F492251
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1255 | 481 | 1254 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_13334_c1|nmdc:mga00v17_13334_c1_3340_4329 |
| Length | 329 |
| Sequence | VDARHKAGHDEVKGQNPMIIERQEDVTPAVLKELARAPNARFKEIMGPFIRHMHDFIRESKLTEEEFRTAMNYVVALGKASNESHNEAVLIAGSLGISSLVCLLNNSDGQTDTDASLLGPFWREQSPITPNGASIVRSATPGPALFVKAWFRDRAGNPIKGAEVDIWQSSTEGFYENQDPGQADMNLRGKFFTDENGYIAFQSIKPAGYPIPVHGPTGDLLRAQGRHNMRPAHLHFLASKDGFKTLISQIYVADDKNIDSDVQFGVTRHLIGNFAKHDGPAPTANVTGTWYSLDHNFVMEAGPSKLPRAPITGKAQGERPALPVLERVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 126 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 131 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 132 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 133 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 139 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 155 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 156 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 174 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 175 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 267 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 268 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 269 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 276 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 277 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 278 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 279 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 280 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 281 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 282 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 304 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 305 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 308 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 309 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 310 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 313 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 314 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 315 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 316 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 317 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 318 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 319 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 320 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 321 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 322 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 323 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 324 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 325 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 326 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 327 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 328 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 329 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 330 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 450 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 467 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 469 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 471 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 473 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 474 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 476 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 477 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 478 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 481 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.92 |
| Metatranscriptomes | 0 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 0 |
| Rhizoplane | 8.05 |
| Rhizosphere | 86.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1075987 | 2162886007 | Bacteria | 1498 |
| 2 | 2214800751 | 2209111006 | Bacteria | 11360 |
| 3 | 2214809099 | 2209111006 | Bacteria | 1998 |
| 4 | ARcpr5oldR_c000150 | 3300000041 | Bacteria | 12077 |
| 5 | ARSoilYngRDRAFT_c00266 | 3300000042 | Bacteria | 7923 |
| 6 | ARcpr5yngRDRAFT_c000123 | 3300000043 | Bacteria | 12049 |
| 7 | ARSoilOldRDRAFT_c000007 | 3300000044 | Bacteria | 55959 |
| 8 | ARCol0oldRDRAFT_c00020 | 3300000045 | Bacteria | 12065 |
| 9 | ARCol0yngRDRAFT_1000009 | 3300000652 | Bacteria | 43473 |
| 10 | JGI24741J21665_1012297 | 3300001915 | Bacteria | 1474 |
| 11 | JGI24746J21847_1006319 | 3300001977 | Bacteria | 1840 |
| 12 | JGI24739J22299_10003727 | 3300001989 | Bacteria | 5818 |
| 13 | JGI24737J22298_10028599 | 3300001990 | Bacteria | 1751 |
| 14 | JGI24737J22298_10055890 | 3300001990 | Bacteria | 1193 |
| 15 | JGI24743J22301_10005560 | 3300001991 | Bacteria | 2109 |
| 16 | JGI24750J21931_1000613 | 3300002070 | Bacteria | 5366 |
| 17 | JGI24738J21930_10003331 | 3300002075 | Bacteria | 4075 |
| 18 | JGI24749J21850_1015264 | 3300002076 | Bacteria | 1078 |
| 19 | JGI24744J21845_10001820 | 3300002077 | Bacteria | 4283 |
| 20 | JGI24744J21845_10001986 | 3300002077 | Bacteria | 4137 |
| 21 | JGI24035J26624_1000072 | 3300002126 | Bacteria | 8181 |
| 22 | JGI24033J26618_1004187 | 3300002155 | Bacteria | 1549 |
| 23 | JGI24033J26618_1005390 | 3300002155 | Bacteria | 1409 |
| 24 | JGI24034J26672_10000632 | 3300002239 | Bacteria | 4522 |
| 25 | JGI24742J22300_10002483 | 3300002244 | Bacteria | 2949 |
| 26 | JGI24751J29686_10010480 | 3300002459 | Bacteria | 1911 |
| 27 | JGI25158J39367_1004330 | 3300002739 | Bacteria | 2136 |
| 28 | JGI25159J45721_1000675 | 3300002987 | Bacteria | 15067 |
| 29 | JGI25151J46595_10018941 | 3300003187 | Bacteria | 2939 |
| 30 | JGI25406J46586_10009709 | 3300003203 | Bacteria | 4301 |
| 31 | JGI25160J50197_1000962 | 3300003354 | Bacteria | 15067 |
| 32 | JGI25404J52841_10012261 | 3300003659 | Bacteria | 1856 |
| 33 | Ga0055532_1000231 | 3300003758 | Bacteria | 41528 |
| 34 | Ga0055527_1000188 | 3300003760 | Bacteria | 41528 |
| 35 | Ga0055535_1000592 | 3300003761 | Bacteria | 29980 |
| 36 | Ga0055542_1001825 | 3300003762 | Bacteria | 8718 |
| 37 | Ga0055526_1014272 | 3300003771 | Bacteria | 3281 |
| 38 | Ga0055543_1003620 | 3300004625 | Bacteria | 4468 |
| 39 | Ga0065165_1002550 | 3300005262 | Bacteria | 15105 |
| 40 | Ga0065716_1001883 | 3300005277 | Bacteria | 2879 |
| 41 | Ga0065704_10080735 | 3300005289 | Bacteria | 3833 |
| 42 | Ga0065712_10070846 | 3300005290 | Bacteria | 5648 |
| 43 | Ga0065715_10212808 | 3300005293 | Bacteria | 1306 |
| 44 | Ga0065715_10257302 | 3300005293 | Bacteria | 1148 |
| 45 | Ga0065715_10303590 | 3300005293 | Bacteria | 1036 |
| 46 | Ga0070658_10027080 | 3300005327 | Bacteria | 4602 |
| 47 | Ga0070658_10155840 | 3300005327 | Bacteria | 1915 |
| 48 | Ga0070658_10400048 | 3300005327 | Unclassified | 1180 |
| 49 | Ga0070676_10000884 | 3300005328 | Bacteria | 14780 |
| 50 | Ga0070676_10008244 | 3300005328 | Bacteria | 5610 |
| 51 | Ga0070683_100201988 | 3300005329 | Bacteria | 1887 |
| 52 | Ga0070690_100014364 | 3300005330 | Bacteria | 4699 |
| 53 | Ga0070690_100034837 | 3300005330 | Bacteria | 3156 |
| 54 | Ga0070690_100312567 | 3300005330 | Unclassified | 1130 |
| 55 | Ga0070670_100006862 | 3300005331 | Bacteria | 9649 |
| 56 | Ga0070670_100066773 | 3300005331 | Bacteria | 3087 |
| 57 | Ga0070670_100069045 | 3300005331 | Bacteria | 3033 |
| 58 | Ga0070670_100094337 | 3300005331 | Bacteria | 2573 |
| 59 | Ga0070677_10000988 | 3300005333 | Bacteria | 9191 |
| 60 | Ga0070677_10020355 | 3300005333 | Bacteria | 2416 |
| 61 | Ga0068869_100032403 | 3300005334 | Bacteria | 3682 |
| 62 | Ga0068869_100077044 | 3300005334 | Bacteria | 2479 |
| 63 | Ga0070666_10085701 | 3300005335 | Bacteria | 2158 |
| 64 | Ga0070666_10123437 | 3300005335 | Bacteria | 1797 |
| 65 | Ga0070666_10173559 | 3300005335 | Bacteria | 1510 |
| 66 | Ga0070680_100016581 | 3300005336 | Bacteria | 5797 |
| 67 | Ga0070680_100419011 | 3300005336 | Bacteria | 1142 |
| 68 | Ga0070682_100068289 | 3300005337 | Bacteria | 2266 |
| 69 | Ga0068868_100011533 | 3300005338 | Bacteria | 6437 |
| 70 | Ga0068868_100032503 | 3300005338 | Bacteria | 4014 |
| 71 | Ga0070660_100006262 | 3300005339 | Bacteria | 8241 |
| 72 | Ga0070689_100033029 | 3300005340 | Bacteria | 3940 |
| 73 | Ga0070689_100046647 | 3300005340 | Bacteria | 3339 |
| 74 | Ga0070689_100159190 | 3300005340 | Bacteria | 1824 |
| 75 | Ga0070689_100169480 | 3300005340 | Bacteria | 1768 |
| 76 | Ga0070691_10001048 | 3300005341 | Bacteria | 11394 |
| 77 | Ga0070691_10002316 | 3300005341 | Bacteria | 8434 |
| 78 | Ga0070691_10016847 | 3300005341 | Bacteria | 3360 |
| 79 | Ga0070687_100006103 | 3300005343 | Bacteria | 4918 |
| 80 | Ga0070687_100015548 | 3300005343 | Bacteria | 3445 |
| 81 | Ga0070687_100226203 | 3300005343 | Bacteria | 1149 |
| 82 | Ga0070661_100031155 | 3300005344 | Bacteria | 3855 |
| 83 | Ga0070661_100071832 | 3300005344 | Bacteria | 2547 |
| 84 | Ga0070692_10001006 | 3300005345 | Bacteria | 9699 |
| 85 | Ga0070692_10017275 | 3300005345 | Bacteria | 3445 |
| 86 | Ga0070668_100071279 | 3300005347 | Bacteria | 2707 |
| 87 | Ga0070675_100002103 | 3300005354 | Bacteria | 14725 |
| 88 | Ga0070675_100081609 | 3300005354 | Bacteria | 2697 |
| 89 | Ga0070675_100112371 | 3300005354 | Bacteria | 2307 |
| 90 | Ga0070671_100015813 | 3300005355 | Bacteria | 6095 |
| 91 | Ga0070671_100021922 | 3300005355 | Bacteria | 5218 |
| 92 | Ga0070671_100083504 | 3300005355 | Bacteria | 2671 |
| 93 | Ga0070674_100017597 | 3300005356 | Bacteria | 4501 |
| 94 | Ga0070674_100032398 | 3300005356 | Bacteria | 3471 |
| 95 | Ga0070674_100133795 | 3300005356 | Bacteria | 1852 |
| 96 | Ga0070673_100000950 | 3300005364 | Bacteria | 16418 |
| 97 | Ga0070673_100003515 | 3300005364 | Bacteria | 9767 |
| 98 | Ga0070673_100006321 | 3300005364 | Bacteria | 7693 |
| 99 | Ga0070673_100104219 | 3300005364 | Bacteria | 2341 |
| 100 | Ga0070673_100183299 | 3300005364 | Bacteria | 1793 |
| 101 | Ga0070688_100093367 | 3300005365 | Bacteria | 1970 |
| 102 | Ga0070688_100214816 | 3300005365 | Bacteria | 1352 |
| 103 | Ga0070688_100324500 | 3300005365 | Bacteria | 1120 |
| 104 | Ga0070659_100215754 | 3300005366 | Bacteria | 1582 |
| 105 | Ga0070667_100008645 | 3300005367 | Bacteria | 8438 |
| 106 | Ga0070667_100115440 | 3300005367 | Bacteria | 2332 |
| 107 | Ga0070667_100243221 | 3300005367 | Bacteria | 1607 |
| 108 | Ga0070667_100260753 | 3300005367 | Unclassified | 1552 |
| 109 | Ga0070667_100393820 | 3300005367 | Bacteria | 1260 |
| 110 | Ga0070703_10001238 | 3300005406 | Bacteria | 7788 |
| 111 | Ga0070709_10002890 | 3300005434 | Bacteria | 9260 |
| 112 | Ga0070709_10086506 | 3300005434 | Bacteria | 2058 |
| 113 | Ga0070714_100018377 | 3300005435 | Bacteria | 5679 |
| 114 | Ga0070714_100062021 | 3300005435 | Bacteria | 3213 |
| 115 | Ga0070714_100088698 | 3300005435 | Bacteria | 2707 |
| 116 | Ga0070713_100032262 | 3300005436 | Bacteria | 4181 |
| 117 | Ga0070710_10009574 | 3300005437 | Bacteria | 4744 |
| 118 | Ga0070710_10121239 | 3300005437 | Bacteria | 1583 |
| 119 | Ga0070701_10030989 | 3300005438 | Bacteria | 2651 |
| 120 | Ga0070701_10108188 | 3300005438 | Bacteria | 1549 |
| 121 | Ga0070711_100009225 | 3300005439 | Bacteria | 6066 |
| 122 | Ga0070711_100018778 | 3300005439 | Bacteria | 4421 |
| 123 | Ga0070711_100143911 | 3300005439 | Bacteria | 1791 |
| 124 | Ga0070711_100337761 | 3300005439 | Bacteria | 1208 |
| 125 | Ga0070705_100000402 | 3300005440 | Bacteria | 24952 |
| 126 | Ga0070705_100020818 | 3300005440 | Bacteria | 3479 |
| 127 | Ga0070705_100045906 | 3300005440 | Bacteria | 2516 |
| 128 | Ga0070705_100140908 | 3300005440 | Bacteria | 1587 |
| 129 | Ga0070700_100000724 | 3300005441 | Bacteria | 16295 |
| 130 | Ga0070694_100000600 | 3300005444 | Bacteria | 19813 |
| 131 | Ga0070694_100027477 | 3300005444 | Bacteria | 3695 |
| 132 | Ga0070708_100035647 | 3300005445 | Bacteria | 4335 |
| 133 | Ga0070708_100054489 | 3300005445 | Bacteria | 3552 |
| 134 | Ga0070663_100016167 | 3300005455 | Bacteria | 4836 |
| 135 | Ga0070663_100159348 | 3300005455 | Bacteria | 1736 |
| 136 | Ga0070678_100008877 | 3300005456 | Bacteria | 6050 |
| 137 | Ga0070678_100019314 | 3300005456 | Bacteria | 4439 |
| 138 | Ga0070678_100033275 | 3300005456 | Bacteria | 3577 |
| 139 | Ga0070662_100102604 | 3300005457 | Bacteria | 2167 |
| 140 | Ga0070662_100225936 | 3300005457 | Bacteria | 1496 |
| 141 | Ga0070681_10005925 | 3300005458 | Bacteria | 11829 |
| 142 | Ga0070681_10126410 | 3300005458 | Bacteria | 2489 |
| 143 | Ga0070681_10498387 | 3300005458 | Bacteria | 1131 |
| 144 | Ga0068867_100001504 | 3300005459 | Bacteria | 16138 |
| 145 | Ga0068867_100011516 | 3300005459 | Bacteria | 6244 |
| 146 | Ga0068867_100051652 | 3300005459 | Bacteria | 3032 |
| 147 | Ga0070685_10004829 | 3300005466 | Bacteria | 6821 |
| 148 | Ga0070685_10053569 | 3300005466 | Bacteria | 2338 |
| 149 | Ga0070685_10084626 | 3300005466 | Bacteria | 1908 |
| 150 | Ga0070706_100357177 | 3300005467 | Bacteria | 1362 |
| 151 | Ga0070707_100375620 | 3300005468 | Bacteria | 1381 |
| 152 | Ga0070698_100072731 | 3300005471 | Bacteria | 3446 |
| 153 | Ga0070698_100090055 | 3300005471 | Bacteria | 3051 |
| 154 | Ga0070699_100000330 | 3300005518 | Bacteria | 45857 |
| 155 | Ga0070699_100008676 | 3300005518 | Bacteria | 8810 |
| 156 | Ga0070699_100128434 | 3300005518 | Bacteria | 2234 |
| 157 | Ga0070699_100227359 | 3300005518 | Bacteria | 1663 |
| 158 | Ga0070679_100009727 | 3300005530 | Bacteria | 9094 |
| 159 | Ga0070679_100138090 | 3300005530 | Bacteria | 2418 |
| 160 | Ga0070679_100229052 | 3300005530 | Bacteria | 1818 |
| 161 | Ga0070684_100003143 | 3300005535 | Bacteria | 12332 |
| 162 | Ga0070684_100467224 | 3300005535 | Bacteria | 1167 |
| 163 | Ga0070697_100145261 | 3300005536 | Bacteria | 1996 |
| 164 | Ga0070697_100207413 | 3300005536 | Bacteria | 1667 |
| 165 | Ga0068853_100006565 | 3300005539 | Bacteria | 9267 |
| 166 | Ga0068853_100032751 | 3300005539 | Bacteria | 4404 |
| 167 | Ga0068853_100319072 | 3300005539 | Bacteria | 1440 |
| 168 | Ga0070672_100005327 | 3300005543 | Bacteria | 8519 |
| 169 | Ga0070672_100252630 | 3300005543 | Bacteria | 1485 |
| 170 | Ga0070686_100021206 | 3300005544 | Bacteria | 3858 |
| 171 | Ga0070686_100041073 | 3300005544 | Bacteria | 2889 |
| 172 | Ga0070695_100000637 | 3300005545 | Bacteria | 18603 |
| 173 | Ga0070696_100000069 | 3300005546 | Bacteria | 49879 |
| 174 | Ga0070696_100050368 | 3300005546 | Bacteria | 2895 |
| 175 | Ga0070696_100241585 | 3300005546 | Bacteria | 1362 |
| 176 | Ga0070693_100002964 | 3300005547 | Bacteria | 7856 |
