F492251

General Info

Members Datasets Scaffolds Average Seq Length
1255 481 1254 303

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_13334_c1|nmdc:mga00v17_13334_c1_3340_4329
Length 329
Sequence VDARHKAGHDEVKGQNPMIIERQEDVTPAVLKELARAPNARFKEIMGPFIRHMHDFIRESKLTEEEFRTAMNYVVALGKASNESHNEAVLIAGSLGISSLVCLLNNSDGQTDTDASLLGPFWREQSPITPNGASIVRSATPGPALFVKAWFRDRAGNPIKGAEVDIWQSSTEGFYENQDPGQADMNLRGKFFTDENGYIAFQSIKPAGYPIPVHGPTGDLLRAQGRHNMRPAHLHFLASKDGFKTLISQIYVADDKNIDSDVQFGVTRHLIGNFAKHDGPAPTANVTGTWYSLDHNFVMEAGPSKLPRAPITGKAQGERPALPVLERVP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2643221723 Ensifer sp. Root278 Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
155 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
156 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
174 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
175 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
183 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
267 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
268 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
269 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
270 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
276 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
277 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
278 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
279 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
280 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
281 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
282 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
283 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
284 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
285 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
286 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
287 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
288 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
289 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
294 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
295 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
296 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
297 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
298 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
303 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
304 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
305 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
306 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
309 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
310 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
313 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
314 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
317 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
318 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
323 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
324 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
325 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
326 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
327 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
328 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
329 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
330 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
343 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
344 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
345 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
346 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
347 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
348 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
349 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
355 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
358 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
359 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
365 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
372 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
373 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
379 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
434 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
435 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
436 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
437 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
438 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
439 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
440 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
441 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
442 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
443 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
444 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
457 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
458 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
461 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
462 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
463 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
464 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
465 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
466 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
467 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
468 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
469 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
470 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
471 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
472 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
473 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
476 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
477 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
478 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
481 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 8.05
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1075987 2162886007 Bacteria 1498
2 2214800751 2209111006 Bacteria 11360
3 2214809099 2209111006 Bacteria 1998
4 ARcpr5oldR_c000150 3300000041 Bacteria 12077
5 ARSoilYngRDRAFT_c00266 3300000042 Bacteria 7923
6 ARcpr5yngRDRAFT_c000123 3300000043 Bacteria 12049
7 ARSoilOldRDRAFT_c000007 3300000044 Bacteria 55959
8 ARCol0oldRDRAFT_c00020 3300000045 Bacteria 12065
9 ARCol0yngRDRAFT_1000009 3300000652 Bacteria 43473
10 JGI24741J21665_1012297 3300001915 Bacteria 1474
11 JGI24746J21847_1006319 3300001977 Bacteria 1840
12 JGI24739J22299_10003727 3300001989 Bacteria 5818
13 JGI24737J22298_10028599 3300001990 Bacteria 1751
14 JGI24737J22298_10055890 3300001990 Bacteria 1193
15 JGI24743J22301_10005560 3300001991 Bacteria 2109
16 JGI24750J21931_1000613 3300002070 Bacteria 5366
17 JGI24738J21930_10003331 3300002075 Bacteria 4075
18 JGI24749J21850_1015264 3300002076 Bacteria 1078
19 JGI24744J21845_10001820 3300002077 Bacteria 4283
20 JGI24744J21845_10001986 3300002077 Bacteria 4137
21 JGI24035J26624_1000072 3300002126 Bacteria 8181
22 JGI24033J26618_1004187 3300002155 Bacteria 1549
23 JGI24033J26618_1005390 3300002155 Bacteria 1409
24 JGI24034J26672_10000632 3300002239 Bacteria 4522
25 JGI24742J22300_10002483 3300002244 Bacteria 2949
26 JGI24751J29686_10010480 3300002459 Bacteria 1911
27 JGI25158J39367_1004330 3300002739 Bacteria 2136
28 JGI25159J45721_1000675 3300002987 Bacteria 15067
29 JGI25151J46595_10018941 3300003187 Bacteria 2939
30 JGI25406J46586_10009709 3300003203 Bacteria 4301
31 JGI25160J50197_1000962 3300003354 Bacteria 15067
32 JGI25404J52841_10012261 3300003659 Bacteria 1856
33 Ga0055532_1000231 3300003758 Bacteria 41528
34 Ga0055527_1000188 3300003760 Bacteria 41528
35 Ga0055535_1000592 3300003761 Bacteria 29980
36 Ga0055542_1001825 3300003762 Bacteria 8718
37 Ga0055526_1014272 3300003771 Bacteria 3281
38 Ga0055543_1003620 3300004625 Bacteria 4468
39 Ga0065165_1002550 3300005262 Bacteria 15105
40 Ga0065716_1001883 3300005277 Bacteria 2879
41 Ga0065704_10080735 3300005289 Bacteria 3833
42 Ga0065712_10070846 3300005290 Bacteria 5648
43 Ga0065715_10212808 3300005293 Bacteria 1306
44 Ga0065715_10257302 3300005293 Bacteria 1148
45 Ga0065715_10303590 3300005293 Bacteria 1036
46 Ga0070658_10027080 3300005327 Bacteria 4602
47 Ga0070658_10155840 3300005327 Bacteria 1915
48 Ga0070658_10400048 3300005327 Unclassified 1180
49 Ga0070676_10000884 3300005328 Bacteria 14780
50 Ga0070676_10008244 3300005328 Bacteria 5610
51 Ga0070683_100201988 3300005329 Bacteria 1887
52 Ga0070690_100014364 3300005330 Bacteria 4699
53 Ga0070690_100034837 3300005330 Bacteria 3156
54 Ga0070690_100312567 3300005330 Unclassified 1130
55 Ga0070670_100006862 3300005331 Bacteria 9649
56 Ga0070670_100066773 3300005331 Bacteria 3087
57 Ga0070670_100069045 3300005331 Bacteria 3033
58 Ga0070670_100094337 3300005331 Bacteria 2573
59 Ga0070677_10000988 3300005333 Bacteria 9191
60 Ga0070677_10020355 3300005333 Bacteria 2416
61 Ga0068869_100032403 3300005334 Bacteria 3682
62 Ga0068869_100077044 3300005334 Bacteria 2479
63 Ga0070666_10085701 3300005335 Bacteria 2158
64 Ga0070666_10123437 3300005335 Bacteria 1797
65 Ga0070666_10173559 3300005335 Bacteria 1510
66 Ga0070680_100016581 3300005336 Bacteria 5797
67 Ga0070680_100419011 3300005336 Bacteria 1142
68 Ga0070682_100068289 3300005337 Bacteria 2266
69 Ga0068868_100011533 3300005338 Bacteria 6437
70 Ga0068868_100032503 3300005338 Bacteria 4014
71 Ga0070660_100006262 3300005339 Bacteria 8241
72 Ga0070689_100033029 3300005340 Bacteria 3940
73 Ga0070689_100046647 3300005340 Bacteria 3339
74 Ga0070689_100159190 3300005340 Bacteria 1824
75 Ga0070689_100169480 3300005340 Bacteria 1768
76 Ga0070691_10001048 3300005341 Bacteria 11394
77 Ga0070691_10002316 3300005341 Bacteria 8434
78 Ga0070691_10016847 3300005341 Bacteria 3360
79 Ga0070687_100006103 3300005343 Bacteria 4918
80 Ga0070687_100015548 3300005343 Bacteria 3445
81 Ga0070687_100226203 3300005343 Bacteria 1149
82 Ga0070661_100031155 3300005344 Bacteria 3855
83 Ga0070661_100071832 3300005344 Bacteria 2547
84 Ga0070692_10001006 3300005345 Bacteria 9699
85 Ga0070692_10017275 3300005345 Bacteria 3445
86 Ga0070668_100071279 3300005347 Bacteria 2707
87 Ga0070675_100002103 3300005354 Bacteria 14725
88 Ga0070675_100081609 3300005354 Bacteria 2697
89 Ga0070675_100112371 3300005354 Bacteria 2307
90 Ga0070671_100015813 3300005355 Bacteria 6095
91 Ga0070671_100021922 3300005355 Bacteria 5218
92 Ga0070671_100083504 3300005355 Bacteria 2671
93 Ga0070674_100017597 3300005356 Bacteria 4501
94 Ga0070674_100032398 3300005356 Bacteria 3471
95 Ga0070674_100133795 3300005356 Bacteria 1852
96 Ga0070673_100000950 3300005364 Bacteria 16418
97 Ga0070673_100003515 3300005364 Bacteria 9767
98 Ga0070673_100006321 3300005364 Bacteria 7693
99 Ga0070673_100104219 3300005364 Bacteria 2341
100 Ga0070673_100183299 3300005364 Bacteria 1793
101 Ga0070688_100093367 3300005365 Bacteria 1970
102 Ga0070688_100214816 3300005365 Bacteria 1352
103 Ga0070688_100324500 3300005365 Bacteria 1120
104 Ga0070659_100215754 3300005366 Bacteria 1582
105 Ga0070667_100008645 3300005367 Bacteria 8438
106 Ga0070667_100115440 3300005367 Bacteria 2332
107 Ga0070667_100243221 3300005367 Bacteria 1607
108 Ga0070667_100260753 3300005367 Unclassified 1552
109 Ga0070667_100393820 3300005367 Bacteria 1260
110 Ga0070703_10001238 3300005406 Bacteria 7788
111 Ga0070709_10002890 3300005434 Bacteria 9260
112 Ga0070709_10086506 3300005434 Bacteria 2058
113 Ga0070714_100018377 3300005435 Bacteria 5679
114 Ga0070714_100062021 3300005435 Bacteria 3213
115 Ga0070714_100088698 3300005435 Bacteria 2707
116 Ga0070713_100032262 3300005436 Bacteria 4181
117 Ga0070710_10009574 3300005437 Bacteria 4744
118 Ga0070710_10121239 3300005437 Bacteria 1583
119 Ga0070701_10030989 3300005438 Bacteria 2651
120 Ga0070701_10108188 3300005438 Bacteria 1549
121 Ga0070711_100009225 3300005439 Bacteria 6066
122 Ga0070711_100018778 3300005439 Bacteria 4421
123 Ga0070711_100143911 3300005439 Bacteria 1791
124 Ga0070711_100337761 3300005439 Bacteria 1208
125 Ga0070705_100000402 3300005440 Bacteria 24952
126 Ga0070705_100020818 3300005440 Bacteria 3479
127 Ga0070705_100045906 3300005440 Bacteria 2516
128 Ga0070705_100140908 3300005440 Bacteria 1587
129 Ga0070700_100000724 3300005441 Bacteria 16295
130 Ga0070694_100000600 3300005444 Bacteria 19813
131 Ga0070694_100027477 3300005444 Bacteria 3695
132 Ga0070708_100035647 3300005445 Bacteria 4335
133 Ga0070708_100054489 3300005445 Bacteria 3552
134 Ga0070663_100016167 3300005455 Bacteria 4836
135 Ga0070663_100159348 3300005455 Bacteria 1736
136 Ga0070678_100008877 3300005456 Bacteria 6050
137 Ga0070678_100019314 3300005456 Bacteria 4439
138 Ga0070678_100033275 3300005456 Bacteria 3577
139 Ga0070662_100102604 3300005457 Bacteria 2167
140 Ga0070662_100225936 3300005457 Bacteria 1496
141 Ga0070681_10005925 3300005458 Bacteria 11829
142 Ga0070681_10126410 3300005458 Bacteria 2489
143 Ga0070681_10498387 3300005458 Bacteria 1131
144 Ga0068867_100001504 3300005459 Bacteria 16138
145 Ga0068867_100011516 3300005459 Bacteria 6244
146 Ga0068867_100051652 3300005459 Bacteria 3032
147 Ga0070685_10004829 3300005466 Bacteria 6821
148 Ga0070685_10053569 3300005466 Bacteria 2338
149 Ga0070685_10084626 3300005466 Bacteria 1908
150 Ga0070706_100357177 3300005467 Bacteria 1362
151 Ga0070707_100375620 3300005468 Bacteria 1381
152 Ga0070698_100072731 3300005471 Bacteria 3446
153 Ga0070698_100090055 3300005471 Bacteria 3051
154 Ga0070699_100000330 3300005518 Bacteria 45857
155 Ga0070699_100008676 3300005518 Bacteria 8810
156 Ga0070699_100128434 3300005518 Bacteria 2234
157 Ga0070699_100227359 3300005518 Bacteria 1663
158 Ga0070679_100009727 3300005530 Bacteria 9094
159 Ga0070679_100138090 3300005530 Bacteria 2418
160 Ga0070679_100229052 3300005530 Bacteria 1818
161 Ga0070684_100003143 3300005535 Bacteria 12332
162 Ga0070684_100467224 3300005535 Bacteria 1167
163 Ga0070697_100145261 3300005536 Bacteria 1996
164 Ga0070697_100207413 3300005536 Bacteria 1667
165 Ga0068853_100006565 3300005539 Bacteria 9267
166 Ga0068853_100032751 3300005539 Bacteria 4404
167 Ga0068853_100319072 3300005539 Bacteria 1440
168 Ga0070672_100005327 3300005543 Bacteria 8519
169 Ga0070672_100252630 3300005543 Bacteria 1485
170 Ga0070686_100021206 3300005544 Bacteria 3858
171 Ga0070686_100041073 3300005544 Bacteria 2889
172 Ga0070695_100000637 3300005545 Bacteria 18603
173 Ga0070696_100000069 3300005546 Bacteria 49879
174 Ga0070696_100050368 3300005546 Bacteria 2895
175 Ga0070696_100241585 3300005546 Bacteria 1362
176 Ga0070693_100002964 3300005547 Bacteria 7856
177 Ga0070693_100019541 3300005547 Bacteria 3554
178 Ga0070693_100090064 3300005547 Bacteria 1847
179 Ga0070693_100121695 3300005547 Unclassified 1619
180 Ga0070693_100256545 3300005547 Bacteria 1161
181 Ga0070665_100031023 3300005548 Bacteria 5379
182 Ga0070665_100316131 3300005548 Bacteria 1566
183 Ga0070704_100000749 3300005549 Bacteria 15968
184 Ga0070704_100214606 3300005549 Bacteria 1561
185 Ga0068855_100019111 3300005563 Bacteria 8234
186 Ga0068855_100073458 3300005563 Bacteria 3973
187 Ga0068855_100124790 3300005563 Bacteria 2944
188 Ga0068855_100327480 3300005563 Bacteria 1692
189 Ga0070664_100153271 3300005564 Bacteria 2035
190 Ga0070664_100160834 3300005564 Bacteria 1987
191 Ga0070664_100368748 3300005564 Bacteria 1309
192 Ga0070664_100507705 3300005564 Unclassified 1112
193 Ga0070664_100536712 3300005564 Bacteria 1081
194 Ga0068857_100000616 3300005577 Bacteria 26168
195 Ga0068857_100019113 3300005577 Bacteria 6014
196 Ga0068857_100060288 3300005577 Bacteria 3370
197 Ga0068857_100079354 3300005577 Bacteria 2930
198 Ga0068854_100060789 3300005578 Bacteria 2734
199 Ga0068854_100170218 3300005578 Bacteria 1694
200 Ga0068856_100059449 3300005614 Bacteria 3775
201 Ga0068856_100106093 3300005614 Bacteria 2804
202 Ga0068856_100178755 3300005614 Bacteria 2135
203 Ga0070702_100011750 3300005615 Bacteria 4366
204 Ga0070702_100019301 3300005615 Bacteria 3553
205 Ga0070702_100080400 3300005615 Bacteria 1950
206 Ga0068852_100002017 3300005616 Bacteria 13827
207 Ga0068859_100004949 3300005617 Bacteria 13537
208 Ga0068859_100005304 3300005617 Bacteria 13104
209 Ga0068859_100018608 3300005617 Bacteria 6983
210 Ga0068859_100060783 3300005617 Bacteria 3807
211 Ga0068859_100064044 3300005617 Bacteria 3708
212 Ga0068864_100003232 3300005618 Bacteria 13462
213 Ga0068864_100004578 3300005618 Bacteria 11352
214 Ga0068864_100043738 3300005618 Bacteria 3836
215 Ga0068864_100080402 3300005618 Bacteria 2855
216 Ga0068866_10002061 3300005718 Bacteria 8362
217 Ga0068866_10011605 3300005718 Bacteria 3817
218 Ga0068866_10158439 3300005718 Bacteria 1318
219 Ga0068870_10000289 3300005840 Bacteria 18688
220 Ga0068870_10004900 3300005840 Bacteria 5793
221 Ga0068863_100001280 3300005841 Bacteria 25093
222 Ga0068863_100025968 3300005841 Bacteria 5589
223 Ga0068858_100057360 3300005842 Bacteria 3599
224 Ga0068860_100008827 3300005843 Bacteria 10042
225 Ga0068860_100008977 3300005843 Bacteria 9959
226 Ga0068860_100036450 3300005843 Bacteria 4712
227 Ga0068862_100005504 3300005844 Bacteria 10580
228 Ga0068862_100006312 3300005844 Bacteria 9856
229 Ga0068862_100351644 3300005844 Bacteria 1367
230 Ga0081455_10000540 3300005937 Bacteria 49195
231 Ga0081455_10001205 3300005937 Bacteria 32425
232 Ga0081455_10005299 3300005937 Bacteria 14164
233 Ga0081455_10022139 3300005937 Bacteria 5947
234 Ga0081455_10042728 3300005937 Bacteria 3973
235 Ga0081455_10119772 3300005937 Bacteria 2075
236 Ga0081538_10010807 3300005981 Bacteria 7455
237 Ga0081540_1000015 3300005983 Bacteria 178704
238 Ga0081540_1008029 3300005983 Bacteria 7425
239 Ga0081540_1054309 3300005983 Bacteria 1959
240 Ga0081539_10002225 3300005985 Bacteria 28285
241 Ga0081539_10077702 3300005985 Unclassified 1754
242 Ga0070717_10000817 3300006028 Bacteria 20525
243 Ga0070717_10033136 3300006028 Bacteria 4167
244 Ga0070717_10138362 3300006028 Bacteria 2099
245 Ga0070717_10243185 3300006028 Bacteria 1588
246 Ga0070717_10517859 3300006028 Bacteria 1079
247 Ga0075365_10196964 3300006038 Bacteria 1411
248 Ga0075364_10011348 3300006051 Bacteria 5412
249 Ga0075432_10059642 3300006058 Bacteria 1356
250 Ga0070715_10002395 3300006163 Bacteria 5744
251 Ga0070715_10002890 3300006163 Bacteria 5360
252 Ga0070715_10156595 3300006163 Bacteria 1122
253 Ga0070716_100017968 3300006173 Bacteria 3677
254 Ga0070716_100018008 3300006173 Bacteria 3673
255 Ga0070712_100001671 3300006175 Bacteria 13570
256 Ga0070712_100011668 3300006175 Bacteria 5581
257 Ga0070712_100055726 3300006175 Bacteria 2769
258 Ga0070712_100056602 3300006175 Bacteria 2751
259 Ga0070712_100112826 3300006175 Bacteria 2031
260 Ga0070712_100144699 3300006175 Bacteria 1818
261 Ga0075367_10072194 3300006178 Bacteria 2077
262 Ga0075366_10004013 3300006195 Bacteria 7866
263 Ga0097621_100001930 3300006237 Bacteria 14142
264 Ga0097621_100005823 3300006237 Bacteria 8704
265 Ga0097621_100120569 3300006237 Bacteria 2224
266 Ga0097621_100177418 3300006237 Bacteria 1839
267 Ga0068871_100001884 3300006358 Bacteria 14190
268 Ga0068871_100003555 3300006358 Bacteria 10726
269 Ga0068871_100010659 3300006358 Bacteria 6720
270 Ga0068871_100091434 3300006358 Bacteria 2536
271 Ga0068871_100207262 3300006358 Bacteria 1695
272 Ga0068871_100559324 3300006358 Bacteria 1037
273 Ga0075428_100097372 3300006844 Bacteria 3207
274 Ga0075428_100229821 3300006844 Bacteria 2002
275 Ga0075430_100053277 3300006846 Bacteria 3407
276 Ga0075431_100026272 3300006847 Bacteria 5972
277 Ga0075431_100291957 3300006847 Bacteria 1649
278 Ga0075433_10005937 3300006852 Bacteria 9616
279 Ga0075433_10009567 3300006852 Bacteria 7751
280 Ga0075433_10081387 3300006852 Bacteria 2855
281 Ga0075433_10097799 3300006852 Bacteria 2598
282 Ga0075433_10312525 3300006852 Bacteria 1391
283 Ga0075434_100013765 3300006871 Bacteria 7713
284 Ga0075434_100060452 3300006871 Bacteria 3768
285 Ga0075434_100151373 3300006871 Bacteria 2340
286 Ga0075434_100168466 3300006871 Bacteria 2210
287 Ga0075434_100186328 3300006871 Bacteria 2096
288 Ga0075434_100210513 3300006871 Bacteria 1964
289 Ga0075434_100455617 3300006871 Bacteria 1300
290 Ga0075434_100548251 3300006871 Bacteria 1176
291 Ga0075429_100010683 3300006880 Bacteria 7944
292 Ga0068865_100022254 3300006881 Bacteria 4132
293 Ga0075436_100001808 3300006914 Bacteria 14657
294 Ga0097620_100004949 3300006931 Bacteria 13537
295 Ga0097620_100005304 3300006931 Bacteria 13104
296 Ga0097620_100018608 3300006931 Bacteria 6983
297 Ga0097620_100060780 3300006931 Bacteria 3807
298 Ga0097620_100064046 3300006931 Bacteria 3708
299 Ga0075435_100074793 3300007076 Bacteria 2772
300 Ga0075435_100150262 3300007076 Bacteria 1958
301 Ga0075435_100196637 3300007076 Bacteria 1708
