3300046514 Ga0495618_0047041 Ga0495618_0047041_207_1025 255
1127 3300046516 Ga0495628_0088097 Ga0495628_0088097_166_981 255
1128 3300046516 Ga0495628_0150472 Ga0495628_0150472_462_1280 255
1129 3300046517 Ga0495630_0009062 Ga0495630_0009062_3835_4653 255
1130 3300046518 Ga0495631_0043961 Ga0495631_0043961_197_1015 255
1131 3300046520 Ga0495637_0060628 Ga0495637_0060628_659_1477 255
1132 3300046523 Ga0495644_0000276 Ga0495644_0000276_8262_9080 255
1133 3300046526 Ga0495666_0010279 Ga0495666_0010279_2680_3498 255
1134 3300046529 Ga0495652_0055761 Ga0495652_0055761_278_1096 255
1135 3300046531 Ga0495665_0013872 Ga0495665_0013872_1952_2770 255
1136 3300046535 Ga0495586_0010130 Ga0495586_0010130_4034_4852 255
1137 3300046536 Ga0495587_0005259 Ga0495587_0005259_7233_8051 255
1138 3300046557 Ga0495622_0021826 Ga0495622_0021826_1140_1958 255
1139 3300046558 Ga0495633_0084274 Ga0495633_0084274_257_1075 255
1140 3300046559 Ga0495667_0005630 Ga0495667_0005630_2640_3458 255
1141 3300046559 Ga0495667_0194119 Ga0495667_0194119_333_1151 255
1142 3300046615 Ga0495656_0023120 Ga0495656_0023120_1043_1861 255
1143 3300046663 Ga0495635_0020965 Ga0495635_0020965_2032_2850 255
1144 3300046664 Ga0495659_0000313 Ga0495659_0000313_4871_5689 255
1145 3300046674 Ga0495588_0070004 Ga0495588_0070004_245_1063 255
1146 3300046675 Ga0495657_0022974 Ga0495657_0022974_470_1288 255
1147 3300046678 Ga0495599_0062772 Ga0495599_0062772_1454_2272 255
1148 3300046681 Ga0495647_0003430 Ga0495647_0003430_898_1716 255
1149 3300046683 Ga0495658_0014430 Ga0495658_0014430_64_882 255
1150 3300046689 Ga0495613_0090317 Ga0495613_0090317_92_910 255
1151 3300046690 Ga0495624_0002456 Ga0495624_0002456_8861_9679 255
1152 3300046691 Ga0495670_0000678 Ga0495670_0000678_2651_3469 255
1153 3300046809 Ga0495600_0003434 Ga0495600_0003434_4644_5462 255
1154 3300047315 Ga0495581_0062689 Ga0495581_0062689_364_1182 255
1155 3300047317 Ga0495604_0018621 Ga0495604_0018621_2524_3342 255
1156 3300047317 Ga0495604_0404982 Ga0495604_0404982_68_883 255
1157 3300047319 Ga0495674_0207364 Ga0495674_0207364_195_1013 255
1158 3300047321 Ga0495676_0084461 Ga0495676_0084461_418_1236 255
1159 3300047322 Ga0495680_0007610 Ga0495680_0007610_4345_5163 255
1160 3300047322 Ga0495680_0151914 Ga0495680_0151914_736_1551 255
1161 3300047443 Ga0495687_007944 Ga0495687_007944_1717_2529 255
1162 3300047444 Ga0495675_0034659 Ga0495675_0034659_1537_2355 255
1163 3300047444 Ga0495675_0102524 Ga0495675_0102524_98_916 255
1164 3300047471 Ga0495684_0003052 Ga0495684_0003052_2991_3809 255
1165 3300047673 Ga0495593_0022233 Ga0495593_0022233_2651_3469 255
1166 3300048088 Ga0495602_0083728 Ga0495602_0083728_1130_1948 255
1167 3300048088 Ga0495602_0230950 Ga0495602_0230950_474_1289 255
1168 3300048903 Ga0496100_0002748 Ga0496100_0002748_3704_4522 255
1169 3300048904 Ga0496101_0001569 Ga0496101_0001569_485_1303 255
1170 3300048904 Ga0496101_0014208 Ga0496101_0014208_3114_3926 255
1171 3300048905 Ga0496102_0004673 Ga0496102_0004673_1532_2350 255
1172 3300048905 Ga0496102_0367432 Ga0496102_0367432_185_997 255
1173 3300048906 Ga0496103_0000430 Ga0496103_0000430_32406_33224 255
1174 3300048906 Ga0496103_0021945 Ga0496103_0021945_97_909 255
1175 3300048907 Ga0496104_0021681 Ga0496104_0021681_4136_4948 255
1176 3300048907 Ga0496104_0069299 Ga0496104_0069299_793_1605 255
1177 3300048909 Ga0496106_0003028 Ga0496106_0003028_1763_2581 255
1178 3300048909 Ga0496106_0047456 Ga0496106_0047456_1930_2742 255
1179 3300048910 Ga0496107_0002796 Ga0496107_0002796_7976_8794 255
1180 3300048911 Ga0496108_0006618 Ga0496108_0006618_4124_4936 255
1181 3300048912 Ga0496109_0000338 Ga0496109_0000338_3342_4160 255
1182 3300048913 Ga0496110_0012004 Ga0496110_0012004_5941_6759 255
1183 3300048913 Ga0496110_0027225 Ga0496110_0027225_265_1077 255