| 177 | Ga0070693_100019541 | 3300005547 | Bacteria | 3554 |
| 178 | Ga0070693_100090064 | 3300005547 | Bacteria | 1847 |
| 179 | Ga0070693_100121695 | 3300005547 | Unclassified | 1619 |
| 180 | Ga0070693_100256545 | 3300005547 | Bacteria | 1161 |
| 181 | Ga0070665_100031023 | 3300005548 | Bacteria | 5379 |
| 182 | Ga0070665_100316131 | 3300005548 | Bacteria | 1566 |
| 183 | Ga0070704_100000749 | 3300005549 | Bacteria | 15968 |
| 184 | Ga0070704_100214606 | 3300005549 | Bacteria | 1561 |
| 185 | Ga0068855_100019111 | 3300005563 | Bacteria | 8234 |
| 186 | Ga0068855_100073458 | 3300005563 | Bacteria | 3973 |
| 187 | Ga0068855_100124790 | 3300005563 | Bacteria | 2944 |
| 188 | Ga0068855_100327480 | 3300005563 | Bacteria | 1692 |
| 189 | Ga0070664_100153271 | 3300005564 | Bacteria | 2035 |
| 190 | Ga0070664_100160834 | 3300005564 | Bacteria | 1987 |
| 191 | Ga0070664_100368748 | 3300005564 | Bacteria | 1309 |
| 192 | Ga0070664_100507705 | 3300005564 | Unclassified | 1112 |
| 193 | Ga0070664_100536712 | 3300005564 | Bacteria | 1081 |
| 194 | Ga0068857_100000616 | 3300005577 | Bacteria | 26168 |
| 195 | Ga0068857_100019113 | 3300005577 | Bacteria | 6014 |
| 196 | Ga0068857_100060288 | 3300005577 | Bacteria | 3370 |
| 197 | Ga0068857_100079354 | 3300005577 | Bacteria | 2930 |
| 198 | Ga0068854_100060789 | 3300005578 | Bacteria | 2734 |
| 199 | Ga0068854_100170218 | 3300005578 | Bacteria | 1694 |
| 200 | Ga0068856_100059449 | 3300005614 | Bacteria | 3775 |
| 201 | Ga0068856_100106093 | 3300005614 | Bacteria | 2804 |
| 202 | Ga0068856_100178755 | 3300005614 | Bacteria | 2135 |
| 203 | Ga0070702_100011750 | 3300005615 | Bacteria | 4366 |
| 204 | Ga0070702_100019301 | 3300005615 | Bacteria | 3553 |
| 205 | Ga0070702_100080400 | 3300005615 | Bacteria | 1950 |
| 206 | Ga0068852_100002017 | 3300005616 | Bacteria | 13827 |
| 207 | Ga0068859_100004949 | 3300005617 | Bacteria | 13537 |
| 208 | Ga0068859_100005304 | 3300005617 | Bacteria | 13104 |
| 209 | Ga0068859_100018608 | 3300005617 | Bacteria | 6983 |
| 210 | Ga0068859_100060783 | 3300005617 | Bacteria | 3807 |
| 211 | Ga0068859_100064044 | 3300005617 | Bacteria | 3708 |
| 212 | Ga0068864_100003232 | 3300005618 | Bacteria | 13462 |
| 213 | Ga0068864_100004578 | 3300005618 | Bacteria | 11352 |
| 214 | Ga0068864_100043738 | 3300005618 | Bacteria | 3836 |
| 215 | Ga0068864_100080402 | 3300005618 | Bacteria | 2855 |
| 216 | Ga0068866_10002061 | 3300005718 | Bacteria | 8362 |
| 217 | Ga0068866_10011605 | 3300005718 | Bacteria | 3817 |
| 218 | Ga0068866_10158439 | 3300005718 | Bacteria | 1318 |
| 219 | Ga0068870_10000289 | 3300005840 | Bacteria | 18688 |
| 220 | Ga0068870_10004900 | 3300005840 | Bacteria | 5793 |
| 221 | Ga0068863_100001280 | 3300005841 | Bacteria | 25093 |
| 222 | Ga0068863_100025968 | 3300005841 | Bacteria | 5589 |
| 223 | Ga0068858_100057360 | 3300005842 | Bacteria | 3599 |
| 224 | Ga0068860_100008827 | 3300005843 | Bacteria | 10042 |
| 225 | Ga0068860_100008977 | 3300005843 | Bacteria | 9959 |
| 226 | Ga0068860_100036450 | 3300005843 | Bacteria | 4712 |
| 227 | Ga0068862_100005504 | 3300005844 | Bacteria | 10580 |
| 228 | Ga0068862_100006312 | 3300005844 | Bacteria | 9856 |
| 229 | Ga0068862_100351644 | 3300005844 | Bacteria | 1367 |
| 230 | Ga0081455_10000540 | 3300005937 | Bacteria | 49195 |
| 231 | Ga0081455_10001205 | 3300005937 | Bacteria | 32425 |
| 232 | Ga0081455_10005299 | 3300005937 | Bacteria | 14164 |
| 233 | Ga0081455_10022139 | 3300005937 | Bacteria | 5947 |
| 234 | Ga0081455_10042728 | 3300005937 | Bacteria | 3973 |
| 235 | Ga0081455_10119772 | 3300005937 | Bacteria | 2075 |
| 236 | Ga0081538_10010807 | 3300005981 | Bacteria | 7455 |
| 237 | Ga0081540_1000015 | 3300005983 | Bacteria | 178704 |
| 238 | Ga0081540_1008029 | 3300005983 | Bacteria | 7425 |
| 239 | Ga0081540_1054309 | 3300005983 | Bacteria | 1959 |
| 240 | Ga0081539_10002225 | 3300005985 | Bacteria | 28285 |
| 241 | Ga0081539_10077702 | 3300005985 | Unclassified | 1754 |
| 242 | Ga0070717_10000817 | 3300006028 | Bacteria | 20525 |
| 243 | Ga0070717_10033136 | 3300006028 | Bacteria | 4167 |
| 244 | Ga0070717_10138362 | 3300006028 | Bacteria | 2099 |
| 245 | Ga0070717_10243185 | 3300006028 | Bacteria | 1588 |
| 246 | Ga0070717_10517859 | 3300006028 | Bacteria | 1079 |
| 247 | Ga0075365_10196964 | 3300006038 | Bacteria | 1411 |
| 248 | Ga0075364_10011348 | 3300006051 | Bacteria | 5412 |
| 249 | Ga0075432_10059642 | 3300006058 | Bacteria | 1356 |
| 250 | Ga0070715_10002395 | 3300006163 | Bacteria | 5744 |
| 251 | Ga0070715_10002890 | 3300006163 | Bacteria | 5360 |
| 252 | Ga0070715_10156595 | 3300006163 | Bacteria | 1122 |
| 253 | Ga0070716_100017968 | 3300006173 | Bacteria | 3677 |
| 254 | Ga0070716_100018008 | 3300006173 | Bacteria | 3673 |
| 255 | Ga0070712_100001671 | 3300006175 | Bacteria | 13570 |
| 256 | Ga0070712_100011668 | 3300006175 | Bacteria | 5581 |
| 257 | Ga0070712_100055726 | 3300006175 | Bacteria | 2769 |
| 258 | Ga0070712_100056602 | 3300006175 | Bacteria | 2751 |
| 259 | Ga0070712_100112826 | 3300006175 | Bacteria | 2031 |
| 260 | Ga0070712_100144699 | 3300006175 | Bacteria | 1818 |
| 261 | Ga0075367_10072194 | 3300006178 | Bacteria | 2077 |
| 262 | Ga0075366_10004013 | 3300006195 | Bacteria | 7866 |
| 263 | Ga0097621_100001930 | 3300006237 | Bacteria | 14142 |
| 264 | Ga0097621_100005823 | 3300006237 | Bacteria | 8704 |
| 265 | Ga0097621_100120569 | 3300006237 | Bacteria | 2224 |
| 266 | Ga0097621_100177418 | 3300006237 | Bacteria | 1839 |
| 267 | Ga0068871_100001884 | 3300006358 | Bacteria | 14190 |
| 268 | Ga0068871_100003555 | 3300006358 | Bacteria | 10726 |
| 269 | Ga0068871_100010659 | 3300006358 | Bacteria | 6720 |
| 270 | Ga0068871_100091434 | 3300006358 | Bacteria | 2536 |
| 271 | Ga0068871_100207262 | 3300006358 | Bacteria | 1695 |
| 272 | Ga0068871_100559324 | 3300006358 | Bacteria | 1037 |
| 273 | Ga0075428_100097372 | 3300006844 | Bacteria | 3207 |
| 274 | Ga0075428_100229821 | 3300006844 | Bacteria | 2002 |
| 275 | Ga0075430_100053277 | 3300006846 | Bacteria | 3407 |
| 276 | Ga0075431_100026272 | 3300006847 | Bacteria | 5972 |
| 277 | Ga0075431_100291957 | 3300006847 | Bacteria | 1649 |
| 278 | Ga0075433_10005937 | 3300006852 | Bacteria | 9616 |
| 279 | Ga0075433_10009567 | 3300006852 | Bacteria | 7751 |
| 280 | Ga0075433_10081387 | 3300006852 | Bacteria | 2855 |
| 281 | Ga0075433_10097799 | 3300006852 | Bacteria | 2598 |
| 282 | Ga0075433_10312525 | 3300006852 | Bacteria | 1391 |
| 283 | Ga0075434_100013765 | 3300006871 | Bacteria | 7713 |
| 284 | Ga0075434_100060452 | 3300006871 | Bacteria | 3768 |
| 285 | Ga0075434_100151373 | 3300006871 | Bacteria | 2340 |
| 286 | Ga0075434_100168466 | 3300006871 | Bacteria | 2210 |
| 287 | Ga0075434_100186328 | 3300006871 | Bacteria | 2096 |
| 288 | Ga0075434_100210513 | 3300006871 | Bacteria | 1964 |
| 289 | Ga0075434_100455617 | 3300006871 | Bacteria | 1300 |
| 290 | Ga0075434_100548251 | 3300006871 | Bacteria | 1176 |
| 291 | Ga0075429_100010683 | 3300006880 | Bacteria | 7944 |
| 292 | Ga0068865_100022254 | 3300006881 | Bacteria | 4132 |
| 293 | Ga0075436_100001808 | 3300006914 | Bacteria | 14657 |
| 294 | Ga0097620_100004949 | 3300006931 | Bacteria | 13537 |
| 295 | Ga0097620_100005304 | 3300006931 | Bacteria | 13104 |
| 296 | Ga0097620_100018608 | 3300006931 | Bacteria | 6983 |
| 297 | Ga0097620_100060780 | 3300006931 | Bacteria | 3807 |
| 298 | Ga0097620_100064046 | 3300006931 | Bacteria | 3708 |
| 299 | Ga0075435_100074793 | 3300007076 | Bacteria | 2772 |
| 300 | Ga0075435_100150262 | 3300007076 | Bacteria | 1958 |
| 301 | Ga0075435_100196637 | 3300007076 | Bacteria | 1708 |
| 302 | Ga0075435_100223910 | 3300007076 | Bacteria | 1597 |
| 303 | Ga0075435_100362484 | 3300007076 | Bacteria | 1243 |
| 304 | Ga0099795_10006632 | 3300007788 | Unclassified | 3172 |
| 305 | Ga0099795_10011343 | 3300007788 | Bacteria | 2661 |
| 306 | Ga0105250_10011298 | 3300009092 | Bacteria | 3705 |
| 307 | Ga0105240_10077106 | 3300009093 | Bacteria | 4107 |
| 308 | Ga0105240_10308309 | 3300009093 | Bacteria | 1808 |
| 309 | Ga0105240_10387178 | 3300009093 | Bacteria | 1578 |
| 310 | Ga0111539_10000345 | 3300009094 | Bacteria | 57093 |
| 311 | Ga0111539_10001931 | 3300009094 | Bacteria | 27629 |
| 312 | Ga0111539_10002122 | 3300009094 | Bacteria | 26499 |
| 313 | Ga0111539_10074518 | 3300009094 | Bacteria | 3999 |
| 314 | Ga0111539_10135014 | 3300009094 | Bacteria | 2889 |
| 315 | Ga0111539_10383441 | 3300009094 | Bacteria | 1637 |
| 316 | Ga0105245_10002784 | 3300009098 | Bacteria | 15726 |
| 317 | Ga0105245_10063738 | 3300009098 | Bacteria | 3329 |
| 318 | Ga0105247_10003272 | 3300009101 | Bacteria | 10625 |
| 319 | Ga0105247_10011048 | 3300009101 | Bacteria | 5448 |
| 320 | Ga0114129_10003572 | 3300009147 | Bacteria | 21879 |
| 321 | Ga0114129_10007079 | 3300009147 | Bacteria | 15964 |
| 322 | Ga0114129_10010645 | 3300009147 | Bacteria | 13117 |
| 323 | Ga0105243_10015911 | 3300009148 | Bacteria | 5689 |
| 324 | Ga0105243_10038149 | 3300009148 | Bacteria | 3741 |
| 325 | Ga0105243_10108219 | 3300009148 | Bacteria | 2320 |
| 326 | Ga0105241_10000940 | 3300009174 | Bacteria | 21996 |
| 327 | Ga0105242_10002276 | 3300009176 | Bacteria | 15168 |
| 328 | Ga0105242_10007660 | 3300009176 | Bacteria | 8309 |
| 329 | Ga0105242_10047519 | 3300009176 | Bacteria | 3485 |
| 330 | Ga0105248_10067581 | 3300009177 | Bacteria | 4013 |
| 331 | Ga0105248_10358663 | 3300009177 | Bacteria | 1641 |
| 332 | Ga0105238_10032937 | 3300009551 | Bacteria | 5275 |
| 333 | Ga0105238_10274521 | 3300009551 | Bacteria | 1666 |
| 334 | Ga0105249_10012262 | 3300009553 | Bacteria | 7552 |
| 335 | Ga0105249_10182734 | 3300009553 | Bacteria | 2041 |
| 336 | Ga0105249_10726736 | 3300009553 | Bacteria | 1054 |
| 337 | Ga0099796_10034707 | 3300010159 | Bacteria | 1668 |
| 338 | Ga0105239_10003461 | 3300010375 | Bacteria | 19316 |
| 339 | Ga0105239_10098595 | 3300010375 | Bacteria | 3230 |
| 340 | Ga0105239_10206978 | 3300010375 | Bacteria | 2198 |
| 341 | Ga0105239_10217083 | 3300010375 | Bacteria | 2144 |
| 342 | Ga0105246_10012297 | 3300011119 | Bacteria | 5337 |
| 343 | Ga0105246_10030167 | 3300011119 | Bacteria | 3578 |
| 344 | Ga0157345_1004195 | 3300012498 | Unclassified | 1074 |
| 345 | Ga0157339_1002441 | 3300012505 | Bacteria | 1256 |
| 346 | Ga0157316_1002487 | 3300012510 | Bacteria | 1253 |
| 347 | Ga0157373_10004480 | 3300013100 | Bacteria | 10517 |
| 348 | Ga0157373_10179750 | 3300013100 | Bacteria | 1489 |
| 349 | Ga0157371_10035439 | 3300013102 | Bacteria | 3575 |
| 350 | Ga0157371_10159738 | 3300013102 | Bacteria | 1609 |
| 351 | Ga0157369_10090869 | 3300013105 | Bacteria | 3260 |
| 352 | Ga0157369_10349613 | 3300013105 | Bacteria | 1535 |
| 353 | Ga0157374_10002727 | 3300013296 | Bacteria | 14830 |
| 354 | Ga0157374_10008248 | 3300013296 | Bacteria | 8898 |
| 355 | Ga0157378_10100825 | 3300013297 | Bacteria | 2636 |
| 356 | Ga0163162_10045574 | 3300013306 | Bacteria | 4393 |
| 357 | Ga0163162_10450821 | 3300013306 | Bacteria | 1418 |
| 358 | Ga0157372_10040903 | 3300013307 | Bacteria | 5123 |
| 359 | Ga0157372_10457375 | 3300013307 | Bacteria | 1488 |
| 360 | Ga0157372_10563574 | 3300013307 | Bacteria | 1328 |
| 361 | Ga0157375_10590914 | 3300013308 | Bacteria | 1270 |
| 362 | Ga0163163_10042310 | 3300014325 | Bacteria | 4461 |
| 363 | Ga0163163_10063147 | 3300014325 | Bacteria | 3671 |
| 364 | Ga0157380_10023039 | 3300014326 | Bacteria | 4696 |
| 365 | Ga0157380_10542290 | 3300014326 | Unclassified | 1139 |
| 366 | Ga0157379_10010629 | 3300014968 | Bacteria | 8022 |
| 367 | Ga0157379_10032040 | 3300014968 | Bacteria | 4684 |
| 368 | Ga0157379_10113642 | 3300014968 | Bacteria | 2433 |
| 369 | Ga0157379_10249132 | 3300014968 | Bacteria | 1612 |
| 370 | Ga0157379_10353174 | 3300014968 | Bacteria | 1346 |
| 371 | Ga0157376_10002411 | 3300014969 | Bacteria | 12632 |
| 372 | Ga0157376_10063454 | 3300014969 | Bacteria | 3112 |
| 373 | Ga0157376_10067933 | 3300014969 | Bacteria | 3016 |
| 374 | Ga0157376_10211875 | 3300014969 | Bacteria | 1789 |
| 375 | Ga0163161_10001476 | 3300017792 | Bacteria | 17368 |
| 376 | Ga0163161_10058906 | 3300017792 | Bacteria | 2792 |
| 377 | Ga0163161_10090221 | 3300017792 | Bacteria | 2268 |
| 378 | Ga0163161_10140284 | 3300017792 | Bacteria | 1830 |
| 379 | Ga0213872_10021480 | 3300021361 | Bacteria | 2973 |
| 380 | Ga0213874_10006500 | 3300021377 | Bacteria | 2769 |
| 381 | Ga0213876_10011677 | 3300021384 | Bacteria | 4689 |
| 382 | Ga0213876_10126063 | 3300021384 | Bacteria | 1360 |
| 383 | Ga0224572_1004661 | 3300024225 | Bacteria | 2402 |
| 384 | Ga0228598_1002219 | 3300024227 | Bacteria | 4247 |
| 385 | Ga0209436_100633 | 3300025208 | Bacteria | 15033 |
| 386 | Ga0209672_100020 | 3300025228 | Bacteria | 429003 |
| 387 | Ga0209147_100024 | 3300025229 | Bacteria | 429003 |
| 388 | Ga0209258_100121 | 3300025242 | Bacteria | 180843 |
| 389 | Ga0209148_1000458 | 3300025254 | Bacteria | 44146 |
| 390 | Ga0209455_1000263 | 3300025272 | Bacteria | 60487 |
| 391 | Ga0209130_1001496 | 3300025284 | Bacteria | 15119 |
| 392 | Ga0207673_1000001 | 3300025290 | Bacteria | 29268 |
| 393 | Ga0209676_1001975 | 3300025292 | Bacteria | 16337 |
| 394 | Ga0209025_1000301 | 3300025294 | Bacteria | 110450 |
| 395 | Ga0209564_1000494 | 3300025295 | Bacteria | 65041 |
| 396 | Ga0209564_1002177 | 3300025295 | Bacteria | 16470 |
| 397 | Ga0209050_1004792 | 3300025298 | Bacteria | 8916 |
| 398 | Ga0207426_1001904 | 3300025302 | Bacteria | 15119 |
| 399 | Ga0209051_1016506 | 3300025303 | Bacteria | 3336 |
| 400 | Ga0209257_1005496 | 3300025304 | Bacteria | 8855 |
| 401 | Ga0207697_10013424 | 3300025315 | Bacteria | 3418 |
| 402 | Ga0207656_10074393 | 3300025321 | Bacteria | 1516 |
| 403 | Ga0207653_10000848 | 3300025885 | Bacteria | 10195 |
| 404 | Ga0207682_10000056 | 3300025893 | Bacteria | 48265 |
| 405 | Ga0207682_10002089 | 3300025893 | Bacteria | 9046 |
| 406 | Ga0207692_10001234 | 3300025898 | Bacteria | 9495 |
| 407 | Ga0207692_10011799 | 3300025898 | Bacteria | 3733 |
| 408 | Ga0207692_10013842 | 3300025898 | Bacteria | 3510 |
| 409 | Ga0207710_10004332 | 3300025900 | Bacteria | 6209 |
| 410 | Ga0207710_10008537 | 3300025900 | Bacteria | 4319 |
| 411 | Ga0207710_10049812 | 3300025900 | Bacteria | 1878 |
| 412 | Ga0207688_10001105 | 3300025901 | Bacteria | 13845 |
| 413 | Ga0207688_10014043 | 3300025901 | Bacteria | 4355 |
| 414 | Ga0207688_10030510 | 3300025901 | Bacteria | 2973 |