302 Ga0075435_100223910 3300007076 Bacteria 1597
303 Ga0075435_100362484 3300007076 Bacteria 1243
304 Ga0099795_10006632 3300007788 Unclassified 3172
305 Ga0099795_10011343 3300007788 Bacteria 2661
306 Ga0105250_10011298 3300009092 Bacteria 3705
307 Ga0105240_10077106 3300009093 Bacteria 4107
308 Ga0105240_10308309 3300009093 Bacteria 1808
309 Ga0105240_10387178 3300009093 Bacteria 1578
310 Ga0111539_10000345 3300009094 Bacteria 57093
311 Ga0111539_10001931 3300009094 Bacteria 27629
312 Ga0111539_10002122 3300009094 Bacteria 26499
313 Ga0111539_10074518 3300009094 Bacteria 3999
314 Ga0111539_10135014 3300009094 Bacteria 2889
315 Ga0111539_10383441 3300009094 Bacteria 1637
316 Ga0105245_10002784 3300009098 Bacteria 15726
317 Ga0105245_10063738 3300009098 Bacteria 3329
318 Ga0105247_10003272 3300009101 Bacteria 10625
319 Ga0105247_10011048 3300009101 Bacteria 5448
320 Ga0114129_10003572 3300009147 Bacteria 21879
321 Ga0114129_10007079 3300009147 Bacteria 15964
322 Ga0114129_10010645 3300009147 Bacteria 13117
323 Ga0105243_10015911 3300009148 Bacteria 5689
324 Ga0105243_10038149 3300009148 Bacteria 3741
325 Ga0105243_10108219 3300009148 Bacteria 2320
326 Ga0105241_10000940 3300009174 Bacteria 21996
327 Ga0105242_10002276 3300009176 Bacteria 15168
328 Ga0105242_10007660 3300009176 Bacteria 8309
329 Ga0105242_10047519 3300009176 Bacteria 3485
330 Ga0105248_10067581 3300009177 Bacteria 4013
331 Ga0105248_10358663 3300009177 Bacteria 1641
332 Ga0105238_10032937 3300009551 Bacteria 5275
333 Ga0105238_10274521 3300009551 Bacteria 1666
334 Ga0105249_10012262 3300009553 Bacteria 7552
335 Ga0105249_10182734 3300009553 Bacteria 2041
336 Ga0105249_10726736 3300009553 Bacteria 1054
337 Ga0099796_10034707 3300010159 Bacteria 1668
338 Ga0105239_10003461 3300010375 Bacteria 19316
339 Ga0105239_10098595 3300010375 Bacteria 3230
340 Ga0105239_10206978 3300010375 Bacteria 2198
341 Ga0105239_10217083 3300010375 Bacteria 2144
342 Ga0105246_10012297 3300011119 Bacteria 5337
343 Ga0105246_10030167 3300011119 Bacteria 3578
344 Ga0157345_1004195 3300012498 Unclassified 1074
345 Ga0157339_1002441 3300012505 Bacteria 1256
346 Ga0157316_1002487 3300012510 Bacteria 1253
347 Ga0157373_10004480 3300013100 Bacteria 10517
348 Ga0157373_10179750 3300013100 Bacteria 1489
349 Ga0157371_10035439 3300013102 Bacteria 3575
350 Ga0157371_10159738 3300013102 Bacteria 1609
351 Ga0157369_10090869 3300013105 Bacteria 3260
352 Ga0157369_10349613 3300013105 Bacteria 1535
353 Ga0157374_10002727 3300013296 Bacteria 14830
354 Ga0157374_10008248 3300013296 Bacteria 8898
355 Ga0157378_10100825 3300013297 Bacteria 2636
356 Ga0163162_10045574 3300013306 Bacteria 4393
357 Ga0163162_10450821 3300013306 Bacteria 1418
358 Ga0157372_10040903 3300013307 Bacteria 5123
359 Ga0157372_10457375 3300013307 Bacteria 1488
360 Ga0157372_10563574 3300013307 Bacteria 1328
361 Ga0157375_10590914 3300013308 Bacteria 1270
362 Ga0163163_10042310 3300014325 Bacteria 4461
363 Ga0163163_10063147 3300014325 Bacteria 3671
364 Ga0157380_10023039 3300014326 Bacteria 4696
365 Ga0157380_10542290 3300014326 Unclassified 1139
366 Ga0157379_10010629 3300014968 Bacteria 8022
367 Ga0157379_10032040 3300014968 Bacteria 4684
368 Ga0157379_10113642 3300014968 Bacteria 2433
369 Ga0157379_10249132 3300014968 Bacteria 1612
370 Ga0157379_10353174 3300014968 Bacteria 1346
371 Ga0157376_10002411 3300014969 Bacteria 12632
372 Ga0157376_10063454 3300014969 Bacteria 3112
373 Ga0157376_10067933 3300014969 Bacteria 3016
374 Ga0157376_10211875 3300014969 Bacteria 1789
375 Ga0163161_10001476 3300017792 Bacteria 17368
376 Ga0163161_10058906 3300017792 Bacteria 2792
377 Ga0163161_10090221 3300017792 Bacteria 2268
378 Ga0163161_10140284 3300017792 Bacteria 1830
379 Ga0213872_10021480 3300021361 Bacteria 2973
380 Ga0213874_10006500 3300021377 Bacteria 2769
381 Ga0213876_10011677 3300021384 Bacteria 4689
382 Ga0213876_10126063 3300021384 Bacteria 1360
383 Ga0224572_1004661 3300024225 Bacteria 2402
384 Ga0228598_1002219 3300024227 Bacteria 4247
385 Ga0209436_100633 3300025208 Bacteria 15033
386 Ga0209672_100020 3300025228 Bacteria 429003
387 Ga0209147_100024 3300025229 Bacteria 429003
388 Ga0209258_100121 3300025242 Bacteria 180843
389 Ga0209148_1000458 3300025254 Bacteria 44146
390 Ga0209455_1000263 3300025272 Bacteria 60487
391 Ga0209130_1001496 3300025284 Bacteria 15119
392 Ga0207673_1000001 3300025290 Bacteria 29268
393 Ga0209676_1001975 3300025292 Bacteria 16337
394 Ga0209025_1000301 3300025294 Bacteria 110450
395 Ga0209564_1000494 3300025295 Bacteria 65041
396 Ga0209564_1002177 3300025295 Bacteria 16470
397 Ga0209050_1004792 3300025298 Bacteria 8916
398 Ga0207426_1001904 3300025302 Bacteria 15119
399 Ga0209051_1016506 3300025303 Bacteria 3336
400 Ga0209257_1005496 3300025304 Bacteria 8855
401 Ga0207697_10013424 3300025315 Bacteria 3418
402 Ga0207656_10074393 3300025321 Bacteria 1516
403 Ga0207653_10000848 3300025885 Bacteria 10195
404 Ga0207682_10000056 3300025893 Bacteria 48265
405 Ga0207682_10002089 3300025893 Bacteria 9046
406 Ga0207692_10001234 3300025898 Bacteria 9495
407 Ga0207692_10011799 3300025898 Bacteria 3733
408 Ga0207692_10013842 3300025898 Bacteria 3510
409 Ga0207710_10004332 3300025900 Bacteria 6209
410 Ga0207710_10008537 3300025900 Bacteria 4319
411 Ga0207710_10049812 3300025900 Bacteria 1878
412 Ga0207688_10001105 3300025901 Bacteria 13845
413 Ga0207688_10014043 3300025901 Bacteria 4355
414 Ga0207688_10030510 3300025901 Bacteria 2973
415 Ga0207680_10030467 3300025903 Bacteria 3043
416 Ga0207680_10085902 3300025903 Bacteria 1988
417 Ga0207647_10014078 3300025904 Bacteria 5528
418 Ga0207647_10019467 3300025904 Bacteria 4564
419 Ga0207685_10014369 3300025905 Bacteria 2477
420 Ga0207699_10002060 3300025906 Bacteria 9495
421 Ga0207699_10269338 3300025906 Bacteria 1180
422 Ga0207645_10000249 3300025907 Bacteria 44921
423 Ga0207645_10031831 3300025907 Bacteria 3391
424 Ga0207645_10046288 3300025907 Bacteria 2779
425 Ga0207645_10095830 3300025907 Bacteria 1911
426 Ga0207643_10000187 3300025908 Bacteria 42567
427 Ga0207643_10000387 3300025908 Bacteria 29359
428 Ga0207705_10015260 3300025909 Bacteria 5516
429 Ga0207705_10369973 3300025909 Bacteria 1106
430 Ga0207684_10240569 3300025910 Bacteria 1561
431 Ga0207684_10451070 3300025910 Bacteria 1104
432 Ga0207654_10033440 3300025911 Bacteria 2851
433 Ga0207654_10322388 3300025911 Bacteria 1056
434 Ga0207707_10103617 3300025912 Bacteria 2487
435 Ga0207693_10001675 3300025915 Bacteria 19535
436 Ga0207693_10014672 3300025915 Bacteria 6295
437 Ga0207693_10018411 3300025915 Bacteria 5563
438 Ga0207693_10018746 3300025915 Bacteria 5507
439 Ga0207693_10084543 3300025915 Bacteria 2486
440 Ga0207693_10100120 3300025915 Bacteria 2272
441 Ga0207663_10037400 3300025916 Bacteria 2926
442 Ga0207663_10247647 3300025916 Bacteria 1310
443 Ga0207660_10000647 3300025917 Bacteria 23458
444 Ga0207660_10085564 3300025917 Bacteria 2326
445 Ga0207660_10219395 3300025917 Bacteria 1492
446 Ga0207662_10010233 3300025918 Bacteria 5173
447 Ga0207662_10033219 3300025918 Bacteria 3006
448 Ga0207662_10081076 3300025918 Bacteria 1981
449 Ga0207662_10108064 3300025918 Bacteria 1731
450 Ga0207657_10132608 3300025919 Bacteria 2041
451 Ga0207649_10123225 3300025920 Bacteria 1750
452 Ga0207649_10298348 3300025920 Bacteria 1177
453 Ga0207652_10030686 3300025921 Bacteria 4504
454 Ga0207652_10088661 3300025921 Bacteria 2715
455 Ga0207652_10177499 3300025921 Bacteria 1913
456 Ga0207652_10191465 3300025921 Bacteria 1840
457 Ga0207681_10064261 3300025923 Bacteria 2534
458 Ga0207681_10095713 3300025923 Bacteria 2130
459 Ga0207694_10016005 3300025924 Bacteria 5660
460 Ga0207650_10002475 3300025925 Bacteria 12841
461 Ga0207659_10001692 3300025926 Bacteria 13090
462 Ga0207659_10130622 3300025926 Bacteria 1938
463 Ga0207659_10138252 3300025926 Bacteria 1888
464 Ga0207687_10003004 3300025927 Bacteria 11441
465 Ga0207687_10012483 3300025927 Bacteria 5549
466 Ga0207687_10240762 3300025927 Bacteria 1434
467 Ga0207700_10000623 3300025928 Bacteria 20712
468 Ga0207700_10025105 3300025928 Bacteria 4134
469 Ga0207700_10205103 3300025928 Bacteria 1663
470 Ga0207664_10014641 3300025929 Bacteria 5672
471 Ga0207664_10073350 3300025929 Bacteria 2762
472 Ga0207664_10277010 3300025929 Bacteria 1471
473 Ga0207664_10531698 3300025929 Bacteria 1054
474 Ga0207644_10041278 3300025931 Bacteria 3263
475 Ga0207644_10045679 3300025931 Bacteria 3117
476 Ga0207690_10000546 3300025932 Bacteria 24592
477 Ga0207690_10290302 3300025932 Bacteria 1276
478 Ga0207706_10001175 3300025933 Bacteria 26500
479 Ga0207706_10003621 3300025933 Bacteria 14767
480 Ga0207706_10033074 3300025933 Bacteria 4603
481 Ga0207706_10034253 3300025933 Bacteria 4518
482 Ga0207686_10048630 3300025934 Bacteria 2628
483 Ga0207686_10082937 3300025934 Bacteria 2097
484 Ga0207709_10037740 3300025935 Bacteria 2872
485 Ga0207709_10056475 3300025935 Bacteria 2430
486 Ga0207670_10010169 3300025936 Bacteria 5408
487 Ga0207670_10020270 3300025936 Bacteria 4082
488 Ga0207670_10109304 3300025936 Bacteria 1989
489 Ga0207669_10000534 3300025937 Bacteria 16573
490 Ga0207669_10181459 3300025937 Bacteria 1509
491 Ga0207704_10002477 3300025938 Bacteria 8317
492 Ga0207704_10103140 3300025938 Bacteria 1907
493 Ga0207665_10001717 3300025939 Bacteria 14724
494 Ga0207665_10025158 3300025939 Bacteria 3927
495 Ga0207665_10152258 3300025939 Bacteria 1658
496 Ga0207665_10169870 3300025939 Bacteria 1574
497 Ga0207691_10001992 3300025940 Bacteria 19980
498 Ga0207691_10009096 3300025940 Bacteria 9533
499 Ga0207691_10036320 3300025940 Bacteria 4565
500 Ga0207711_10008662 3300025941 Bacteria 8508
501 Ga0207711_10019334 3300025941 Bacteria 5672
502 Ga0207711_10039618 3300025941 Bacteria 4009
503 Ga0207711_10095339 3300025941 Bacteria 2624
504 Ga0207711_10194867 3300025941 Bacteria 1848
505 Ga0207689_10000424 3300025942 Bacteria 39635
506 Ga0207689_10002173 3300025942 Bacteria 18432
507 Ga0207689_10010839 3300025942 Bacteria 7841
508 Ga0207689_10026402 3300025942 Bacteria 4862
509 Ga0207679_10000187 3300025945 Bacteria 49895
510 Ga0207667_10011279 3300025949 Bacteria 10393
511 Ga0207667_10023894 3300025949 Bacteria 6724
512 Ga0207651_10005649 3300025960 Bacteria 6448
513 Ga0207651_10013062 3300025960 Bacteria 4733
514 Ga0207651_10097459 3300025960 Bacteria 2171
515 Ga0207712_10001563 3300025961 Bacteria 15410
516 Ga0207712_10003253 3300025961 Bacteria 10309
517 Ga0207712_10015028 3300025961 Bacteria 4988
518 Ga0207712_10017851 3300025961 Bacteria 4616
519 Ga0207668_10000807 3300025972 Bacteria 19183
520 Ga0207640_10001794 3300025981 Bacteria 11532
521 Ga0207658_10015810 3300025986 Bacteria 5180
522 Ga0207658_10058657 3300025986 Bacteria 2865
523 Ga0207658_10491320 3300025986 Bacteria 1092
524 Ga0207677_10002480 3300026023 Bacteria 9685
525 Ga0207677_10008071 3300026023 Bacteria 5861
526 Ga0207677_10009309 3300026023 Bacteria 5524
527 Ga0207703_10059722 3300026035 Bacteria 3115
528 Ga0207639_10039012 3300026041 Bacteria 3537
529 Ga0207639_10230764 3300026041 Bacteria 1604
530 Ga0207639_10276707 3300026041 Bacteria 1475
531 Ga0207639_10485280 3300026041 Bacteria 1127
532 Ga0207678_10012666 3300026067 Bacteria 7411
533 Ga0207678_10021453 3300026067 Bacteria 5663
534 Ga0207678_10058216 3300026067 Bacteria 3325
535 Ga0207678_10505189 3300026067 Bacteria 1054
536 Ga0207708_10001458 3300026075 Bacteria 17696
537 Ga0207708_10001620 3300026075 Bacteria 16770
538 Ga0207702_10011282 3300026078 Bacteria 7448
539 Ga0207702_10067339 3300026078 Bacteria 3073
540 Ga0207702_10099674 3300026078 Bacteria 2561
541 Ga0207702_10170780 3300026078 Bacteria 1994
542 Ga0207702_10175935 3300026078 Bacteria 1967
543 Ga0207641_10001747 3300026088 Bacteria 20964
544 Ga0207641_10042162 3300026088 Bacteria 3827
545 Ga0207648_10006315 3300026089 Bacteria 11787
546 Ga0207648_10031587 3300026089 Bacteria 4682
547 Ga0207648_10099231 3300026089 Bacteria 2550
548 Ga0207648_10412078 3300026089 Bacteria 1226
549 Ga0207676_10005369 3300026095 Bacteria 9076
550 Ga0207676_10006683 3300026095 Bacteria 8159
551 Ga0207676_10028355 3300026095 Bacteria 4181
552 Ga0207676_10056234 3300026095 Bacteria 3092
553 Ga0207674_10008573 3300026116 Bacteria 11784
554 Ga0207674_10099023 3300026116 Bacteria 2898
555 Ga0207674_10120373 3300026116 Bacteria 2593
556 Ga0207674_10169960 3300026116 Bacteria 2134
557 Ga0207674_10174146 3300026116 Bacteria 2104
558 Ga0207675_100002650 3300026118 Bacteria 17661
559 Ga0207675_100029584 3300026118 Bacteria 5102
560 Ga0207675_100149945 3300026118 Bacteria 2219
561 Ga0207675_100301744 3300026118 Bacteria 1560
562 Ga0207675_100344747 3300026118 Bacteria 1459
563 Ga0207683_10000727 3300026121 Bacteria 29910
564 Ga0207683_10003304 3300026121 Bacteria 14057
565 Ga0207683_10006260 3300026121 Bacteria 10200
566 Ga0207683_10008669 3300026121 Bacteria 8695
567 Ga0207683_10024882 3300026121 Bacteria 5160
568 Ga0207698_10001591 3300026142 Bacteria 13231
569 Ga0209984_1004387 3300027424 Bacteria 1661
570 Ga0209999_1013478 3300027543 Bacteria 1482
571 Ga0210002_1000292 3300027617 Bacteria 6906
572 Ga0209983_1004894 3300027665 Bacteria 2798
573 Ga0209971_1010091 3300027682 Bacteria 2234
574 Ga0209966_1003324 3300027695 Bacteria 2703
575 Ga0207428_10000150 3300027907 Bacteria 94699
576 Ga0207428_10001312 3300027907 Bacteria 26468
577 Ga0268266_10028928 3300028379 Bacteria 4709
578 Ga0268266_10127675 3300028379 Bacteria 2271
579 Ga0268266_10474231 3300028379 Unclassified 1192
580 Ga0268265_10003058 3300028380 Bacteria 12198
581 Ga0268265_10021946 3300028380 Bacteria 4480
582 Ga0268265_10206229 3300028380 Bacteria 1709
583 Ga0268264_10003627 3300028381 Bacteria 13283
584 Ga0268264_10096728 3300028381 Bacteria 2558
585 Ga0268264_10409918 3300028381 Bacteria 1304
586 Ga0265318_10050700 3300028577 Bacteria 1559
587 Ga0265330_10132773 3300031235 Bacteria 1059
588 Ga0265332_10027965 3300031238 Bacteria 2469
589 Ga0265325_10003669 3300031241 Bacteria 9941
590 Ga0265325_10048000 3300031241 Bacteria 2208
591 Ga0265325_10057470 3300031241 Bacteria 1984
592 Ga0265329_10014152 3300031242 Bacteria 2821
593 Ga0265340_10020356 3300031247 Bacteria 3410
594 Ga0265331_10114966 3300031250 Bacteria 1232
595 Ga0265316_10062118 3300031344 Bacteria 2899
596 Ga0307513_10185900 3300031456 Bacteria 1935
597 Ga0265313_10000339 3300031595 Bacteria 50809
598 Ga0265313_10009086 3300031595 Bacteria 6501
599 Ga0265313_10019348 3300031595 Bacteria 3792
600 Ga0265313_10033359 3300031595 Bacteria 2617
601 Ga0265314_10011237 3300031711 Bacteria 7409
602 Ga0265314_10040172 3300031711 Bacteria 3360
603 Ga0265314_10119536 3300031711 Bacteria 1661
604 Ga0265342_10004131 3300031712 Bacteria 11554
605 Ga0265342_10037020 3300031712 Bacteria 2978
606 Ga0373930_0000047 3300034816 Bacteria 10984
607 Ga0373930_0006240 3300034816 Bacteria 2009
608 Ga0373930_0040994 3300034816 Bacteria 986
609 Ga0373948_0000024 3300034817 Bacteria 18497
610 Ga0373948_0005463 3300034817 Bacteria 2064
611 Ga0373950_0016164 3300034818 Bacteria 1274
612 Ga0373958_0000655 3300034819 Bacteria 4350
613 Ga0373958_0011872 3300034819 Unclassified 1481
614 Ga0373959_0013683 3300034820 Bacteria 1467
615 Ga0373938_0000288 3300034957 Bacteria 8090
616 Ga0373926_0006670 3300035083 Bacteria 3833
617 Ga0373926_0027700 3300035083 Unclassified 1987
618 Ga0373926_0035211 3300035083 Bacteria 1775
619 Ga0373928_0000269 3300035084 Bacteria 10306
620 Ga0373928_0002346 3300035084 Bacteria 3676
621 Ga0373934_0008776 3300035086 Bacteria 3776
622 Ga0373940_0000152 3300035088 Bacteria 9041
623 Ga0373940_0009981 3300035088 Bacteria 2221
624 Ga0373944_0000529 3300035089 Bacteria 8958
625 Ga0373944_0010817 3300035089 Unclassified 2493
626 Ga0373949_0000315 3300035090 Bacteria 17190
627 Ga0373949_0006098 3300035090 Bacteria 2668
628 Ga0373949_0012300 3300035090 Bacteria 1891
629 Ga0373951_0003234 3300035091 Bacteria 3984
630 Ga0373951_0038011 3300035091 Bacteria 1152
631 Ga0373952_0000084 3300035092 Bacteria 12547
632 Ga0373952_0001863 3300035092 Bacteria 3830
633 Ga0373952_0011890 3300035092 Bacteria 1704
634 Ga0373923_0003265 3300035111 Bacteria 5169
635 Ga0373923_0005474 3300035111 Bacteria 4312
636 Ga0373923_0018969 3300035111 Bacteria 2656
637 Ga0373923_0049207 3300035111 Bacteria 1762
638 Ga0373932_0001167 3300035112 Bacteria 7530
639 Ga0373936_0000722 3300035113 Bacteria 11534
640 Ga0373936_0072224 3300035113 Bacteria 1424
641 Ga0373936_0109845 3300035113 Bacteria 1170
642 Ga0373939_0001213 3300035114 Bacteria 6297
643 Ga0373939_0001845 3300035114 Bacteria 5086
644 Ga0373941_0000158 3300035115 Bacteria 12249
645 Ga0373941_0039953 3300035115 Bacteria 1444
646 Ga0373945_0002014 3300035116 Bacteria 6311
647 Ga0373945_0024203 3300035116 Bacteria 2102
648 Ga0373953_0004608 3300035117 Bacteria 4404
649 Ga0373953_0008792 3300035117 Bacteria 3444
650 Ga0373953_0049685 3300035117 Bacteria 1693
651 Ga0373954_0002688 3300035118 Bacteria 7483
652 Ga0373954_0018825 3300035118 Bacteria 3111
653 Ga0373954_0031726 3300035118 Bacteria 2440
654 Ga0373954_0050459 3300035118 Bacteria 1952
655 Ga0373956_0007670 3300035119 Bacteria 4349
656 Ga0373956_0031671 3300035119 Bacteria 2319
657 Ga0373956_0041589 3300035119 Bacteria 2041
658 Ga0373956_0072435 3300035119 Bacteria 1573
659 Ga0373957_0173682 3300035120 Bacteria 891
660 Ga0373943_0000757 3300035170 Bacteria 14076
661 Ga0373943_0011141 3300035170 Bacteria 4041
662 Ga0373943_0013910 3300035170 Bacteria 3638
663 Ga0373943_0045843 3300035170 Bacteria 2132
664 Ga0373943_0099946 3300035170 Bacteria 1515
665 Ga0373946_0031860 3300035171 Unclassified 2114
666 Ga0373946_0034850 3300035171 Bacteria 2034
667 Ga0373946_0104575 3300035171 Bacteria 1273
668 Ga0373955_0000713 3300035172 Bacteria 14339
669 Ga0373955_0003253 3300035172 Bacteria 7119
670 Ga0373955_0010615 3300035172 Bacteria 4356
671 Ga0373955_0095658 3300035172 Bacteria 1699
672 Ga0373961_0000464 3300035241 Bacteria 16037
673 Ga0373961_0016441 3300035241 Bacteria 1906
674 Ga0373962_0003173 3300035242 Bacteria 3942
675 Ga0373962_0007894 3300035242 Bacteria 2611
676 Ga0373924_0010553 3300035410 Bacteria 3411
677 Ga0373924_0022450 3300035410 Bacteria 2467
678 Ga0373931_0000291 3300035691 Bacteria 21048
679 Ga0373931_0001643 3300035691 Bacteria 9670
680 Ga0373931_0007687 3300035691 Bacteria 5088
681 Ga0373931_0136848 3300035691 Bacteria 1415
682 Ga0373935_0001165 3300035692 Bacteria 14434
683 Ga0373935_0030524 3300035692 Bacteria 3341
684 Ga0373935_0056027 3300035692 Unclassified 2512
685 Ga0373935_0093851 3300035692 Bacteria 1968
686 Ga0373935_0101292 3300035692 Bacteria 1899
687 Ga0373935_0157303 3300035692 Bacteria 1546
688 Ga0373935_0285164 3300035692 Bacteria 1163
689 Ga0373927_0001051 3300035695 Bacteria 21045
690 Ga0373927_0002713 3300035695 Bacteria 12913
691 Ga0373927_0026537 3300035695 Bacteria 3786
692 Ga0373927_0041094 3300035695 Bacteria 2999
693 Ga0373927_0062052 3300035695 Bacteria 2417
694 Ga0373927_0210020 3300035695 Bacteria 1278
695 Ga0373933_0005438 3300035724 Bacteria 6934
696 Ga0373933_0016565 3300035724 Bacteria 4124
697 Ga0373947_0006809 3300035725 Bacteria 6629
698 Ga0373947_0013134 3300035725 Bacteria 4748
699 Ga0373947_0014697 3300035725 Bacteria 4490
700 Ga0373947_0054394 3300035725 Bacteria 2415
701 Ga0373947_0061602 3300035725 Bacteria 2281
702 Ga0373947_0201078 3300035725 Bacteria 1303
703 Ga0373937_0002067 3300036401 Bacteria 16792
704 Ga0373937_0003621 3300036401 Bacteria 13032
705 Ga0373937_0144123 3300036401 Bacteria 2229
706 Ga0373937_0233721 3300036401 Bacteria 1731
707 Ga0373925_0000249 3300037068 Bacteria 57266
708 Ga0373925_0001925 3300037068 Bacteria 17184
709 Ga0373925_0096181 3300037068 Bacteria 2269
710 Ga0373925_0182855 3300037068 Bacteria 1660
711 Ga0373925_0439238 3300037068 Bacteria 1068
712 Ga0395899_0014008 3300037312 Bacteria 6122
713 Ga0395899_0084987 3300037312 Bacteria 2300
714 Ga0395900_0046094 3300037418 Bacteria 4489
715 Ga0395900_0295055 3300037418 Bacteria 1609
716 Ga0395898_0145754 3300037466 Bacteria 2266
717 Ga0395905_0110725 3300037471 Bacteria 2579
718 Ga0436364_1422653 3300037853 Bacteria 850
719 Ga0395901_0097273 3300038443 Bacteria 3085
720 Ga0242420_000772 3300038996 Bacteria 3880
721 Ga0436365_0330093 3300039437 Bacteria 5700
722 Ga0436365_0397707 3300039437 Bacteria 1915
723 Ga0436365_0794950 3300039437 Bacteria 10697
724 Ga0436365_0861956 3300039437 Bacteria 2208
725 Ga0436365_1923592 3300039437 Bacteria 1130
726 Ga0436360_0500596 3300039438 Bacteria 2081
727 Ga0436361_0327070 3300039447 Bacteria 11104
728 Ga0436361_0474885 3300039447 Bacteria 5686
729 Ga0436361_0492112 3300039447 Bacteria 6024
730 Ga0436363_1120598 3300039450 Bacteria 976
731 Ga0436363_1294531 3300039450 Bacteria 2769
732 Ga0439441_002555 3300042001 Bacteria 2580