1184 3300048914 Ga0496111_0006431 Ga0496111_0006431_5284_6096 255
1185 3300048914 Ga0496111_0230583 Ga0496111_0230583_143_961 255
1186 3300048915 Ga0496112_0020955 Ga0496112_0020955_61_873 255
1187 3300048915 Ga0496112_0181433 Ga0496112_0181433_234_1052 255
1188 3300048915 Ga0496112_0472203 Ga0496112_0472203_200_1012 255
1189 3300048916 Ga0496113_0073775 Ga0496113_0073775_126_938 255
1190 3300048918 Ga0496115_0001318 Ga0496115_0001318_5618_6436 255
1191 3300048921 Ga0496118_0112978 Ga0496118_0112978_127_939 255
1192 3300048924 Ga0496121_0022465 Ga0496121_0022465_3249_4061 255
1193 3300048926 Ga0496123_0158750 Ga0496123_0158750_121_933 255
1194 3300048927 Ga0496124_0226789 Ga0496124_0226789_333_1145 255
1195 3300049569 Ga0501032_0041769 Ga0501032_0041769_1149_1979 255
1196 3300049570 Ga0501033_0042302 Ga0501033_0042302_207_1037 255
1197 3300049571 Ga0501034_0099411 Ga0501034_0099411_601_1443 255
1198 3300049571 Ga0501034_0117993 Ga0501034_0117993_485_1282 255
1199 3300049571 Ga0501034_0273017 Ga0501034_0273017_94_924 255
1200 3300049572 Ga0501036_0050872 Ga0501036_0050872_2406_3236 255
1201 3300049573 Ga0501037_0025878 Ga0501037_0025878_3297_4127 255
1202 3300049574 Ga0501038_0012938 Ga0501038_0012938_2206_3048 255
1203 3300049574 Ga0501038_0270661 Ga0501038_0270661_186_1037 255
1204 3300049575 Ga0501039_0040108 Ga0501039_0040108_2299_3129 255
1205 3300049579 Ga0501043_0109394 Ga0501043_0109394_600_1451 255
1206 3300049579 Ga0501043_0191030 Ga0501043_0191030_608_1438 255
1207 3300049581 Ga0501047_0061353 Ga0501047_0061353_1301_2152 255
1208 3300049581 Ga0501047_0067292 Ga0501047_0067292_476_1306 255
1209 3300049584 Ga0501068_0062319 Ga0501068_0062319_506_1336 255
1210 3300049586 Ga0501070_0019942 Ga0501070_0019942_4585_5436 255
1211 3300049586 Ga0501070_0306670 Ga0501070_0306670_283_1113 255
1212 3300049592 Ga0501076_0329261 Ga0501076_0329261_41_847 255
1213 3300049741 Ga0501079_0029988 Ga0501079_0029988_3104_3934 255
1214 3300049742 Ga0501080_0007431 Ga0501080_0007431_655_1506 255
1215 3300049742 Ga0501080_0411693 Ga0501080_0411693_62_892 255
1216 3300049822 Ga0501035_0028842 Ga0501035_0028842_3724_4554 255
1217 3300049822 Ga0501035_0566022 Ga0501035_0566022_34_885 255
1218 3300049823 Ga0501044_0012179 Ga0501044_0012179_7448_8290 255
1219 3300049823 Ga0501044_0218398 Ga0501044_0218398_148_999 255
1220 3300049823 Ga0501044_0492650 Ga0501044_0492650_15_845 255
1221 3300049824 Ga0501045_0301716 Ga0501045_0301716_298_1116 255
1222 3300050490 nmdc:mga03n38_115705_c1 nmdc:mga03n38_115705_c1_238_1050 255
1223 3300050492 nmdc:mga0yw44_93104_c1 nmdc:mga0yw44_93104_c1_446_1258 255
1224 3300050493 nmdc:mga0k408_128597_c1 nmdc:mga0k408_128597_c1_464_1288 255
1225 3300050493 nmdc:mga0k408_62477_c1 nmdc:mga0k408_62477_c1_497_1315 255
1226 3300050494 nmdc:mga06z11_293043_c1 nmdc:mga06z11_293043_c1_103_918 255
1227 3300050496 nmdc:mga07m45_42634_c1 nmdc:mga07m45_42634_c1_807_1625 255
1228 3300050507 nmdc:mga05p37_7455_c1 nmdc:mga05p37_7455_c1_9432_10250 255
1229 3300050511 nmdc:mga08y16_2015_c1 nmdc:mga08y16_2015_c1_19393_20211 255
1230 3300050511 nmdc:mga08y16_58619_c1 nmdc:mga08y16_58619_c1_2210_3007 255
1231 3300050512 nmdc:mga0n895_115319_c1 nmdc:mga0n895_115319_c1_1368_2186 255
1232 3300050512 nmdc:mga0n895_4804_c1 nmdc:mga0n895_4804_c1_930_1727 255
1233 3300050512 nmdc:mga0n895_543_c1 nmdc:mga0n895_543_c1_12163_12981 255
1234 3300050513 nmdc:mga0rr50_112178_c2 nmdc:mga0rr50_112178_c2_486_1304 255
1235 3300050513 nmdc:mga0rr50_296228_c1 nmdc:mga0rr50_296228_c1_384_1181 255
1236 3300050513 nmdc:mga0rr50_69644_c1 nmdc:mga0rr50_69644_c1_476_1294 255
1237 3300050514 nmdc:mga08x19_207846_c1 nmdc:mga08x19_207846_c1_444_1262 255
1238 3300050515 nmdc:mga0a205_114547_c1 nmdc:mga0a205_114547_c1_542_1360 255