| 415 | Ga0207680_10030467 | 3300025903 | Bacteria | 3043 |
| 416 | Ga0207680_10085902 | 3300025903 | Bacteria | 1988 |
| 417 | Ga0207647_10014078 | 3300025904 | Bacteria | 5528 |
| 418 | Ga0207647_10019467 | 3300025904 | Bacteria | 4564 |
| 419 | Ga0207685_10014369 | 3300025905 | Bacteria | 2477 |
| 420 | Ga0207699_10002060 | 3300025906 | Bacteria | 9495 |
| 421 | Ga0207699_10269338 | 3300025906 | Bacteria | 1180 |
| 422 | Ga0207645_10000249 | 3300025907 | Bacteria | 44921 |
| 423 | Ga0207645_10031831 | 3300025907 | Bacteria | 3391 |
| 424 | Ga0207645_10046288 | 3300025907 | Bacteria | 2779 |
| 425 | Ga0207645_10095830 | 3300025907 | Bacteria | 1911 |
| 426 | Ga0207643_10000187 | 3300025908 | Bacteria | 42567 |
| 427 | Ga0207643_10000387 | 3300025908 | Bacteria | 29359 |
| 428 | Ga0207705_10015260 | 3300025909 | Bacteria | 5516 |
| 429 | Ga0207705_10369973 | 3300025909 | Bacteria | 1106 |
| 430 | Ga0207684_10240569 | 3300025910 | Bacteria | 1561 |
| 431 | Ga0207684_10451070 | 3300025910 | Bacteria | 1104 |
| 432 | Ga0207654_10033440 | 3300025911 | Bacteria | 2851 |
| 433 | Ga0207654_10322388 | 3300025911 | Bacteria | 1056 |
| 434 | Ga0207707_10103617 | 3300025912 | Bacteria | 2487 |
| 435 | Ga0207693_10001675 | 3300025915 | Bacteria | 19535 |
| 436 | Ga0207693_10014672 | 3300025915 | Bacteria | 6295 |
| 437 | Ga0207693_10018411 | 3300025915 | Bacteria | 5563 |
| 438 | Ga0207693_10018746 | 3300025915 | Bacteria | 5507 |
| 439 | Ga0207693_10084543 | 3300025915 | Bacteria | 2486 |
| 440 | Ga0207693_10100120 | 3300025915 | Bacteria | 2272 |
| 441 | Ga0207663_10037400 | 3300025916 | Bacteria | 2926 |
| 442 | Ga0207663_10247647 | 3300025916 | Bacteria | 1310 |
| 443 | Ga0207660_10000647 | 3300025917 | Bacteria | 23458 |
| 444 | Ga0207660_10085564 | 3300025917 | Bacteria | 2326 |
| 445 | Ga0207660_10219395 | 3300025917 | Bacteria | 1492 |
| 446 | Ga0207662_10010233 | 3300025918 | Bacteria | 5173 |
| 447 | Ga0207662_10033219 | 3300025918 | Bacteria | 3006 |
| 448 | Ga0207662_10081076 | 3300025918 | Bacteria | 1981 |
| 449 | Ga0207662_10108064 | 3300025918 | Bacteria | 1731 |
| 450 | Ga0207657_10132608 | 3300025919 | Bacteria | 2041 |
| 451 | Ga0207649_10123225 | 3300025920 | Bacteria | 1750 |
| 452 | Ga0207649_10298348 | 3300025920 | Bacteria | 1177 |
| 453 | Ga0207652_10030686 | 3300025921 | Bacteria | 4504 |
| 454 | Ga0207652_10088661 | 3300025921 | Bacteria | 2715 |
| 455 | Ga0207652_10177499 | 3300025921 | Bacteria | 1913 |
| 456 | Ga0207652_10191465 | 3300025921 | Bacteria | 1840 |
| 457 | Ga0207681_10064261 | 3300025923 | Bacteria | 2534 |
| 458 | Ga0207681_10095713 | 3300025923 | Bacteria | 2130 |
| 459 | Ga0207694_10016005 | 3300025924 | Bacteria | 5660 |
| 460 | Ga0207650_10002475 | 3300025925 | Bacteria | 12841 |
| 461 | Ga0207659_10001692 | 3300025926 | Bacteria | 13090 |
| 462 | Ga0207659_10130622 | 3300025926 | Bacteria | 1938 |
| 463 | Ga0207659_10138252 | 3300025926 | Bacteria | 1888 |
| 464 | Ga0207687_10003004 | 3300025927 | Bacteria | 11441 |
| 465 | Ga0207687_10012483 | 3300025927 | Bacteria | 5549 |
| 466 | Ga0207687_10240762 | 3300025927 | Bacteria | 1434 |
| 467 | Ga0207700_10000623 | 3300025928 | Bacteria | 20712 |
| 468 | Ga0207700_10025105 | 3300025928 | Bacteria | 4134 |
| 469 | Ga0207700_10205103 | 3300025928 | Bacteria | 1663 |
| 470 | Ga0207664_10014641 | 3300025929 | Bacteria | 5672 |
| 471 | Ga0207664_10073350 | 3300025929 | Bacteria | 2762 |
| 472 | Ga0207664_10277010 | 3300025929 | Bacteria | 1471 |
| 473 | Ga0207664_10531698 | 3300025929 | Bacteria | 1054 |
| 474 | Ga0207644_10041278 | 3300025931 | Bacteria | 3263 |
| 475 | Ga0207644_10045679 | 3300025931 | Bacteria | 3117 |
| 476 | Ga0207690_10000546 | 3300025932 | Bacteria | 24592 |
| 477 | Ga0207690_10290302 | 3300025932 | Bacteria | 1276 |
| 478 | Ga0207706_10001175 | 3300025933 | Bacteria | 26500 |
| 479 | Ga0207706_10003621 | 3300025933 | Bacteria | 14767 |
| 480 | Ga0207706_10033074 | 3300025933 | Bacteria | 4603 |
| 481 | Ga0207706_10034253 | 3300025933 | Bacteria | 4518 |
| 482 | Ga0207686_10048630 | 3300025934 | Bacteria | 2628 |
| 483 | Ga0207686_10082937 | 3300025934 | Bacteria | 2097 |
| 484 | Ga0207709_10037740 | 3300025935 | Bacteria | 2872 |
| 485 | Ga0207709_10056475 | 3300025935 | Bacteria | 2430 |
| 486 | Ga0207670_10010169 | 3300025936 | Bacteria | 5408 |
| 487 | Ga0207670_10020270 | 3300025936 | Bacteria | 4082 |
| 488 | Ga0207670_10109304 | 3300025936 | Bacteria | 1989 |
| 489 | Ga0207669_10000534 | 3300025937 | Bacteria | 16573 |
| 490 | Ga0207669_10181459 | 3300025937 | Bacteria | 1509 |
| 491 | Ga0207704_10002477 | 3300025938 | Bacteria | 8317 |
| 492 | Ga0207704_10103140 | 3300025938 | Bacteria | 1907 |
| 493 | Ga0207665_10001717 | 3300025939 | Bacteria | 14724 |
| 494 | Ga0207665_10025158 | 3300025939 | Bacteria | 3927 |
| 495 | Ga0207665_10152258 | 3300025939 | Bacteria | 1658 |
| 496 | Ga0207665_10169870 | 3300025939 | Bacteria | 1574 |
| 497 | Ga0207691_10001992 | 3300025940 | Bacteria | 19980 |
| 498 | Ga0207691_10009096 | 3300025940 | Bacteria | 9533 |
| 499 | Ga0207691_10036320 | 3300025940 | Bacteria | 4565 |
| 500 | Ga0207711_10008662 | 3300025941 | Bacteria | 8508 |
| 501 | Ga0207711_10019334 | 3300025941 | Bacteria | 5672 |
| 502 | Ga0207711_10039618 | 3300025941 | Bacteria | 4009 |
| 503 | Ga0207711_10095339 | 3300025941 | Bacteria | 2624 |
| 504 | Ga0207711_10194867 | 3300025941 | Bacteria | 1848 |
| 505 | Ga0207689_10000424 | 3300025942 | Bacteria | 39635 |
| 506 | Ga0207689_10002173 | 3300025942 | Bacteria | 18432 |
| 507 | Ga0207689_10010839 | 3300025942 | Bacteria | 7841 |
| 508 | Ga0207689_10026402 | 3300025942 | Bacteria | 4862 |
| 509 | Ga0207679_10000187 | 3300025945 | Bacteria | 49895 |
| 510 | Ga0207667_10011279 | 3300025949 | Bacteria | 10393 |
| 511 | Ga0207667_10023894 | 3300025949 | Bacteria | 6724 |
| 512 | Ga0207651_10005649 | 3300025960 | Bacteria | 6448 |
| 513 | Ga0207651_10013062 | 3300025960 | Bacteria | 4733 |
| 514 | Ga0207651_10097459 | 3300025960 | Bacteria | 2171 |
| 515 | Ga0207712_10001563 | 3300025961 | Bacteria | 15410 |
| 516 | Ga0207712_10003253 | 3300025961 | Bacteria | 10309 |
| 517 | Ga0207712_10015028 | 3300025961 | Bacteria | 4988 |
| 518 | Ga0207712_10017851 | 3300025961 | Bacteria | 4616 |
| 519 | Ga0207668_10000807 | 3300025972 | Bacteria | 19183 |
| 520 | Ga0207640_10001794 | 3300025981 | Bacteria | 11532 |
| 521 | Ga0207658_10015810 | 3300025986 | Bacteria | 5180 |
| 522 | Ga0207658_10058657 | 3300025986 | Bacteria | 2865 |
| 523 | Ga0207658_10491320 | 3300025986 | Bacteria | 1092 |
| 524 | Ga0207677_10002480 | 3300026023 | Bacteria | 9685 |
| 525 | Ga0207677_10008071 | 3300026023 | Bacteria | 5861 |
| 526 | Ga0207677_10009309 | 3300026023 | Bacteria | 5524 |
| 527 | Ga0207703_10059722 | 3300026035 | Bacteria | 3115 |
| 528 | Ga0207639_10039012 | 3300026041 | Bacteria | 3537 |
| 529 | Ga0207639_10230764 | 3300026041 | Bacteria | 1604 |
| 530 | Ga0207639_10276707 | 3300026041 | Bacteria | 1475 |
| 531 | Ga0207639_10485280 | 3300026041 | Bacteria | 1127 |
| 532 | Ga0207678_10012666 | 3300026067 | Bacteria | 7411 |
| 533 | Ga0207678_10021453 | 3300026067 | Bacteria | 5663 |
| 534 | Ga0207678_10058216 | 3300026067 | Bacteria | 3325 |
| 535 | Ga0207678_10505189 | 3300026067 | Bacteria | 1054 |
| 536 | Ga0207708_10001458 | 3300026075 | Bacteria | 17696 |
| 537 | Ga0207708_10001620 | 3300026075 | Bacteria | 16770 |
| 538 | Ga0207702_10011282 | 3300026078 | Bacteria | 7448 |
| 539 | Ga0207702_10067339 | 3300026078 | Bacteria | 3073 |
| 540 | Ga0207702_10099674 | 3300026078 | Bacteria | 2561 |
| 541 | Ga0207702_10170780 | 3300026078 | Bacteria | 1994 |
| 542 | Ga0207702_10175935 | 3300026078 | Bacteria | 1967 |
| 543 | Ga0207641_10001747 | 3300026088 | Bacteria | 20964 |
| 544 | Ga0207641_10042162 | 3300026088 | Bacteria | 3827 |
| 545 | Ga0207648_10006315 | 3300026089 | Bacteria | 11787 |
| 546 | Ga0207648_10031587 | 3300026089 | Bacteria | 4682 |
| 547 | Ga0207648_10099231 | 3300026089 | Bacteria | 2550 |
| 548 | Ga0207648_10412078 | 3300026089 | Bacteria | 1226 |
| 549 | Ga0207676_10005369 | 3300026095 | Bacteria | 9076 |
| 550 | Ga0207676_10006683 | 3300026095 | Bacteria | 8159 |
| 551 | Ga0207676_10028355 | 3300026095 | Bacteria | 4181 |
| 552 | Ga0207676_10056234 | 3300026095 | Bacteria | 3092 |
| 553 | Ga0207674_10008573 | 3300026116 | Bacteria | 11784 |
| 554 | Ga0207674_10099023 | 3300026116 | Bacteria | 2898 |
| 555 | Ga0207674_10120373 | 3300026116 | Bacteria | 2593 |
| 556 | Ga0207674_10169960 | 3300026116 | Bacteria | 2134 |
| 557 | Ga0207674_10174146 | 3300026116 | Bacteria | 2104 |
| 558 | Ga0207675_100002650 | 3300026118 | Bacteria | 17661 |
| 559 | Ga0207675_100029584 | 3300026118 | Bacteria | 5102 |
| 560 | Ga0207675_100149945 | 3300026118 | Bacteria | 2219 |
| 561 | Ga0207675_100301744 | 3300026118 | Bacteria | 1560 |
| 562 | Ga0207675_100344747 | 3300026118 | Bacteria | 1459 |
| 563 | Ga0207683_10000727 | 3300026121 | Bacteria | 29910 |
| 564 | Ga0207683_10003304 | 3300026121 | Bacteria | 14057 |
| 565 | Ga0207683_10006260 | 3300026121 | Bacteria | 10200 |
| 566 | Ga0207683_10008669 | 3300026121 | Bacteria | 8695 |
| 567 | Ga0207683_10024882 | 3300026121 | Bacteria | 5160 |
| 568 | Ga0207698_10001591 | 3300026142 | Bacteria | 13231 |
| 569 | Ga0209984_1004387 | 3300027424 | Bacteria | 1661 |
| 570 | Ga0209999_1013478 | 3300027543 | Bacteria | 1482 |
| 571 | Ga0210002_1000292 | 3300027617 | Bacteria | 6906 |
| 572 | Ga0209983_1004894 | 3300027665 | Bacteria | 2798 |
| 573 | Ga0209971_1010091 | 3300027682 | Bacteria | 2234 |
| 574 | Ga0209966_1003324 | 3300027695 | Bacteria | 2703 |
| 575 | Ga0207428_10000150 | 3300027907 | Bacteria | 94699 |
| 576 | Ga0207428_10001312 | 3300027907 | Bacteria | 26468 |
| 577 | Ga0268266_10028928 | 3300028379 | Bacteria | 4709 |
| 578 | Ga0268266_10127675 | 3300028379 | Bacteria | 2271 |
| 579 | Ga0268266_10474231 | 3300028379 | Unclassified | 1192 |
| 580 | Ga0268265_10003058 | 3300028380 | Bacteria | 12198 |
| 581 | Ga0268265_10021946 | 3300028380 | Bacteria | 4480 |
| 582 | Ga0268265_10206229 | 3300028380 | Bacteria | 1709 |
| 583 | Ga0268264_10003627 | 3300028381 | Bacteria | 13283 |
| 584 | Ga0268264_10096728 | 3300028381 | Bacteria | 2558 |
| 585 | Ga0268264_10409918 | 3300028381 | Bacteria | 1304 |
| 586 | Ga0265318_10050700 | 3300028577 | Bacteria | 1559 |
| 587 | Ga0265330_10132773 | 3300031235 | Bacteria | 1059 |
| 588 | Ga0265332_10027965 | 3300031238 | Bacteria | 2469 |
| 589 | Ga0265325_10003669 | 3300031241 | Bacteria | 9941 |
| 590 | Ga0265325_10048000 | 3300031241 | Bacteria | 2208 |
| 591 | Ga0265325_10057470 | 3300031241 | Bacteria | 1984 |
| 592 | Ga0265329_10014152 | 3300031242 | Bacteria | 2821 |
| 593 | Ga0265340_10020356 | 3300031247 | Bacteria | 3410 |
| 594 | Ga0265331_10114966 | 3300031250 | Bacteria | 1232 |
| 595 | Ga0265316_10062118 | 3300031344 | Bacteria | 2899 |
| 596 | Ga0307513_10185900 | 3300031456 | Bacteria | 1935 |
| 597 | Ga0265313_10000339 | 3300031595 | Bacteria | 50809 |
| 598 | Ga0265313_10009086 | 3300031595 | Bacteria | 6501 |
| 599 | Ga0265313_10019348 | 3300031595 | Bacteria | 3792 |
| 600 | Ga0265313_10033359 | 3300031595 | Bacteria | 2617 |
| 601 | Ga0265314_10011237 | 3300031711 | Bacteria | 7409 |
| 602 | Ga0265314_10040172 | 3300031711 | Bacteria | 3360 |
| 603 | Ga0265314_10119536 | 3300031711 | Bacteria | 1661 |
| 604 | Ga0265342_10004131 | 3300031712 | Bacteria | 11554 |
| 605 | Ga0265342_10037020 | 3300031712 | Bacteria | 2978 |
| 606 | Ga0373930_0000047 | 3300034816 | Bacteria | 10984 |
| 607 | Ga0373930_0006240 | 3300034816 | Bacteria | 2009 |
| 608 | Ga0373930_0040994 | 3300034816 | Bacteria | 986 |
| 609 | Ga0373948_0000024 | 3300034817 | Bacteria | 18497 |
| 610 | Ga0373948_0005463 | 3300034817 | Bacteria | 2064 |
| 611 | Ga0373950_0016164 | 3300034818 | Bacteria | 1274 |
| 612 | Ga0373958_0000655 | 3300034819 | Bacteria | 4350 |
| 613 | Ga0373958_0011872 | 3300034819 | Unclassified | 1481 |
| 614 | Ga0373959_0013683 | 3300034820 | Bacteria | 1467 |
| 615 | Ga0373938_0000288 | 3300034957 | Bacteria | 8090 |
| 616 | Ga0373926_0006670 | 3300035083 | Bacteria | 3833 |
| 617 | Ga0373926_0027700 | 3300035083 | Unclassified | 1987 |
| 618 | Ga0373926_0035211 | 3300035083 | Bacteria | 1775 |
| 619 | Ga0373928_0000269 | 3300035084 | Bacteria | 10306 |
| 620 | Ga0373928_0002346 | 3300035084 | Bacteria | 3676 |
| 621 | Ga0373934_0008776 | 3300035086 | Bacteria | 3776 |
| 622 | Ga0373940_0000152 | 3300035088 | Bacteria | 9041 |
| 623 | Ga0373940_0009981 | 3300035088 | Bacteria | 2221 |
| 624 | Ga0373944_0000529 | 3300035089 | Bacteria | 8958 |
| 625 | Ga0373944_0010817 | 3300035089 | Unclassified | 2493 |
| 626 | Ga0373949_0000315 | 3300035090 | Bacteria | 17190 |
| 627 | Ga0373949_0006098 | 3300035090 | Bacteria | 2668 |
| 628 | Ga0373949_0012300 | 3300035090 | Bacteria | 1891 |
| 629 | Ga0373951_0003234 | 3300035091 | Bacteria | 3984 |
| 630 | Ga0373951_0038011 | 3300035091 | Bacteria | 1152 |
| 631 | Ga0373952_0000084 | 3300035092 | Bacteria | 12547 |
| 632 | Ga0373952_0001863 | 3300035092 | Bacteria | 3830 |
| 633 | Ga0373952_0011890 | 3300035092 | Bacteria | 1704 |
| 634 | Ga0373923_0003265 | 3300035111 | Bacteria | 5169 |
| 635 | Ga0373923_0005474 | 3300035111 | Bacteria | 4312 |
| 636 | Ga0373923_0018969 | 3300035111 | Bacteria | 2656 |
| 637 | Ga0373923_0049207 | 3300035111 | Bacteria | 1762 |
| 638 | Ga0373932_0001167 | 3300035112 | Bacteria | 7530 |
| 639 | Ga0373936_0000722 | 3300035113 | Bacteria | 11534 |
| 640 | Ga0373936_0072224 | 3300035113 | Bacteria | 1424 |
| 641 | Ga0373936_0109845 | 3300035113 | Bacteria | 1170 |
| 642 | Ga0373939_0001213 | 3300035114 | Bacteria | 6297 |
| 643 | Ga0373939_0001845 | 3300035114 | Bacteria | 5086 |
| 644 | Ga0373941_0000158 | 3300035115 | Bacteria | 12249 |
| 645 | Ga0373941_0039953 | 3300035115 | Bacteria | 1444 |
| 646 | Ga0373945_0002014 | 3300035116 | Bacteria | 6311 |
| 647 | Ga0373945_0024203 | 3300035116 | Bacteria | 2102 |
| 648 | Ga0373953_0004608 | 3300035117 | Bacteria | 4404 |
| 649 | Ga0373953_0008792 | 3300035117 | Bacteria | 3444 |
| 650 | Ga0373953_0049685 | 3300035117 | Bacteria | 1693 |
| 651 | Ga0373954_0002688 | 3300035118 | Bacteria | 7483 |
| 652 | Ga0373954_0018825 | 3300035118 | Bacteria | 3111 |
| 653 | Ga0373954_0031726 | 3300035118 | Bacteria | 2440 |
| 654 | Ga0373954_0050459 | 3300035118 | Bacteria | 1952 |
| 655 | Ga0373956_0007670 | 3300035119 | Bacteria | 4349 |