733 Ga0439448_0031169 3300042005 Bacteria 1693
734 Ga0439435_0041639 3300042436 Bacteria 1287
735 Ga0439460_0045021 3300042461 Bacteria 1308
736 Ga0451577_0255522 3300042876 Bacteria 1586
737 Ga0439440_0008383 3300042993 Bacteria 2121
738 Ga0466963_0014372 3300044694 Bacteria 4881
739 Ga0466963_0100809 3300044694 Bacteria 1976
740 Ga0453684_0080311 3300044712 Bacteria 4073
741 Ga0466957_0017880 3300044842 Bacteria 4159
742 Ga0466957_0203949 3300044842 Bacteria 1300
743 Ga0466959_0316392 3300045049 Bacteria 1067
744 Ga0495592_0000022 3300046454 Bacteria 137550
745 Ga0495592_0008608 3300046454 Bacteria 7657
746 Ga0495592_0011867 3300046454 Bacteria 6602
747 Ga0495592_0013017 3300046454 Bacteria 6329
748 Ga0495592_0161415 3300046454 Bacteria 1542
749 Ga0495603_0033766 3300046455 Bacteria 3078
750 Ga0495603_0047555 3300046455 Bacteria 2554
751 Ga0495603_0051826 3300046455 Bacteria 2437
752 Ga0495603_0193777 3300046455 Bacteria 1175
753 Ga0495629_0000026 3300046459 Bacteria 134719
754 Ga0495629_0000409 3300046459 Bacteria 35959
755 Ga0495629_0012401 3300046459 Bacteria 6172
756 Ga0495638_0025735 3300046460 Bacteria 3820
757 Ga0495641_0017376 3300046461 Bacteria 3750
758 Ga0495651_0001051 3300046462 Bacteria 21350
759 Ga0495651_0001548 3300046462 Bacteria 17781
760 Ga0495651_0013614 3300046462 Bacteria 6288
761 Ga0495651_0017121 3300046462 Bacteria 5616
762 Ga0495651_0137371 3300046462 Bacteria 1777
763 Ga0495653_0000055 3300046463 Bacteria 102186
764 Ga0495653_0009787 3300046463 Bacteria 7838
765 Ga0495653_0012003 3300046463 Bacteria 7073
766 Ga0495653_0018050 3300046463 Bacteria 5737
767 Ga0495653_0051356 3300046463 Bacteria 3166
768 Ga0495580_0006887 3300046472 Bacteria 9181
769 Ga0495580_0025051 3300046472 Bacteria 4362
770 Ga0495580_0061749 3300046472 Bacteria 2630
771 Ga0495582_0006073 3300046473 Bacteria 6730
772 Ga0495582_0013298 3300046473 Bacteria 4531
773 Ga0495582_0052396 3300046473 Bacteria 2250
774 Ga0495605_0129073 3300046474 Bacteria 1141
775 Ga0495639_0042911 3300046475 Bacteria 2041
776 Ga0495639_0069063 3300046475 Bacteria 1629
777 Ga0495639_0095392 3300046475 Bacteria 1399
778 Ga0495662_0001894 3300046476 Bacteria 10495
779 Ga0495662_0003150 3300046476 Bacteria 8321
780 Ga0495662_0009265 3300046476 Bacteria 4829
781 Ga0495662_0010784 3300046476 Bacteria 4468
782 Ga0495662_0056662 3300046476 Bacteria 1893
783 Ga0495662_0079271 3300046476 Bacteria 1596
784 Ga0495664_0000006 3300046477 Bacteria 407031
785 Ga0495664_0005906 3300046477 Bacteria 6737
786 Ga0495664_0007402 3300046477 Bacteria 6096
787 Ga0495664_0072871 3300046477 Bacteria 2053
788 Ga0495584_0058837 3300046491 Bacteria 1933
789 Ga0495585_0049171 3300046492 Bacteria 2342
790 Ga0495594_0012401 3300046499 Bacteria 4439
791 Ga0495594_0019299 3300046499 Bacteria 3621
792 Ga0495594_0085576 3300046499 Bacteria 1763
793 Ga0495607_0010403 3300046501 Bacteria 6256
794 Ga0495607_0056603 3300046501 Bacteria 2251
795 Ga0495608_0000002 3300046511 Bacteria 376403
796 Ga0495608_0006088 3300046511 Bacteria 8560
797 Ga0495608_0006648 3300046511 Bacteria 8205
798 Ga0495618_0000001 3300046514 Bacteria 282202
799 Ga0495618_0002201 3300046514 Bacteria 12750
800 Ga0495618_0059037 3300046514 Bacteria 2430
801 Ga0495628_0000004 3300046516 Bacteria 462184
802 Ga0495628_0021376 3300046516 Bacteria 5323
803 Ga0495628_0042157 3300046516 Bacteria 3641
804 Ga0495630_0003468 3300046517 Bacteria 10958
805 Ga0495630_0011056 3300046517 Bacteria 6530
806 Ga0495630_0064058 3300046517 Bacteria 2761
807 Ga0495630_0128836 3300046517 Bacteria 1921
808 Ga0495630_0184910 3300046517 Bacteria 1589
809 Ga0495630_0190911 3300046517 Bacteria 1563
810 Ga0495630_0464088 3300046517 Bacteria 970
811 Ga0495637_0080842 3300046520 Bacteria 1296
812 Ga0495643_0062720 3300046522 Bacteria 1967
813 Ga0495644_0000312 3300046523 Bacteria 22452
814 Ga0495663_0058803 3300046525 Bacteria 1205
815 Ga0495666_0009011 3300046526 Bacteria 4990
816 Ga0495666_0012241 3300046526 Bacteria 4278
817 Ga0495666_0019754 3300046526 Bacteria 3340
818 Ga0495652_0000007 3300046529 Bacteria 418163
819 Ga0495652_0030506 3300046529 Bacteria 4727
820 Ga0495652_0049908 3300046529 Bacteria 3580
821 Ga0495652_0088050 3300046529 Bacteria 2545
822 Ga0495652_0221580 3300046529 Bacteria 1421
823 Ga0495665_0008576 3300046531 Bacteria 5546
824 Ga0495665_0009133 3300046531 Bacteria 5374
825 Ga0495665_0059593 3300046531 Bacteria 2015
826 Ga0495665_0159736 3300046531 Bacteria 1175
827 Ga0495640_0000004 3300046533 Bacteria 357515
828 Ga0495640_0007732 3300046533 Bacteria 8454
829 Ga0495640_0017299 3300046533 Bacteria 5375
830 Ga0495640_0121865 3300046533 Bacteria 1694
831 Ga0495586_0023372 3300046535 Bacteria 3301
832 Ga0495586_0029905 3300046535 Bacteria 2916
833 Ga0495587_0000002 3300046536 Bacteria 425485
834 Ga0495587_0002925 3300046536 Bacteria 11432
835 Ga0495587_0005039 3300046536 Bacteria 8644
836 Ga0495587_0020800 3300046536 Bacteria 4047
837 Ga0495587_0025016 3300046536 Bacteria 3652
838 Ga0495598_0046597 3300046537 Bacteria 1289
839 Ga0495609_0027480 3300046538 Bacteria 2600
840 Ga0495609_0033690 3300046538 Bacteria 2325
841 Ga0495645_0000008 3300046543 Bacteria 331530
842 Ga0495645_0003668 3300046543 Bacteria 10430
843 Ga0495645_0021226 3300046543 Bacteria 4693
844 Ga0495645_0054915 3300046543 Bacteria 2893
845 Ga0495633_0001295 3300046558 Bacteria 19775
846 Ga0495667_0000006 3300046559 Bacteria 257523
847 Ga0495667_0002953 3300046559 Bacteria 11410
848 Ga0495667_0003478 3300046559 Bacteria 10553
849 Ga0495667_0007034 3300046559 Bacteria 7635
850 Ga0495667_0039564 3300046559 Bacteria 3135
851 Ga0495667_0128741 3300046559 Bacteria 1633
852 Ga0495656_0000522 3300046615 Bacteria 12534
853 Ga0495634_0000001 3300046642 Bacteria 303746
854 Ga0495634_0015929 3300046642 Bacteria 5384
855 Ga0495634_0023747 3300046642 Bacteria 4308
856 Ga0495634_0040721 3300046642 Bacteria 3157
857 Ga0495611_0013926 3300046648 Bacteria 3431
858 Ga0495635_0000004 3300046663 Bacteria 388068
859 Ga0495635_0000123 3300046663 Bacteria 47100
860 Ga0495635_0011422 3300046663 Bacteria 6229
861 Ga0495635_0016155 3300046663 Bacteria 5212
862 Ga0495635_0017382 3300046663 Bacteria 5024
863 Ga0495635_0028200 3300046663 Bacteria 3902
864 Ga0495635_0117984 3300046663 Bacteria 1811
865 Ga0495635_0124318 3300046663 Bacteria 1759
866 Ga0495659_0032781 3300046664 Bacteria 1820
867 Ga0495659_0068501 3300046664 Bacteria 1325
868 Ga0495659_0077831 3300046664 Unclassified 1253
869 Ga0495588_0009872 3300046674 Bacteria 4425
870 Ga0495588_0031902 3300046674 Bacteria 2654
871 Ga0495657_0000139 3300046675 Bacteria 65385
872 Ga0495657_0009876 3300046675 Bacteria 7202
873 Ga0495657_0053038 3300046675 Bacteria 2715
874 Ga0495599_0000003 3300046678 Bacteria 319085
875 Ga0495599_0010016 3300046678 Bacteria 5803
876 Ga0495599_0117601 3300046678 Bacteria 1653
877 Ga0495599_0156758 3300046678 Bacteria 1408
878 Ga0495623_0000048 3300046679 Bacteria 73714
879 Ga0495623_0002450 3300046679 Bacteria 12303
880 Ga0495646_0000001 3300046680 Bacteria 403396
881 Ga0495646_0006974 3300046680 Bacteria 7175
882 Ga0495646_0017298 3300046680 Bacteria 4573
883 Ga0495646_0060709 3300046680 Bacteria 2253
884 Ga0495647_0012751 3300046681 Bacteria 2899
885 Ga0495647_0032742 3300046681 Unclassified 1939
886 Ga0495658_0004396 3300046683 Bacteria 6940
887 Ga0495658_0031443 3300046683 Bacteria 2891
888 Ga0495658_0036565 3300046683 Bacteria 2710
889 Ga0495658_0042330 3300046683 Bacteria 2542
890 Ga0495658_0135233 3300046683 Bacteria 1504
891 Ga0495669_0031031 3300046684 Bacteria 2346
892 Ga0495613_0003849 3300046689 Bacteria 11230
893 Ga0495613_0011297 3300046689 Bacteria 6634
894 Ga0495613_0031905 3300046689 Bacteria 3913
895 Ga0495613_0061800 3300046689 Bacteria 2742
896 Ga0495624_0002831 3300046690 Bacteria 12987
897 Ga0495624_0007113 3300046690 Bacteria 7874
898 Ga0495624_0016426 3300046690 Bacteria 4982
899 Ga0495624_0032056 3300046690 Bacteria 3410
900 Ga0495624_0098731 3300046690 Bacteria 1798
901 Ga0495670_0000701 3300046691 Bacteria 15976
902 Ga0495670_0149171 3300046691 Bacteria 1226
903 Ga0495649_0052194 3300046694 Bacteria 2216
904 Ga0495600_0000083 3300046809 Bacteria 52058
905 Ga0495600_0003659 3300046809 Bacteria 9072
906 Ga0495600_0008685 3300046809 Bacteria 6251
907 Ga0495600_0016229 3300046809 Bacteria 4722
908 Ga0495600_0194031 3300046809 Bacteria 1305
909 Ga0495581_0003328 3300047315 Bacteria 9232
910 Ga0495581_0030379 3300047315 Bacteria 3131
911 Ga0495581_0052466 3300047315 Unclassified 2355
912 Ga0495581_0071628 3300047315 Bacteria 2005
913 Ga0495581_0092475 3300047315 Bacteria 1756
914 Ga0495604_0000003 3300047317 Bacteria 464246
915 Ga0495604_0001090 3300047317 Bacteria 22540
916 Ga0495604_0009839 3300047317 Bacteria 7565
917 Ga0495604_0012255 3300047317 Bacteria 6816
918 Ga0495604_0096576 3300047317 Bacteria 2180
919 Ga0495674_0000006 3300047319 Bacteria 341772
920 Ga0495674_0003125 3300047319 Bacteria 16088
921 Ga0495674_0003227 3300047319 Bacteria 15826
922 Ga0495674_0011118 3300047319 Bacteria 8498
923 Ga0495674_0077789 3300047319 Bacteria 2851
924 Ga0495676_0052656 3300047321 Bacteria 3247
925 Ga0495676_0124665 3300047321 Bacteria 1868
926 Ga0495676_0222156 3300047321 Unclassified 1301
927 Ga0495680_0000795 3300047322 Bacteria 35314
928 Ga0495680_0000825 3300047322 Bacteria 34510
929 Ga0495680_0002001 3300047322 Bacteria 21392
930 Ga0495680_0037655 3300047322 Bacteria 3873
931 Ga0495680_0042963 3300047322 Bacteria 3583
932 Ga0495680_0087177 3300047322 Bacteria 2348
933 Ga0495683_0144629 3300047323 Bacteria 1112
934 Ga0495675_0000109 3300047444 Bacteria 59153
935 Ga0495675_0004145 3300047444 Bacteria 8773
936 Ga0495675_0018767 3300047444 Bacteria 4393
937 Ga0495684_0000003 3300047471 Bacteria 331335
938 Ga0495684_0005001 3300047471 Bacteria 10343
939 Ga0495684_0005490 3300047471 Bacteria 9867
940 Ga0495684_0251615 3300047471 Bacteria 1285
941 Ga0495593_0000767 3300047673 Bacteria 18655
942 Ga0495593_0015854 3300047673 Bacteria 4258
943 Ga0495593_0023159 3300047673 Bacteria 3454
944 Ga0495602_0000011 3300048088 Bacteria 212024
945 Ga0495602_0001877 3300048088 Bacteria 21025
946 Ga0495602_0010500 3300048088 Bacteria 9612
947 Ga0495602_0065204 3300048088 Bacteria 3144
948 Ga0495602_0297384 3300048088 Bacteria 1182
949 Ga0495614_0024177 3300048089 Bacteria 2623
950 Ga0495614_0058038 3300048089 Bacteria 1662
951 Ga0496100_0002097 3300048903 Bacteria 10039
952 Ga0496100_0006356 3300048903 Bacteria 6437
953 Ga0496100_0025496 3300048903 Bacteria 3617
954 Ga0496100_0037227 3300048903 Bacteria 3074
955 Ga0496100_0067752 3300048903 Bacteria 2371
956 Ga0496101_0001573 3300048904 Bacteria 13684
957 Ga0496101_0003612 3300048904 Bacteria 9651
958 Ga0496101_0006966 3300048904 Bacteria 7300
959 Ga0496101_0084085 3300048904 Bacteria 2356
960 Ga0496102_0002596 3300048905 Bacteria 15421
961 Ga0496102_0014548 3300048905 Bacteria 6837
962 Ga0496102_0016207 3300048905 Bacteria 6512
963 Ga0496102_0203036 3300048905 Bacteria 1868
964 Ga0496102_0223176 3300048905 Bacteria 1777
965 Ga0496102_0337506 3300048905 Bacteria 1419
966 Ga0496103_0000963 3300048906 Bacteria 20444
967 Ga0496103_0012426 3300048906 Bacteria 5049
968 Ga0496104_0001393 3300048907 Bacteria 20913
969 Ga0496104_0003080 3300048907 Bacteria 14372
970 Ga0496104_0008002 3300048907 Bacteria 9374
971 Ga0496104_0017091 3300048907 Bacteria 6601
972 Ga0496104_0053582 3300048907 Bacteria 3812
973 Ga0496104_0057914 3300048907 Bacteria 3667
974 Ga0496104_0060617 3300048907 Bacteria 3584
975 Ga0496104_0196139 3300048907 Bacteria 1931
976 Ga0496104_0208634 3300048907 Bacteria 1865
977 Ga0496104_0233050 3300048907 Bacteria 1753
978 Ga0496105_0006839 3300048908 Bacteria 8772
979 Ga0496105_0016436 3300048908 Bacteria 5910
980 Ga0496105_0017193 3300048908 Bacteria 5792
981 Ga0496105_0020989 3300048908 Bacteria 5282
982 Ga0496105_0042813 3300048908 Bacteria 3733
983 Ga0496105_0057934 3300048908 Bacteria 3198
984 Ga0496105_0061855 3300048908 Bacteria 3089
985 Ga0496106_0006418 3300048909 Bacteria 8708
986 Ga0496106_0007022 3300048909 Bacteria 8315
987 Ga0496106_0008577 3300048909 Bacteria 7563
988 Ga0496106_0010388 3300048909 Bacteria 6878
989 Ga0496106_0049674 3300048909 Bacteria 3160
990 Ga0496106_0052883 3300048909 Bacteria 3065
991 Ga0496106_0068739 3300048909 Bacteria 2702
992 Ga0496106_0106989 3300048909 Bacteria 2175
993 Ga0496106_0296987 3300048909 Bacteria 1295
994 Ga0496106_0497504 3300048909 Bacteria 979
995 Ga0496107_0004013 3300048910 Bacteria 9911
996 Ga0496107_0012549 3300048910 Bacteria 5916
997 Ga0496107_0023797 3300048910 Bacteria 4330
998 Ga0496107_0031391 3300048910 Bacteria 3790
999 Ga0496108_0000626 3300048911 Bacteria 27644
1000 Ga0496108_0001093 3300048911 Bacteria 21176
1001 Ga0496108_0010782 3300048911 Bacteria 7418
1002 Ga0496108_0014245 3300048911 Bacteria 6489
1003 Ga0496108_0017276 3300048911 Bacteria 5901
1004 Ga0496108_0080063 3300048911 Bacteria 2766
1005 Ga0496108_0110276 3300048911 Bacteria 2352
1006 Ga0496108_0193092 3300048911 Bacteria 1765
1007 Ga0496109_0001690 3300048912 Bacteria 18382
1008 Ga0496109_0002491 3300048912 Bacteria 15432
1009 Ga0496109_0002725 3300048912 Bacteria 14810
1010 Ga0496109_0028465 3300048912 Bacteria 4997
1011 Ga0496109_0045631 3300048912 Bacteria 3977
1012 Ga0496109_0093967 3300048912 Bacteria 2775
1013 Ga0496109_0110973 3300048912 Bacteria 2550
1014 Ga0496109_0428696 3300048912 Bacteria 1249
1015 Ga0496110_0005926 3300048913 Bacteria 9616
1016 Ga0496110_0009277 3300048913 Bacteria 7957
1017 Ga0496110_0009396 3300048913 Bacteria 7916
1018 Ga0496110_0126494 3300048913 Bacteria 2306
1019 Ga0496110_0553494 3300048913 Unclassified 1045
1020 Ga0496111_0002392 3300048914 Bacteria 11308
1021 Ga0496111_0010978 3300048914 Bacteria 6093
1022 Ga0496111_0014108 3300048914 Bacteria 5450
1023 Ga0496111_0020330 3300048914 Bacteria 4621
1024 Ga0496111_0022206 3300048914 Bacteria 4439
1025 Ga0496111_0032758 3300048914 Bacteria 3705
1026 Ga0496111_0158501 3300048914 Bacteria 1680
1027 Ga0496111_0327728 3300048914 Bacteria 1134
1028 Ga0496112_0002087 3300048915 Bacteria 15846
1029 Ga0496112_0006295 3300048915 Bacteria 10413
1030 Ga0496112_0009904 3300048915 Bacteria 8618
1031 Ga0496112_0013016 3300048915 Bacteria 7671
1032 Ga0496112_0035200 3300048915 Bacteria 4875
1033 Ga0496112_0088433 3300048915 Bacteria 3066
1034 Ga0496112_0103374 3300048915 Bacteria 2819
1035 Ga0496113_0000329 3300048916 Bacteria 22567
1036 Ga0496113_0000855 3300048916 Bacteria 15935
1037 Ga0496113_0007129 3300048916 Bacteria 7160
1038 Ga0496113_0023131 3300048916 Bacteria 4404
1039 Ga0496113_0034534 3300048916 Bacteria 3690
1040 Ga0496113_0069969 3300048916 Bacteria 2666
1041 Ga0496113_0177889 3300048916 Bacteria 1686
1042 Ga0496114_0001660 3300048917 Bacteria 16874
1043 Ga0496114_0048532 3300048917 Bacteria 3531
1044 Ga0496114_0158674 3300048917 Bacteria 1965
1045 Ga0496114_0166607 3300048917 Bacteria 1918
1046 Ga0496115_0001117 3300048918 Bacteria 19364
1047 Ga0496115_0115007 3300048918 Bacteria 2212
1048 Ga0496115_0119922 3300048918 Bacteria 2164
1049 Ga0496115_0152187 3300048918 Bacteria 1910
1050 Ga0496115_0228020 3300048918 Bacteria 1536
1051 Ga0496115_0278007 3300048918 Bacteria 1375
1052 Ga0496122_0048492 3300048925 Bacteria 3264
1053 Ga0496125_0122443 3300048928 Bacteria 1851
1054 Ga0496125_0137958 3300048928 Bacteria 1702
1055 Ga0496126_0372965 3300048929 Bacteria 1163
1056 Ga0501031_0077351 3300049568 Bacteria 2167
1057 Ga0501032_0033654 3300049569 Bacteria 3510
1058 Ga0501032_0079696 3300049569 Bacteria 2180
1059 Ga0501032_0114952 3300049569 Bacteria 1779
1060 Ga0501033_0042229 3300049570 Bacteria 3400
1061 Ga0501033_0050428 3300049570 Bacteria 3087
1062 Ga0501033_0082791 3300049570 Bacteria 2352
1063 Ga0501034_0000772 3300049571 Bacteria 47902
1064 Ga0501034_0019501 3300049571 Bacteria 6936
1065 Ga0501034_0031173 3300049571 Bacteria 5418
1066 Ga0501034_0142240 3300049571 Bacteria 2378
1067 Ga0501034_0156132 3300049571 Bacteria 2255
1068 Ga0501034_0350334 3300049571 Bacteria 1405
1069 Ga0501036_0001347 3300049572 Bacteria 18840
1070 Ga0501036_0005113 3300049572 Bacteria 10604
1071 Ga0501036_0005897 3300049572 Bacteria 9927
1072 Ga0501036_0012992 3300049572 Bacteria 6914
1073 Ga0501036_0203394 3300049572 Bacteria 1665
1074 Ga0501037_0006285 3300049573 Bacteria 8687
1075 Ga0501037_0008680 3300049573 Bacteria 7451
1076 Ga0501037_0025041 3300049573 Bacteria 4410
1077 Ga0501037_0131572 3300049573 Bacteria 1794
1078 Ga0501038_0026586 3300049574 Bacteria 5154
1079 Ga0501038_0076017 3300049574 Bacteria 2837
1080 Ga0501038_0121374 3300049574 Bacteria 2154
1081 Ga0501039_0009445 3300049575 Bacteria 7435
1082 Ga0501039_0050088 3300049575 Bacteria 3230
1083 Ga0501039_0066960 3300049575 Bacteria 2789
1084 Ga0501039_0338611 3300049575 Bacteria 1182
1085 Ga0501039_0473926 3300049575 Bacteria 983
1086 Ga0501040_0224358 3300049576 Bacteria 1337
1087 Ga0501040_0375304 3300049576 Bacteria 1020
1088 Ga0501042_0292404 3300049578 Bacteria 1177
1089 Ga0501043_0006610 3300049579 Bacteria 9284
1090 Ga0501043_0035066 3300049579 Bacteria 3946
1091 Ga0501043_0372910 3300049579 Bacteria 1081
1092 Ga0501046_0028930 3300049580 Bacteria 4509
1093 Ga0501046_0029341 3300049580 Bacteria 4472
1094 Ga0501046_0031961 3300049580 Bacteria 4264
1095 Ga0501046_0079870 3300049580 Bacteria 2528
1096 Ga0501046_0165265 3300049580 Bacteria 1663
1097 Ga0501046_0255618 3300049580 Bacteria 1288
1098 Ga0501047_0000136 3300049581 Bacteria 89236
1099 Ga0501047_0007923 3300049581 Bacteria 10016
1100 Ga0501047_0089349 3300049581 Bacteria 2958
1101 Ga0501047_0093053 3300049581 Bacteria 2893
1102 Ga0501047_0108462 3300049581 Bacteria 2659
1103 Ga0501047_0324647 3300049581 Bacteria 1378
1104 Ga0501048_0000039 3300049582 Bacteria 63521
1105 Ga0501048_0014119 3300049582 Bacteria 5919
1106 Ga0501048_0072602 3300049582 Bacteria 2429
1107 Ga0501067_0019377 3300049583 Bacteria 3765
1108 Ga0501068_0019636 3300049584 Bacteria 3927
1109 Ga0501068_0053873 3300049584 Bacteria 2436
1110 Ga0501068_0058714 3300049584 Bacteria 2335
1111 Ga0501070_0048115 3300049586 Bacteria 3542
1112 Ga0501070_0064092 3300049586 Bacteria 3044
1113 Ga0501070_0071174 3300049586 Bacteria 2879
1114 Ga0501071_0266777 3300049587 Bacteria 1294
1115 Ga0501072_0000783 3300049588 Bacteria 23295
1116 Ga0501072_0041737 3300049588 Bacteria 3604
1117 Ga0501072_0140764 3300049588 Bacteria 1923
1118 Ga0501072_0159006 3300049588 Bacteria 1802
1119 Ga0501072_0167232 3300049588 Unclassified 1754
1120 Ga0501072_0299083 3300049588 Bacteria 1279
1121 Ga0501073_0007504 3300049589 Bacteria 8100
1122 Ga0501073_0072356 3300049589 Bacteria 2401
1123 Ga0501073_0363455 3300049589 Bacteria 999
1124 Ga0501073_0439073 3300049589 Bacteria 902
1125 Ga0501074_0011889 3300049590 Bacteria 6329
1126 Ga0501074_0034926 3300049590 Bacteria 3643
1127 Ga0501075_0010046 3300049591 Bacteria 6640
1128 Ga0501075_0028210 3300049591 Bacteria 4142
1129 Ga0501075_0104823 3300049591 Bacteria 2149
1130 Ga0501076_0003117 3300049592 Bacteria 11548
1131 Ga0501076_0027114 3300049592 Bacteria 4444
1132 Ga0501076_0048362 3300049592 Bacteria 3362
1133 Ga0501077_0013675 3300049593 Bacteria 5087
1134 Ga0501077_0038213 3300049593 Bacteria 3056
1135 Ga0501077_0046503 3300049593 Bacteria 2757
1136 Ga0501077_0116468 3300049593 Bacteria 1693
1137 Ga0501079_0008450 3300049741 Bacteria 7805
1138 Ga0501079_0045576 3300049741 Bacteria 3384
1139 Ga0501079_0046472 3300049741 Bacteria 3350
1140 Ga0501079_0074600 3300049741 Bacteria 2622
1141 Ga0501079_0173682 3300049741 Bacteria 1680
1142 Ga0501079_0242161 3300049741 Bacteria 1409
1143 Ga0501080_0000022 3300049742 Bacteria 90630
1144 Ga0501080_0028092 3300049742 Bacteria 5230
1145 Ga0501080_0058994 3300049742 Bacteria 3571
1146 Ga0501080_0118905 3300049742 Bacteria 2450
1147 Ga0501080_0183106 3300049742 Unclassified 1927
1148 Ga0501081_0005161 3300049743 Bacteria 8411
1149 Ga0501081_0022554 3300049743 Bacteria 4213
1150 Ga0501081_0200957 3300049743 Bacteria 1445
1151 Ga0501083_0009158 3300049744 Bacteria 6994
1152 Ga0501083_0031756 3300049744 Bacteria 3624
1153 Ga0501083_0058740 3300049744 Bacteria 2573
1154 Ga0501083_0080094 3300049744 Bacteria 2166
1155 Ga0501083_0136140 3300049744 Bacteria 1609
1156 Ga0501083_0252565 3300049744 Bacteria 1148
1157 Ga0501035_0038898 3300049822 Bacteria 4307
1158 Ga0501035_0039580 3300049822 Bacteria 4265
1159 Ga0501035_0067613 3300049822 Bacteria 3170
1160 Ga0501035_0205427 3300049822 Bacteria 1688
1161 Ga0501035_0256786 3300049822 Bacteria 1483
1162 Ga0501044_0005112 3300049823 Bacteria 14631
1163 Ga0501044_0005747 3300049823 Bacteria 13731
1164 Ga0501044_0037235 3300049823 Bacteria 5086
1165 Ga0501044_0051391 3300049823 Bacteria 4250
1166 Ga0501044_0057707 3300049823 Bacteria 3983