1239 3300050515 nmdc:mga0a205_20418_c1 nmdc:mga0a205_20418_c1_5195_5992 255
1240 3300050515 nmdc:mga0a205_8969_c1 nmdc:mga0a205_8969_c1_5082_5900 255
1241 3300050516 nmdc:mga0sz30_32769_c1 nmdc:mga0sz30_32769_c1_81_899 255
1242 3300050516 nmdc:mga0sz30_67242_c1 nmdc:mga0sz30_67242_c1_659_1471 255
1243 3300053077 Ga0495601_0003588 Ga0495601_0003588_5897_6715 255
1244 3300053077 Ga0495601_0122219 Ga0495601_0122219_810_1628 255
1245 3300053078 Ga0495612_0004411 Ga0495612_0004411_2222_3040 255
1246 3300053078 Ga0495612_0041489 Ga0495612_0041489_100_915 255
1247 3300053084 Ga0495595_0001441 Ga0495595_0001441_2354_3172 255
1248 3300053084 Ga0495595_0094474 Ga0495595_0094474_207_1025 255
1249 3300053085 Ga0495619_0004134 Ga0495619_0004134_4655_5473 255
1250 3300053085 Ga0495619_0065872 Ga0495619_0065872_967_1785 255
1251 3300053087 Ga0500643_000116 Ga0500643_000116_17584_18393 255
1252 3300053091 Ga0500647_0070088 Ga0500647_0070088_136_948 255
1253 3300053103 Ga0500555_001167 Ga0500555_001167_3391_4200 255
1254 3300053105 Ga0500557_000061 Ga0500557_000061_26862_27674 255
1255 3300053108 Ga0500562_007630 Ga0500562_007630_1325_2134 255
1256 3300053108 Ga0500562_012973 Ga0500562_012973_304_1140 255
1257 3300053130 Ga0500642_0000098 Ga0500642_0000098_3668_4480 255
1258 3300053139 Ga0500568_0003430 Ga0500568_0003430_1490_2299 255
1259 3300053156 Ga0500622_0014627 Ga0500622_0014627_3241_4050 255
1260 3300053158 Ga0500627_0001120 Ga0500627_0001120_1674_2483 255
1261 3300053160 Ga0500633_0017870 Ga0500633_0017870_221_1030 255
1262 3300053729 Ga0500625_016887 Ga0500625_016887_752_1564 255
1263 3300053736 Ga0500599_000994 Ga0500599_000994_184_993 255
1264 3300053737 Ga0500601_000104 Ga0500601_000104_6509_7321 255
1265 3300060353 Ga0501082_0479731 Ga0501082_0479731_93_902 255
1266 3300061719 Ga0466962_0167636 Ga0466962_0167636_31_843 255
1267 3300061734 Ga0530510_0325065 Ga0530510_0325065_67_885 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

15

203

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8444 16 242
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8238 16 242
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.8099 16 247
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7972 16 247
7ap5-assembly1.cif.gz_AAA crystal structure of phycoerythrin from cyanobacterium nostoc sp. wr13 contains multiple stacks of hexameric assemblies which resemble the rods of phycobilisome. 0.3124 2 173
ID Description Score Start End Superfamily
af_B3WFV1_75_234_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4295 119 252 1.10.490.10
af_A3KFU9_372_573_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4081 42 252 1.20.1640.10
af_A3KFU9_372_573_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3937 42 252 1.20.1640.10
af_B3WFV1_75_234_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3669 119 252 1.10.490.10
af_A0A1D6N0I3_20_174_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3657 119 249 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A382I530-F1-model_v4 Sec-independent protein translocase protein TatC 0.9453 114 252 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A523G1K8-F1-model_v4 Sec-independent protein translocase protein TatC 0.9375 12 250 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A2U3D5V5-F1-model_v4 Sec-independent protein translocase protein TatC 0.9351 9 250 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A2D6FWT3-F1-model_v4 Sec-independent protein translocase protein TatC 0.9328 12 250 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A528AGZ7-F1-model_v4 Sec-independent protein translocase protein TatC 0.93 15 252 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Feature Viewer

pLDDT pTM Quality
72.04 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map