| 656 | Ga0373956_0031671 | 3300035119 | Bacteria | 2319 |
| 657 | Ga0373956_0041589 | 3300035119 | Bacteria | 2041 |
| 658 | Ga0373956_0072435 | 3300035119 | Bacteria | 1573 |
| 659 | Ga0373957_0173682 | 3300035120 | Bacteria | 891 |
| 660 | Ga0373943_0000757 | 3300035170 | Bacteria | 14076 |
| 661 | Ga0373943_0011141 | 3300035170 | Bacteria | 4041 |
| 662 | Ga0373943_0013910 | 3300035170 | Bacteria | 3638 |
| 663 | Ga0373943_0045843 | 3300035170 | Bacteria | 2132 |
| 664 | Ga0373943_0099946 | 3300035170 | Bacteria | 1515 |
| 665 | Ga0373946_0031860 | 3300035171 | Unclassified | 2114 |
| 666 | Ga0373946_0034850 | 3300035171 | Bacteria | 2034 |
| 667 | Ga0373946_0104575 | 3300035171 | Bacteria | 1273 |
| 668 | Ga0373955_0000713 | 3300035172 | Bacteria | 14339 |
| 669 | Ga0373955_0003253 | 3300035172 | Bacteria | 7119 |
| 670 | Ga0373955_0010615 | 3300035172 | Bacteria | 4356 |
| 671 | Ga0373955_0095658 | 3300035172 | Bacteria | 1699 |
| 672 | Ga0373961_0000464 | 3300035241 | Bacteria | 16037 |
| 673 | Ga0373961_0016441 | 3300035241 | Bacteria | 1906 |
| 674 | Ga0373962_0003173 | 3300035242 | Bacteria | 3942 |
| 675 | Ga0373962_0007894 | 3300035242 | Bacteria | 2611 |
| 676 | Ga0373924_0010553 | 3300035410 | Bacteria | 3411 |
| 677 | Ga0373924_0022450 | 3300035410 | Bacteria | 2467 |
| 678 | Ga0373931_0000291 | 3300035691 | Bacteria | 21048 |
| 679 | Ga0373931_0001643 | 3300035691 | Bacteria | 9670 |
| 680 | Ga0373931_0007687 | 3300035691 | Bacteria | 5088 |
| 681 | Ga0373931_0136848 | 3300035691 | Bacteria | 1415 |
| 682 | Ga0373935_0001165 | 3300035692 | Bacteria | 14434 |
| 683 | Ga0373935_0030524 | 3300035692 | Bacteria | 3341 |
| 684 | Ga0373935_0056027 | 3300035692 | Unclassified | 2512 |
| 685 | Ga0373935_0093851 | 3300035692 | Bacteria | 1968 |
| 686 | Ga0373935_0101292 | 3300035692 | Bacteria | 1899 |
| 687 | Ga0373935_0157303 | 3300035692 | Bacteria | 1546 |
| 688 | Ga0373935_0285164 | 3300035692 | Bacteria | 1163 |
| 689 | Ga0373927_0001051 | 3300035695 | Bacteria | 21045 |
| 690 | Ga0373927_0002713 | 3300035695 | Bacteria | 12913 |
| 691 | Ga0373927_0026537 | 3300035695 | Bacteria | 3786 |
| 692 | Ga0373927_0041094 | 3300035695 | Bacteria | 2999 |
| 693 | Ga0373927_0062052 | 3300035695 | Bacteria | 2417 |
| 694 | Ga0373927_0210020 | 3300035695 | Bacteria | 1278 |
| 695 | Ga0373933_0005438 | 3300035724 | Bacteria | 6934 |
| 696 | Ga0373933_0016565 | 3300035724 | Bacteria | 4124 |
| 697 | Ga0373947_0006809 | 3300035725 | Bacteria | 6629 |
| 698 | Ga0373947_0013134 | 3300035725 | Bacteria | 4748 |
| 699 | Ga0373947_0014697 | 3300035725 | Bacteria | 4490 |
| 700 | Ga0373947_0054394 | 3300035725 | Bacteria | 2415 |
| 701 | Ga0373947_0061602 | 3300035725 | Bacteria | 2281 |
| 702 | Ga0373947_0201078 | 3300035725 | Bacteria | 1303 |
| 703 | Ga0373937_0002067 | 3300036401 | Bacteria | 16792 |
| 704 | Ga0373937_0003621 | 3300036401 | Bacteria | 13032 |
| 705 | Ga0373937_0144123 | 3300036401 | Bacteria | 2229 |
| 706 | Ga0373937_0233721 | 3300036401 | Bacteria | 1731 |
| 707 | Ga0373925_0000249 | 3300037068 | Bacteria | 57266 |
| 708 | Ga0373925_0001925 | 3300037068 | Bacteria | 17184 |
| 709 | Ga0373925_0096181 | 3300037068 | Bacteria | 2269 |
| 710 | Ga0373925_0182855 | 3300037068 | Bacteria | 1660 |
| 711 | Ga0373925_0439238 | 3300037068 | Bacteria | 1068 |
| 712 | Ga0395899_0014008 | 3300037312 | Bacteria | 6122 |
| 713 | Ga0395899_0084987 | 3300037312 | Bacteria | 2300 |
| 714 | Ga0395900_0046094 | 3300037418 | Bacteria | 4489 |
| 715 | Ga0395900_0295055 | 3300037418 | Bacteria | 1609 |
| 716 | Ga0395898_0145754 | 3300037466 | Bacteria | 2266 |
| 717 | Ga0395905_0110725 | 3300037471 | Bacteria | 2579 |
| 718 | Ga0436364_1422653 | 3300037853 | Bacteria | 850 |
| 719 | Ga0395901_0097273 | 3300038443 | Bacteria | 3085 |
| 720 | Ga0242420_000772 | 3300038996 | Bacteria | 3880 |
| 721 | Ga0436365_0330093 | 3300039437 | Bacteria | 5700 |
| 722 | Ga0436365_0397707 | 3300039437 | Bacteria | 1915 |
| 723 | Ga0436365_0794950 | 3300039437 | Bacteria | 10697 |
| 724 | Ga0436365_0861956 | 3300039437 | Bacteria | 2208 |
| 725 | Ga0436365_1923592 | 3300039437 | Bacteria | 1130 |
| 726 | Ga0436360_0500596 | 3300039438 | Bacteria | 2081 |
| 727 | Ga0436361_0327070 | 3300039447 | Bacteria | 11104 |
| 728 | Ga0436361_0474885 | 3300039447 | Bacteria | 5686 |
| 729 | Ga0436361_0492112 | 3300039447 | Bacteria | 6024 |
| 730 | Ga0436363_1120598 | 3300039450 | Bacteria | 976 |
| 731 | Ga0436363_1294531 | 3300039450 | Bacteria | 2769 |
| 732 | Ga0439441_002555 | 3300042001 | Bacteria | 2580 |
| 733 | Ga0439448_0031169 | 3300042005 | Bacteria | 1693 |
| 734 | Ga0439435_0041639 | 3300042436 | Bacteria | 1287 |
| 735 | Ga0439460_0045021 | 3300042461 | Bacteria | 1308 |
| 736 | Ga0451577_0255522 | 3300042876 | Bacteria | 1586 |
| 737 | Ga0439440_0008383 | 3300042993 | Bacteria | 2121 |
| 738 | Ga0466963_0014372 | 3300044694 | Bacteria | 4881 |
| 739 | Ga0466963_0100809 | 3300044694 | Bacteria | 1976 |
| 740 | Ga0453684_0080311 | 3300044712 | Bacteria | 4073 |
| 741 | Ga0466957_0017880 | 3300044842 | Bacteria | 4159 |
| 742 | Ga0466957_0203949 | 3300044842 | Bacteria | 1300 |
| 743 | Ga0466959_0316392 | 3300045049 | Bacteria | 1067 |
| 744 | Ga0495592_0000022 | 3300046454 | Bacteria | 137550 |
| 745 | Ga0495592_0008608 | 3300046454 | Bacteria | 7657 |
| 746 | Ga0495592_0011867 | 3300046454 | Bacteria | 6602 |
| 747 | Ga0495592_0013017 | 3300046454 | Bacteria | 6329 |
| 748 | Ga0495592_0161415 | 3300046454 | Bacteria | 1542 |
| 749 | Ga0495603_0033766 | 3300046455 | Bacteria | 3078 |
| 750 | Ga0495603_0047555 | 3300046455 | Bacteria | 2554 |
| 751 | Ga0495603_0051826 | 3300046455 | Bacteria | 2437 |
| 752 | Ga0495603_0193777 | 3300046455 | Bacteria | 1175 |
| 753 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 754 | Ga0495629_0000409 | 3300046459 | Bacteria | 35959 |
| 755 | Ga0495629_0012401 | 3300046459 | Bacteria | 6172 |
| 756 | Ga0495638_0025735 | 3300046460 | Bacteria | 3820 |
| 757 | Ga0495641_0017376 | 3300046461 | Bacteria | 3750 |
| 758 | Ga0495651_0001051 | 3300046462 | Bacteria | 21350 |
| 759 | Ga0495651_0001548 | 3300046462 | Bacteria | 17781 |
| 760 | Ga0495651_0013614 | 3300046462 | Bacteria | 6288 |
| 761 | Ga0495651_0017121 | 3300046462 | Bacteria | 5616 |
| 762 | Ga0495651_0137371 | 3300046462 | Bacteria | 1777 |
| 763 | Ga0495653_0000055 | 3300046463 | Bacteria | 102186 |
| 764 | Ga0495653_0009787 | 3300046463 | Bacteria | 7838 |
| 765 | Ga0495653_0012003 | 3300046463 | Bacteria | 7073 |
| 766 | Ga0495653_0018050 | 3300046463 | Bacteria | 5737 |
| 767 | Ga0495653_0051356 | 3300046463 | Bacteria | 3166 |
| 768 | Ga0495580_0006887 | 3300046472 | Bacteria | 9181 |
| 769 | Ga0495580_0025051 | 3300046472 | Bacteria | 4362 |
| 770 | Ga0495580_0061749 | 3300046472 | Bacteria | 2630 |
| 771 | Ga0495582_0006073 | 3300046473 | Bacteria | 6730 |
| 772 | Ga0495582_0013298 | 3300046473 | Bacteria | 4531 |
| 773 | Ga0495582_0052396 | 3300046473 | Bacteria | 2250 |
| 774 | Ga0495605_0129073 | 3300046474 | Bacteria | 1141 |
| 775 | Ga0495639_0042911 | 3300046475 | Bacteria | 2041 |
| 776 | Ga0495639_0069063 | 3300046475 | Bacteria | 1629 |
| 777 | Ga0495639_0095392 | 3300046475 | Bacteria | 1399 |
| 778 | Ga0495662_0001894 | 3300046476 | Bacteria | 10495 |
| 779 | Ga0495662_0003150 | 3300046476 | Bacteria | 8321 |
| 780 | Ga0495662_0009265 | 3300046476 | Bacteria | 4829 |
| 781 | Ga0495662_0010784 | 3300046476 | Bacteria | 4468 |
| 782 | Ga0495662_0056662 | 3300046476 | Bacteria | 1893 |
| 783 | Ga0495662_0079271 | 3300046476 | Bacteria | 1596 |
| 784 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 785 | Ga0495664_0005906 | 3300046477 | Bacteria | 6737 |
| 786 | Ga0495664_0007402 | 3300046477 | Bacteria | 6096 |
| 787 | Ga0495664_0072871 | 3300046477 | Bacteria | 2053 |
| 788 | Ga0495584_0058837 | 3300046491 | Bacteria | 1933 |
| 789 | Ga0495585_0049171 | 3300046492 | Bacteria | 2342 |
| 790 | Ga0495594_0012401 | 3300046499 | Bacteria | 4439 |
| 791 | Ga0495594_0019299 | 3300046499 | Bacteria | 3621 |
| 792 | Ga0495594_0085576 | 3300046499 | Bacteria | 1763 |
| 793 | Ga0495607_0010403 | 3300046501 | Bacteria | 6256 |
| 794 | Ga0495607_0056603 | 3300046501 | Bacteria | 2251 |
| 795 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 796 | Ga0495608_0006088 | 3300046511 | Bacteria | 8560 |
| 797 | Ga0495608_0006648 | 3300046511 | Bacteria | 8205 |
| 798 | Ga0495618_0000001 | 3300046514 | Bacteria | 282202 |
| 799 | Ga0495618_0002201 | 3300046514 | Bacteria | 12750 |
| 800 | Ga0495618_0059037 | 3300046514 | Bacteria | 2430 |
| 801 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 802 | Ga0495628_0021376 | 3300046516 | Bacteria | 5323 |
| 803 | Ga0495628_0042157 | 3300046516 | Bacteria | 3641 |
| 804 | Ga0495630_0003468 | 3300046517 | Bacteria | 10958 |
| 805 | Ga0495630_0011056 | 3300046517 | Bacteria | 6530 |
| 806 | Ga0495630_0064058 | 3300046517 | Bacteria | 2761 |
| 807 | Ga0495630_0128836 | 3300046517 | Bacteria | 1921 |
| 808 | Ga0495630_0184910 | 3300046517 | Bacteria | 1589 |
| 809 | Ga0495630_0190911 | 3300046517 | Bacteria | 1563 |
| 810 | Ga0495630_0464088 | 3300046517 | Bacteria | 970 |
| 811 | Ga0495637_0080842 | 3300046520 | Bacteria | 1296 |
| 812 | Ga0495643_0062720 | 3300046522 | Bacteria | 1967 |
| 813 | Ga0495644_0000312 | 3300046523 | Bacteria | 22452 |
| 814 | Ga0495663_0058803 | 3300046525 | Bacteria | 1205 |
| 815 | Ga0495666_0009011 | 3300046526 | Bacteria | 4990 |
| 816 | Ga0495666_0012241 | 3300046526 | Bacteria | 4278 |
| 817 | Ga0495666_0019754 | 3300046526 | Bacteria | 3340 |
| 818 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 819 | Ga0495652_0030506 | 3300046529 | Bacteria | 4727 |
| 820 | Ga0495652_0049908 | 3300046529 | Bacteria | 3580 |
| 821 | Ga0495652_0088050 | 3300046529 | Bacteria | 2545 |
| 822 | Ga0495652_0221580 | 3300046529 | Bacteria | 1421 |
| 823 | Ga0495665_0008576 | 3300046531 | Bacteria | 5546 |
| 824 | Ga0495665_0009133 | 3300046531 | Bacteria | 5374 |
| 825 | Ga0495665_0059593 | 3300046531 | Bacteria | 2015 |
| 826 | Ga0495665_0159736 | 3300046531 | Bacteria | 1175 |
| 827 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 828 | Ga0495640_0007732 | 3300046533 | Bacteria | 8454 |
| 829 | Ga0495640_0017299 | 3300046533 | Bacteria | 5375 |
| 830 | Ga0495640_0121865 | 3300046533 | Bacteria | 1694 |
| 831 | Ga0495586_0023372 | 3300046535 | Bacteria | 3301 |
| 832 | Ga0495586_0029905 | 3300046535 | Bacteria | 2916 |
| 833 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 834 | Ga0495587_0002925 | 3300046536 | Bacteria | 11432 |
| 835 | Ga0495587_0005039 | 3300046536 | Bacteria | 8644 |
| 836 | Ga0495587_0020800 | 3300046536 | Bacteria | 4047 |
| 837 | Ga0495587_0025016 | 3300046536 | Bacteria | 3652 |
| 838 | Ga0495598_0046597 | 3300046537 | Bacteria | 1289 |
| 839 | Ga0495609_0027480 | 3300046538 | Bacteria | 2600 |
| 840 | Ga0495609_0033690 | 3300046538 | Bacteria | 2325 |
| 841 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 842 | Ga0495645_0003668 | 3300046543 | Bacteria | 10430 |
| 843 | Ga0495645_0021226 | 3300046543 | Bacteria | 4693 |
| 844 | Ga0495645_0054915 | 3300046543 | Bacteria | 2893 |
| 845 | Ga0495633_0001295 | 3300046558 | Bacteria | 19775 |
| 846 | Ga0495667_0000006 | 3300046559 | Bacteria | 257523 |
| 847 | Ga0495667_0002953 | 3300046559 | Bacteria | 11410 |
| 848 | Ga0495667_0003478 | 3300046559 | Bacteria | 10553 |
| 849 | Ga0495667_0007034 | 3300046559 | Bacteria | 7635 |
| 850 | Ga0495667_0039564 | 3300046559 | Bacteria | 3135 |
| 851 | Ga0495667_0128741 | 3300046559 | Bacteria | 1633 |
| 852 | Ga0495656_0000522 | 3300046615 | Bacteria | 12534 |
| 853 | Ga0495634_0000001 | 3300046642 | Bacteria | 303746 |
| 854 | Ga0495634_0015929 | 3300046642 | Bacteria | 5384 |
| 855 | Ga0495634_0023747 | 3300046642 | Bacteria | 4308 |
| 856 | Ga0495634_0040721 | 3300046642 | Bacteria | 3157 |
| 857 | Ga0495611_0013926 | 3300046648 | Bacteria | 3431 |
| 858 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 859 | Ga0495635_0000123 | 3300046663 | Bacteria | 47100 |
| 860 | Ga0495635_0011422 | 3300046663 | Bacteria | 6229 |
| 861 | Ga0495635_0016155 | 3300046663 | Bacteria | 5212 |
| 862 | Ga0495635_0017382 | 3300046663 | Bacteria | 5024 |
| 863 | Ga0495635_0028200 | 3300046663 | Bacteria | 3902 |
| 864 | Ga0495635_0117984 | 3300046663 | Bacteria | 1811 |
| 865 | Ga0495635_0124318 | 3300046663 | Bacteria | 1759 |
| 866 | Ga0495659_0032781 | 3300046664 | Bacteria | 1820 |
| 867 | Ga0495659_0068501 | 3300046664 | Bacteria | 1325 |
| 868 | Ga0495659_0077831 | 3300046664 | Unclassified | 1253 |
| 869 | Ga0495588_0009872 | 3300046674 | Bacteria | 4425 |
| 870 | Ga0495588_0031902 | 3300046674 | Bacteria | 2654 |
| 871 | Ga0495657_0000139 | 3300046675 | Bacteria | 65385 |
| 872 | Ga0495657_0009876 | 3300046675 | Bacteria | 7202 |
| 873 | Ga0495657_0053038 | 3300046675 | Bacteria | 2715 |
| 874 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 875 | Ga0495599_0010016 | 3300046678 | Bacteria | 5803 |
| 876 | Ga0495599_0117601 | 3300046678 | Bacteria | 1653 |
| 877 | Ga0495599_0156758 | 3300046678 | Bacteria | 1408 |
| 878 | Ga0495623_0000048 | 3300046679 | Bacteria | 73714 |
| 879 | Ga0495623_0002450 | 3300046679 | Bacteria | 12303 |
| 880 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 881 | Ga0495646_0006974 | 3300046680 | Bacteria | 7175 |
| 882 | Ga0495646_0017298 | 3300046680 | Bacteria | 4573 |
| 883 | Ga0495646_0060709 | 3300046680 | Bacteria | 2253 |
| 884 | Ga0495647_0012751 | 3300046681 | Bacteria | 2899 |
| 885 | Ga0495647_0032742 | 3300046681 | Unclassified | 1939 |
| 886 | Ga0495658_0004396 | 3300046683 | Bacteria | 6940 |
| 887 | Ga0495658_0031443 | 3300046683 | Bacteria | 2891 |
| 888 | Ga0495658_0036565 | 3300046683 | Bacteria | 2710 |
| 889 | Ga0495658_0042330 | 3300046683 | Bacteria | 2542 |
| 890 | Ga0495658_0135233 | 3300046683 | Bacteria | 1504 |
| 891 | Ga0495669_0031031 | 3300046684 | Bacteria | 2346 |
| 892 | Ga0495613_0003849 | 3300046689 | Bacteria | 11230 |
| 893 | Ga0495613_0011297 | 3300046689 | Bacteria | 6634 |
| 894 | Ga0495613_0031905 | 3300046689 | Bacteria | 3913 |
| 895 | Ga0495613_0061800 | 3300046689 | Bacteria | 2742 |
| 896 | Ga0495624_0002831 | 3300046690 | Bacteria | 12987 |
| 897 | Ga0495624_0007113 | 3300046690 | Bacteria | 7874 |
| 898 | Ga0495624_0016426 | 3300046690 | Bacteria | 4982 |
| 899 | Ga0495624_0032056 | 3300046690 | Bacteria | 3410 |