1167 Ga0501044_0133556 3300049823 Bacteria 2474
1168 Ga0501045_0022917 3300049824 Bacteria 4473
1169 Ga0501045_0076811 3300049824 Bacteria 2461
1170 Ga0501045_0199719 3300049824 Bacteria 1490
1171 nmdc:mga00v17_13334_c1 3300050491 Bacteria 4560
1172 nmdc:mga0k408_7417_c1 3300050493 Bacteria 5855
1173 nmdc:mga06z11_17026_c1 3300050494 Bacteria 3289
1174 nmdc:mga06z11_259108_c1 3300050494 Bacteria 1026
1175 nmdc:mga05p37_16217_c1 3300050507 Bacteria 8969
1176 nmdc:mga05p37_248326_c1 3300050507 Bacteria 2136
1177 nmdc:mga05p37_35915_c1 3300050507 Bacteria 6081
1178 nmdc:mga05p37_5080_c1 3300050507 Bacteria 15430
1179 nmdc:mga09592_9145_c1 3300050508 Bacteria 7115
1180 nmdc:mga0qj67_113891_c1 3300050509 Bacteria 2184
1181 nmdc:mga0qj67_4_c1 3300050509 Bacteria 176711
1182 nmdc:mga06r32_72029_c1 3300050510 Bacteria 3346
1183 nmdc:mga08y16_1115_c1 3300050511 Bacteria 26487
1184 nmdc:mga08y16_146103_c1 3300050511 Bacteria 2458
1185 nmdc:mga08y16_279183_c1 3300050511 Bacteria 1723
1186 nmdc:mga08y16_335349_c1 3300050511 Bacteria 1555
1187 nmdc:mga08y16_58759_c1 3300050511 Bacteria 4018
1188 nmdc:mga08y16_940_c1 3300050511 Bacteria 28306
1189 nmdc:mga0n895_13630_c1 3300050512 Bacteria 7346
1190 nmdc:mga0n895_580510_c1 3300050512 Bacteria 1125
1191 nmdc:mga0n895_6093_c1 3300050512 Bacteria 10180
1192 nmdc:mga0n895_68710_c1 3300050512 Bacteria 3510
1193 nmdc:mga0rr50_124793_c1 3300050513 Bacteria 2054
1194 nmdc:mga0rr50_24181_c1 3300050513 Bacteria 4204
1195 nmdc:mga0rr50_269319_c1 3300050513 Bacteria 1419
1196 nmdc:mga0rr50_600949_c1 3300050513 Bacteria 938
1197 nmdc:mga08x19_23812_c1 3300050514 Bacteria 3800
1198 nmdc:mga0a205_14863_c1 3300050515 Bacteria 7265
1199 nmdc:mga0a205_183933_c1 3300050515 Bacteria 1983
1200 nmdc:mga0a205_213_c1 3300050515 Bacteria 40801
1201 Ga0495601_0000004 3300053077 Bacteria 449178
1202 Ga0495601_0000347 3300053077 Bacteria 24383
1203 Ga0495601_0000993 3300053077 Bacteria 15524
1204 Ga0495601_0001303 3300053077 Bacteria 13690
1205 Ga0495612_0000008 3300053078 Bacteria 232633
1206 Ga0495612_0002372 3300053078 Bacteria 7760
1207 Ga0495612_0004290 3300053078 Bacteria 5918
1208 Ga0495612_0007390 3300053078 Bacteria 4489
1209 Ga0495612_0045915 3300053078 Bacteria 1788
1210 Ga0495612_0056043 3300053078 Bacteria 1626
1211 Ga0495595_0000231 3300053084 Bacteria 22163
1212 Ga0495595_0001232 3300053084 Bacteria 9952
1213 Ga0495595_0005605 3300053084 Bacteria 5082
1214 Ga0495595_0009841 3300053084 Bacteria 3963
1215 Ga0495595_0058421 3300053084 Bacteria 1801
1216 Ga0495619_0000005 3300053085 Bacteria 418061
1217 Ga0495619_0000083 3300053085 Bacteria 70312
1218 Ga0495619_0000360 3300053085 Bacteria 31637
1219 Ga0495619_0001190 3300053085 Bacteria 17140
1220 Ga0495619_0013867 3300053085 Bacteria 5085
1221 Ga0495619_0023486 3300053085 Bacteria 3953
1222 Ga0495619_0053980 3300053085 Bacteria 2659
1223 Ga0495619_0091584 3300053085 Bacteria 2058
1224 Ga0500643_019710 3300053087 Bacteria 2216
1225 Ga0500644_0000887 3300053088 Bacteria 9734
1226 Ga0500651_0029388 3300053093 Bacteria 3456
1227 Ga0500566_0017411 3300053094 Bacteria 4224
1228 Ga0500566_0122855 3300053094 Bacteria 1398
1229 Ga0500641_0015864 3300053096 Bacteria 2801
1230 Ga0500654_058472 3300053099 Bacteria 1998
1231 Ga0500595_000003 3300053119 Bacteria 419332
1232 Ga0500642_0132199 3300053130 Bacteria 1170
1233 Ga0500652_014053 3300053131 Bacteria 2853
1234 Ga0500568_0087172 3300053139 Bacteria 1180
1235 Ga0500616_0000002 3300053153 Bacteria 1611257
1236 Ga0500634_0054968 3300053161 Bacteria 2132
1237 Ga0500611_025528 3300053727 Bacteria 1172
1238 Ga0500645_003223 3300053730 Bacteria 6752
1239 Ga0501084_0043091 3300054114 Bacteria 3775
1240 Ga0501084_0044973 3300054114 Bacteria 3697
1241 Ga0501084_0050694 3300054114 Bacteria 3473
1242 Ga0501084_0219723 3300054114 Bacteria 1603
1243 Ga0501084_0239560 3300054114 Bacteria 1531
1244 Ga0501082_0009209 3300060353 Bacteria 8510
1245 Ga0501082_0012714 3300060353 Bacteria 7234
1246 Ga0501082_0018728 3300060353 Bacteria 5965
1247 Ga0501082_0175858 3300060353 Bacteria 1861
1248 Ga0501082_0263132 3300060353 Bacteria 1500
1249 Ga0466962_0079558 3300061719 Bacteria 1567
1250 Ga0530510_0014732 3300061734 Bacteria 5521
1251 Ga0530510_0025912 3300061734 Bacteria 4194
1252 Ga0530510_0029751 3300061734 Bacteria 3921
1253 Ga0530510_0134102 3300061734 Bacteria 1823
1254 Ga0530510_0192710 3300061734 Unclassified 1513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0439073 Ga0501073_0439073_43_885 263
2 3300046517 Ga0495630_0464088 Ga0495630_0464088_11_850 264
3 3300049575 Ga0501039_0473926 Ga0501039_0473926_101_943 266
4 3300037853 Ga0436364_1422653 Ga0436364_1422653_25_834 267
5 3300046522 Ga0495643_0062720 Ga0495643_0062720_24_830 267
6 3300046674 Ga0495588_0031902 Ga0495588_0031902_20_826 267
7 3300014326 Ga0157380_10023039 Ga0157380_100230391 268
8 3300035170 Ga0373943_0045843 Ga0373943_0045843_1244_2101 268
9 3300037068 Ga0373925_0439238 Ga0373925_0439238_20_877 268
10 3300048929 Ga0496126_0372965 Ga0496126_0372965_322_1134 268
11 3300050513 nmdc:mga0rr50_600949_c1 nmdc:mga0rr50_600949_c1_64_915 268
12 3300034816 Ga0373930_0040994 Ga0373930_0040994_148_966 272
13 3300035692 Ga0373935_0285164 Ga0373935_0285164_26_844 272
14 3300035725 Ga0373947_0201078 Ga0373947_0201078_469_1287 272
15 3300046476 Ga0495662_0079271 Ga0495662_0079271_748_1566 272
16 3300046533 Ga0495640_0121865 Ga0495640_0121865_28_846 272
17 3300046664 Ga0495659_0032781 Ga0495659_0032781_21_839 272
18 3300046680 Ga0495646_0017298 Ga0495646_0017298_28_846 272
19 3300047319 Ga0495674_0077789 Ga0495674_0077789_28_846 272
20 3300049580 Ga0501046_0165265 Ga0501046_0165265_206_1087 280
21 3300035120 Ga0373957_0173682 Ga0373957_0173682_12_863 283
22 3300035090 Ga0373949_0012300 Ga0373949_0012300_1021_1875 284
23 3300035091 Ga0373951_0038011 Ga0373951_0038011_30_884 284
24 3300049588 Ga0501072_0167232 Ga0501072_0167232_807_1742 284
25 3300005328 Ga0070676_10000884 Ga0070676_100008842 293
26 3300005341 Ga0070691_10002316 Ga0070691_100023168 294
27 3300005343 Ga0070687_100015548 Ga0070687_1000155483 294
28 3300005354 Ga0070675_100112371 Ga0070675_1001123711 294
29 3300005406 Ga0070703_10001238 Ga0070703_100012384 294
30 3300005438 Ga0070701_10030989 Ga0070701_100309893 294
31 3300005440 Ga0070705_100000402 Ga0070705_10000040221 294
32 3300005441 Ga0070700_100000724 Ga0070700_1000007243 294
33 3300005444 Ga0070694_100000600 Ga0070694_10000060010 294
34 3300005445 Ga0070708_100054489 Ga0070708_1000544891 294
35 3300005455 Ga0070663_100016167 Ga0070663_1000161673 294
36 3300005458 Ga0070681_10126410 Ga0070681_101264103 294
37 3300005471 Ga0070698_100090055 Ga0070698_1000900552 294
38 3300005518 Ga0070699_100000330 Ga0070699_10000033024 294
39 3300005536 Ga0070697_100207413 Ga0070697_1002074132 294
40 3300005545 Ga0070695_100000637 Ga0070695_10000063710 294
41 3300005546 Ga0070696_100000069 Ga0070696_10000006927 294
42 3300005547 Ga0070693_100256545 Ga0070693_1002565451 294
43 3300005549 Ga0070704_100000749 Ga0070704_1000007494 294
44 3300005577 Ga0068857_100019113 Ga0068857_1000191132 294
45 3300005617 Ga0068859_100005304 Ga0068859_1000053048 294
46 3300005618 Ga0068864_100043738 Ga0068864_1000437382 294
47 3300005843 Ga0068860_100008977 Ga0068860_1000089774 294
48 3300005844 Ga0068862_100006312 Ga0068862_1000063129 294
49 3300005985 Ga0081539_10077702 Ga0081539_100777022 294
50 3300006038 Ga0075365_10196964 Ga0075365_101969642 294
51 3300006051 Ga0075364_10011348 Ga0075364_100113483 294
52 3300006195 Ga0075366_10004013 Ga0075366_100040135 294
53 3300006931 Ga0097620_100005304 Ga0097620_1000053048 294
54 3300009148 Ga0105243_10038149 Ga0105243_100381493 294
55 3300009553 Ga0105249_10012262 Ga0105249_100122623 294
56 3300021377 Ga0213874_10006500 Ga0213874_100065002 294
57 3300025885 Ga0207653_10000848 Ga0207653_100008482 294
58 3300025912 Ga0207707_10103617 Ga0207707_101036171 294
59 3300025917 Ga0207660_10085564 Ga0207660_100855642 294
60 3300025918 Ga0207662_10033219 Ga0207662_100332192 294
61 3300025938 Ga0207704_10103140 Ga0207704_101031402 294
62 3300025961 Ga0207712_10003253 Ga0207712_100032533 294
63 3300026067 Ga0207678_10012666 Ga0207678_100126663 294
64 3300026075 Ga0207708_10001458 Ga0207708_1000145815 294
65 3300026116 Ga0207674_10008573 Ga0207674_100085732 294
66 3300026118 Ga0207675_100301744 Ga0207675_1003017441 294
67 3300028381 Ga0268264_10003627 Ga0268264_100036274 294
68 3300031456 Ga0307513_10185900 Ga0307513_101859002 294
69 3300039450 Ga0436363_1294531 Ga0436363_1294531_1438_2367 294
70 3300046460 Ga0495638_0025735 Ga0495638_0025735_1894_2832 294
71 3300048905 Ga0496102_0002596 Ga0496102_0002596_10742_11662 294
72 3300048907 Ga0496104_0001393 Ga0496104_0001393_15404_16375 294
73 3300048907 Ga0496104_0196139 Ga0496104_0196139_719_1639 294
74 3300048909 Ga0496106_0006418 Ga0496106_0006418_4385_5305 294
75 3300048911 Ga0496108_0193092 Ga0496108_0193092_551_1471 294
76 3300049593 Ga0501077_0116468 Ga0501077_0116468_169_1089 294
77 3300049741 Ga0501079_0242161 Ga0501079_0242161_355_1275 294
78 3300049744 Ga0501083_0252565 Ga0501083_0252565_187_1125 294
79 3300049824 Ga0501045_0076811 Ga0501045_0076811_544_1464 294
80 3300050491 nmdc:mga00v17_13334_c1 nmdc:mga00v17_13334_c1_3340_4329 294
81 3300050493 nmdc:mga0k408_7417_c1 nmdc:mga0k408_7417_c1_4180_5169 294
82 3300053099 Ga0500654_058472 Ga0500654_058472_272_1210 294
83 3300053130 Ga0500642_0132199 Ga0500642_0132199_221_1159 294
84 3300053139 Ga0500568_0087172 Ga0500568_0087172_144_1082 294
85 3300053727 Ga0500611_025528 Ga0500611_025528_209_1147 294
86 3300061734 Ga0530510_0014732 Ga0530510_0014732_4252_5172 294
87 3300002739 JGI25158J39367_1004330 JGI25158J39367_10043303 295
88 3300002987 JGI25159J45721_1000675 JGI25159J45721_10006754 295
89 3300003187 JGI25151J46595_10018941 JGI25151J46595_100189412 295
90 3300003354 JGI25160J50197_1000962 JGI25160J50197_100096214 295
91 3300003758 Ga0055532_1000231 Ga0055532_100023111 295
92 3300003760 Ga0055527_1000188 Ga0055527_100018811 295
93 3300003761 Ga0055535_1000592 Ga0055535_100059221 295
94 3300003762 Ga0055542_1001825 Ga0055542_10018256 295
95 3300003771 Ga0055526_1014272 Ga0055526_10142722 295
96 3300004625 Ga0055543_1003620 Ga0055543_10036201 295
97 3300005262 Ga0065165_1002550 Ga0065165_10025504 295
98 3300005293 Ga0065715_10212808 Ga0065715_102128081 295
99 3300005331 Ga0070670_100069045 Ga0070670_1000690453 295
100 3300005333 Ga0070677_10020355 Ga0070677_100203552 295
101 3300005334 Ga0068869_100077044 Ga0068869_1000770442 295
102 3300005340 Ga0070689_100169480 Ga0070689_1001694801 295
103 3300005343 Ga0070687_100226203 Ga0070687_1002262031 295
104 3300005356 Ga0070674_100133795 Ga0070674_1001337952 295
105 3300005364 Ga0070673_100183299 Ga0070673_1001832992 295
106 3300005365 Ga0070688_100093367 Ga0070688_1000933672 295
107 3300005367 Ga0070667_100393820 Ga0070667_1003938202 295
108 3300005459 Ga0068867_100051652 Ga0068867_1000516522 295
109 3300005530 Ga0070679_100229052 Ga0070679_1002290522 295
110 3300005564 Ga0070664_100536712 Ga0070664_1005367122 295
111 3300005577 Ga0068857_100060288 Ga0068857_1000602883 295
112 3300005617 Ga0068859_100060783 Ga0068859_1000607833 295
113 3300005618 Ga0068864_100080402 Ga0068864_1000804023 295
114 3300005718 Ga0068866_10158439 Ga0068866_101584391 295
115 3300006175 Ga0070712_100001671 Ga0070712_1000016715 295
116 3300006358 Ga0068871_100207262 Ga0068871_1002072621 295
117 3300006358 Ga0068871_100559324 Ga0068871_1005593241 295
118 3300006852 Ga0075433_10097799 Ga0075433_100977993 295
119 3300006871 Ga0075434_100186328 Ga0075434_1001863282 295
120 3300006931 Ga0097620_100060780 Ga0097620_1000607803 295
121 3300025208 Ga0209436_100633 Ga0209436_10063314 295
122 3300025228 Ga0209672_100020 Ga0209672_100020235 295
123 3300025229 Ga0209147_100024 Ga0209147_100024235 295
124 3300025242 Ga0209258_100121 Ga0209258_100121157 295
125 3300025254 Ga0209148_1000458 Ga0209148_10004588 295
126 3300025272 Ga0209455_1000263 Ga0209455_100026355 295
127 3300025284 Ga0209130_1001496 Ga0209130_10014963 295
128 3300025292 Ga0209676_1001975 Ga0209676_100197516 295
129 3300025294 Ga0209025_1000301 Ga0209025_100030162 295
130 3300025295 Ga0209564_1000494 Ga0209564_100049459 295
131 3300025295 Ga0209564_1002177 Ga0209564_100217716 295
132 3300025298 Ga0209050_1004792 Ga0209050_10047923 295
133 3300025302 Ga0207426_1001904 Ga0207426_10019043 295
134 3300025303 Ga0209051_1016506 Ga0209051_10165063 295
135 3300025304 Ga0209257_1005496 Ga0209257_10054962 295
136 3300025893 Ga0207682_10002089 Ga0207682_100020898 295
137 3300025901 Ga0207688_10014043 Ga0207688_100140432 295
138 3300025907 Ga0207645_10095830 Ga0207645_100958302 295
139 3300025915 Ga0207693_10001675 Ga0207693_1000167512 295
140 3300025917 Ga0207660_10219395 Ga0207660_102193952 295
141 3300025918 Ga0207662_10081076 Ga0207662_100810762 295
142 3300025921 Ga0207652_10191465 Ga0207652_101914652 295
143 3300025923 Ga0207681_10095713 Ga0207681_100957132 295
144 3300025926 Ga0207659_10138252 Ga0207659_101382522 295
145 3300025927 Ga0207687_10240762 Ga0207687_102407622 295
146 3300025937 Ga0207669_10181459 Ga0207669_101814591 295
147 3300025940 Ga0207691_10036320 Ga0207691_100363203 295
148 3300025941 Ga0207711_10194867 Ga0207711_101948672 295
149 3300025942 Ga0207689_10026402 Ga0207689_100264024 295
150 3300025986 Ga0207658_10491320 Ga0207658_104913201 295
151 3300026095 Ga0207676_10056234 Ga0207676_100562342 295
152 3300026116 Ga0207674_10174146 Ga0207674_101741462 295
153 3300026121 Ga0207683_10008669 Ga0207683_100086692 295
154 3300028380 Ga0268265_10206229 Ga0268265_102062291 295
155 3300028381 Ga0268264_10096728 Ga0268264_100967282 295
156 3300028381 Ga0268264_10409918 Ga0268264_104099181 295
157 3300031711 Ga0265314_10011237 Ga0265314_100112376 295
158 3300039437 Ga0436365_0861956 Ga0436365_0861956_1106_2038 295
159 3300046474 Ga0495605_0129073 Ga0495605_0129073_129_1061 295
160 3300046476 Ga0495662_0009265 Ga0495662_0009265_2926_3939 295
161 3300046491 Ga0495584_0058837 Ga0495584_0058837_974_1906 295
162 3300046517 Ga0495630_0190911 Ga0495630_0190911_268_1200 295
163 3300046537 Ga0495598_0046597 Ga0495598_0046597_163_1095 295
164 3300046683 Ga0495658_0135233 Ga0495658_0135233_184_1116 295
165 3300048907 Ga0496104_0053582 Ga0496104_0053582_1917_2849 295
166 3300048907 Ga0496104_0233050 Ga0496104_0233050_780_1712 295
167 3300048908 Ga0496105_0057934 Ga0496105_0057934_2108_3040 295
168 3300048909 Ga0496106_0106989 Ga0496106_0106989_1012_1944 295
169 3300048909 Ga0496106_0296987 Ga0496106_0296987_123_1055 295
170 3300048914 Ga0496111_0158501 Ga0496111_0158501_13_945 295
171 3300048917 Ga0496114_0166607 Ga0496114_0166607_528_1460 295
172 3300048918 Ga0496115_0115007 Ga0496115_0115007_789_1721 295
173 3300048918 Ga0496115_0119922 Ga0496115_0119922_27_965 295
174 3300048925 Ga0496122_0048492 Ga0496122_0048492_1529_2419 295
175 3300048928 Ga0496125_0137958 Ga0496125_0137958_543_1481 295
176 3300049570 Ga0501033_0042229 Ga0501033_0042229_757_1683 295
177 3300049570 Ga0501033_0050428 Ga0501033_0050428_1377_2300 295
178 3300049571 Ga0501034_0142240 Ga0501034_0142240_21_947 295
179 3300049573 Ga0501037_0131572 Ga0501037_0131572_757_1683 295
180 3300049575 Ga0501039_0066960 Ga0501039_0066960_335_1261 295
181 3300049575 Ga0501039_0338611 Ga0501039_0338611_190_1131 295
182 3300049576 Ga0501040_0224358 Ga0501040_0224358_285_1226 295
183 3300049579 Ga0501043_0372910 Ga0501043_0372910_118_1044 295
184 3300049580 Ga0501046_0255618 Ga0501046_0255618_261_1202 295
185 3300049581 Ga0501047_0108462 Ga0501047_0108462_1741_2631 295
186 3300049581 Ga0501047_0324647 Ga0501047_0324647_135_1061 295
187 3300049587 Ga0501071_0266777 Ga0501071_0266777_232_1122 295
188 3300049588 Ga0501072_0000783 Ga0501072_0000783_1273_2205 295
189 3300049588 Ga0501072_0159006 Ga0501072_0159006_347_1288 295
190 3300049591 Ga0501075_0104823 Ga0501075_0104823_545_1486 295
191 3300049592 Ga0501076_0048362 Ga0501076_0048362_1828_2769 295
192 3300049593 Ga0501077_0038213 Ga0501077_0038213_1983_2924 295
193 3300049741 Ga0501079_0045576 Ga0501079_0045576_278_1219 295
194 3300049743 Ga0501081_0200957 Ga0501081_0200957_131_1072 295
195 3300049823 Ga0501044_0005747 Ga0501044_0005747_10467_11390 295
196 3300049823 Ga0501044_0051391 Ga0501044_0051391_3049_3939 295
197 3300050509 nmdc:mga0qj67_4_c1 nmdc:mga0qj67_4_c1_43905_44837 295
198 3300050512 nmdc:mga0n895_13630_c1 nmdc:mga0n895_13630_c1_3948_4880 295
199 3300053078 Ga0495612_0056043 Ga0495612_0056043_178_1110 295
200 3300053084 Ga0495595_0058421 Ga0495595_0058421_257_1189 295
201 3300053085 Ga0495619_0053980 Ga0495619_0053980_407_1339 295
202 3300053087 Ga0500643_019710 Ga0500643_019710_976_1863 295
203 3300053088 Ga0500644_0000887 Ga0500644_0000887_6381_7268 295
204 3300053093 Ga0500651_0029388 Ga0500651_0029388_788_1675 295
205 3300053094 Ga0500566_0017411 Ga0500566_0017411_2157_3044 295
206 3300053119 Ga0500595_000003 Ga0500595_000003_250388_251275 295
207 3300053131 Ga0500652_014053 Ga0500652_014053_1806_2693 295
208 3300053153 Ga0500616_0000002 Ga0500616_0000002_1441833_1442726 295
209 3300053161 Ga0500634_0054968 Ga0500634_0054968_861_1790 295
210 3300053730 Ga0500645_003223 Ga0500645_003223_2064_2951 295
211 3300054114 Ga0501084_0043091 Ga0501084_0043091_2327_3268 295
212 3300054114 Ga0501084_0219723 Ga0501084_0219723_302_1234 295
213 3300060353 Ga0501082_0175858 Ga0501082_0175858_190_1131 295
214 iso_pu_bacteria 2643221723 2644675270 295
215 2162886007 SwRhRL2b_contig_1075987 SwRhRL2b_0432.00001010 296
216 2209111006 2214800751 2213830001 296
217 2209111006 2214809099 2213841245 296
218 3300000041 ARcpr5oldR_c000150 ARcpr5oldR_0001503 296
219 3300000042 ARSoilYngRDRAFT_c00266 ARSoilYngRDRAFT_002665 296
220 3300000043 ARcpr5yngRDRAFT_c000123 ARcpr5yngRDRAFT_0001233 296
221 3300000044 ARSoilOldRDRAFT_c000007 ARSoilOldRDRAFT_00000751 296
222 3300000045 ARCol0oldRDRAFT_c00020 ARCol0oldRDRAFT_000203 296
223 3300000652 ARCol0yngRDRAFT_1000009 ARCol0yngRDRAFT_10000096 296
224 3300001915 JGI24741J21665_1012297 JGI24741J21665_10122972 296
225 3300001977 JGI24746J21847_1006319 JGI24746J21847_10063192 296
226 3300001989 JGI24739J22299_10003727 JGI24739J22299_100037272 296
227 3300001990 JGI24737J22298_10028599 JGI24737J22298_100285992 296
228 3300001990 JGI24737J22298_10055890 JGI24737J22298_100558901 296
229 3300001991 JGI24743J22301_10005560 JGI24743J22301_100055601 296
230 3300002070 JGI24750J21931_1000613 JGI24750J21931_10006135 296
231 3300002075 JGI24738J21930_10003331 JGI24738J21930_100033312 296
232 3300002076 JGI24749J21850_1015264 JGI24749J21850_10152641 296
233 3300002077 JGI24744J21845_10001820 JGI24744J21845_100018201 296
234 3300002077 JGI24744J21845_10001986 JGI24744J21845_100019862 296
235 3300002126 JGI24035J26624_1000072 JGI24035J26624_10000723 296
236 3300002155 JGI24033J26618_1004187 JGI24033J26618_10041872 296
237 3300002155 JGI24033J26618_1005390 JGI24033J26618_10053901 296
238 3300002239 JGI24034J26672_10000632 JGI24034J26672_100006322 296
239 3300002244 JGI24742J22300_10002483 JGI24742J22300_100024832 296
240 3300002459 JGI24751J29686_10010480 JGI24751J29686_100104802 296
241 3300003203 JGI25406J46586_10009709 JGI25406J46586_100097093 296
242 3300003659 JGI25404J52841_10012261 JGI25404J52841_100122612 296
243 3300005277 Ga0065716_1001883 Ga0065716_10018834 296
244 3300005289 Ga0065704_10080735 Ga0065704_100807353 296
245 3300005290 Ga0065712_10070846 Ga0065712_100708463 296
246 3300005293 Ga0065715_10257302 Ga0065715_102573022 296
247 3300005293 Ga0065715_10303590 Ga0065715_103035901 296
248 3300005327 Ga0070658_10027080 Ga0070658_100270802 296
249 3300005327 Ga0070658_10155840 Ga0070658_101558402 296
250 3300005327 Ga0070658_10400048 Ga0070658_104000481 296
251 3300005328 Ga0070676_10008244 Ga0070676_100082442 296
252 3300005329 Ga0070683_100201988 Ga0070683_1002019882 296
253 3300005330 Ga0070690_100014364 Ga0070690_1000143642 296
254 3300005330 Ga0070690_100034837 Ga0070690_1000348372 296
255 3300005330 Ga0070690_100312567 Ga0070690_1003125672 296
256 3300005331 Ga0070670_100006862 Ga0070670_1000068622 296
257 3300005331 Ga0070670_100066773 Ga0070670_1000667731 296
258 3300005331 Ga0070670_100094337 Ga0070670_1000943373 296
259 3300005333 Ga0070677_10000988 Ga0070677_1000098812 296
260 3300005334 Ga0068869_100032403 Ga0068869_1000324034 296
261 3300005335 Ga0070666_10085701 Ga0070666_100857012 296
262 3300005335 Ga0070666_10123437 Ga0070666_101234371 296
263 3300005335 Ga0070666_10173559 Ga0070666_101735591 296
264 3300005336 Ga0070680_100016581 Ga0070680_1000165812 296
265 3300005336 Ga0070680_100419011 Ga0070680_1004190112 296
266 3300005337 Ga0070682_100068289 Ga0070682_1000682892 296