| 900 | Ga0495624_0098731 | 3300046690 | Bacteria | 1798 |
| 901 | Ga0495670_0000701 | 3300046691 | Bacteria | 15976 |
| 902 | Ga0495670_0149171 | 3300046691 | Bacteria | 1226 |
| 903 | Ga0495649_0052194 | 3300046694 | Bacteria | 2216 |
| 904 | Ga0495600_0000083 | 3300046809 | Bacteria | 52058 |
| 905 | Ga0495600_0003659 | 3300046809 | Bacteria | 9072 |
| 906 | Ga0495600_0008685 | 3300046809 | Bacteria | 6251 |
| 907 | Ga0495600_0016229 | 3300046809 | Bacteria | 4722 |
| 908 | Ga0495600_0194031 | 3300046809 | Bacteria | 1305 |
| 909 | Ga0495581_0003328 | 3300047315 | Bacteria | 9232 |
| 910 | Ga0495581_0030379 | 3300047315 | Bacteria | 3131 |
| 911 | Ga0495581_0052466 | 3300047315 | Unclassified | 2355 |
| 912 | Ga0495581_0071628 | 3300047315 | Bacteria | 2005 |
| 913 | Ga0495581_0092475 | 3300047315 | Bacteria | 1756 |
| 914 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 915 | Ga0495604_0001090 | 3300047317 | Bacteria | 22540 |
| 916 | Ga0495604_0009839 | 3300047317 | Bacteria | 7565 |
| 917 | Ga0495604_0012255 | 3300047317 | Bacteria | 6816 |
| 918 | Ga0495604_0096576 | 3300047317 | Bacteria | 2180 |
| 919 | Ga0495674_0000006 | 3300047319 | Bacteria | 341772 |
| 920 | Ga0495674_0003125 | 3300047319 | Bacteria | 16088 |
| 921 | Ga0495674_0003227 | 3300047319 | Bacteria | 15826 |
| 922 | Ga0495674_0011118 | 3300047319 | Bacteria | 8498 |
| 923 | Ga0495674_0077789 | 3300047319 | Bacteria | 2851 |
| 924 | Ga0495676_0052656 | 3300047321 | Bacteria | 3247 |
| 925 | Ga0495676_0124665 | 3300047321 | Bacteria | 1868 |
| 926 | Ga0495676_0222156 | 3300047321 | Unclassified | 1301 |
| 927 | Ga0495680_0000795 | 3300047322 | Bacteria | 35314 |
| 928 | Ga0495680_0000825 | 3300047322 | Bacteria | 34510 |
| 929 | Ga0495680_0002001 | 3300047322 | Bacteria | 21392 |
| 930 | Ga0495680_0037655 | 3300047322 | Bacteria | 3873 |
| 931 | Ga0495680_0042963 | 3300047322 | Bacteria | 3583 |
| 932 | Ga0495680_0087177 | 3300047322 | Bacteria | 2348 |
| 933 | Ga0495683_0144629 | 3300047323 | Bacteria | 1112 |
| 934 | Ga0495675_0000109 | 3300047444 | Bacteria | 59153 |
| 935 | Ga0495675_0004145 | 3300047444 | Bacteria | 8773 |
| 936 | Ga0495675_0018767 | 3300047444 | Bacteria | 4393 |
| 937 | Ga0495684_0000003 | 3300047471 | Bacteria | 331335 |
| 938 | Ga0495684_0005001 | 3300047471 | Bacteria | 10343 |
| 939 | Ga0495684_0005490 | 3300047471 | Bacteria | 9867 |
| 940 | Ga0495684_0251615 | 3300047471 | Bacteria | 1285 |
| 941 | Ga0495593_0000767 | 3300047673 | Bacteria | 18655 |
| 942 | Ga0495593_0015854 | 3300047673 | Bacteria | 4258 |
| 943 | Ga0495593_0023159 | 3300047673 | Bacteria | 3454 |
| 944 | Ga0495602_0000011 | 3300048088 | Bacteria | 212024 |
| 945 | Ga0495602_0001877 | 3300048088 | Bacteria | 21025 |
| 946 | Ga0495602_0010500 | 3300048088 | Bacteria | 9612 |
| 947 | Ga0495602_0065204 | 3300048088 | Bacteria | 3144 |
| 948 | Ga0495602_0297384 | 3300048088 | Bacteria | 1182 |
| 949 | Ga0495614_0024177 | 3300048089 | Bacteria | 2623 |
| 950 | Ga0495614_0058038 | 3300048089 | Bacteria | 1662 |
| 951 | Ga0496100_0002097 | 3300048903 | Bacteria | 10039 |
| 952 | Ga0496100_0006356 | 3300048903 | Bacteria | 6437 |
| 953 | Ga0496100_0025496 | 3300048903 | Bacteria | 3617 |
| 954 | Ga0496100_0037227 | 3300048903 | Bacteria | 3074 |
| 955 | Ga0496100_0067752 | 3300048903 | Bacteria | 2371 |
| 956 | Ga0496101_0001573 | 3300048904 | Bacteria | 13684 |
| 957 | Ga0496101_0003612 | 3300048904 | Bacteria | 9651 |
| 958 | Ga0496101_0006966 | 3300048904 | Bacteria | 7300 |
| 959 | Ga0496101_0084085 | 3300048904 | Bacteria | 2356 |
| 960 | Ga0496102_0002596 | 3300048905 | Bacteria | 15421 |
| 961 | Ga0496102_0014548 | 3300048905 | Bacteria | 6837 |
| 962 | Ga0496102_0016207 | 3300048905 | Bacteria | 6512 |
| 963 | Ga0496102_0203036 | 3300048905 | Bacteria | 1868 |
| 964 | Ga0496102_0223176 | 3300048905 | Bacteria | 1777 |
| 965 | Ga0496102_0337506 | 3300048905 | Bacteria | 1419 |
| 966 | Ga0496103_0000963 | 3300048906 | Bacteria | 20444 |
| 967 | Ga0496103_0012426 | 3300048906 | Bacteria | 5049 |
| 968 | Ga0496104_0001393 | 3300048907 | Bacteria | 20913 |
| 969 | Ga0496104_0003080 | 3300048907 | Bacteria | 14372 |
| 970 | Ga0496104_0008002 | 3300048907 | Bacteria | 9374 |
| 971 | Ga0496104_0017091 | 3300048907 | Bacteria | 6601 |
| 972 | Ga0496104_0053582 | 3300048907 | Bacteria | 3812 |
| 973 | Ga0496104_0057914 | 3300048907 | Bacteria | 3667 |
| 974 | Ga0496104_0060617 | 3300048907 | Bacteria | 3584 |
| 975 | Ga0496104_0196139 | 3300048907 | Bacteria | 1931 |
| 976 | Ga0496104_0208634 | 3300048907 | Bacteria | 1865 |
| 977 | Ga0496104_0233050 | 3300048907 | Bacteria | 1753 |
| 978 | Ga0496105_0006839 | 3300048908 | Bacteria | 8772 |
| 979 | Ga0496105_0016436 | 3300048908 | Bacteria | 5910 |
| 980 | Ga0496105_0017193 | 3300048908 | Bacteria | 5792 |
| 981 | Ga0496105_0020989 | 3300048908 | Bacteria | 5282 |
| 982 | Ga0496105_0042813 | 3300048908 | Bacteria | 3733 |
| 983 | Ga0496105_0057934 | 3300048908 | Bacteria | 3198 |
| 984 | Ga0496105_0061855 | 3300048908 | Bacteria | 3089 |
| 985 | Ga0496106_0006418 | 3300048909 | Bacteria | 8708 |
| 986 | Ga0496106_0007022 | 3300048909 | Bacteria | 8315 |
| 987 | Ga0496106_0008577 | 3300048909 | Bacteria | 7563 |
| 988 | Ga0496106_0010388 | 3300048909 | Bacteria | 6878 |
| 989 | Ga0496106_0049674 | 3300048909 | Bacteria | 3160 |
| 990 | Ga0496106_0052883 | 3300048909 | Bacteria | 3065 |
| 991 | Ga0496106_0068739 | 3300048909 | Bacteria | 2702 |
| 992 | Ga0496106_0106989 | 3300048909 | Bacteria | 2175 |
| 993 | Ga0496106_0296987 | 3300048909 | Bacteria | 1295 |
| 994 | Ga0496106_0497504 | 3300048909 | Bacteria | 979 |
| 995 | Ga0496107_0004013 | 3300048910 | Bacteria | 9911 |
| 996 | Ga0496107_0012549 | 3300048910 | Bacteria | 5916 |
| 997 | Ga0496107_0023797 | 3300048910 | Bacteria | 4330 |
| 998 | Ga0496107_0031391 | 3300048910 | Bacteria | 3790 |
| 999 | Ga0496108_0000626 | 3300048911 | Bacteria | 27644 |
| 1000 | Ga0496108_0001093 | 3300048911 | Bacteria | 21176 |
| 1001 | Ga0496108_0010782 | 3300048911 | Bacteria | 7418 |
| 1002 | Ga0496108_0014245 | 3300048911 | Bacteria | 6489 |
| 1003 | Ga0496108_0017276 | 3300048911 | Bacteria | 5901 |
| 1004 | Ga0496108_0080063 | 3300048911 | Bacteria | 2766 |
| 1005 | Ga0496108_0110276 | 3300048911 | Bacteria | 2352 |
| 1006 | Ga0496108_0193092 | 3300048911 | Bacteria | 1765 |
| 1007 | Ga0496109_0001690 | 3300048912 | Bacteria | 18382 |
| 1008 | Ga0496109_0002491 | 3300048912 | Bacteria | 15432 |
| 1009 | Ga0496109_0002725 | 3300048912 | Bacteria | 14810 |
| 1010 | Ga0496109_0028465 | 3300048912 | Bacteria | 4997 |
| 1011 | Ga0496109_0045631 | 3300048912 | Bacteria | 3977 |
| 1012 | Ga0496109_0093967 | 3300048912 | Bacteria | 2775 |
| 1013 | Ga0496109_0110973 | 3300048912 | Bacteria | 2550 |
| 1014 | Ga0496109_0428696 | 3300048912 | Bacteria | 1249 |
| 1015 | Ga0496110_0005926 | 3300048913 | Bacteria | 9616 |
| 1016 | Ga0496110_0009277 | 3300048913 | Bacteria | 7957 |
| 1017 | Ga0496110_0009396 | 3300048913 | Bacteria | 7916 |
| 1018 | Ga0496110_0126494 | 3300048913 | Bacteria | 2306 |
| 1019 | Ga0496110_0553494 | 3300048913 | Unclassified | 1045 |
| 1020 | Ga0496111_0002392 | 3300048914 | Bacteria | 11308 |
| 1021 | Ga0496111_0010978 | 3300048914 | Bacteria | 6093 |
| 1022 | Ga0496111_0014108 | 3300048914 | Bacteria | 5450 |
| 1023 | Ga0496111_0020330 | 3300048914 | Bacteria | 4621 |
| 1024 | Ga0496111_0022206 | 3300048914 | Bacteria | 4439 |
| 1025 | Ga0496111_0032758 | 3300048914 | Bacteria | 3705 |
| 1026 | Ga0496111_0158501 | 3300048914 | Bacteria | 1680 |
| 1027 | Ga0496111_0327728 | 3300048914 | Bacteria | 1134 |
| 1028 | Ga0496112_0002087 | 3300048915 | Bacteria | 15846 |
| 1029 | Ga0496112_0006295 | 3300048915 | Bacteria | 10413 |
| 1030 | Ga0496112_0009904 | 3300048915 | Bacteria | 8618 |
| 1031 | Ga0496112_0013016 | 3300048915 | Bacteria | 7671 |
| 1032 | Ga0496112_0035200 | 3300048915 | Bacteria | 4875 |
| 1033 | Ga0496112_0088433 | 3300048915 | Bacteria | 3066 |
| 1034 | Ga0496112_0103374 | 3300048915 | Bacteria | 2819 |
| 1035 | Ga0496113_0000329 | 3300048916 | Bacteria | 22567 |
| 1036 | Ga0496113_0000855 | 3300048916 | Bacteria | 15935 |
| 1037 | Ga0496113_0007129 | 3300048916 | Bacteria | 7160 |
| 1038 | Ga0496113_0023131 | 3300048916 | Bacteria | 4404 |
| 1039 | Ga0496113_0034534 | 3300048916 | Bacteria | 3690 |
| 1040 | Ga0496113_0069969 | 3300048916 | Bacteria | 2666 |
| 1041 | Ga0496113_0177889 | 3300048916 | Bacteria | 1686 |
| 1042 | Ga0496114_0001660 | 3300048917 | Bacteria | 16874 |
| 1043 | Ga0496114_0048532 | 3300048917 | Bacteria | 3531 |
| 1044 | Ga0496114_0158674 | 3300048917 | Bacteria | 1965 |
| 1045 | Ga0496114_0166607 | 3300048917 | Bacteria | 1918 |
| 1046 | Ga0496115_0001117 | 3300048918 | Bacteria | 19364 |
| 1047 | Ga0496115_0115007 | 3300048918 | Bacteria | 2212 |
| 1048 | Ga0496115_0119922 | 3300048918 | Bacteria | 2164 |
| 1049 | Ga0496115_0152187 | 3300048918 | Bacteria | 1910 |
| 1050 | Ga0496115_0228020 | 3300048918 | Bacteria | 1536 |
| 1051 | Ga0496115_0278007 | 3300048918 | Bacteria | 1375 |
| 1052 | Ga0496122_0048492 | 3300048925 | Bacteria | 3264 |
| 1053 | Ga0496125_0122443 | 3300048928 | Bacteria | 1851 |
| 1054 | Ga0496125_0137958 | 3300048928 | Bacteria | 1702 |
| 1055 | Ga0496126_0372965 | 3300048929 | Bacteria | 1163 |
| 1056 | Ga0501031_0077351 | 3300049568 | Bacteria | 2167 |
| 1057 | Ga0501032_0033654 | 3300049569 | Bacteria | 3510 |
| 1058 | Ga0501032_0079696 | 3300049569 | Bacteria | 2180 |
| 1059 | Ga0501032_0114952 | 3300049569 | Bacteria | 1779 |
| 1060 | Ga0501033_0042229 | 3300049570 | Bacteria | 3400 |
| 1061 | Ga0501033_0050428 | 3300049570 | Bacteria | 3087 |
| 1062 | Ga0501033_0082791 | 3300049570 | Bacteria | 2352 |
| 1063 | Ga0501034_0000772 | 3300049571 | Bacteria | 47902 |
| 1064 | Ga0501034_0019501 | 3300049571 | Bacteria | 6936 |
| 1065 | Ga0501034_0031173 | 3300049571 | Bacteria | 5418 |
| 1066 | Ga0501034_0142240 | 3300049571 | Bacteria | 2378 |
| 1067 | Ga0501034_0156132 | 3300049571 | Bacteria | 2255 |
| 1068 | Ga0501034_0350334 | 3300049571 | Bacteria | 1405 |
| 1069 | Ga0501036_0001347 | 3300049572 | Bacteria | 18840 |
| 1070 | Ga0501036_0005113 | 3300049572 | Bacteria | 10604 |
| 1071 | Ga0501036_0005897 | 3300049572 | Bacteria | 9927 |
| 1072 | Ga0501036_0012992 | 3300049572 | Bacteria | 6914 |
| 1073 | Ga0501036_0203394 | 3300049572 | Bacteria | 1665 |
| 1074 | Ga0501037_0006285 | 3300049573 | Bacteria | 8687 |
| 1075 | Ga0501037_0008680 | 3300049573 | Bacteria | 7451 |
| 1076 | Ga0501037_0025041 | 3300049573 | Bacteria | 4410 |
| 1077 | Ga0501037_0131572 | 3300049573 | Bacteria | 1794 |
| 1078 | Ga0501038_0026586 | 3300049574 | Bacteria | 5154 |
| 1079 | Ga0501038_0076017 | 3300049574 | Bacteria | 2837 |
| 1080 | Ga0501038_0121374 | 3300049574 | Bacteria | 2154 |
| 1081 | Ga0501039_0009445 | 3300049575 | Bacteria | 7435 |
| 1082 | Ga0501039_0050088 | 3300049575 | Bacteria | 3230 |
| 1083 | Ga0501039_0066960 | 3300049575 | Bacteria | 2789 |
| 1084 | Ga0501039_0338611 | 3300049575 | Bacteria | 1182 |
| 1085 | Ga0501039_0473926 | 3300049575 | Bacteria | 983 |
| 1086 | Ga0501040_0224358 | 3300049576 | Bacteria | 1337 |
| 1087 | Ga0501040_0375304 | 3300049576 | Bacteria | 1020 |
| 1088 | Ga0501042_0292404 | 3300049578 | Bacteria | 1177 |
| 1089 | Ga0501043_0006610 | 3300049579 | Bacteria | 9284 |
| 1090 | Ga0501043_0035066 | 3300049579 | Bacteria | 3946 |
| 1091 | Ga0501043_0372910 | 3300049579 | Bacteria | 1081 |
| 1092 | Ga0501046_0028930 | 3300049580 | Bacteria | 4509 |
| 1093 | Ga0501046_0029341 | 3300049580 | Bacteria | 4472 |
| 1094 | Ga0501046_0031961 | 3300049580 | Bacteria | 4264 |
| 1095 | Ga0501046_0079870 | 3300049580 | Bacteria | 2528 |
| 1096 | Ga0501046_0165265 | 3300049580 | Bacteria | 1663 |
| 1097 | Ga0501046_0255618 | 3300049580 | Bacteria | 1288 |
| 1098 | Ga0501047_0000136 | 3300049581 | Bacteria | 89236 |
| 1099 | Ga0501047_0007923 | 3300049581 | Bacteria | 10016 |
| 1100 | Ga0501047_0089349 | 3300049581 | Bacteria | 2958 |
| 1101 | Ga0501047_0093053 | 3300049581 | Bacteria | 2893 |
| 1102 | Ga0501047_0108462 | 3300049581 | Bacteria | 2659 |
| 1103 | Ga0501047_0324647 | 3300049581 | Bacteria | 1378 |
| 1104 | Ga0501048_0000039 | 3300049582 | Bacteria | 63521 |
| 1105 | Ga0501048_0014119 | 3300049582 | Bacteria | 5919 |
| 1106 | Ga0501048_0072602 | 3300049582 | Bacteria | 2429 |
| 1107 | Ga0501067_0019377 | 3300049583 | Bacteria | 3765 |
| 1108 | Ga0501068_0019636 | 3300049584 | Bacteria | 3927 |
| 1109 | Ga0501068_0053873 | 3300049584 | Bacteria | 2436 |
| 1110 | Ga0501068_0058714 | 3300049584 | Bacteria | 2335 |
| 1111 | Ga0501070_0048115 | 3300049586 | Bacteria | 3542 |
| 1112 | Ga0501070_0064092 | 3300049586 | Bacteria | 3044 |
| 1113 | Ga0501070_0071174 | 3300049586 | Bacteria | 2879 |
| 1114 | Ga0501071_0266777 | 3300049587 | Bacteria | 1294 |
| 1115 | Ga0501072_0000783 | 3300049588 | Bacteria | 23295 |
| 1116 | Ga0501072_0041737 | 3300049588 | Bacteria | 3604 |
| 1117 | Ga0501072_0140764 | 3300049588 | Bacteria | 1923 |
| 1118 | Ga0501072_0159006 | 3300049588 | Bacteria | 1802 |
| 1119 | Ga0501072_0167232 | 3300049588 | Unclassified | 1754 |
| 1120 | Ga0501072_0299083 | 3300049588 | Bacteria | 1279 |
| 1121 | Ga0501073_0007504 | 3300049589 | Bacteria | 8100 |
| 1122 | Ga0501073_0072356 | 3300049589 | Bacteria | 2401 |
| 1123 | Ga0501073_0363455 | 3300049589 | Bacteria | 999 |
| 1124 | Ga0501073_0439073 | 3300049589 | Bacteria | 902 |
| 1125 | Ga0501074_0011889 | 3300049590 | Bacteria | 6329 |
| 1126 | Ga0501074_0034926 | 3300049590 | Bacteria | 3643 |
| 1127 | Ga0501075_0010046 | 3300049591 | Bacteria | 6640 |
| 1128 | Ga0501075_0028210 | 3300049591 | Bacteria | 4142 |
| 1129 | Ga0501075_0104823 | 3300049591 | Bacteria | 2149 |
| 1130 | Ga0501076_0003117 | 3300049592 | Bacteria | 11548 |
| 1131 | Ga0501076_0027114 | 3300049592 | Bacteria | 4444 |
| 1132 | Ga0501076_0048362 | 3300049592 | Bacteria | 3362 |
| 1133 | Ga0501077_0013675 | 3300049593 | Bacteria | 5087 |
| 1134 | Ga0501077_0038213 | 3300049593 | Bacteria | 3056 |
| 1135 | Ga0501077_0046503 | 3300049593 | Bacteria | 2757 |
| 1136 | Ga0501077_0116468 | 3300049593 | Bacteria | 1693 |
| 1137 | Ga0501079_0008450 | 3300049741 | Bacteria | 7805 |
| 1138 | Ga0501079_0045576 | 3300049741 | Bacteria | 3384 |
| 1139 | Ga0501079_0046472 | 3300049741 | Bacteria | 3350 |
| 1140 | Ga0501079_0074600 | 3300049741 | Bacteria | 2622 |
| 1141 | Ga0501079_0173682 | 3300049741 | Bacteria | 1680 |