267 3300005338 Ga0068868_100011533 Ga0068868_1000115335 296
268 3300005338 Ga0068868_100032503 Ga0068868_1000325035 296
269 3300005339 Ga0070660_100006262 Ga0070660_1000062628 296
270 3300005340 Ga0070689_100033029 Ga0070689_1000330292 296
271 3300005340 Ga0070689_100046647 Ga0070689_1000466471 296
272 3300005340 Ga0070689_100159190 Ga0070689_1001591902 296
273 3300005341 Ga0070691_10001048 Ga0070691_100010482 296
274 3300005341 Ga0070691_10016847 Ga0070691_100168474 296
275 3300005343 Ga0070687_100006103 Ga0070687_1000061031 296
276 3300005344 Ga0070661_100031155 Ga0070661_1000311552 296
277 3300005344 Ga0070661_100071832 Ga0070661_1000718322 296
278 3300005345 Ga0070692_10001006 Ga0070692_1000100612 296
279 3300005345 Ga0070692_10017275 Ga0070692_100172755 296
280 3300005347 Ga0070668_100071279 Ga0070668_1000712792 296
281 3300005354 Ga0070675_100002103 Ga0070675_1000021037 296
282 3300005354 Ga0070675_100081609 Ga0070675_1000816093 296
283 3300005355 Ga0070671_100015813 Ga0070671_1000158135 296
284 3300005355 Ga0070671_100021922 Ga0070671_1000219221 296
285 3300005355 Ga0070671_100083504 Ga0070671_1000835042 296
286 3300005356 Ga0070674_100017597 Ga0070674_1000175972 296
287 3300005356 Ga0070674_100032398 Ga0070674_1000323984 296
288 3300005364 Ga0070673_100000950 Ga0070673_10000095017 296
289 3300005364 Ga0070673_100003515 Ga0070673_1000035153 296
290 3300005364 Ga0070673_100006321 Ga0070673_1000063212 296
291 3300005364 Ga0070673_100104219 Ga0070673_1001042192 296
292 3300005365 Ga0070688_100214816 Ga0070688_1002148161 296
293 3300005365 Ga0070688_100324500 Ga0070688_1003245001 296
294 3300005366 Ga0070659_100215754 Ga0070659_1002157541 296
295 3300005367 Ga0070667_100008645 Ga0070667_1000086457 296
296 3300005367 Ga0070667_100115440 Ga0070667_1001154404 296
297 3300005367 Ga0070667_100243221 Ga0070667_1002432212 296
298 3300005367 Ga0070667_100260753 Ga0070667_1002607532 296
299 3300005434 Ga0070709_10002890 Ga0070709_100028905 296
300 3300005434 Ga0070709_10086506 Ga0070709_100865062 296
301 3300005435 Ga0070714_100018377 Ga0070714_1000183777 296
302 3300005435 Ga0070714_100062021 Ga0070714_1000620212 296
303 3300005435 Ga0070714_100088698 Ga0070714_1000886982 296
304 3300005436 Ga0070713_100032262 Ga0070713_1000322622 296
305 3300005437 Ga0070710_10009574 Ga0070710_100095744 296
306 3300005437 Ga0070710_10121239 Ga0070710_101212392 296
307 3300005438 Ga0070701_10108188 Ga0070701_101081882 296
308 3300005439 Ga0070711_100009225 Ga0070711_1000092255 296
309 3300005439 Ga0070711_100018778 Ga0070711_1000187783 296
310 3300005439 Ga0070711_100143911 Ga0070711_1001439111 296
311 3300005439 Ga0070711_100337761 Ga0070711_1003377612 296
312 3300005440 Ga0070705_100020818 Ga0070705_1000208185 296
313 3300005440 Ga0070705_100045906 Ga0070705_1000459062 296
314 3300005440 Ga0070705_100140908 Ga0070705_1001409082 296
315 3300005444 Ga0070694_100027477 Ga0070694_1000274774 296
316 3300005445 Ga0070708_100035647 Ga0070708_1000356476 296
317 3300005455 Ga0070663_100159348 Ga0070663_1001593482 296
318 3300005456 Ga0070678_100008877 Ga0070678_1000088777 296
319 3300005456 Ga0070678_100019314 Ga0070678_1000193142 296
320 3300005456 Ga0070678_100033275 Ga0070678_1000332753 296
321 3300005457 Ga0070662_100102604 Ga0070662_1001026042 296
322 3300005457 Ga0070662_100225936 Ga0070662_1002259362 296
323 3300005458 Ga0070681_10005925 Ga0070681_1000592512 296
324 3300005458 Ga0070681_10498387 Ga0070681_104983871 296
325 3300005459 Ga0068867_100001504 Ga0068867_1000015049 296
326 3300005459 Ga0068867_100011516 Ga0068867_1000115162 296
327 3300005466 Ga0070685_10004829 Ga0070685_100048297 296
328 3300005466 Ga0070685_10053569 Ga0070685_100535692 296
329 3300005466 Ga0070685_10084626 Ga0070685_100846262 296
330 3300005467 Ga0070706_100357177 Ga0070706_1003571772 296
331 3300005468 Ga0070707_100375620 Ga0070707_1003756202 296
332 3300005471 Ga0070698_100072731 Ga0070698_1000727312 296
333 3300005518 Ga0070699_100008676 Ga0070699_1000086767 296
334 3300005518 Ga0070699_100128434 Ga0070699_1001284342 296
335 3300005518 Ga0070699_100227359 Ga0070699_1002273592 296
336 3300005530 Ga0070679_100009727 Ga0070679_1000097279 296
337 3300005530 Ga0070679_100138090 Ga0070679_1001380902 296
338 3300005535 Ga0070684_100003143 Ga0070684_10000314312 296
339 3300005535 Ga0070684_100467224 Ga0070684_1004672242 296
340 3300005536 Ga0070697_100145261 Ga0070697_1001452612 296
341 3300005539 Ga0068853_100006565 Ga0068853_1000065652 296
342 3300005539 Ga0068853_100032751 Ga0068853_1000327512 296
343 3300005539 Ga0068853_100319072 Ga0068853_1003190721 296
344 3300005543 Ga0070672_100005327 Ga0070672_1000053272 296
345 3300005543 Ga0070672_100252630 Ga0070672_1002526302 296
346 3300005544 Ga0070686_100021206 Ga0070686_1000212063 296
347 3300005544 Ga0070686_100041073 Ga0070686_1000410734 296
348 3300005546 Ga0070696_100050368 Ga0070696_1000503682 296
349 3300005546 Ga0070696_100241585 Ga0070696_1002415852 296
350 3300005547 Ga0070693_100002964 Ga0070693_1000029643 296
351 3300005547 Ga0070693_100019541 Ga0070693_1000195414 296
352 3300005547 Ga0070693_100090064 Ga0070693_1000900642 296
353 3300005547 Ga0070693_100121695 Ga0070693_1001216952 296
354 3300005548 Ga0070665_100031023 Ga0070665_1000310237 296
355 3300005548 Ga0070665_100316131 Ga0070665_1003161312 296
356 3300005549 Ga0070704_100214606 Ga0070704_1002146062 296
357 3300005563 Ga0068855_100019111 Ga0068855_10001911111 296
358 3300005563 Ga0068855_100073458 Ga0068855_1000734582 296
359 3300005563 Ga0068855_100124790 Ga0068855_1001247902 296
360 3300005563 Ga0068855_100327480 Ga0068855_1003274802 296
361 3300005564 Ga0070664_100153271 Ga0070664_1001532712 296
362 3300005564 Ga0070664_100160834 Ga0070664_1001608342 296
363 3300005564 Ga0070664_100368748 Ga0070664_1003687482 296
364 3300005564 Ga0070664_100507705 Ga0070664_1005077052 296
365 3300005577 Ga0068857_100000616 Ga0068857_10000061612 296
366 3300005577 Ga0068857_100079354 Ga0068857_1000793542 296
367 3300005578 Ga0068854_100060789 Ga0068854_1000607893 296
368 3300005578 Ga0068854_100170218 Ga0068854_1001702182 296
369 3300005614 Ga0068856_100059449 Ga0068856_1000594492 296
370 3300005614 Ga0068856_100106093 Ga0068856_1001060934 296
371 3300005614 Ga0068856_100178755 Ga0068856_1001787552 296
372 3300005615 Ga0070702_100011750 Ga0070702_1000117505 296
373 3300005615 Ga0070702_100019301 Ga0070702_1000193012 296
374 3300005615 Ga0070702_100080400 Ga0070702_1000804002 296
375 3300005616 Ga0068852_100002017 Ga0068852_10000201715 296
376 3300005617 Ga0068859_100004949 Ga0068859_1000049497 296
377 3300005617 Ga0068859_100018608 Ga0068859_1000186082 296
378 3300005617 Ga0068859_100064044 Ga0068859_1000640445 296
379 3300005618 Ga0068864_100003232 Ga0068864_10000323216 296
380 3300005618 Ga0068864_100004578 Ga0068864_1000045788 296
381 3300005718 Ga0068866_10002061 Ga0068866_100020612 296
382 3300005718 Ga0068866_10011605 Ga0068866_100116055 296
383 3300005840 Ga0068870_10000289 Ga0068870_100002895 296
384 3300005840 Ga0068870_10004900 Ga0068870_100049006 296
385 3300005841 Ga0068863_100001280 Ga0068863_10000128018 296
386 3300005841 Ga0068863_100025968 Ga0068863_1000259685 296
387 3300005842 Ga0068858_100057360 Ga0068858_1000573605 296
388 3300005843 Ga0068860_100008827 Ga0068860_1000088273 296
389 3300005843 Ga0068860_100036450 Ga0068860_1000364502 296
390 3300005844 Ga0068862_100005504 Ga0068862_10000550413 296
391 3300005844 Ga0068862_100351644 Ga0068862_1003516441 296
392 3300005937 Ga0081455_10000540 Ga0081455_1000054043 296
393 3300005937 Ga0081455_10001205 Ga0081455_100012053 296
394 3300005937 Ga0081455_10005299 Ga0081455_100052992 296
395 3300005937 Ga0081455_10022139 Ga0081455_100221396 296
396 3300005937 Ga0081455_10042728 Ga0081455_100427282 296
397 3300005937 Ga0081455_10119772 Ga0081455_101197723 296
398 3300005981 Ga0081538_10010807 Ga0081538_100108077 296
399 3300005983 Ga0081540_1000015 Ga0081540_100001529 296
400 3300005983 Ga0081540_1008029 Ga0081540_10080294 296
401 3300005983 Ga0081540_1054309 Ga0081540_10543093 296
402 3300005985 Ga0081539_10002225 Ga0081539_1000222521 296
403 3300006028 Ga0070717_10000817 Ga0070717_1000081719 296
404 3300006028 Ga0070717_10033136 Ga0070717_100331362 296
405 3300006028 Ga0070717_10138362 Ga0070717_101383621 296
406 3300006028 Ga0070717_10243185 Ga0070717_102431851 296
407 3300006028 Ga0070717_10517859 Ga0070717_105178591 296
408 3300006058 Ga0075432_10059642 Ga0075432_100596422 296
409 3300006163 Ga0070715_10002395 Ga0070715_100023957 296
410 3300006163 Ga0070715_10002890 Ga0070715_100028904 296
411 3300006163 Ga0070715_10156595 Ga0070715_101565951 296
412 3300006173 Ga0070716_100017968 Ga0070716_1000179682 296
413 3300006173 Ga0070716_100018008 Ga0070716_1000180084 296
414 3300006175 Ga0070712_100011668 Ga0070712_1000116684 296
415 3300006175 Ga0070712_100055726 Ga0070712_1000557263 296
416 3300006175 Ga0070712_100056602 Ga0070712_1000566022 296
417 3300006175 Ga0070712_100112826 Ga0070712_1001128262 296
418 3300006175 Ga0070712_100144699 Ga0070712_1001446992 296
419 3300006178 Ga0075367_10072194 Ga0075367_100721942 296
420 3300006237 Ga0097621_100001930 Ga0097621_10000193014 296
421 3300006237 Ga0097621_100005823 Ga0097621_10000582310 296
422 3300006237 Ga0097621_100120569 Ga0097621_1001205692 296
423 3300006237 Ga0097621_100177418 Ga0097621_1001774181 296
424 3300006358 Ga0068871_100001884 Ga0068871_10000188416 296
425 3300006358 Ga0068871_100003555 Ga0068871_1000035553 296
426 3300006358 Ga0068871_100010659 Ga0068871_1000106592 296
427 3300006358 Ga0068871_100091434 Ga0068871_1000914343 296
428 3300006844 Ga0075428_100097372 Ga0075428_1000973723 296
429 3300006844 Ga0075428_100229821 Ga0075428_1002298212 296
430 3300006846 Ga0075430_100053277 Ga0075430_1000532772 296
431 3300006847 Ga0075431_100026272 Ga0075431_1000262724 296
432 3300006847 Ga0075431_100291957 Ga0075431_1002919572 296
433 3300006852 Ga0075433_10005937 Ga0075433_1000593712 296
434 3300006852 Ga0075433_10009567 Ga0075433_100095672 296
435 3300006852 Ga0075433_10081387 Ga0075433_100813872 296
436 3300006852 Ga0075433_10312525 Ga0075433_103125251 296
437 3300006871 Ga0075434_100013765 Ga0075434_1000137653 296
438 3300006871 Ga0075434_100060452 Ga0075434_1000604522 296
439 3300006871 Ga0075434_100151373 Ga0075434_1001513732 296
440 3300006871 Ga0075434_100168466 Ga0075434_1001684662 296
441 3300006871 Ga0075434_100210513 Ga0075434_1002105132 296
442 3300006871 Ga0075434_100455617 Ga0075434_1004556171 296
443 3300006871 Ga0075434_100548251 Ga0075434_1005482512 296
444 3300006880 Ga0075429_100010683 Ga0075429_1000106835 296
445 3300006881 Ga0068865_100022254 Ga0068865_1000222543 296
446 3300006914 Ga0075436_100001808 Ga0075436_1000018082 296
447 3300006931 Ga0097620_100004949 Ga0097620_1000049497 296
448 3300006931 Ga0097620_100018608 Ga0097620_1000186082 296
449 3300006931 Ga0097620_100064046 Ga0097620_1000640465 296
450 3300007076 Ga0075435_100074793 Ga0075435_1000747932 296
451 3300007076 Ga0075435_100150262 Ga0075435_1001502622 296
452 3300007076 Ga0075435_100196637 Ga0075435_1001966372 296
453 3300007076 Ga0075435_100223910 Ga0075435_1002239103 296
454 3300007076 Ga0075435_100362484 Ga0075435_1003624842 296
455 3300007788 Ga0099795_10006632 Ga0099795_100066322 296
456 3300007788 Ga0099795_10011343 Ga0099795_100113432 296
457 3300009092 Ga0105250_10011298 Ga0105250_100112983 296
458 3300009093 Ga0105240_10077106 Ga0105240_100771065 296
459 3300009093 Ga0105240_10308309 Ga0105240_103083092 296
460 3300009093 Ga0105240_10387178 Ga0105240_103871782 296
461 3300009094 Ga0111539_10000345 Ga0111539_1000034542 296
462 3300009094 Ga0111539_10001931 Ga0111539_1000193118 296
463 3300009094 Ga0111539_10002122 Ga0111539_1000212217 296
464 3300009094 Ga0111539_10074518 Ga0111539_100745186 296
465 3300009094 Ga0111539_10135014 Ga0111539_101350142 296
466 3300009094 Ga0111539_10383441 Ga0111539_103834411 296
467 3300009098 Ga0105245_10002784 Ga0105245_100027845 296
468 3300009098 Ga0105245_10063738 Ga0105245_100637385 296
469 3300009101 Ga0105247_10003272 Ga0105247_1000327213 296
470 3300009101 Ga0105247_10011048 Ga0105247_100110482 296
471 3300009147 Ga0114129_10003572 Ga0114129_100035725 296
472 3300009147 Ga0114129_10007079 Ga0114129_1000707915 296
473 3300009147 Ga0114129_10010645 Ga0114129_1001064514 296
474 3300009148 Ga0105243_10015911 Ga0105243_100159114 296
475 3300009148 Ga0105243_10108219 Ga0105243_101082192 296
476 3300009174 Ga0105241_10000940 Ga0105241_1000094012 296
477 3300009176 Ga0105242_10002276 Ga0105242_1000227611 296
478 3300009176 Ga0105242_10007660 Ga0105242_100076602 296
479 3300009176 Ga0105242_10047519 Ga0105242_100475192 296
480 3300009177 Ga0105248_10067581 Ga0105248_100675812 296
481 3300009177 Ga0105248_10358663 Ga0105248_103586632 296
482 3300009551 Ga0105238_10032937 Ga0105238_100329372 296
483 3300009551 Ga0105238_10274521 Ga0105238_102745212 296
484 3300009553 Ga0105249_10182734 Ga0105249_101827341 296
485 3300009553 Ga0105249_10726736 Ga0105249_107267361 296
486 3300010159 Ga0099796_10034707 Ga0099796_100347072 296
487 3300010375 Ga0105239_10003461 Ga0105239_1000346110 296
488 3300010375 Ga0105239_10098595 Ga0105239_100985953 296
489 3300010375 Ga0105239_10206978 Ga0105239_102069782 296
490 3300010375 Ga0105239_10217083 Ga0105239_102170832 296
491 3300011119 Ga0105246_10012297 Ga0105246_100122974 296
492 3300011119 Ga0105246_10030167 Ga0105246_100301672 296
493 3300012498 Ga0157345_1004195 Ga0157345_10041951 296
494 3300012505 Ga0157339_1002441 Ga0157339_10024411 296
495 3300012510 Ga0157316_1002487 Ga0157316_10024872 296
496 3300013100 Ga0157373_10004480 Ga0157373_100044807 296
497 3300013100 Ga0157373_10179750 Ga0157373_101797502 296
498 3300013102 Ga0157371_10035439 Ga0157371_100354392 296
499 3300013102 Ga0157371_10159738 Ga0157371_101597382 296
500 3300013105 Ga0157369_10090869 Ga0157369_100908692 296
501 3300013105 Ga0157369_10349613 Ga0157369_103496132 296
502 3300013296 Ga0157374_10002727 Ga0157374_100027275 296
503 3300013296 Ga0157374_10008248 Ga0157374_100082484 296
504 3300013297 Ga0157378_10100825 Ga0157378_101008253 296
505 3300013306 Ga0163162_10045574 Ga0163162_100455743 296
506 3300013306 Ga0163162_10450821 Ga0163162_104508212 296
507 3300013307 Ga0157372_10040903 Ga0157372_100409037 296
508 3300013307 Ga0157372_10457375 Ga0157372_104573752 296
509 3300013307 Ga0157372_10563574 Ga0157372_105635742 296
510 3300013308 Ga0157375_10590914 Ga0157375_105909141 296
511 3300014325 Ga0163163_10042310 Ga0163163_100423101 296
512 3300014325 Ga0163163_10063147 Ga0163163_100631473 296
513 3300014326 Ga0157380_10542290 Ga0157380_105422902 296
514 3300014968 Ga0157379_10010629 Ga0157379_100106292 296
515 3300014968 Ga0157379_10032040 Ga0157379_100320402 296
516 3300014968 Ga0157379_10113642 Ga0157379_101136422 296
517 3300014968 Ga0157379_10249132 Ga0157379_102491321 296
518 3300014968 Ga0157379_10353174 Ga0157379_103531741 296
519 3300014969 Ga0157376_10002411 Ga0157376_1000241112 296
520 3300014969 Ga0157376_10063454 Ga0157376_100634544 296
521 3300014969 Ga0157376_10067933 Ga0157376_100679334 296
522 3300014969 Ga0157376_10211875 Ga0157376_102118751 296
523 3300017792 Ga0163161_10001476 Ga0163161_1000147622 296
524 3300017792 Ga0163161_10058906 Ga0163161_100589065 296
525 3300017792 Ga0163161_10090221 Ga0163161_100902212 296
526 3300017792 Ga0163161_10140284 Ga0163161_101402842 296
527 3300021361 Ga0213872_10021480 Ga0213872_100214801 296
528 3300021384 Ga0213876_10011677 Ga0213876_100116772 296
529 3300021384 Ga0213876_10126063 Ga0213876_101260632 296
530 3300024225 Ga0224572_1004661 Ga0224572_10046612 296
531 3300024227 Ga0228598_1002219 Ga0228598_10022193 296
532 3300025290 Ga0207673_1000001 Ga0207673_100000115 296
533 3300025315 Ga0207697_10013424 Ga0207697_100134242 296
534 3300025321 Ga0207656_10074393 Ga0207656_100743932 296
535 3300025893 Ga0207682_10000056 Ga0207682_1000005611 296
536 3300025898 Ga0207692_10001234 Ga0207692_100012348 296
537 3300025898 Ga0207692_10011799 Ga0207692_100117995 296
538 3300025898 Ga0207692_10013842 Ga0207692_100138422 296
539 3300025900 Ga0207710_10004332 Ga0207710_100043325 296
540 3300025900 Ga0207710_10008537 Ga0207710_100085372 296
541 3300025900 Ga0207710_10049812 Ga0207710_100498122 296
542 3300025901 Ga0207688_10001105 Ga0207688_100011056 296
543 3300025901 Ga0207688_10030510 Ga0207688_100305102 296
544 3300025903 Ga0207680_10030467 Ga0207680_100304672 296
545 3300025903 Ga0207680_10085902 Ga0207680_100859021 296
546 3300025904 Ga0207647_10014078 Ga0207647_100140784 296
547 3300025904 Ga0207647_10019467 Ga0207647_100194674 296
548 3300025905 Ga0207685_10014369 Ga0207685_100143692 296
549 3300025906 Ga0207699_10002060 Ga0207699_100020605 296
550 3300025906 Ga0207699_10269338 Ga0207699_102693382 296
551 3300025907 Ga0207645_10000249 Ga0207645_1000024930 296
552 3300025907 Ga0207645_10031831 Ga0207645_100318312 296
553 3300025907 Ga0207645_10046288 Ga0207645_100462881 296
554 3300025908 Ga0207643_10000187 Ga0207643_100001875 296
555 3300025908 Ga0207643_10000387 Ga0207643_100003876 296
556 3300025909 Ga0207705_10015260 Ga0207705_100152605 296
557 3300025909 Ga0207705_10369973 Ga0207705_103699731 296
558 3300025910 Ga0207684_10240569 Ga0207684_102405691 296
559 3300025910 Ga0207684_10451070 Ga0207684_104510701 296
560 3300025911 Ga0207654_10033440 Ga0207654_100334402 296
561 3300025911 Ga0207654_10322388 Ga0207654_103223881 296
562 3300025915 Ga0207693_10014672 Ga0207693_100146721 296
563 3300025915 Ga0207693_10018411 Ga0207693_100184115 296
564 3300025915 Ga0207693_10018746 Ga0207693_100187465 296
565 3300025915 Ga0207693_10084543 Ga0207693_100845432 296
566 3300025915 Ga0207693_10100120 Ga0207693_101001202 296
567 3300025916 Ga0207663_10037400 Ga0207663_100374003 296
568 3300025916 Ga0207663_10247647 Ga0207663_102476472 296
569 3300025917 Ga0207660_10000647 Ga0207660_1000064715 296
570 3300025918 Ga0207662_10010233 Ga0207662_100102331 296
571 3300025918 Ga0207662_10108064 Ga0207662_101080642 296
572 3300025919 Ga0207657_10132608 Ga0207657_101326082 296
573 3300025920 Ga0207649_10123225 Ga0207649_101232253 296
574 3300025920 Ga0207649_10298348 Ga0207649_102983481 296
575 3300025921 Ga0207652_10030686 Ga0207652_100306862 296
576 3300025921 Ga0207652_10088661 Ga0207652_100886612 296
577 3300025921 Ga0207652_10177499 Ga0207652_101774992 296
578 3300025923 Ga0207681_10064261 Ga0207681_100642611 296
579 3300025924 Ga0207694_10016005 Ga0207694_100160057 296
580 3300025925 Ga0207650_10002475 Ga0207650_100024757 296
581 3300025926 Ga0207659_10001692 Ga0207659_100016926 296
582 3300025926 Ga0207659_10130622 Ga0207659_101306221 296
583 3300025927 Ga0207687_10003004 Ga0207687_1000300411 296
584 3300025927 Ga0207687_10012483 Ga0207687_100124836 296
585 3300025928 Ga0207700_10000623 Ga0207700_1000062323 296
586 3300025928 Ga0207700_10025105 Ga0207700_100251054 296
587 3300025928 Ga0207700_10205103 Ga0207700_102051032 296
588 3300025929 Ga0207664_10014641 Ga0207664_100146417 296
589 3300025929 Ga0207664_10073350 Ga0207664_100733505 296
590 3300025929 Ga0207664_10277010 Ga0207664_102770101 296
591 3300025929 Ga0207664_10531698 Ga0207664_105316981 296
592 3300025931 Ga0207644_10041278 Ga0207644_100412783 296
593 3300025931 Ga0207644_10045679 Ga0207644_100456792 296
594 3300025932 Ga0207690_10000546 Ga0207690_100005469 296
595 3300025932 Ga0207690_10290302 Ga0207690_102903022 296
596 3300025933 Ga0207706_10001175 Ga0207706_1000117517 296
597 3300025933 Ga0207706_10003621 Ga0207706_100036215 296
598 3300025933 Ga0207706_10033074 Ga0207706_100330742 296
599 3300025933 Ga0207706_10034253 Ga0207706_100342532 296
600 3300025934 Ga0207686_10048630 Ga0207686_100486302 296
601 3300025934 Ga0207686_10082937 Ga0207686_100829372 296
602 3300025935 Ga0207709_10037740 Ga0207709_100377402 296
603 3300025935 Ga0207709_10056475 Ga0207709_100564752 296
604 3300025936 Ga0207670_10010169 Ga0207670_100101693 296
605 3300025936 Ga0207670_10020270 Ga0207670_100202702 296
606 3300025936 Ga0207670_10109304 Ga0207670_101093042 296
607 3300025937 Ga0207669_10000534 Ga0207669_100005342 296
608 3300025938 Ga0207704_10002477 Ga0207704_100024773 296
609 3300025939 Ga0207665_10001717 Ga0207665_100017179 296
610 3300025939 Ga0207665_10025158 Ga0207665_100251582 296
611 3300025939 Ga0207665_10152258 Ga0207665_101522583 296
612 3300025939 Ga0207665_10169870 Ga0207665_101698702 296
613 3300025940 Ga0207691_10001992 Ga0207691_1000199217 296
614 3300025940 Ga0207691_10009096 Ga0207691_100090968 296
615 3300025941 Ga0207711_10008662 Ga0207711_100086624 296
616 3300025941 Ga0207711_10019334 Ga0207711_100193342 296