| 1142 | Ga0501079_0242161 | 3300049741 | Bacteria | 1409 |
| 1143 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 1144 | Ga0501080_0028092 | 3300049742 | Bacteria | 5230 |
| 1145 | Ga0501080_0058994 | 3300049742 | Bacteria | 3571 |
| 1146 | Ga0501080_0118905 | 3300049742 | Bacteria | 2450 |
| 1147 | Ga0501080_0183106 | 3300049742 | Unclassified | 1927 |
| 1148 | Ga0501081_0005161 | 3300049743 | Bacteria | 8411 |
| 1149 | Ga0501081_0022554 | 3300049743 | Bacteria | 4213 |
| 1150 | Ga0501081_0200957 | 3300049743 | Bacteria | 1445 |
| 1151 | Ga0501083_0009158 | 3300049744 | Bacteria | 6994 |
| 1152 | Ga0501083_0031756 | 3300049744 | Bacteria | 3624 |
| 1153 | Ga0501083_0058740 | 3300049744 | Bacteria | 2573 |
| 1154 | Ga0501083_0080094 | 3300049744 | Bacteria | 2166 |
| 1155 | Ga0501083_0136140 | 3300049744 | Bacteria | 1609 |
| 1156 | Ga0501083_0252565 | 3300049744 | Bacteria | 1148 |
| 1157 | Ga0501035_0038898 | 3300049822 | Bacteria | 4307 |
| 1158 | Ga0501035_0039580 | 3300049822 | Bacteria | 4265 |
| 1159 | Ga0501035_0067613 | 3300049822 | Bacteria | 3170 |
| 1160 | Ga0501035_0205427 | 3300049822 | Bacteria | 1688 |
| 1161 | Ga0501035_0256786 | 3300049822 | Bacteria | 1483 |
| 1162 | Ga0501044_0005112 | 3300049823 | Bacteria | 14631 |
| 1163 | Ga0501044_0005747 | 3300049823 | Bacteria | 13731 |
| 1164 | Ga0501044_0037235 | 3300049823 | Bacteria | 5086 |
| 1165 | Ga0501044_0051391 | 3300049823 | Bacteria | 4250 |
| 1166 | Ga0501044_0057707 | 3300049823 | Bacteria | 3983 |
| 1167 | Ga0501044_0133556 | 3300049823 | Bacteria | 2474 |
| 1168 | Ga0501045_0022917 | 3300049824 | Bacteria | 4473 |
| 1169 | Ga0501045_0076811 | 3300049824 | Bacteria | 2461 |
| 1170 | Ga0501045_0199719 | 3300049824 | Bacteria | 1490 |
| 1171 | nmdc:mga00v17_13334_c1 | 3300050491 | Bacteria | 4560 |
| 1172 | nmdc:mga0k408_7417_c1 | 3300050493 | Bacteria | 5855 |
| 1173 | nmdc:mga06z11_17026_c1 | 3300050494 | Bacteria | 3289 |
| 1174 | nmdc:mga06z11_259108_c1 | 3300050494 | Bacteria | 1026 |
| 1175 | nmdc:mga05p37_16217_c1 | 3300050507 | Bacteria | 8969 |
| 1176 | nmdc:mga05p37_248326_c1 | 3300050507 | Bacteria | 2136 |
| 1177 | nmdc:mga05p37_35915_c1 | 3300050507 | Bacteria | 6081 |
| 1178 | nmdc:mga05p37_5080_c1 | 3300050507 | Bacteria | 15430 |
| 1179 | nmdc:mga09592_9145_c1 | 3300050508 | Bacteria | 7115 |
| 1180 | nmdc:mga0qj67_113891_c1 | 3300050509 | Bacteria | 2184 |
| 1181 | nmdc:mga0qj67_4_c1 | 3300050509 | Bacteria | 176711 |
| 1182 | nmdc:mga06r32_72029_c1 | 3300050510 | Bacteria | 3346 |
| 1183 | nmdc:mga08y16_1115_c1 | 3300050511 | Bacteria | 26487 |
| 1184 | nmdc:mga08y16_146103_c1 | 3300050511 | Bacteria | 2458 |
| 1185 | nmdc:mga08y16_279183_c1 | 3300050511 | Bacteria | 1723 |
| 1186 | nmdc:mga08y16_335349_c1 | 3300050511 | Bacteria | 1555 |
| 1187 | nmdc:mga08y16_58759_c1 | 3300050511 | Bacteria | 4018 |
| 1188 | nmdc:mga08y16_940_c1 | 3300050511 | Bacteria | 28306 |
| 1189 | nmdc:mga0n895_13630_c1 | 3300050512 | Bacteria | 7346 |
| 1190 | nmdc:mga0n895_580510_c1 | 3300050512 | Bacteria | 1125 |
| 1191 | nmdc:mga0n895_6093_c1 | 3300050512 | Bacteria | 10180 |
| 1192 | nmdc:mga0n895_68710_c1 | 3300050512 | Bacteria | 3510 |
| 1193 | nmdc:mga0rr50_124793_c1 | 3300050513 | Bacteria | 2054 |
| 1194 | nmdc:mga0rr50_24181_c1 | 3300050513 | Bacteria | 4204 |
| 1195 | nmdc:mga0rr50_269319_c1 | 3300050513 | Bacteria | 1419 |
| 1196 | nmdc:mga0rr50_600949_c1 | 3300050513 | Bacteria | 938 |
| 1197 | nmdc:mga08x19_23812_c1 | 3300050514 | Bacteria | 3800 |
| 1198 | nmdc:mga0a205_14863_c1 | 3300050515 | Bacteria | 7265 |
| 1199 | nmdc:mga0a205_183933_c1 | 3300050515 | Bacteria | 1983 |
| 1200 | nmdc:mga0a205_213_c1 | 3300050515 | Bacteria | 40801 |
| 1201 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 1202 | Ga0495601_0000347 | 3300053077 | Bacteria | 24383 |
| 1203 | Ga0495601_0000993 | 3300053077 | Bacteria | 15524 |
| 1204 | Ga0495601_0001303 | 3300053077 | Bacteria | 13690 |
| 1205 | Ga0495612_0000008 | 3300053078 | Bacteria | 232633 |
| 1206 | Ga0495612_0002372 | 3300053078 | Bacteria | 7760 |
| 1207 | Ga0495612_0004290 | 3300053078 | Bacteria | 5918 |
| 1208 | Ga0495612_0007390 | 3300053078 | Bacteria | 4489 |
| 1209 | Ga0495612_0045915 | 3300053078 | Bacteria | 1788 |
| 1210 | Ga0495612_0056043 | 3300053078 | Bacteria | 1626 |
| 1211 | Ga0495595_0000231 | 3300053084 | Bacteria | 22163 |
| 1212 | Ga0495595_0001232 | 3300053084 | Bacteria | 9952 |
| 1213 | Ga0495595_0005605 | 3300053084 | Bacteria | 5082 |
| 1214 | Ga0495595_0009841 | 3300053084 | Bacteria | 3963 |
| 1215 | Ga0495595_0058421 | 3300053084 | Bacteria | 1801 |
| 1216 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 1217 | Ga0495619_0000083 | 3300053085 | Bacteria | 70312 |
| 1218 | Ga0495619_0000360 | 3300053085 | Bacteria | 31637 |
| 1219 | Ga0495619_0001190 | 3300053085 | Bacteria | 17140 |
| 1220 | Ga0495619_0013867 | 3300053085 | Bacteria | 5085 |
| 1221 | Ga0495619_0023486 | 3300053085 | Bacteria | 3953 |
| 1222 | Ga0495619_0053980 | 3300053085 | Bacteria | 2659 |
| 1223 | Ga0495619_0091584 | 3300053085 | Bacteria | 2058 |
| 1224 | Ga0500643_019710 | 3300053087 | Bacteria | 2216 |
| 1225 | Ga0500644_0000887 | 3300053088 | Bacteria | 9734 |
| 1226 | Ga0500651_0029388 | 3300053093 | Bacteria | 3456 |
| 1227 | Ga0500566_0017411 | 3300053094 | Bacteria | 4224 |
| 1228 | Ga0500566_0122855 | 3300053094 | Bacteria | 1398 |
| 1229 | Ga0500641_0015864 | 3300053096 | Bacteria | 2801 |
| 1230 | Ga0500654_058472 | 3300053099 | Bacteria | 1998 |
| 1231 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1232 | Ga0500642_0132199 | 3300053130 | Bacteria | 1170 |
| 1233 | Ga0500652_014053 | 3300053131 | Bacteria | 2853 |
| 1234 | Ga0500568_0087172 | 3300053139 | Bacteria | 1180 |
| 1235 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1236 | Ga0500634_0054968 | 3300053161 | Bacteria | 2132 |
| 1237 | Ga0500611_025528 | 3300053727 | Bacteria | 1172 |
| 1238 | Ga0500645_003223 | 3300053730 | Bacteria | 6752 |
| 1239 | Ga0501084_0043091 | 3300054114 | Bacteria | 3775 |
| 1240 | Ga0501084_0044973 | 3300054114 | Bacteria | 3697 |
| 1241 | Ga0501084_0050694 | 3300054114 | Bacteria | 3473 |
| 1242 | Ga0501084_0219723 | 3300054114 | Bacteria | 1603 |
| 1243 | Ga0501084_0239560 | 3300054114 | Bacteria | 1531 |
| 1244 | Ga0501082_0009209 | 3300060353 | Bacteria | 8510 |
| 1245 | Ga0501082_0012714 | 3300060353 | Bacteria | 7234 |
| 1246 | Ga0501082_0018728 | 3300060353 | Bacteria | 5965 |
| 1247 | Ga0501082_0175858 | 3300060353 | Bacteria | 1861 |
| 1248 | Ga0501082_0263132 | 3300060353 | Bacteria | 1500 |
| 1249 | Ga0466962_0079558 | 3300061719 | Bacteria | 1567 |
| 1250 | Ga0530510_0014732 | 3300061734 | Bacteria | 5521 |
| 1251 | Ga0530510_0025912 | 3300061734 | Bacteria | 4194 |
| 1252 | Ga0530510_0029751 | 3300061734 | Bacteria | 3921 |
| 1253 | Ga0530510_0134102 | 3300061734 | Bacteria | 1823 |
| 1254 | Ga0530510_0192710 | 3300061734 | Unclassified | 1513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0439073 | Ga0501073_0439073_43_885 | 263 |
| 2 | 3300046517 | Ga0495630_0464088 | Ga0495630_0464088_11_850 | 264 |
| 3 | 3300049575 | Ga0501039_0473926 | Ga0501039_0473926_101_943 | 266 |
| 4 | 3300037853 | Ga0436364_1422653 | Ga0436364_1422653_25_834 | 267 |
| 5 | 3300046522 | Ga0495643_0062720 | Ga0495643_0062720_24_830 | 267 |
| 6 | 3300046674 | Ga0495588_0031902 | Ga0495588_0031902_20_826 | 267 |
| 7 | 3300014326 | Ga0157380_10023039 | Ga0157380_100230391 | 268 |
| 8 | 3300035170 | Ga0373943_0045843 | Ga0373943_0045843_1244_2101 | 268 |
| 9 | 3300037068 | Ga0373925_0439238 | Ga0373925_0439238_20_877 | 268 |
| 10 | 3300048929 | Ga0496126_0372965 | Ga0496126_0372965_322_1134 | 268 |
| 11 | 3300050513 | nmdc:mga0rr50_600949_c1 | nmdc:mga0rr50_600949_c1_64_915 | 268 |
| 12 | 3300034816 | Ga0373930_0040994 | Ga0373930_0040994_148_966 | 272 |
| 13 | 3300035692 | Ga0373935_0285164 | Ga0373935_0285164_26_844 | 272 |
| 14 | 3300035725 | Ga0373947_0201078 | Ga0373947_0201078_469_1287 | 272 |
| 15 | 3300046476 | Ga0495662_0079271 | Ga0495662_0079271_748_1566 | 272 |
| 16 | 3300046533 | Ga0495640_0121865 | Ga0495640_0121865_28_846 | 272 |
| 17 | 3300046664 | Ga0495659_0032781 | Ga0495659_0032781_21_839 | 272 |
| 18 | 3300046680 | Ga0495646_0017298 | Ga0495646_0017298_28_846 | 272 |
| 19 | 3300047319 | Ga0495674_0077789 | Ga0495674_0077789_28_846 | 272 |
| 20 | 3300049580 | Ga0501046_0165265 | Ga0501046_0165265_206_1087 | 280 |
| 21 | 3300035120 | Ga0373957_0173682 | Ga0373957_0173682_12_863 | 283 |
| 22 | 3300035090 | Ga0373949_0012300 | Ga0373949_0012300_1021_1875 | 284 |
| 23 | 3300035091 | Ga0373951_0038011 | Ga0373951_0038011_30_884 | 284 |
| 24 | 3300049588 | Ga0501072_0167232 | Ga0501072_0167232_807_1742 | 284 |
| 25 | 3300005328 | Ga0070676_10000884 | Ga0070676_100008842 | 293 |
| 26 | 3300005341 | Ga0070691_10002316 | Ga0070691_100023168 | 294 |
| 27 | 3300005343 | Ga0070687_100015548 | Ga0070687_1000155483 | 294 |
| 28 | 3300005354 | Ga0070675_100112371 | Ga0070675_1001123711 | 294 |
| 29 | 3300005406 | Ga0070703_10001238 | Ga0070703_100012384 | 294 |
| 30 | 3300005438 | Ga0070701_10030989 | Ga0070701_100309893 | 294 |
| 31 | 3300005440 | Ga0070705_100000402 | Ga0070705_10000040221 | 294 |
| 32 | 3300005441 | Ga0070700_100000724 | Ga0070700_1000007243 | 294 |
| 33 | 3300005444 | Ga0070694_100000600 | Ga0070694_10000060010 | 294 |
| 34 | 3300005445 | Ga0070708_100054489 | Ga0070708_1000544891 | 294 |
| 35 | 3300005455 | Ga0070663_100016167 | Ga0070663_1000161673 | 294 |
| 36 | 3300005458 | Ga0070681_10126410 | Ga0070681_101264103 | 294 |
| 37 | 3300005471 | Ga0070698_100090055 | Ga0070698_1000900552 | 294 |
| 38 | 3300005518 | Ga0070699_100000330 | Ga0070699_10000033024 | 294 |
| 39 | 3300005536 | Ga0070697_100207413 | Ga0070697_1002074132 | 294 |
| 40 | 3300005545 | Ga0070695_100000637 | Ga0070695_10000063710 | 294 |
| 41 | 3300005546 | Ga0070696_100000069 | Ga0070696_10000006927 | 294 |
| 42 | 3300005547 | Ga0070693_100256545 | Ga0070693_1002565451 | 294 |
| 43 | 3300005549 | Ga0070704_100000749 | Ga0070704_1000007494 | 294 |
| 44 | 3300005577 | Ga0068857_100019113 | Ga0068857_1000191132 | 294 |
| 45 | 3300005617 | Ga0068859_100005304 | Ga0068859_1000053048 | 294 |
| 46 | 3300005618 | Ga0068864_100043738 | Ga0068864_1000437382 | 294 |
| 47 | 3300005843 | Ga0068860_100008977 | Ga0068860_1000089774 | 294 |
| 48 | 3300005844 | Ga0068862_100006312 | Ga0068862_1000063129 | 294 |
| 49 | 3300005985 | Ga0081539_10077702 | Ga0081539_100777022 | 294 |
| 50 | 3300006038 | Ga0075365_10196964 | Ga0075365_101969642 | 294 |
| 51 | 3300006051 | Ga0075364_10011348 | Ga0075364_100113483 | 294 |
| 52 | 3300006195 | Ga0075366_10004013 | Ga0075366_100040135 | 294 |
| 53 | 3300006931 | Ga0097620_100005304 | Ga0097620_1000053048 | 294 |
| 54 | 3300009148 | Ga0105243_10038149 | Ga0105243_100381493 | 294 |
| 55 | 3300009553 | Ga0105249_10012262 | Ga0105249_100122623 | 294 |
| 56 | 3300021377 | Ga0213874_10006500 | Ga0213874_100065002 | 294 |
| 57 | 3300025885 | Ga0207653_10000848 | Ga0207653_100008482 | 294 |
| 58 | 3300025912 | Ga0207707_10103617 | Ga0207707_101036171 | 294 |
| 59 | 3300025917 | Ga0207660_10085564 | Ga0207660_100855642 | 294 |
| 60 | 3300025918 | Ga0207662_10033219 | Ga0207662_100332192 | 294 |
| 61 | 3300025938 | Ga0207704_10103140 | Ga0207704_101031402 | 294 |
| 62 | 3300025961 | Ga0207712_10003253 | Ga0207712_100032533 | 294 |
| 63 | 3300026067 | Ga0207678_10012666 | Ga0207678_100126663 | 294 |
| 64 | 3300026075 | Ga0207708_10001458 | Ga0207708_1000145815 | 294 |
| 65 | 3300026116 | Ga0207674_10008573 | Ga0207674_100085732 | 294 |
| 66 | 3300026118 | Ga0207675_100301744 | Ga0207675_1003017441 | 294 |
| 67 | 3300028381 | Ga0268264_10003627 | Ga0268264_100036274 | 294 |
| 68 | 3300031456 | Ga0307513_10185900 | Ga0307513_101859002 | 294 |
| 69 | 3300039450 | Ga0436363_1294531 | Ga0436363_1294531_1438_2367 | 294 |
| 70 | 3300046460 | Ga0495638_0025735 | Ga0495638_0025735_1894_2832 | 294 |
| 71 | 3300048905 | Ga0496102_0002596 | Ga0496102_0002596_10742_11662 | 294 |
| 72 | 3300048907 | Ga0496104_0001393 | Ga0496104_0001393_15404_16375 | 294 |
| 73 | 3300048907 | Ga0496104_0196139 | Ga0496104_0196139_719_1639 | 294 |
| 74 | 3300048909 | Ga0496106_0006418 | Ga0496106_0006418_4385_5305 | 294 |
| 75 | 3300048911 | Ga0496108_0193092 | Ga0496108_0193092_551_1471 | 294 |
| 76 | 3300049593 | Ga0501077_0116468 | Ga0501077_0116468_169_1089 | 294 |
| 77 | 3300049741 | Ga0501079_0242161 | Ga0501079_0242161_355_1275 | 294 |
| 78 | 3300049744 | Ga0501083_0252565 | Ga0501083_0252565_187_1125 | 294 |
| 79 | 3300049824 | Ga0501045_0076811 | Ga0501045_0076811_544_1464 | 294 |
| 80 | 3300050491 | nmdc:mga00v17_13334_c1 | nmdc:mga00v17_13334_c1_3340_4329 | 294 |
| 81 | 3300050493 | nmdc:mga0k408_7417_c1 | nmdc:mga0k408_7417_c1_4180_5169 | 294 |
| 82 | 3300053099 | Ga0500654_058472 | Ga0500654_058472_272_1210 | 294 |
| 83 | 3300053130 | Ga0500642_0132199 | Ga0500642_0132199_221_1159 | 294 |
| 84 | 3300053139 | Ga0500568_0087172 | Ga0500568_0087172_144_1082 | 294 |
| 85 | 3300053727 | Ga0500611_025528 | Ga0500611_025528_209_1147 | 294 |
| 86 | 3300061734 | Ga0530510_0014732 | Ga0530510_0014732_4252_5172 | 294 |
| 87 | 3300002739 | JGI25158J39367_1004330 | JGI25158J39367_10043303 | 295 |
| 88 | 3300002987 | JGI25159J45721_1000675 | JGI25159J45721_10006754 | 295 |
| 89 | 3300003187 | JGI25151J46595_10018941 | JGI25151J46595_100189412 | 295 |
| 90 | 3300003354 | JGI25160J50197_1000962 | JGI25160J50197_100096214 | 295 |
| 91 | 3300003758 | Ga0055532_1000231 | Ga0055532_100023111 | 295 |
| 92 | 3300003760 | Ga0055527_1000188 | Ga0055527_100018811 | 295 |
| 93 | 3300003761 | Ga0055535_1000592 | Ga0055535_100059221 | 295 |
| 94 | 3300003762 | Ga0055542_1001825 | Ga0055542_10018256 | 295 |
| 95 | 3300003771 | Ga0055526_1014272 | Ga0055526_10142722 | 295 |
| 96 | 3300004625 | Ga0055543_1003620 | Ga0055543_10036201 | 295 |
| 97 | 3300005262 | Ga0065165_1002550 | Ga0065165_10025504 | 295 |
| 98 | 3300005293 | Ga0065715_10212808 | Ga0065715_102128081 | 295 |
| 99 | 3300005331 | Ga0070670_100069045 | Ga0070670_1000690453 | 295 |
| 100 | 3300005333 | Ga0070677_10020355 | Ga0070677_100203552 | 295 |
| 101 | 3300005334 | Ga0068869_100077044 | Ga0068869_1000770442 | 295 |
| 102 | 3300005340 | Ga0070689_100169480 | Ga0070689_1001694801 | 295 |
| 103 | 3300005343 | Ga0070687_100226203 | Ga0070687_1002262031 | 295 |
| 104 | 3300005356 | Ga0070674_100133795 | Ga0070674_1001337952 | 295 |
| 105 | 3300005364 | Ga0070673_100183299 | Ga0070673_1001832992 | 295 |
| 106 | 3300005365 | Ga0070688_100093367 | Ga0070688_1000933672 | 295 |
| 107 | 3300005367 | Ga0070667_100393820 | Ga0070667_1003938202 | 295 |
| 108 | 3300005459 | Ga0068867_100051652 | Ga0068867_1000516522 | 295 |
| 109 | 3300005530 | Ga0070679_100229052 | Ga0070679_1002290522 | 295 |
| 110 | 3300005564 | Ga0070664_100536712 | Ga0070664_1005367122 | 295 |
| 111 | 3300005577 | Ga0068857_100060288 | Ga0068857_1000602883 | 295 |
| 112 | 3300005617 | Ga0068859_100060783 | Ga0068859_1000607833 | 295 |
| 113 | 3300005618 | Ga0068864_100080402 | Ga0068864_1000804023 | 295 |
| 114 | 3300005718 | Ga0068866_10158439 | Ga0068866_101584391 | 295 |
| 115 | 3300006175 | Ga0070712_100001671 | Ga0070712_1000016715 | 295 |
| 116 | 3300006358 | Ga0068871_100207262 | Ga0068871_1002072621 | 295 |
| 117 | 3300006358 | Ga0068871_100559324 | Ga0068871_1005593241 | 295 |
| 118 | 3300006852 | Ga0075433_10097799 | Ga0075433_100977993 | 295 |
| 119 | 3300006871 | Ga0075434_100186328 | Ga0075434_1001863282 | 295 |
| 120 | 3300006931 | Ga0097620_100060780 | Ga0097620_1000607803 | 295 |
| 121 | 3300025208 | Ga0209436_100633 | Ga0209436_10063314 | 295 |
| 122 | 3300025228 | Ga0209672_100020 | Ga0209672_100020235 | 295 |
| 123 | 3300025229 | Ga0209147_100024 | Ga0209147_100024235 | 295 |
| 124 | 3300025242 | Ga0209258_100121 | Ga0209258_100121157 | 295 |
| 125 | 3300025254 | Ga0209148_1000458 | Ga0209148_10004588 | 295 |
| 126 | 3300025272 | Ga0209455_1000263 | Ga0209455_100026355 | 295 |
| 127 | 3300025284 | Ga0209130_1001496 | Ga0209130_10014963 | 295 |
| 128 | 3300025292 | Ga0209676_1001975 | Ga0209676_100197516 | 295 |
| 129 | 3300025294 | Ga0209025_1000301 | Ga0209025_100030162 | 295 |
| 130 | 3300025295 | Ga0209564_1000494 | Ga0209564_100049459 | 295 |
| 131 | 3300025295 | Ga0209564_1002177 | Ga0209564_100217716 | 295 |
| 132 | 3300025298 | Ga0209050_1004792 | Ga0209050_10047923 | 295 |
| 133 | 3300025302 | Ga0207426_1001904 | Ga0207426_10019043 | 295 |
| 134 | 3300025303 | Ga0209051_1016506 | Ga0209051_10165063 | 295 |
| 135 | 3300025304 | Ga0209257_1005496 | Ga0209257_10054962 | 295 |
| 136 | 3300025893 | Ga0207682_10002089 | Ga0207682_100020898 | 295 |
| 137 | 3300025901 | Ga0207688_10014043 | Ga0207688_100140432 | 295 |
| 138 | 3300025907 | Ga0207645_10095830 | Ga0207645_100958302 | 295 |
| 139 | 3300025915 | Ga0207693_10001675 | Ga0207693_1000167512 | 295 |
| 140 | 3300025917 | Ga0207660_10219395 | Ga0207660_102193952 | 295 |
| 141 | 3300025918 | Ga0207662_10081076 | Ga0207662_100810762 | 295 |
| 142 | 3300025921 | Ga0207652_10191465 | Ga0207652_101914652 | 295 |
| 143 | 3300025923 | Ga0207681_10095713 | Ga0207681_100957132 | 295 |
| 144 | 3300025926 | Ga0207659_10138252 | Ga0207659_101382522 | 295 |
| 145 | 3300025927 | Ga0207687_10240762 | Ga0207687_102407622 | 295 |
| 146 | 3300025937 | Ga0207669_10181459 | Ga0207669_101814591 | 295 |
| 147 | 3300025940 | Ga0207691_10036320 | Ga0207691_100363203 | 295 |
| 148 | 3300025941 | Ga0207711_10194867 | Ga0207711_101948672 | 295 |
| 149 | 3300025942 | Ga0207689_10026402 | Ga0207689_100264024 | 295 |
| 150 | 3300025986 | Ga0207658_10491320 | Ga0207658_104913201 | 295 |
| 151 | 3300026095 | Ga0207676_10056234 | Ga0207676_100562342 | 295 |
| 152 | 3300026116 | Ga0207674_10174146 | Ga0207674_101741462 | 295 |
| 153 | 3300026121 | Ga0207683_10008669 | Ga0207683_100086692 | 295 |
| 154 | 3300028380 | Ga0268265_10206229 | Ga0268265_102062291 | 295 |
| 155 | 3300028381 | Ga0268264_10096728 | Ga0268264_100967282 | 295 |
| 156 | 3300028381 | Ga0268264_10409918 | Ga0268264_104099181 | 295 |
| 157 | 3300031711 | Ga0265314_10011237 | Ga0265314_100112376 | 295 |
| 158 | 3300039437 | Ga0436365_0861956 | Ga0436365_0861956_1106_2038 | 295 |
| 159 | 3300046474 | Ga0495605_0129073 | Ga0495605_0129073_129_1061 | 295 |
| 160 | 3300046476 | Ga0495662_0009265 | Ga0495662_0009265_2926_3939 | 295 |
| 161 | 3300046491 | Ga0495584_0058837 | Ga0495584_0058837_974_1906 | 295 |
| 162 | 3300046517 | Ga0495630_0190911 | Ga0495630_0190911_268_1200 | 295 |
| 163 | 3300046537 | Ga0495598_0046597 | Ga0495598_0046597_163_1095 | 295 |
| 164 | 3300046683 | Ga0495658_0135233 | Ga0495658_0135233_184_1116 | 295 |
| 165 | 3300048907 | Ga0496104_0053582 | Ga0496104_0053582_1917_2849 | 295 |
| 166 | 3300048907 | Ga0496104_0233050 | Ga0496104_0233050_780_1712 | 295 |
| 167 | 3300048908 | Ga0496105_0057934 | Ga0496105_0057934_2108_3040 | 295 |
| 168 | 3300048909 | Ga0496106_0106989 | Ga0496106_0106989_1012_1944 | 295 |
| 169 | 3300048909 | Ga0496106_0296987 | Ga0496106_0296987_123_1055 | 295 |
| 170 | 3300048914 | Ga0496111_0158501 | Ga0496111_0158501_13_945 | 295 |
| 171 | 3300048917 | Ga0496114_0166607 | Ga0496114_0166607_528_1460 | 295 |
| 172 | 3300048918 | Ga0496115_0115007 | Ga0496115_0115007_789_1721 | 295 |
| 173 | 3300048918 | Ga0496115_0119922 | Ga0496115_0119922_27_965 | 295 |
| 174 | 3300048925 | Ga0496122_0048492 | Ga0496122_0048492_1529_2419 | 295 |
| 175 | 3300048928 | Ga0496125_0137958 | Ga0496125_0137958_543_1481 | 295 |
| 176 | 3300049570 | Ga0501033_0042229 | Ga0501033_0042229_757_1683 | 295 |
| 177 | 3300049570 | Ga0501033_0050428 | Ga0501033_0050428_1377_2300 | 295 |
| 178 | 3300049571 | Ga0501034_0142240 | Ga0501034_0142240_21_947 | 295 |
| 179 | 3300049573 | Ga0501037_0131572 | Ga0501037_0131572_757_1683 | 295 |
| 180 | 3300049575 | Ga0501039_0066960 | Ga0501039_0066960_335_1261 | 295 |
| 181 | 3300049575 | Ga0501039_0338611 | Ga0501039_0338611_190_1131 | 295 |
| 182 | 3300049576 | Ga0501040_0224358 | Ga0501040_0224358_285_1226 | 295 |
| 183 | 3300049579 | Ga0501043_0372910 | Ga0501043_0372910_118_1044 | 295 |
| 184 | 3300049580 | Ga0501046_0255618 | Ga0501046_0255618_261_1202 | 295 |
| 185 | 3300049581 | Ga0501047_0108462 | Ga0501047_0108462_1741_2631 | 295 |
| 186 | 3300049581 | Ga0501047_0324647 | Ga0501047_0324647_135_1061 | 295 |
| 187 | 3300049587 | Ga0501071_0266777 | Ga0501071_0266777_232_1122 | 295 |
| 188 | 3300049588 | Ga0501072_0000783 | Ga0501072_0000783_1273_2205 | 295 |
| 189 | 3300049588 | Ga0501072_0159006 | Ga0501072_0159006_347_1288 | 295 |
| 190 | 3300049591 | Ga0501075_0104823 | Ga0501075_0104823_545_1486 | 295 |
| 191 | 3300049592 | Ga0501076_0048362 | Ga0501076_0048362_1828_2769 | 295 |
| 192 | 3300049593 | Ga0501077_0038213 | Ga0501077_0038213_1983_2924 | 295 |
| 193 | 3300049741 | Ga0501079_0045576 | Ga0501079_0045576_278_1219 | 295 |
| 194 | 3300049743 | Ga0501081_0200957 | Ga0501081_0200957_131_1072 | 295 |
| 195 | 3300049823 | Ga0501044_0005747 | Ga0501044_0005747_10467_11390 | 295 |
| 196 | 3300049823 | Ga0501044_0051391 | Ga0501044_0051391_3049_3939 | 295 |
| 197 | 3300050509 | nmdc:mga0qj67_4_c1 | nmdc:mga0qj67_4_c1_43905_44837 | 295 |
| 198 | 3300050512 | nmdc:mga0n895_13630_c1 | nmdc:mga0n895_13630_c1_3948_4880 | 295 |
| 199 | 3300053078 | Ga0495612_0056043 | Ga0495612_0056043_178_1110 | 295 |
| 200 | 3300053084 | Ga0495595_0058421 | Ga0495595_0058421_257_1189 | 295 |
| 201 | 3300053085 | Ga0495619_0053980 | Ga0495619_0053980_407_1339 | 295 |
| 202 | 3300053087 | Ga0500643_019710 | Ga0500643_019710_976_1863 | 295 |
| 203 | 3300053088 | Ga0500644_0000887 | Ga0500644_0000887_6381_7268 | 295 |
| 204 | 3300053093 | Ga0500651_0029388 | Ga0500651_0029388_788_1675 | 295 |
| 205 | 3300053094 | Ga0500566_0017411 | Ga0500566_0017411_2157_3044 | 295 |
| 206 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_250388_251275 | 295 |
| 207 | 3300053131 | Ga0500652_014053 | Ga0500652_014053_1806_2693 | 295 |
| 208 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1441833_1442726 | 295 |
| 209 | 3300053161 | Ga0500634_0054968 | Ga0500634_0054968_861_1790 | 295 |
| 210 | 3300053730 | Ga0500645_003223 | Ga0500645_003223_2064_2951 | 295 |
| 211 | 3300054114 | Ga0501084_0043091 | Ga0501084_0043091_2327_3268 | 295 |
| 212 | 3300054114 | Ga0501084_0219723 | Ga0501084_0219723_302_1234 | 295 |
| 213 | 3300060353 | Ga0501082_0175858 | Ga0501082_0175858_190_1131 | 295 |
| 214 | iso_pu_bacteria | 2643221723 | 2644675270 | 295 |
| 215 | 2162886007 | SwRhRL2b_contig_1075987 | SwRhRL2b_0432.00001010 | 296 |
| 216 | 2209111006 | 2214800751 | 2213830001 | 296 |
| 217 | 2209111006 | 2214809099 | 2213841245 | 296 |
| 218 | 3300000041 | ARcpr5oldR_c000150 | ARcpr5oldR_0001503 | 296 |
| 219 | 3300000042 | ARSoilYngRDRAFT_c00266 | ARSoilYngRDRAFT_002665 | 296 |
| 220 | 3300000043 | ARcpr5yngRDRAFT_c000123 | ARcpr5yngRDRAFT_0001233 | 296 |
| 221 | 3300000044 | ARSoilOldRDRAFT_c000007 | ARSoilOldRDRAFT_00000751 | 296 |
| 222 | 3300000045 | ARCol0oldRDRAFT_c00020 | ARCol0oldRDRAFT_000203 | 296 |
| 223 | 3300000652 | ARCol0yngRDRAFT_1000009 | ARCol0yngRDRAFT_10000096 | 296 |
| 224 | 3300001915 | JGI24741J21665_1012297 | JGI24741J21665_10122972 | 296 |
| 225 | 3300001977 | JGI24746J21847_1006319 | JGI24746J21847_10063192 | 296 |
| 226 | 3300001989 | JGI24739J22299_10003727 | JGI24739J22299_100037272 | 296 |
| 227 | 3300001990 | JGI24737J22298_10028599 | JGI24737J22298_100285992 | 296 |
| 228 | 3300001990 | JGI24737J22298_10055890 | JGI24737J22298_100558901 | 296 |
| 229 | 3300001991 | JGI24743J22301_10005560 | JGI24743J22301_100055601 | 296 |
| 230 | 3300002070 | JGI24750J21931_1000613 | JGI24750J21931_10006135 | 296 |
| 231 | 3300002075 | JGI24738J21930_10003331 | JGI24738J21930_100033312 | 296 |
| 232 | 3300002076 | JGI24749J21850_1015264 | JGI24749J21850_10152641 | 296 |
| 233 | 3300002077 | JGI24744J21845_10001820 | JGI24744J21845_100018201 | 296 |
| 234 | 3300002077 | JGI24744J21845_10001986 | JGI24744J21845_100019862 | 296 |
| 235 | 3300002126 | JGI24035J26624_1000072 | JGI24035J26624_10000723 | 296 |
| 236 | 3300002155 | JGI24033J26618_1004187 | JGI24033J26618_10041872 | 296 |
| 237 | 3300002155 | JGI24033J26618_1005390 | JGI24033J26618_10053901 | 296 |
| 238 | 3300002239 | JGI24034J26672_10000632 | JGI24034J26672_100006322 | 296 |
| 239 | 3300002244 | JGI24742J22300_10002483 | JGI24742J22300_100024832 | 296 |
| 240 | 3300002459 | JGI24751J29686_10010480 | JGI24751J29686_100104802 | 296 |
| 241 | 3300003203 | JGI25406J46586_10009709 | JGI25406J46586_100097093 | 296 |
| 242 | 3300003659 | JGI25404J52841_10012261 | JGI25404J52841_100122612 | 296 |
| 243 | 3300005277 | Ga0065716_1001883 | Ga0065716_10018834 | 296 |
| 244 | 3300005289 | Ga0065704_10080735 | Ga0065704_100807353 | 296 |
| 245 | 3300005290 | Ga0065712_10070846 | Ga0065712_100708463 | 296 |
| 246 | 3300005293 | Ga0065715_10257302 | Ga0065715_102573022 | 296 |
| 247 | 3300005293 | Ga0065715_10303590 | Ga0065715_103035901 | 296 |
| 248 | 3300005327 | Ga0070658_10027080 | Ga0070658_100270802 | 296 |
| 249 | 3300005327 | Ga0070658_10155840 | Ga0070658_101558402 | 296 |
| 250 | 3300005327 | Ga0070658_10400048 | Ga0070658_104000481 | 296 |
| 251 | 3300005328 | Ga0070676_10008244 | Ga0070676_100082442 | 296 |
| 252 | 3300005329 | Ga0070683_100201988 | Ga0070683_1002019882 | 296 |
| 253 | 3300005330 | Ga0070690_100014364 | Ga0070690_1000143642 | 296 |
| 254 | 3300005330 | Ga0070690_100034837 | Ga0070690_1000348372 | 296 |
| 255 | 3300005330 | Ga0070690_100312567 | Ga0070690_1003125672 | 296 |
| 256 | 3300005331 | Ga0070670_100006862 | Ga0070670_1000068622 | 296 |
| 257 | 3300005331 | Ga0070670_100066773 | Ga0070670_1000667731 | 296 |
| 258 | 3300005331 | Ga0070670_100094337 | Ga0070670_1000943373 | 296 |
| 259 | 3300005333 | Ga0070677_10000988 | Ga0070677_1000098812 | 296 |
| 260 | 3300005334 | Ga0068869_100032403 | Ga0068869_1000324034 | 296 |
| 261 | 3300005335 | Ga0070666_10085701 | Ga0070666_100857012 | 296 |
| 262 | 3300005335 | Ga0070666_10123437 | Ga0070666_101234371 | 296 |
| 263 | 3300005335 | Ga0070666_10173559 | Ga0070666_101735591 | 296 |
| 264 | 3300005336 | Ga0070680_100016581 | Ga0070680_1000165812 | 296 |
| 265 | 3300005336 | Ga0070680_100419011 | Ga0070680_1004190112 | 296 |
| 266 | 3300005337 | Ga0070682_100068289 | Ga0070682_1000682892 | 296 |
| 267 | 3300005338 | Ga0068868_100011533 | Ga0068868_1000115335 | 296 |
| 268 | 3300005338 | Ga0068868_100032503 | Ga0068868_1000325035 | 296 |
| 269 | 3300005339 | Ga0070660_100006262 | Ga0070660_1000062628 | 296 |
| 270 | 3300005340 | Ga0070689_100033029 | Ga0070689_1000330292 | 296 |
| 271 | 3300005340 | Ga0070689_100046647 | Ga0070689_1000466471 | 296 |
| 272 | 3300005340 | Ga0070689_100159190 | Ga0070689_1001591902 | 296 |
| 273 | 3300005341 | Ga0070691_10001048 | Ga0070691_100010482 | 296 |
| 274 | 3300005341 | Ga0070691_10016847 | Ga0070691_100168474 | 296 |
| 275 | 3300005343 | Ga0070687_100006103 | Ga0070687_1000061031 | 296 |
| 276 | 3300005344 | Ga0070661_100031155 | Ga0070661_1000311552 | 296 |
| 277 | 3300005344 | Ga0070661_100071832 | Ga0070661_1000718322 | 296 |
| 278 | 3300005345 | Ga0070692_10001006 | Ga0070692_1000100612 | 296 |
| 279 | 3300005345 | Ga0070692_10017275 | Ga0070692_100172755 | 296 |
| 280 | 3300005347 | Ga0070668_100071279 | Ga0070668_1000712792 | 296 |
| 281 | 3300005354 | Ga0070675_100002103 | Ga0070675_1000021037 | 296 |
| 282 | 3300005354 | Ga0070675_100081609 | Ga0070675_1000816093 | 296 |
| 283 | 3300005355 | Ga0070671_100015813 | Ga0070671_1000158135 | 296 |
| 284 | 3300005355 | Ga0070671_100021922 | Ga0070671_1000219221 | 296 |
| 285 | 3300005355 | Ga0070671_100083504 | Ga0070671_1000835042 | 296 |
| 286 | 3300005356 | Ga0070674_100017597 | Ga0070674_1000175972 | 296 |
| 287 | 3300005356 | Ga0070674_100032398 | Ga0070674_1000323984 | 296 |
| 288 | 3300005364 | Ga0070673_100000950 | Ga0070673_10000095017 | 296 |
| 289 | 3300005364 | Ga0070673_100003515 | Ga0070673_1000035153 | 296 |
| 290 | 3300005364 | Ga0070673_100006321 | Ga0070673_1000063212 | 296 |
| 291 | 3300005364 | Ga0070673_100104219 | Ga0070673_1001042192 | 296 |
| 292 | 3300005365 | Ga0070688_100214816 | Ga0070688_1002148161 | 296 |
| 293 | 3300005365 | Ga0070688_100324500 | Ga0070688_1003245001 | 296 |
| 294 | 3300005366 | Ga0070659_100215754 | Ga0070659_1002157541 | 296 |
| 295 | 3300005367 | Ga0070667_100008645 | Ga0070667_1000086457 | 296 |
| 296 | 3300005367 | Ga0070667_100115440 | Ga0070667_1001154404 | 296 |
| 297 | 3300005367 | Ga0070667_100243221 | Ga0070667_1002432212 | 296 |
| 298 | 3300005367 | Ga0070667_100260753 | Ga0070667_1002607532 | 296 |
| 299 | 3300005434 | Ga0070709_10002890 | Ga0070709_100028905 | 296 |
| 300 | 3300005434 | Ga0070709_10086506 | Ga0070709_100865062 | 296 |
| 301 | 3300005435 | Ga0070714_100018377 | Ga0070714_1000183777 | 296 |