617 3300025941 Ga0207711_10039618 Ga0207711_100396182 296
618 3300025941 Ga0207711_10095339 Ga0207711_100953393 296
619 3300025942 Ga0207689_10000424 Ga0207689_1000042430 296
620 3300025942 Ga0207689_10002173 Ga0207689_100021736 296
621 3300025942 Ga0207689_10010839 Ga0207689_100108395 296
622 3300025945 Ga0207679_10000187 Ga0207679_100001875 296
623 3300025949 Ga0207667_10011279 Ga0207667_100112794 296
624 3300025949 Ga0207667_10023894 Ga0207667_100238947 296
625 3300025960 Ga0207651_10005649 Ga0207651_100056494 296
626 3300025960 Ga0207651_10013062 Ga0207651_100130624 296
627 3300025960 Ga0207651_10097459 Ga0207651_100974592 296
628 3300025961 Ga0207712_10001563 Ga0207712_100015637 296
629 3300025961 Ga0207712_10015028 Ga0207712_100150283 296
630 3300025961 Ga0207712_10017851 Ga0207712_100178512 296
631 3300025972 Ga0207668_10000807 Ga0207668_100008073 296
632 3300025981 Ga0207640_10001794 Ga0207640_100017948 296
633 3300025986 Ga0207658_10015810 Ga0207658_100158101 296
634 3300025986 Ga0207658_10058657 Ga0207658_100586574 296
635 3300026023 Ga0207677_10002480 Ga0207677_100024806 296
636 3300026023 Ga0207677_10008071 Ga0207677_100080713 296
637 3300026023 Ga0207677_10009309 Ga0207677_100093094 296
638 3300026035 Ga0207703_10059722 Ga0207703_100597222 296
639 3300026041 Ga0207639_10039012 Ga0207639_100390122 296
640 3300026041 Ga0207639_10230764 Ga0207639_102307642 296
641 3300026041 Ga0207639_10276707 Ga0207639_102767072 296
642 3300026041 Ga0207639_10485280 Ga0207639_104852802 296
643 3300026067 Ga0207678_10021453 Ga0207678_100214534 296
644 3300026067 Ga0207678_10058216 Ga0207678_100582162 296
645 3300026067 Ga0207678_10505189 Ga0207678_105051891 296
646 3300026075 Ga0207708_10001620 Ga0207708_100016209 296
647 3300026078 Ga0207702_10011282 Ga0207702_100112822 296
648 3300026078 Ga0207702_10067339 Ga0207702_100673394 296
649 3300026078 Ga0207702_10099674 Ga0207702_100996744 296
650 3300026078 Ga0207702_10170780 Ga0207702_101707801 296
651 3300026078 Ga0207702_10175935 Ga0207702_101759352 296
652 3300026088 Ga0207641_10001747 Ga0207641_1000174711 296
653 3300026088 Ga0207641_10042162 Ga0207641_100421624 296
654 3300026089 Ga0207648_10006315 Ga0207648_100063157 296
655 3300026089 Ga0207648_10031587 Ga0207648_100315875 296
656 3300026089 Ga0207648_10099231 Ga0207648_100992312 296
657 3300026089 Ga0207648_10412078 Ga0207648_104120782 296
658 3300026095 Ga0207676_10005369 Ga0207676_100053692 296
659 3300026095 Ga0207676_10006683 Ga0207676_100066835 296
660 3300026095 Ga0207676_10028355 Ga0207676_100283554 296
661 3300026116 Ga0207674_10099023 Ga0207674_100990232 296
662 3300026116 Ga0207674_10120373 Ga0207674_101203733 296
663 3300026116 Ga0207674_10169960 Ga0207674_101699604 296
664 3300026118 Ga0207675_100002650 Ga0207675_10000265016 296
665 3300026118 Ga0207675_100029584 Ga0207675_1000295844 296
666 3300026118 Ga0207675_100149945 Ga0207675_1001499454 296
667 3300026118 Ga0207675_100344747 Ga0207675_1003447471 296
668 3300026121 Ga0207683_10000727 Ga0207683_1000072723 296
669 3300026121 Ga0207683_10003304 Ga0207683_1000330417 296
670 3300026121 Ga0207683_10006260 Ga0207683_100062605 296
671 3300026121 Ga0207683_10024882 Ga0207683_100248825 296
672 3300026142 Ga0207698_10001591 Ga0207698_1000159113 296
673 3300027424 Ga0209984_1004387 Ga0209984_10043872 296
674 3300027543 Ga0209999_1013478 Ga0209999_10134782 296
675 3300027617 Ga0210002_1000292 Ga0210002_10002922 296
676 3300027665 Ga0209983_1004894 Ga0209983_10048942 296
677 3300027682 Ga0209971_1010091 Ga0209971_10100912 296
678 3300027695 Ga0209966_1003324 Ga0209966_10033242 296
679 3300027907 Ga0207428_10000150 Ga0207428_1000015080 296
680 3300027907 Ga0207428_10001312 Ga0207428_1000131212 296
681 3300028379 Ga0268266_10028928 Ga0268266_100289287 296
682 3300028379 Ga0268266_10127675 Ga0268266_101276752 296
683 3300028379 Ga0268266_10474231 Ga0268266_104742312 296
684 3300028380 Ga0268265_10003058 Ga0268265_1000305812 296
685 3300028380 Ga0268265_10021946 Ga0268265_100219462 296
686 3300028577 Ga0265318_10050700 Ga0265318_100507002 296
687 3300031235 Ga0265330_10132773 Ga0265330_101327732 296
688 3300031238 Ga0265332_10027965 Ga0265332_100279653 296
689 3300031241 Ga0265325_10003669 Ga0265325_1000366910 296
690 3300031241 Ga0265325_10048000 Ga0265325_100480002 296
691 3300031241 Ga0265325_10057470 Ga0265325_100574702 296
692 3300031242 Ga0265329_10014152 Ga0265329_100141523 296
693 3300031247 Ga0265340_10020356 Ga0265340_100203563 296
694 3300031250 Ga0265331_10114966 Ga0265331_101149661 296
695 3300031344 Ga0265316_10062118 Ga0265316_100621182 296
696 3300031595 Ga0265313_10000339 Ga0265313_1000033928 296
697 3300031595 Ga0265313_10009086 Ga0265313_100090866 296
698 3300031595 Ga0265313_10019348 Ga0265313_100193482 296
699 3300031595 Ga0265313_10033359 Ga0265313_100333592 296
700 3300031711 Ga0265314_10040172 Ga0265314_100401722 296
701 3300031711 Ga0265314_10119536 Ga0265314_101195362 296
702 3300031712 Ga0265342_10004131 Ga0265342_1000413110 296
703 3300031712 Ga0265342_10037020 Ga0265342_100370202 296
704 3300034816 Ga0373930_0000047 Ga0373930_0000047_2386_3276 296
705 3300034816 Ga0373930_0006240 Ga0373930_0006240_767_1657 296
706 3300034817 Ga0373948_0000024 Ga0373948_0000024_5898_6788 296
707 3300034817 Ga0373948_0005463 Ga0373948_0005463_602_1492 296
708 3300034818 Ga0373950_0016164 Ga0373950_0016164_50_940 296
709 3300034819 Ga0373958_0000655 Ga0373958_0000655_2117_3007 296
710 3300034819 Ga0373958_0011872 Ga0373958_0011872_116_1006 296
711 3300034820 Ga0373959_0013683 Ga0373959_0013683_251_1141 296
712 3300034957 Ga0373938_0000288 Ga0373938_0000288_2781_3671 296
713 3300035083 Ga0373926_0006670 Ga0373926_0006670_1804_2694 296
714 3300035083 Ga0373926_0027700 Ga0373926_0027700_776_1720 296
715 3300035083 Ga0373926_0035211 Ga0373926_0035211_411_1301 296
716 3300035084 Ga0373928_0000269 Ga0373928_0000269_2292_3182 296
717 3300035084 Ga0373928_0002346 Ga0373928_0002346_2081_3016 296
718 3300035086 Ga0373934_0008776 Ga0373934_0008776_1623_2513 296
719 3300035088 Ga0373940_0000152 Ga0373940_0000152_6639_7529 296
720 3300035088 Ga0373940_0009981 Ga0373940_0009981_881_1771 296
721 3300035089 Ga0373944_0000529 Ga0373944_0000529_1409_2299 296
722 3300035089 Ga0373944_0010817 Ga0373944_0010817_910_1854 296
723 3300035090 Ga0373949_0000315 Ga0373949_0000315_9693_10583 296
724 3300035090 Ga0373949_0006098 Ga0373949_0006098_261_1151 296
725 3300035091 Ga0373951_0003234 Ga0373951_0003234_596_1486 296
726 3300035092 Ga0373952_0000084 Ga0373952_0000084_9234_10124 296
727 3300035092 Ga0373952_0001863 Ga0373952_0001863_508_1398 296
728 3300035092 Ga0373952_0011890 Ga0373952_0011890_538_1428 296
729 3300035111 Ga0373923_0003265 Ga0373923_0003265_1967_2857 296
730 3300035111 Ga0373923_0005474 Ga0373923_0005474_2097_2987 296
731 3300035111 Ga0373923_0018969 Ga0373923_0018969_461_1402 296
732 3300035111 Ga0373923_0049207 Ga0373923_0049207_51_992 296
733 3300035112 Ga0373932_0001167 Ga0373932_0001167_3439_4329 296
734 3300035113 Ga0373936_0000722 Ga0373936_0000722_634_1629 296
735 3300035113 Ga0373936_0072224 Ga0373936_0072224_283_1218 296
736 3300035113 Ga0373936_0109845 Ga0373936_0109845_98_1033 296
737 3300035114 Ga0373939_0001213 Ga0373939_0001213_467_1357 296
738 3300035114 Ga0373939_0001845 Ga0373939_0001845_718_1608 296
739 3300035115 Ga0373941_0000158 Ga0373941_0000158_6221_7111 296
740 3300035115 Ga0373941_0039953 Ga0373941_0039953_135_1025 296
741 3300035116 Ga0373945_0002014 Ga0373945_0002014_1741_2685 296
742 3300035116 Ga0373945_0024203 Ga0373945_0024203_604_1494 296
743 3300035117 Ga0373953_0004608 Ga0373953_0004608_765_1706 296
744 3300035117 Ga0373953_0008792 Ga0373953_0008792_1813_2748 296
745 3300035117 Ga0373953_0049685 Ga0373953_0049685_512_1402 296
746 3300035118 Ga0373954_0002688 Ga0373954_0002688_5007_5948 296
747 3300035118 Ga0373954_0018825 Ga0373954_0018825_880_1770 296
748 3300035118 Ga0373954_0031726 Ga0373954_0031726_475_1416 296
749 3300035118 Ga0373954_0050459 Ga0373954_0050459_131_1066 296
750 3300035119 Ga0373956_0007670 Ga0373956_0007670_1439_2374 296
751 3300035119 Ga0373956_0031671 Ga0373956_0031671_326_1216 296
752 3300035119 Ga0373956_0041589 Ga0373956_0041589_745_1686 296
753 3300035119 Ga0373956_0072435 Ga0373956_0072435_137_1027 296
754 3300035170 Ga0373943_0000757 Ga0373943_0000757_7383_8324 296
755 3300035170 Ga0373943_0011141 Ga0373943_0011141_2133_3023 296
756 3300035170 Ga0373943_0013910 Ga0373943_0013910_13_957 296
757 3300035170 Ga0373943_0099946 Ga0373943_0099946_355_1245 296
758 3300035171 Ga0373946_0031860 Ga0373946_0031860_349_1293 296
759 3300035171 Ga0373946_0034850 Ga0373946_0034850_909_1799 296
760 3300035171 Ga0373946_0104575 Ga0373946_0104575_370_1260 296
761 3300035172 Ga0373955_0000713 Ga0373955_0000713_12617_13558 296
762 3300035172 Ga0373955_0003253 Ga0373955_0003253_3444_4334 296
763 3300035172 Ga0373955_0010615 Ga0373955_0010615_2792_3682 296
764 3300035172 Ga0373955_0095658 Ga0373955_0095658_93_1034 296
765 3300035241 Ga0373961_0000464 Ga0373961_0000464_11611_12501 296
766 3300035241 Ga0373961_0016441 Ga0373961_0016441_28_918 296
767 3300035242 Ga0373962_0003173 Ga0373962_0003173_2110_3000 296
768 3300035242 Ga0373962_0007894 Ga0373962_0007894_1511_2401 296
769 3300035410 Ga0373924_0010553 Ga0373924_0010553_541_1482 296
770 3300035410 Ga0373924_0022450 Ga0373924_0022450_27_917 296
771 3300035691 Ga0373931_0000291 Ga0373931_0000291_8742_9632 296
772 3300035691 Ga0373931_0001643 Ga0373931_0001643_6000_6890 296
773 3300035691 Ga0373931_0007687 Ga0373931_0007687_2645_3535 296
774 3300035691 Ga0373931_0136848 Ga0373931_0136848_91_1026 296
775 3300035692 Ga0373935_0001165 Ga0373935_0001165_1930_2871 296
776 3300035692 Ga0373935_0030524 Ga0373935_0030524_1031_1921 296
777 3300035692 Ga0373935_0056027 Ga0373935_0056027_699_1643 296
778 3300035692 Ga0373935_0093851 Ga0373935_0093851_740_1675 296
779 3300035692 Ga0373935_0101292 Ga0373935_0101292_592_1533 296
780 3300035692 Ga0373935_0157303 Ga0373935_0157303_236_1126 296
781 3300035695 Ga0373927_0001051 Ga0373927_0001051_10106_11050 296
782 3300035695 Ga0373927_0002713 Ga0373927_0002713_6174_7115 296
783 3300035695 Ga0373927_0026537 Ga0373927_0026537_1169_2059 296
784 3300035695 Ga0373927_0041094 Ga0373927_0041094_1842_2777 296
785 3300035695 Ga0373927_0062052 Ga0373927_0062052_504_1445 296
786 3300035695 Ga0373927_0210020 Ga0373927_0210020_358_1248 296
787 3300035724 Ga0373933_0005438 Ga0373933_0005438_4389_5279 296
788 3300035724 Ga0373933_0016565 Ga0373933_0016565_1476_2366 296
789 3300035725 Ga0373947_0006809 Ga0373947_0006809_3692_4633 296
790 3300035725 Ga0373947_0013134 Ga0373947_0013134_3824_4714 296
791 3300035725 Ga0373947_0014697 Ga0373947_0014697_2655_3599 296
792 3300035725 Ga0373947_0054394 Ga0373947_0054394_421_1311 296
793 3300035725 Ga0373947_0061602 Ga0373947_0061602_639_1580 296
794 3300036401 Ga0373937_0002067 Ga0373937_0002067_15124_16014 296
795 3300036401 Ga0373937_0003621 Ga0373937_0003621_2948_3889 296
796 3300036401 Ga0373937_0144123 Ga0373937_0144123_120_1010 296
797 3300036401 Ga0373937_0233721 Ga0373937_0233721_545_1486 296
798 3300037068 Ga0373925_0000249 Ga0373925_0000249_22820_23761 296
799 3300037068 Ga0373925_0001925 Ga0373925_0001925_2616_3560 296
800 3300037068 Ga0373925_0096181 Ga0373925_0096181_333_1268 296
801 3300037068 Ga0373925_0182855 Ga0373925_0182855_463_1353 296
802 3300037312 Ga0395899_0014008 Ga0395899_0014008_4548_5438 296
803 3300037312 Ga0395899_0084987 Ga0395899_0084987_829_1764 296
804 3300037418 Ga0395900_0046094 Ga0395900_0046094_26_916 296
805 3300037418 Ga0395900_0295055 Ga0395900_0295055_223_1158 296
806 3300037466 Ga0395898_0145754 Ga0395898_0145754_662_1552 296
807 3300037471 Ga0395905_0110725 Ga0395905_0110725_159_1094 296
808 3300038443 Ga0395901_0097273 Ga0395901_0097273_958_1893 296
809 3300038996 Ga0242420_000772 Ga0242420_000772_212_1102 296
810 3300039437 Ga0436365_0330093 Ga0436365_0330093_1144_2079 296
811 3300039437 Ga0436365_0397707 Ga0436365_0397707_601_1497 296
812 3300039437 Ga0436365_0794950 Ga0436365_0794950_1691_2587 296
813 3300039437 Ga0436365_1923592 Ga0436365_1923592_59_955 296
814 3300039438 Ga0436360_0500596 Ga0436360_0500596_568_1509 296
815 3300039447 Ga0436361_0327070 Ga0436361_0327070_7734_8669 296
816 3300039447 Ga0436361_0474885 Ga0436361_0474885_2473_3408 296
817 3300039447 Ga0436361_0492112 Ga0436361_0492112_4938_5879 296
818 3300039450 Ga0436363_1120598 Ga0436363_1120598_17_952 296
819 3300042001 Ga0439441_002555 Ga0439441_002555_1646_2536 296
820 3300042005 Ga0439448_0031169 Ga0439448_0031169_598_1488 296
821 3300042436 Ga0439435_0041639 Ga0439435_0041639_218_1153 296
822 3300042461 Ga0439460_0045021 Ga0439460_0045021_119_1054 296
823 3300042876 Ga0451577_0255522 Ga0451577_0255522_527_1417 296
824 3300042993 Ga0439440_0008383 Ga0439440_0008383_1043_1978 296
825 3300044694 Ga0466963_0014372 Ga0466963_0014372_575_1468 296
826 3300044694 Ga0466963_0100809 Ga0466963_0100809_138_1028 296
827 3300044712 Ga0453684_0080311 Ga0453684_0080311_1236_2126 296
828 3300044842 Ga0466957_0017880 Ga0466957_0017880_41_931 296
829 3300044842 Ga0466957_0203949 Ga0466957_0203949_59_949 296
830 3300045049 Ga0466959_0316392 Ga0466959_0316392_38_931 296
831 3300046454 Ga0495592_0000022 Ga0495592_0000022_28956_29897 296
832 3300046454 Ga0495592_0008608 Ga0495592_0008608_5563_6453 296
833 3300046454 Ga0495592_0011867 Ga0495592_0011867_477_1418 296
834 3300046454 Ga0495592_0013017 Ga0495592_0013017_4228_5118 296
835 3300046454 Ga0495592_0161415 Ga0495592_0161415_415_1350 296
836 3300046455 Ga0495603_0033766 Ga0495603_0033766_350_1240 296
837 3300046455 Ga0495603_0047555 Ga0495603_0047555_1058_1948 296
838 3300046455 Ga0495603_0051826 Ga0495603_0051826_479_1369 296
839 3300046455 Ga0495603_0193777 Ga0495603_0193777_29_970 296
840 3300046459 Ga0495629_0000026 Ga0495629_0000026_103308_104198 296
841 3300046459 Ga0495629_0000409 Ga0495629_0000409_3768_4709 296
842 3300046459 Ga0495629_0012401 Ga0495629_0012401_5195_6136 296
843 3300046461 Ga0495641_0017376 Ga0495641_0017376_2503_3393 296
844 3300046462 Ga0495651_0001051 Ga0495651_0001051_3653_4594 296
845 3300046462 Ga0495651_0001548 Ga0495651_0001548_10730_11671 296
846 3300046462 Ga0495651_0013614 Ga0495651_0013614_2674_3564 296
847 3300046462 Ga0495651_0017121 Ga0495651_0017121_3104_3994 296
848 3300046462 Ga0495651_0137371 Ga0495651_0137371_151_1041 296
849 3300046463 Ga0495653_0000055 Ga0495653_0000055_31667_32608 296
850 3300046463 Ga0495653_0009787 Ga0495653_0009787_3317_4207 296
851 3300046463 Ga0495653_0012003 Ga0495653_0012003_982_1872 296
852 3300046463 Ga0495653_0018050 Ga0495653_0018050_1010_1951 296
853 3300046463 Ga0495653_0051356 Ga0495653_0051356_2055_2999 296
854 3300046472 Ga0495580_0006887 Ga0495580_0006887_557_1447 296
855 3300046472 Ga0495580_0025051 Ga0495580_0025051_287_1231 296
856 3300046472 Ga0495580_0061749 Ga0495580_0061749_592_1482 296
857 3300046473 Ga0495582_0006073 Ga0495582_0006073_4292_5182 296
858 3300046473 Ga0495582_0013298 Ga0495582_0013298_31_921 296
859 3300046473 Ga0495582_0052396 Ga0495582_0052396_151_1041 296
860 3300046475 Ga0495639_0042911 Ga0495639_0042911_795_1685 296
861 3300046475 Ga0495639_0069063 Ga0495639_0069063_86_1021 296
862 3300046475 Ga0495639_0095392 Ga0495639_0095392_31_921 296
863 3300046476 Ga0495662_0001894 Ga0495662_0001894_230_1171 296
864 3300046476 Ga0495662_0003150 Ga0495662_0003150_6917_7861 296
865 3300046476 Ga0495662_0010784 Ga0495662_0010784_549_1439 296
866 3300046476 Ga0495662_0056662 Ga0495662_0056662_241_1182 296
867 3300046477 Ga0495664_0000006 Ga0495664_0000006_263985_264926 296
868 3300046477 Ga0495664_0005906 Ga0495664_0005906_2765_3709 296
869 3300046477 Ga0495664_0007402 Ga0495664_0007402_2384_3274 296
870 3300046477 Ga0495664_0072871 Ga0495664_0072871_983_1924 296
871 3300046492 Ga0495585_0049171 Ga0495585_0049171_1090_1980 296
872 3300046499 Ga0495594_0012401 Ga0495594_0012401_2681_3571 296
873 3300046499 Ga0495594_0019299 Ga0495594_0019299_1380_2270 296
874 3300046499 Ga0495594_0085576 Ga0495594_0085576_558_1448 296
875 3300046501 Ga0495607_0010403 Ga0495607_0010403_1529_2419 296
876 3300046501 Ga0495607_0056603 Ga0495607_0056603_949_1884 296
877 3300046511 Ga0495608_0000002 Ga0495608_0000002_263933_264874 296
878 3300046511 Ga0495608_0006088 Ga0495608_0006088_6892_7782 296
879 3300046511 Ga0495608_0006648 Ga0495608_0006648_6563_7504 296
880 3300046514 Ga0495618_0000001 Ga0495618_0000001_120875_121816 296
881 3300046514 Ga0495618_0002201 Ga0495618_0002201_7329_8270 296
882 3300046514 Ga0495618_0059037 Ga0495618_0059037_18_962 296
883 3300046516 Ga0495628_0000004 Ga0495628_0000004_163485_164426 296
884 3300046516 Ga0495628_0021376 Ga0495628_0021376_3527_4417 296
885 3300046516 Ga0495628_0042157 Ga0495628_0042157_915_1856 296
886 3300046517 Ga0495630_0003468 Ga0495630_0003468_2357_3298 296
887 3300046517 Ga0495630_0011056 Ga0495630_0011056_2969_3910 296
888 3300046517 Ga0495630_0064058 Ga0495630_0064058_479_1369 296
889 3300046517 Ga0495630_0128836 Ga0495630_0128836_943_1878 296
890 3300046517 Ga0495630_0184910 Ga0495630_0184910_315_1205 296
891 3300046520 Ga0495637_0080842 Ga0495637_0080842_138_1073 296
892 3300046523 Ga0495644_0000312 Ga0495644_0000312_4005_4895 296
893 3300046525 Ga0495663_0058803 Ga0495663_0058803_186_1076 296
894 3300046526 Ga0495666_0009011 Ga0495666_0009011_3494_4384 296
895 3300046526 Ga0495666_0012241 Ga0495666_0012241_1694_2638 296
896 3300046526 Ga0495666_0019754 Ga0495666_0019754_1262_2152 296
897 3300046529 Ga0495652_0000007 Ga0495652_0000007_153067_154008 296
898 3300046529 Ga0495652_0030506 Ga0495652_0030506_907_1797 296
899 3300046529 Ga0495652_0049908 Ga0495652_0049908_1587_2531 296
900 3300046529 Ga0495652_0088050 Ga0495652_0088050_849_1739 296
901 3300046529 Ga0495652_0221580 Ga0495652_0221580_394_1335 296
902 3300046531 Ga0495665_0008576 Ga0495665_0008576_1638_2528 296
903 3300046531 Ga0495665_0009133 Ga0495665_0009133_3982_4872 296
904 3300046531 Ga0495665_0059593 Ga0495665_0059593_396_1337 296
905 3300046531 Ga0495665_0159736 Ga0495665_0159736_75_965 296
906 3300046533 Ga0495640_0000004 Ga0495640_0000004_286050_286991 296
907 3300046533 Ga0495640_0007732 Ga0495640_0007732_4498_5442 296
908 3300046533 Ga0495640_0017299 Ga0495640_0017299_1145_2086 296
909 3300046535 Ga0495586_0023372 Ga0495586_0023372_412_1302 296
910 3300046535 Ga0495586_0029905 Ga0495586_0029905_53_943 296
911 3300046536 Ga0495587_0000002 Ga0495587_0000002_160421_161362 296
912 3300046536 Ga0495587_0002925 Ga0495587_0002925_3428_4318 296
913 3300046536 Ga0495587_0005039 Ga0495587_0005039_5074_6015 296
914 3300046536 Ga0495587_0020800 Ga0495587_0020800_2314_3204 296
915 3300046536 Ga0495587_0025016 Ga0495587_0025016_2039_2980 296
916 3300046538 Ga0495609_0027480 Ga0495609_0027480_1397_2287 296
917 3300046538 Ga0495609_0033690 Ga0495609_0033690_15_905 296
918 3300046543 Ga0495645_0000008 Ga0495645_0000008_66535_67476 296
919 3300046543 Ga0495645_0003668 Ga0495645_0003668_1897_2787 296
920 3300046543 Ga0495645_0021226 Ga0495645_0021226_2392_3282 296
921 3300046543 Ga0495645_0054915 Ga0495645_0054915_715_1656 296
922 3300046558 Ga0495633_0001295 Ga0495633_0001295_15840_16730 296
923 3300046559 Ga0495667_0000006 Ga0495667_0000006_160408_161349 296
924 3300046559 Ga0495667_0002953 Ga0495667_0002953_6376_7266 296
925 3300046559 Ga0495667_0003478 Ga0495667_0003478_3767_4657 296
926 3300046559 Ga0495667_0007034 Ga0495667_0007034_4452_5393 296
927 3300046559 Ga0495667_0039564 Ga0495667_0039564_312_1202 296
928 3300046559 Ga0495667_0128741 Ga0495667_0128741_512_1453 296
929 3300046615 Ga0495656_0000522 Ga0495656_0000522_1071_1961 296
930 3300046642 Ga0495634_0000001 Ga0495634_0000001_138507_139448 296
931 3300046642 Ga0495634_0015929 Ga0495634_0015929_3102_3992 296
932 3300046642 Ga0495634_0023747 Ga0495634_0023747_2781_3722 296
933 3300046642 Ga0495634_0040721 Ga0495634_0040721_262_1152 296
934 3300046648 Ga0495611_0013926 Ga0495611_0013926_554_1444 296
935 3300046663 Ga0495635_0000004 Ga0495635_0000004_286006_286947 296
936 3300046663 Ga0495635_0000123 Ga0495635_0000123_33668_34612 296
937 3300046663 Ga0495635_0011422 Ga0495635_0011422_2952_3842 296
938 3300046663 Ga0495635_0016155 Ga0495635_0016155_2418_3308 296
939 3300046663 Ga0495635_0017382 Ga0495635_0017382_2930_3820 296
940 3300046663 Ga0495635_0028200 Ga0495635_0028200_2333_3274 296
941 3300046663 Ga0495635_0117984 Ga0495635_0117984_596_1486 296
942 3300046663 Ga0495635_0124318 Ga0495635_0124318_744_1685 296
943 3300046664 Ga0495659_0068501 Ga0495659_0068501_240_1175 296
944 3300046664 Ga0495659_0077831 Ga0495659_0077831_200_1090 296
945 3300046674 Ga0495588_0009872 Ga0495588_0009872_617_1507 296
946 3300046675 Ga0495657_0000139 Ga0495657_0000139_28972_29913 296
947 3300046675 Ga0495657_0009876 Ga0495657_0009876_4442_5332 296
948 3300046675 Ga0495657_0053038 Ga0495657_0053038_973_1914 296
949 3300046678 Ga0495599_0000003 Ga0495599_0000003_54146_55087 296
950 3300046678 Ga0495599_0010016 Ga0495599_0010016_3856_4746 296
951 3300046678 Ga0495599_0117601 Ga0495599_0117601_686_1576 296
952 3300046678 Ga0495599_0156758 Ga0495599_0156758_270_1211 296
953 3300046679 Ga0495623_0000048 Ga0495623_0000048_22680_23621 296
954 3300046679 Ga0495623_0002450 Ga0495623_0002450_1332_2222 296
955 3300046680 Ga0495646_0000001 Ga0495646_0000001_264042_264983 296
956 3300046680 Ga0495646_0006974 Ga0495646_0006974_2618_3559 296
957 3300046680 Ga0495646_0060709 Ga0495646_0060709_1001_1891 296
958 3300046681 Ga0495647_0012751 Ga0495647_0012751_1129_2019 296
959 3300046681 Ga0495647_0032742 Ga0495647_0032742_919_1863 296
960 3300046683 Ga0495658_0004396 Ga0495658_0004396_3838_4728 296
961 3300046683 Ga0495658_0031443 Ga0495658_0031443_1948_2838 296
962 3300046683 Ga0495658_0036565 Ga0495658_0036565_1808_2698 296
963 3300046683 Ga0495658_0042330 Ga0495658_0042330_139_1029 296
964 3300046684 Ga0495669_0031031 Ga0495669_0031031_562_1497 296
965 3300046689 Ga0495613_0003849 Ga0495613_0003849_8868_9758 296
966 3300046689 Ga0495613_0011297 Ga0495613_0011297_388_1332 296
967 3300046689 Ga0495613_0031905 Ga0495613_0031905_577_1512 296
968 3300046689 Ga0495613_0061800 Ga0495613_0061800_326_1216 296
969 3300046690 Ga0495624_0002831 Ga0495624_0002831_8421_9362 296
970 3300046690 Ga0495624_0007113 Ga0495624_0007113_6647_7591 296
971 3300046690 Ga0495624_0016426 Ga0495624_0016426_3205_4095 296
972 3300046690 Ga0495624_0032056 Ga0495624_0032056_1792_2733 296
973 3300046690 Ga0495624_0098731 Ga0495624_0098731_302_1192 296
974 3300046691 Ga0495670_0000701 Ga0495670_0000701_1088_1978 296
975 3300046691 Ga0495670_0149171 Ga0495670_0149171_236_1171 296
976 3300046694 Ga0495649_0052194 Ga0495649_0052194_747_1682 296
977 3300046809 Ga0495600_0000083 Ga0495600_0000083_19618_20559 296
978 3300046809 Ga0495600_0003659 Ga0495600_0003659_2843_3784 296
979 3300046809 Ga0495600_0008685 Ga0495600_0008685_3044_3934 296
980 3300046809 Ga0495600_0016229 Ga0495600_0016229_2313_3203 296
981 3300046809 Ga0495600_0194031 Ga0495600_0194031_290_1231 296
982 3300047315 Ga0495581_0003328 Ga0495581_0003328_4531_5421 296
983 3300047315 Ga0495581_0030379 Ga0495581_0030379_1554_2444 296
984 3300047315 Ga0495581_0052466 Ga0495581_0052466_459_1403 296
985 3300047315 Ga0495581_0071628 Ga0495581_0071628_965_1855 296
986 3300047315 Ga0495581_0092475 Ga0495581_0092475_751_1692 296
987 3300047317 Ga0495604_0000003 Ga0495604_0000003_263907_264848 296
988 3300047317 Ga0495604_0001090 Ga0495604_0001090_13475_14416 296
989 3300047317 Ga0495604_0009839 Ga0495604_0009839_779_1669 296
990 3300047317 Ga0495604_0012255 Ga0495604_0012255_5139_6029 296
991 3300047317 Ga0495604_0096576 Ga0495604_0096576_1102_2043 296
992 3300047319 Ga0495674_0000006 Ga0495674_0000006_202991_203932 296
993 3300047319 Ga0495674_0003125 Ga0495674_0003125_11806_12747 296
994 3300047319 Ga0495674_0003227 Ga0495674_0003227_4500_5444 296
995 3300047319 Ga0495674_0011118 Ga0495674_0011118_1100_1990 296
996 3300047321 Ga0495676_0052656 Ga0495676_0052656_1964_2899 296
997 3300047321 Ga0495676_0124665 Ga0495676_0124665_375_1265 296
998 3300047321 Ga0495676_0222156 Ga0495676_0222156_211_1155 296
999 3300047322 Ga0495680_0000795 Ga0495680_0000795_24160_25101 296
1000 3300047322 Ga0495680_0000825 Ga0495680_0000825_2006_2896 296
1001 3300047322 Ga0495680_0002001 Ga0495680_0002001_15829_16770 296
1002 3300047322 Ga0495680_0037655 Ga0495680_0037655_2953_3843 296
1003 3300047322 Ga0495680_0042963 Ga0495680_0042963_2525_3415 296
1004 3300047322 Ga0495680_0087177 Ga0495680_0087177_225_1115 296
1005 3300047323 Ga0495683_0144629 Ga0495683_0144629_130_1065 296
1006 3300047444 Ga0495675_0000109 Ga0495675_0000109_23134_24075 296
1007 3300047444 Ga0495675_0004145 Ga0495675_0004145_6261_7151 296
1008 3300047444 Ga0495675_0018767 Ga0495675_0018767_82_1023 296
1009 3300047471 Ga0495684_0000003 Ga0495684_0000003_177361_178302 296
1010 3300047471 Ga0495684_0005001 Ga0495684_0005001_2201_3142 296
1011 3300047471 Ga0495684_0005490 Ga0495684_0005490_5608_6498 296
1012 3300047471 Ga0495684_0251615 Ga0495684_0251615_81_1025 296
1013 3300047673 Ga0495593_0000767 Ga0495593_0000767_8396_9337 296
1014 3300047673 Ga0495593_0015854 Ga0495593_0015854_1094_2038 296
1015 3300047673 Ga0495593_0023159 Ga0495593_0023159_816_1706 296
1016 3300048088 Ga0495602_0000011 Ga0495602_0000011_63370_64311 296
1017 3300048088 Ga0495602_0001877 Ga0495602_0001877_824_1714 296
1018 3300048088 Ga0495602_0010500 Ga0495602_0010500_2796_3737 296
1019 3300048088 Ga0495602_0065204 Ga0495602_0065204_25_966 296
1020 3300048088 Ga0495602_0297384 Ga0495602_0297384_93_983 296
1021 3300048089 Ga0495614_0024177 Ga0495614_0024177_606_1496 296
1022 3300048089 Ga0495614_0058038 Ga0495614_0058038_466_1356 296
1023 3300048903 Ga0496100_0002097 Ga0496100_0002097_3370_4260 296
1024 3300048903 Ga0496100_0006356 Ga0496100_0006356_3844_4779 296
1025 3300048903 Ga0496100_0025496 Ga0496100_0025496_1115_2056 296
1026 3300048903 Ga0496100_0037227 Ga0496100_0037227_1146_2081 296
1027 3300048903 Ga0496100_0067752 Ga0496100_0067752_1082_1972 296
1028 3300048904 Ga0496101_0001573 Ga0496101_0001573_8447_9382 296
1029 3300048904 Ga0496101_0003612 Ga0496101_0003612_2819_3709 296
1030 3300048904 Ga0496101_0006966 Ga0496101_0006966_68_1003 296
1031 3300048904 Ga0496101_0084085 Ga0496101_0084085_1273_2163 296
1032 3300048905 Ga0496102_0014548 Ga0496102_0014548_5855_6790 296
1033 3300048905 Ga0496102_0016207 Ga0496102_0016207_4668_5603 296
1034 3300048905 Ga0496102_0203036 Ga0496102_0203036_741_1631 296
1035 3300048905 Ga0496102_0223176 Ga0496102_0223176_275_1216 296
1036 3300048905 Ga0496102_0337506 Ga0496102_0337506_106_1041 296
1037 3300048906 Ga0496103_0000963 Ga0496103_0000963_3369_4259 296
1038 3300048906 Ga0496103_0012426 Ga0496103_0012426_2710_3645 296
1039 3300048907 Ga0496104_0003080 Ga0496104_0003080_572_1507 296
1040 3300048907 Ga0496104_0008002 Ga0496104_0008002_7347_8282 296
1041 3300048907 Ga0496104_0017091 Ga0496104_0017091_873_1808 296
1042 3300048907 Ga0496104_0057914 Ga0496104_0057914_2533_3423 296
1043 3300048907 Ga0496104_0060617 Ga0496104_0060617_1186_2076 296
1044 3300048907 Ga0496104_0208634 Ga0496104_0208634_104_994 296
1045 3300048908 Ga0496105_0006839 Ga0496105_0006839_4286_5176 296
1046 3300048908 Ga0496105_0016436 Ga0496105_0016436_4192_5082 296
1047 3300048908 Ga0496105_0017193 Ga0496105_0017193_4441_5376 296
1048 3300048908 Ga0496105_0020989 Ga0496105_0020989_878_1813 296
1049 3300048908 Ga0496105_0042813 Ga0496105_0042813_952_1887 296
1050 3300048908 Ga0496105_0061855 Ga0496105_0061855_1721_2611 296
1051 3300048909 Ga0496106_0007022 Ga0496106_0007022_772_1662 296
1052 3300048909 Ga0496106_0008577 Ga0496106_0008577_4441_5376 296
1053 3300048909 Ga0496106_0010388 Ga0496106_0010388_5543_6433 296
1054 3300048909 Ga0496106_0049674 Ga0496106_0049674_1417_2352 296
1055 3300048909 Ga0496106_0052883 Ga0496106_0052883_1600_2490 296
1056 3300048909 Ga0496106_0068739 Ga0496106_0068739_317_1252 296
1057 3300048909 Ga0496106_0497504 Ga0496106_0497504_14_949 296
1058 3300048910 Ga0496107_0004013 Ga0496107_0004013_4364_5299 296
1059 3300048910 Ga0496107_0012549 Ga0496107_0012549_1202_2092 296
1060 3300048910 Ga0496107_0023797 Ga0496107_0023797_1007_1942 296
1061 3300048910 Ga0496107_0031391 Ga0496107_0031391_2742_3632 296
1062 3300048911 Ga0496108_0000626 Ga0496108_0000626_13769_14704 296
1063 3300048911 Ga0496108_0001093 Ga0496108_0001093_4567_5502 296
1064 3300048911 Ga0496108_0010782 Ga0496108_0010782_515_1450 296
1065 3300048911 Ga0496108_0014245 Ga0496108_0014245_1716_2606 296
1066 3300048911 Ga0496108_0017276 Ga0496108_0017276_4901_5836 296
1067 3300048911 Ga0496108_0080063 Ga0496108_0080063_795_1685 296
1068 3300048911 Ga0496108_0110276 Ga0496108_0110276_1057_1947 296
1069 3300048912 Ga0496109_0001690 Ga0496109_0001690_8429_9319 296
1070 3300048912 Ga0496109_0002491 Ga0496109_0002491_1222_2157 296
1071 3300048912 Ga0496109_0002725 Ga0496109_0002725_7423_8358 296
1072 3300048912 Ga0496109_0028465 Ga0496109_0028465_15_950 296
1073 3300048912 Ga0496109_0045631 Ga0496109_0045631_2454_3389 296
1074 3300048912 Ga0496109_0093967 Ga0496109_0093967_1082_1972 296
1075 3300048912 Ga0496109_0110973 Ga0496109_0110973_900_1790 296
1076 3300048912 Ga0496109_0428696 Ga0496109_0428696_263_1198 296
1077 3300048913 Ga0496110_0005926 Ga0496110_0005926_1589_2524 296
1078 3300048913 Ga0496110_0009277 Ga0496110_0009277_6662_7597 296
1079 3300048913 Ga0496110_0009396 Ga0496110_0009396_2188_3123 296
1080 3300048913 Ga0496110_0126494 Ga0496110_0126494_798_1733 296
1081 3300048913 Ga0496110_0553494 Ga0496110_0553494_137_1027 296
1082 3300048914 Ga0496111_0002392 Ga0496111_0002392_8946_9881 296
1083 3300048914 Ga0496111_0010978 Ga0496111_0010978_5021_5956 296
1084 3300048914 Ga0496111_0014108 Ga0496111_0014108_1281_2171 296
1085 3300048914 Ga0496111_0020330 Ga0496111_0020330_1295_2230 296
1086 3300048914 Ga0496111_0022206 Ga0496111_0022206_2267_3157 296
1087 3300048914 Ga0496111_0032758 Ga0496111_0032758_1987_2877 296
1088 3300048914 Ga0496111_0327728 Ga0496111_0327728_185_1120 296
1089 3300048915 Ga0496112_0002087 Ga0496112_0002087_14381_15271 296
1090 3300048915 Ga0496112_0006295 Ga0496112_0006295_6373_7308 296
1091 3300048915 Ga0496112_0009904 Ga0496112_0009904_3409_4344 296
1092 3300048915 Ga0496112_0013016 Ga0496112_0013016_1036_1926 296
1093 3300048915 Ga0496112_0035200 Ga0496112_0035200_2697_3638 296
1094 3300048915 Ga0496112_0088433 Ga0496112_0088433_1854_2789 296
1095 3300048915 Ga0496112_0103374 Ga0496112_0103374_670_1560 296
1096 3300048916 Ga0496113_0000329 Ga0496113_0000329_18880_19770 296
1097 3300048916 Ga0496113_0000855 Ga0496113_0000855_3791_4726 296
1098 3300048916 Ga0496113_0007129 Ga0496113_0007129_4117_5052 296
1099 3300048916 Ga0496113_0023131 Ga0496113_0023131_3367_4257 296
1100 3300048916 Ga0496113_0034534 Ga0496113_0034534_1528_2463 296
1101 3300048916 Ga0496113_0069969 Ga0496113_0069969_1363_2253 296
1102 3300048916 Ga0496113_0177889 Ga0496113_0177889_563_1504 296
1103 3300048917 Ga0496114_0001660 Ga0496114_0001660_13538_14428 296
1104 3300048917 Ga0496114_0048532 Ga0496114_0048532_2197_3087 296
1105 3300048917 Ga0496114_0158674 Ga0496114_0158674_235_1125 296
1106 3300048918 Ga0496115_0001117 Ga0496115_0001117_16514_17404 296
1107 3300048918 Ga0496115_0152187 Ga0496115_0152187_448_1338 296
1108 3300048918 Ga0496115_0228020 Ga0496115_0228020_96_986 296
1109 3300048918 Ga0496115_0278007 Ga0496115_0278007_396_1331 296
1110 3300048928 Ga0496125_0122443 Ga0496125_0122443_652_1542 296
1111 3300049568 Ga0501031_0077351 Ga0501031_0077351_1053_1949 296
1112 3300049569 Ga0501032_0033654 Ga0501032_0033654_1328_2224 296
1113 3300049569 Ga0501032_0079696 Ga0501032_0079696_95_991 296
1114 3300049569 Ga0501032_0114952 Ga0501032_0114952_134_1030 296
1115 3300049570 Ga0501033_0082791 Ga0501033_0082791_409_1305 296
1116 3300049571 Ga0501034_0000772 Ga0501034_0000772_39174_40070 296
1117 3300049571 Ga0501034_0019501 Ga0501034_0019501_127_1023 296
1118 3300049571 Ga0501034_0031173 Ga0501034_0031173_2177_3073 296
1119 3300049571 Ga0501034_0156132 Ga0501034_0156132_1310_2206 296
1120 3300049571 Ga0501034_0350334 Ga0501034_0350334_204_1094 296
1121 3300049572 Ga0501036_0001347 Ga0501036_0001347_14760_15656 296
1122 3300049572 Ga0501036_0005113 Ga0501036_0005113_2944_3840 296
1123 3300049572 Ga0501036_0005897 Ga0501036_0005897_820_1716 296
1124 3300049572 Ga0501036_0012992 Ga0501036_0012992_1768_2739 296
1125 3300049572 Ga0501036_0203394 Ga0501036_0203394_653_1549 296
1126 3300049573 Ga0501037_0006285 Ga0501037_0006285_4884_5780 296
1127 3300049573 Ga0501037_0008680 Ga0501037_0008680_2550_3446 296
1128 3300049573 Ga0501037_0025041 Ga0501037_0025041_2699_3595 296
1129 3300049574 Ga0501038_0026586 Ga0501038_0026586_3392_4288 296
1130 3300049574 Ga0501038_0076017 Ga0501038_0076017_257_1153 296
1131 3300049574 Ga0501038_0121374 Ga0501038_0121374_45_941 296
1132 3300049575 Ga0501039_0009445 Ga0501039_0009445_2663_3559 296
1133 3300049575 Ga0501039_0050088 Ga0501039_0050088_1500_2396 296
1134 3300049576 Ga0501040_0375304 Ga0501040_0375304_56_952 296
1135 3300049578 Ga0501042_0292404 Ga0501042_0292404_244_1140 296
1136 3300049579 Ga0501043_0006610 Ga0501043_0006610_3799_4695 296
1137 3300049579 Ga0501043_0035066 Ga0501043_0035066_1823_2719 296
1138 3300049580 Ga0501046_0028930 Ga0501046_0028930_2990_3886 296
1139 3300049580 Ga0501046_0029341 Ga0501046_0029341_900_1871 296
1140 3300049580 Ga0501046_0031961 Ga0501046_0031961_2615_3511 296
1141 3300049580 Ga0501046_0079870 Ga0501046_0079870_750_1646 296
1142 3300049581 Ga0501047_0000136 Ga0501047_0000136_83762_84658 296
1143 3300049581 Ga0501047_0007923 Ga0501047_0007923_6989_7879 296
1144 3300049581 Ga0501047_0089349 Ga0501047_0089349_2019_2915 296
1145 3300049581 Ga0501047_0093053 Ga0501047_0093053_1269_2165 296
1146 3300049582 Ga0501048_0000039 Ga0501048_0000039_35607_36503 296
1147 3300049582 Ga0501048_0014119 Ga0501048_0014119_1451_2422 296
1148 3300049582 Ga0501048_0072602 Ga0501048_0072602_1506_2402 296
1149 3300049583 Ga0501067_0019377 Ga0501067_0019377_1255_2151 296
1150 3300049584 Ga0501068_0019636 Ga0501068_0019636_2883_3779 296
1151 3300049584 Ga0501068_0053873 Ga0501068_0053873_876_1772 296
1152 3300049584 Ga0501068_0058714 Ga0501068_0058714_1260_2156 296
1153 3300049586 Ga0501070_0048115 Ga0501070_0048115_883_1779 296
1154 3300049586 Ga0501070_0064092 Ga0501070_0064092_933_1829 296
1155 3300049586 Ga0501070_0071174 Ga0501070_0071174_773_1669 296
1156 3300049588 Ga0501072_0041737 Ga0501072_0041737_1041_1982 296
1157 3300049588 Ga0501072_0140764 Ga0501072_0140764_761_1657 296
1158 3300049588 Ga0501072_0299083 Ga0501072_0299083_265_1161 296
1159 3300049589 Ga0501073_0007504 Ga0501073_0007504_4374_5270 296
1160 3300049589 Ga0501073_0072356 Ga0501073_0072356_674_1570 296
1161 3300049589 Ga0501073_0363455 Ga0501073_0363455_12_908 296
1162 3300049590 Ga0501074_0011889 Ga0501074_0011889_3549_4445 296
1163 3300049590 Ga0501074_0034926 Ga0501074_0034926_1679_2575 296
1164 3300049591 Ga0501075_0010046 Ga0501075_0010046_3519_4490 296
1165 3300049591 Ga0501075_0028210 Ga0501075_0028210_1205_2146 296
1166 3300049592 Ga0501076_0003117 Ga0501076_0003117_3704_4675 296
1167 3300049592 Ga0501076_0027114 Ga0501076_0027114_1462_2403 296
1168 3300049593 Ga0501077_0013675 Ga0501077_0013675_2475_3365 296
1169 3300049593 Ga0501077_0046503 Ga0501077_0046503_338_1309 296
1170 3300049741 Ga0501079_0008450 Ga0501079_0008450_2405_3376 296
1171 3300049741 Ga0501079_0046472 Ga0501079_0046472_1984_2877 296
1172 3300049741 Ga0501079_0074600 Ga0501079_0074600_422_1318 296
1173 3300049741 Ga0501079_0173682 Ga0501079_0173682_426_1367 296
1174 3300049742 Ga0501080_0000022 Ga0501080_0000022_25229_26125 296
1175 3300049742 Ga0501080_0028092 Ga0501080_0028092_81_977 296
1176 3300049742 Ga0501080_0058994 Ga0501080_0058994_806_1702 296
1177 3300049742 Ga0501080_0118905 Ga0501080_0118905_1095_1988 296
1178 3300049742 Ga0501080_0183106 Ga0501080_0183106_894_1865 296
1179 3300049743 Ga0501081_0005161 Ga0501081_0005161_2999_3892 296
1180 3300049743 Ga0501081_0022554 Ga0501081_0022554_2658_3629 296
1181 3300049744 Ga0501083_0009158 Ga0501083_0009158_3945_4835 296
1182 3300049744 Ga0501083_0031756 Ga0501083_0031756_1478_2374 296
1183 3300049744 Ga0501083_0058740 Ga0501083_0058740_475_1371 296
1184 3300049744 Ga0501083_0080094 Ga0501083_0080094_889_1785 296
1185 3300049744 Ga0501083_0136140 Ga0501083_0136140_40_936 296
1186 3300049822 Ga0501035_0038898 Ga0501035_0038898_2807_3778 296
1187 3300049822 Ga0501035_0039580 Ga0501035_0039580_3114_4010 296
1188 3300049822 Ga0501035_0067613 Ga0501035_0067613_469_1359 296
1189 3300049822 Ga0501035_0205427 Ga0501035_0205427_95_991 296
1190 3300049822 Ga0501035_0256786 Ga0501035_0256786_572_1468 296
1191 3300049823 Ga0501044_0005112 Ga0501044_0005112_4701_5597 296
1192 3300049823 Ga0501044_0037235 Ga0501044_0037235_2007_2903 296
1193 3300049823 Ga0501044_0057707 Ga0501044_0057707_818_1714 296
1194 3300049823 Ga0501044_0133556 Ga0501044_0133556_1011_1907 296
1195 3300049824 Ga0501045_0022917 Ga0501045_0022917_2576_3547 296
1196 3300049824 Ga0501045_0199719 Ga0501045_0199719_409_1350 296
1197 3300050494 nmdc:mga06z11_17026_c1 nmdc:mga06z11_17026_c1_820_1755 296
1198 3300050494 nmdc:mga06z11_259108_c1 nmdc:mga06z11_259108_c1_89_979 296
1199 3300050507 nmdc:mga05p37_16217_c1 nmdc:mga05p37_16217_c1_1373_2308 296
1200 3300050507 nmdc:mga05p37_248326_c1 nmdc:mga05p37_248326_c1_682_1572 296
1201 3300050507 nmdc:mga05p37_35915_c1 nmdc:mga05p37_35915_c1_2965_3936 296
1202 3300050507 nmdc:mga05p37_5080_c1 nmdc:mga05p37_5080_c1_10062_10997 296
1203 3300050508 nmdc:mga09592_9145_c1 nmdc:mga09592_9145_c1_5202_6143 296
1204 3300050509 nmdc:mga0qj67_113891_c1 nmdc:mga0qj67_113891_c1_59_994 296
1205 3300050510 nmdc:mga06r32_72029_c1 nmdc:mga06r32_72029_c1_889_1830 296
1206 3300050511 nmdc:mga08y16_1115_c1 nmdc:mga08y16_1115_c1_8720_9610 296
1207 3300050511 nmdc:mga08y16_146103_c1 nmdc:mga08y16_146103_c1_132_1067 296
1208 3300050511 nmdc:mga08y16_279183_c1 nmdc:mga08y16_279183_c1_637_1608 296
1209 3300050511 nmdc:mga08y16_335349_c1 nmdc:mga08y16_335349_c1_368_1303 296
1210 3300050511 nmdc:mga08y16_58759_c1 nmdc:mga08y16_58759_c1_3032_3922 296
1211 3300050511 nmdc:mga08y16_940_c1 nmdc:mga08y16_940_c1_9411_10301 296
1212 3300050512 nmdc:mga0n895_580510_c1 nmdc:mga0n895_580510_c1_66_1037 296
1213 3300050512 nmdc:mga0n895_6093_c1 nmdc:mga0n895_6093_c1_5659_6549 296
1214 3300050512 nmdc:mga0n895_68710_c1 nmdc:mga0n895_68710_c1_353_1243 296
1215 3300050513 nmdc:mga0rr50_124793_c1 nmdc:mga0rr50_124793_c1_876_1766 296
1216 3300050513 nmdc:mga0rr50_24181_c1 nmdc:mga0rr50_24181_c1_2043_2933 296
1217 3300050513 nmdc:mga0rr50_269319_c1 nmdc:mga0rr50_269319_c1_341_1276 296
1218 3300050514 nmdc:mga08x19_23812_c1 nmdc:mga08x19_23812_c1_2380_3321 296
1219 3300050515 nmdc:mga0a205_14863_c1 nmdc:mga0a205_14863_c1_3649_4539 296
1220 3300050515 nmdc:mga0a205_183933_c1 nmdc:mga0a205_183933_c1_494_1384 296
1221 3300050515 nmdc:mga0a205_213_c1 nmdc:mga0a205_213_c1_14810_15700 296
1222 3300053077 Ga0495601_0000004 Ga0495601_0000004_184104_185045 296
1223 3300053077 Ga0495601_0000347 Ga0495601_0000347_22858_23748 296
1224 3300053077 Ga0495601_0000993 Ga0495601_0000993_9810_10754 296
1225 3300053077 Ga0495601_0001303 Ga0495601_0001303_7224_8114 296
1226 3300053078 Ga0495612_0000008 Ga0495612_0000008_28217_29158 296
1227 3300053078 Ga0495612_0002372 Ga0495612_0002372_1469_2413 296
1228 3300053078 Ga0495612_0004290 Ga0495612_0004290_4268_5209 296
1229 3300053078 Ga0495612_0007390 Ga0495612_0007390_2006_2896 296
1230 3300053078 Ga0495612_0045915 Ga0495612_0045915_30_920 296
1231 3300053084 Ga0495595_0000231 Ga0495595_0000231_9417_10358 296
1232 3300053084 Ga0495595_0001232 Ga0495595_0001232_4847_5788 296
1233 3300053084 Ga0495595_0005605 Ga0495595_0005605_1390_2280 296
1234 3300053084 Ga0495595_0009841 Ga0495595_0009841_1187_2077 296
1235 3300053085 Ga0495619_0000005 Ga0495619_0000005_264048_264989 296
1236 3300053085 Ga0495619_0000083 Ga0495619_0000083_43123_44013 296
1237 3300053085 Ga0495619_0000360 Ga0495619_0000360_10174_11064 296
1238 3300053085 Ga0495619_0001190 Ga0495619_0001190_15683_16624 296
1239 3300053085 Ga0495619_0013867 Ga0495619_0013867_1588_2532 296
1240 3300053085 Ga0495619_0023486 Ga0495619_0023486_1058_1948 296
1241 3300053085 Ga0495619_0091584 Ga0495619_0091584_251_1192 296
1242 3300053094 Ga0500566_0122855 Ga0500566_0122855_415_1305 296
1243 3300053096 Ga0500641_0015864 Ga0500641_0015864_776_1666 296
1244 3300054114 Ga0501084_0044973 Ga0501084_0044973_2074_3045 296
1245 3300054114 Ga0501084_0050694 Ga0501084_0050694_1062_1955 296
1246 3300054114 Ga0501084_0239560 Ga0501084_0239560_481_1377 296
1247 3300060353 Ga0501082_0009209 Ga0501082_0009209_5965_6855 296
1248 3300060353 Ga0501082_0012714 Ga0501082_0012714_4938_5831 296
1249 3300060353 Ga0501082_0018728 Ga0501082_0018728_2468_3439 296
1250 3300060353 Ga0501082_0263132 Ga0501082_0263132_377_1318 296
1251 3300061719 Ga0466962_0079558 Ga0466962_0079558_258_1148 296
1252 3300061734 Ga0530510_0025912 Ga0530510_0025912_2658_3629 296
1253 3300061734 Ga0530510_0029751 Ga0530510_0029751_920_1861 296
1254 3300061734 Ga0530510_0134102 Ga0530510_0134102_740_1675 296
1255 3300061734 Ga0530510_0192710 Ga0530510_0192710_481_1434 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04444

Dioxygenase_N

Catechol dioxygenase N terminus

39

113

0.96

PF00775

Dioxygenase_C

Dioxygenase

117

299

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tmx-assembly1.cif.gz_B crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.9414 5 286
1tmx-assembly1.cif.gz_B crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.913 5 286
1tmx-assembly1.cif.gz_A crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e 0.9074 5 286
3th1-assembly1.cif.gz_A-2 crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida 0.8942 21 284
3n9t-assembly1.cif.gz_A-2 cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4 0.8917 6 286
ID Description Score Start End Superfamily
af_P86029_1_299_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9171 7 285 2.60.130.10
af_Q59Z18_7_293_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9114 1 283 2.60.130.10
1tmxA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9074 5 286 2.60.130.10
3th1A00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8942 21 284 2.60.130.10
af_Q59Z18_7_293_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8935 1 283 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A5E8VIE8-F1-model_v4 Catechol 1,2-dioxygenase 0.9843 1 296 GO:0008199
GO:0009712
GO:0018576
AF-A5VH88-F1-model_v4 deleted 0.9831 2 296
AF-A0A7W5KI92-F1-model_v4 deleted 0.9829 33 296
AF-A0A5E8VIE8-F1-model_v4 Catechol 1,2-dioxygenase 0.981 1 296 GO:0008199
GO:0009712
GO:0018576
AF-A0A840SSC0-F1-model_v4 Catechol 1,2-dioxygenase (EC 1.13.11.1) 0.9741 2 296 GO:0008199
GO:0009712
GO:0018576

Feature Viewer

pLDDT pTM Quality
91.85 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map