| 302 | 3300005435 | Ga0070714_100062021 | Ga0070714_1000620212 | 296 |
| 303 | 3300005435 | Ga0070714_100088698 | Ga0070714_1000886982 | 296 |
| 304 | 3300005436 | Ga0070713_100032262 | Ga0070713_1000322622 | 296 |
| 305 | 3300005437 | Ga0070710_10009574 | Ga0070710_100095744 | 296 |
| 306 | 3300005437 | Ga0070710_10121239 | Ga0070710_101212392 | 296 |
| 307 | 3300005438 | Ga0070701_10108188 | Ga0070701_101081882 | 296 |
| 308 | 3300005439 | Ga0070711_100009225 | Ga0070711_1000092255 | 296 |
| 309 | 3300005439 | Ga0070711_100018778 | Ga0070711_1000187783 | 296 |
| 310 | 3300005439 | Ga0070711_100143911 | Ga0070711_1001439111 | 296 |
| 311 | 3300005439 | Ga0070711_100337761 | Ga0070711_1003377612 | 296 |
| 312 | 3300005440 | Ga0070705_100020818 | Ga0070705_1000208185 | 296 |
| 313 | 3300005440 | Ga0070705_100045906 | Ga0070705_1000459062 | 296 |
| 314 | 3300005440 | Ga0070705_100140908 | Ga0070705_1001409082 | 296 |
| 315 | 3300005444 | Ga0070694_100027477 | Ga0070694_1000274774 | 296 |
| 316 | 3300005445 | Ga0070708_100035647 | Ga0070708_1000356476 | 296 |
| 317 | 3300005455 | Ga0070663_100159348 | Ga0070663_1001593482 | 296 |
| 318 | 3300005456 | Ga0070678_100008877 | Ga0070678_1000088777 | 296 |
| 319 | 3300005456 | Ga0070678_100019314 | Ga0070678_1000193142 | 296 |
| 320 | 3300005456 | Ga0070678_100033275 | Ga0070678_1000332753 | 296 |
| 321 | 3300005457 | Ga0070662_100102604 | Ga0070662_1001026042 | 296 |
| 322 | 3300005457 | Ga0070662_100225936 | Ga0070662_1002259362 | 296 |
| 323 | 3300005458 | Ga0070681_10005925 | Ga0070681_1000592512 | 296 |
| 324 | 3300005458 | Ga0070681_10498387 | Ga0070681_104983871 | 296 |
| 325 | 3300005459 | Ga0068867_100001504 | Ga0068867_1000015049 | 296 |
| 326 | 3300005459 | Ga0068867_100011516 | Ga0068867_1000115162 | 296 |
| 327 | 3300005466 | Ga0070685_10004829 | Ga0070685_100048297 | 296 |
| 328 | 3300005466 | Ga0070685_10053569 | Ga0070685_100535692 | 296 |
| 329 | 3300005466 | Ga0070685_10084626 | Ga0070685_100846262 | 296 |
| 330 | 3300005467 | Ga0070706_100357177 | Ga0070706_1003571772 | 296 |
| 331 | 3300005468 | Ga0070707_100375620 | Ga0070707_1003756202 | 296 |
| 332 | 3300005471 | Ga0070698_100072731 | Ga0070698_1000727312 | 296 |
| 333 | 3300005518 | Ga0070699_100008676 | Ga0070699_1000086767 | 296 |
| 334 | 3300005518 | Ga0070699_100128434 | Ga0070699_1001284342 | 296 |
| 335 | 3300005518 | Ga0070699_100227359 | Ga0070699_1002273592 | 296 |
| 336 | 3300005530 | Ga0070679_100009727 | Ga0070679_1000097279 | 296 |
| 337 | 3300005530 | Ga0070679_100138090 | Ga0070679_1001380902 | 296 |
| 338 | 3300005535 | Ga0070684_100003143 | Ga0070684_10000314312 | 296 |
| 339 | 3300005535 | Ga0070684_100467224 | Ga0070684_1004672242 | 296 |
| 340 | 3300005536 | Ga0070697_100145261 | Ga0070697_1001452612 | 296 |
| 341 | 3300005539 | Ga0068853_100006565 | Ga0068853_1000065652 | 296 |
| 342 | 3300005539 | Ga0068853_100032751 | Ga0068853_1000327512 | 296 |
| 343 | 3300005539 | Ga0068853_100319072 | Ga0068853_1003190721 | 296 |
| 344 | 3300005543 | Ga0070672_100005327 | Ga0070672_1000053272 | 296 |
| 345 | 3300005543 | Ga0070672_100252630 | Ga0070672_1002526302 | 296 |
| 346 | 3300005544 | Ga0070686_100021206 | Ga0070686_1000212063 | 296 |
| 347 | 3300005544 | Ga0070686_100041073 | Ga0070686_1000410734 | 296 |
| 348 | 3300005546 | Ga0070696_100050368 | Ga0070696_1000503682 | 296 |
| 349 | 3300005546 | Ga0070696_100241585 | Ga0070696_1002415852 | 296 |
| 350 | 3300005547 | Ga0070693_100002964 | Ga0070693_1000029643 | 296 |
| 351 | 3300005547 | Ga0070693_100019541 | Ga0070693_1000195414 | 296 |
| 352 | 3300005547 | Ga0070693_100090064 | Ga0070693_1000900642 | 296 |
| 353 | 3300005547 | Ga0070693_100121695 | Ga0070693_1001216952 | 296 |
| 354 | 3300005548 | Ga0070665_100031023 | Ga0070665_1000310237 | 296 |
| 355 | 3300005548 | Ga0070665_100316131 | Ga0070665_1003161312 | 296 |
| 356 | 3300005549 | Ga0070704_100214606 | Ga0070704_1002146062 | 296 |
| 357 | 3300005563 | Ga0068855_100019111 | Ga0068855_10001911111 | 296 |
| 358 | 3300005563 | Ga0068855_100073458 | Ga0068855_1000734582 | 296 |
| 359 | 3300005563 | Ga0068855_100124790 | Ga0068855_1001247902 | 296 |
| 360 | 3300005563 | Ga0068855_100327480 | Ga0068855_1003274802 | 296 |
| 361 | 3300005564 | Ga0070664_100153271 | Ga0070664_1001532712 | 296 |
| 362 | 3300005564 | Ga0070664_100160834 | Ga0070664_1001608342 | 296 |
| 363 | 3300005564 | Ga0070664_100368748 | Ga0070664_1003687482 | 296 |
| 364 | 3300005564 | Ga0070664_100507705 | Ga0070664_1005077052 | 296 |
| 365 | 3300005577 | Ga0068857_100000616 | Ga0068857_10000061612 | 296 |
| 366 | 3300005577 | Ga0068857_100079354 | Ga0068857_1000793542 | 296 |
| 367 | 3300005578 | Ga0068854_100060789 | Ga0068854_1000607893 | 296 |
| 368 | 3300005578 | Ga0068854_100170218 | Ga0068854_1001702182 | 296 |
| 369 | 3300005614 | Ga0068856_100059449 | Ga0068856_1000594492 | 296 |
| 370 | 3300005614 | Ga0068856_100106093 | Ga0068856_1001060934 | 296 |
| 371 | 3300005614 | Ga0068856_100178755 | Ga0068856_1001787552 | 296 |
| 372 | 3300005615 | Ga0070702_100011750 | Ga0070702_1000117505 | 296 |
| 373 | 3300005615 | Ga0070702_100019301 | Ga0070702_1000193012 | 296 |
| 374 | 3300005615 | Ga0070702_100080400 | Ga0070702_1000804002 | 296 |
| 375 | 3300005616 | Ga0068852_100002017 | Ga0068852_10000201715 | 296 |
| 376 | 3300005617 | Ga0068859_100004949 | Ga0068859_1000049497 | 296 |
| 377 | 3300005617 | Ga0068859_100018608 | Ga0068859_1000186082 | 296 |
| 378 | 3300005617 | Ga0068859_100064044 | Ga0068859_1000640445 | 296 |
| 379 | 3300005618 | Ga0068864_100003232 | Ga0068864_10000323216 | 296 |
| 380 | 3300005618 | Ga0068864_100004578 | Ga0068864_1000045788 | 296 |
| 381 | 3300005718 | Ga0068866_10002061 | Ga0068866_100020612 | 296 |
| 382 | 3300005718 | Ga0068866_10011605 | Ga0068866_100116055 | 296 |
| 383 | 3300005840 | Ga0068870_10000289 | Ga0068870_100002895 | 296 |
| 384 | 3300005840 | Ga0068870_10004900 | Ga0068870_100049006 | 296 |
| 385 | 3300005841 | Ga0068863_100001280 | Ga0068863_10000128018 | 296 |
| 386 | 3300005841 | Ga0068863_100025968 | Ga0068863_1000259685 | 296 |
| 387 | 3300005842 | Ga0068858_100057360 | Ga0068858_1000573605 | 296 |
| 388 | 3300005843 | Ga0068860_100008827 | Ga0068860_1000088273 | 296 |
| 389 | 3300005843 | Ga0068860_100036450 | Ga0068860_1000364502 | 296 |
| 390 | 3300005844 | Ga0068862_100005504 | Ga0068862_10000550413 | 296 |
| 391 | 3300005844 | Ga0068862_100351644 | Ga0068862_1003516441 | 296 |
| 392 | 3300005937 | Ga0081455_10000540 | Ga0081455_1000054043 | 296 |
| 393 | 3300005937 | Ga0081455_10001205 | Ga0081455_100012053 | 296 |
| 394 | 3300005937 | Ga0081455_10005299 | Ga0081455_100052992 | 296 |
| 395 | 3300005937 | Ga0081455_10022139 | Ga0081455_100221396 | 296 |
| 396 | 3300005937 | Ga0081455_10042728 | Ga0081455_100427282 | 296 |
| 397 | 3300005937 | Ga0081455_10119772 | Ga0081455_101197723 | 296 |
| 398 | 3300005981 | Ga0081538_10010807 | Ga0081538_100108077 | 296 |
| 399 | 3300005983 | Ga0081540_1000015 | Ga0081540_100001529 | 296 |
| 400 | 3300005983 | Ga0081540_1008029 | Ga0081540_10080294 | 296 |
| 401 | 3300005983 | Ga0081540_1054309 | Ga0081540_10543093 | 296 |
| 402 | 3300005985 | Ga0081539_10002225 | Ga0081539_1000222521 | 296 |
| 403 | 3300006028 | Ga0070717_10000817 | Ga0070717_1000081719 | 296 |
| 404 | 3300006028 | Ga0070717_10033136 | Ga0070717_100331362 | 296 |
| 405 | 3300006028 | Ga0070717_10138362 | Ga0070717_101383621 | 296 |
| 406 | 3300006028 | Ga0070717_10243185 | Ga0070717_102431851 | 296 |
| 407 | 3300006028 | Ga0070717_10517859 | Ga0070717_105178591 | 296 |
| 408 | 3300006058 | Ga0075432_10059642 | Ga0075432_100596422 | 296 |
| 409 | 3300006163 | Ga0070715_10002395 | Ga0070715_100023957 | 296 |
| 410 | 3300006163 | Ga0070715_10002890 | Ga0070715_100028904 | 296 |
| 411 | 3300006163 | Ga0070715_10156595 | Ga0070715_101565951 | 296 |
| 412 | 3300006173 | Ga0070716_100017968 | Ga0070716_1000179682 | 296 |
| 413 | 3300006173 | Ga0070716_100018008 | Ga0070716_1000180084 | 296 |
| 414 | 3300006175 | Ga0070712_100011668 | Ga0070712_1000116684 | 296 |
| 415 | 3300006175 | Ga0070712_100055726 | Ga0070712_1000557263 | 296 |
| 416 | 3300006175 | Ga0070712_100056602 | Ga0070712_1000566022 | 296 |
| 417 | 3300006175 | Ga0070712_100112826 | Ga0070712_1001128262 | 296 |
| 418 | 3300006175 | Ga0070712_100144699 | Ga0070712_1001446992 | 296 |
| 419 | 3300006178 | Ga0075367_10072194 | Ga0075367_100721942 | 296 |
| 420 | 3300006237 | Ga0097621_100001930 | Ga0097621_10000193014 | 296 |
| 421 | 3300006237 | Ga0097621_100005823 | Ga0097621_10000582310 | 296 |
| 422 | 3300006237 | Ga0097621_100120569 | Ga0097621_1001205692 | 296 |
| 423 | 3300006237 | Ga0097621_100177418 | Ga0097621_1001774181 | 296 |
| 424 | 3300006358 | Ga0068871_100001884 | Ga0068871_10000188416 | 296 |
| 425 | 3300006358 | Ga0068871_100003555 | Ga0068871_1000035553 | 296 |
| 426 | 3300006358 | Ga0068871_100010659 | Ga0068871_1000106592 | 296 |
| 427 | 3300006358 | Ga0068871_100091434 | Ga0068871_1000914343 | 296 |
| 428 | 3300006844 | Ga0075428_100097372 | Ga0075428_1000973723 | 296 |
| 429 | 3300006844 | Ga0075428_100229821 | Ga0075428_1002298212 | 296 |
| 430 | 3300006846 | Ga0075430_100053277 | Ga0075430_1000532772 | 296 |
| 431 | 3300006847 | Ga0075431_100026272 | Ga0075431_1000262724 | 296 |
| 432 | 3300006847 | Ga0075431_100291957 | Ga0075431_1002919572 | 296 |
| 433 | 3300006852 | Ga0075433_10005937 | Ga0075433_1000593712 | 296 |
| 434 | 3300006852 | Ga0075433_10009567 | Ga0075433_100095672 | 296 |
| 435 | 3300006852 | Ga0075433_10081387 | Ga0075433_100813872 | 296 |
| 436 | 3300006852 | Ga0075433_10312525 | Ga0075433_103125251 | 296 |
| 437 | 3300006871 | Ga0075434_100013765 | Ga0075434_1000137653 | 296 |
| 438 | 3300006871 | Ga0075434_100060452 | Ga0075434_1000604522 | 296 |
| 439 | 3300006871 | Ga0075434_100151373 | Ga0075434_1001513732 | 296 |
| 440 | 3300006871 | Ga0075434_100168466 | Ga0075434_1001684662 | 296 |
| 441 | 3300006871 | Ga0075434_100210513 | Ga0075434_1002105132 | 296 |
| 442 | 3300006871 | Ga0075434_100455617 | Ga0075434_1004556171 | 296 |
| 443 | 3300006871 | Ga0075434_100548251 | Ga0075434_1005482512 | 296 |
| 444 | 3300006880 | Ga0075429_100010683 | Ga0075429_1000106835 | 296 |
| 445 | 3300006881 | Ga0068865_100022254 | Ga0068865_1000222543 | 296 |
| 446 | 3300006914 | Ga0075436_100001808 | Ga0075436_1000018082 | 296 |
| 447 | 3300006931 | Ga0097620_100004949 | Ga0097620_1000049497 | 296 |
| 448 | 3300006931 | Ga0097620_100018608 | Ga0097620_1000186082 | 296 |
| 449 | 3300006931 | Ga0097620_100064046 | Ga0097620_1000640465 | 296 |
| 450 | 3300007076 | Ga0075435_100074793 | Ga0075435_1000747932 | 296 |
| 451 | 3300007076 | Ga0075435_100150262 | Ga0075435_1001502622 | 296 |
| 452 | 3300007076 | Ga0075435_100196637 | Ga0075435_1001966372 | 296 |
| 453 | 3300007076 | Ga0075435_100223910 | Ga0075435_1002239103 | 296 |
| 454 | 3300007076 | Ga0075435_100362484 | Ga0075435_1003624842 | 296 |
| 455 | 3300007788 | Ga0099795_10006632 | Ga0099795_100066322 | 296 |
| 456 | 3300007788 | Ga0099795_10011343 | Ga0099795_100113432 | 296 |
| 457 | 3300009092 | Ga0105250_10011298 | Ga0105250_100112983 | 296 |
| 458 | 3300009093 | Ga0105240_10077106 | Ga0105240_100771065 | 296 |
| 459 | 3300009093 | Ga0105240_10308309 | Ga0105240_103083092 | 296 |
| 460 | 3300009093 | Ga0105240_10387178 | Ga0105240_103871782 | 296 |
| 461 | 3300009094 | Ga0111539_10000345 | Ga0111539_1000034542 | 296 |
| 462 | 3300009094 | Ga0111539_10001931 | Ga0111539_1000193118 | 296 |
| 463 | 3300009094 | Ga0111539_10002122 | Ga0111539_1000212217 | 296 |
| 464 | 3300009094 | Ga0111539_10074518 | Ga0111539_100745186 | 296 |
| 465 | 3300009094 | Ga0111539_10135014 | Ga0111539_101350142 | 296 |
| 466 | 3300009094 | Ga0111539_10383441 | Ga0111539_103834411 | 296 |
| 467 | 3300009098 | Ga0105245_10002784 | Ga0105245_100027845 | 296 |
| 468 | 3300009098 | Ga0105245_10063738 | Ga0105245_100637385 | 296 |
| 469 | 3300009101 | Ga0105247_10003272 | Ga0105247_1000327213 | 296 |
| 470 | 3300009101 | Ga0105247_10011048 | Ga0105247_100110482 | 296 |
| 471 | 3300009147 | Ga0114129_10003572 | Ga0114129_100035725 | 296 |
| 472 | 3300009147 | Ga0114129_10007079 | Ga0114129_1000707915 | 296 |
| 473 | 3300009147 | Ga0114129_10010645 | Ga0114129_1001064514 | 296 |
| 474 | 3300009148 | Ga0105243_10015911 | Ga0105243_100159114 | 296 |
| 475 | 3300009148 | Ga0105243_10108219 | Ga0105243_101082192 | 296 |
| 476 | 3300009174 | Ga0105241_10000940 | Ga0105241_1000094012 | 296 |
| 477 | 3300009176 | Ga0105242_10002276 | Ga0105242_1000227611 | 296 |
| 478 | 3300009176 | Ga0105242_10007660 | Ga0105242_100076602 | 296 |
| 479 | 3300009176 | Ga0105242_10047519 | Ga0105242_100475192 | 296 |
| 480 | 3300009177 | Ga0105248_10067581 | Ga0105248_100675812 | 296 |
| 481 | 3300009177 | Ga0105248_10358663 | Ga0105248_103586632 | 296 |
| 482 | 3300009551 | Ga0105238_10032937 | Ga0105238_100329372 | 296 |
| 483 | 3300009551 | Ga0105238_10274521 | Ga0105238_102745212 | 296 |
| 484 | 3300009553 | Ga0105249_10182734 | Ga0105249_101827341 | 296 |
| 485 | 3300009553 | Ga0105249_10726736 | Ga0105249_107267361 | 296 |
| 486 | 3300010159 | Ga0099796_10034707 | Ga0099796_100347072 | 296 |
| 487 | 3300010375 | Ga0105239_10003461 | Ga0105239_1000346110 | 296 |
| 488 | 3300010375 | Ga0105239_10098595 | Ga0105239_100985953 | 296 |
| 489 | 3300010375 | Ga0105239_10206978 | Ga0105239_102069782 | 296 |
| 490 | 3300010375 | Ga0105239_10217083 | Ga0105239_102170832 | 296 |
| 491 | 3300011119 | Ga0105246_10012297 | Ga0105246_100122974 | 296 |
| 492 | 3300011119 | Ga0105246_10030167 | Ga0105246_100301672 | 296 |
| 493 | 3300012498 | Ga0157345_1004195 | Ga0157345_10041951 | 296 |
| 494 | 3300012505 | Ga0157339_1002441 | Ga0157339_10024411 | 296 |
| 495 | 3300012510 | Ga0157316_1002487 | Ga0157316_10024872 | 296 |
| 496 | 3300013100 | Ga0157373_10004480 | Ga0157373_100044807 | 296 |
| 497 | 3300013100 | Ga0157373_10179750 | Ga0157373_101797502 | 296 |
| 498 | 3300013102 | Ga0157371_10035439 | Ga0157371_100354392 | 296 |
| 499 | 3300013102 | Ga0157371_10159738 | Ga0157371_101597382 | 296 |
| 500 | 3300013105 | Ga0157369_10090869 | Ga0157369_100908692 | 296 |
| 501 | 3300013105 | Ga0157369_10349613 | Ga0157369_103496132 | 296 |
| 502 | 3300013296 | Ga0157374_10002727 | Ga0157374_100027275 | 296 |
| 503 | 3300013296 | Ga0157374_10008248 | Ga0157374_100082484 | 296 |
| 504 | 3300013297 | Ga0157378_10100825 | Ga0157378_101008253 | 296 |
| 505 | 3300013306 | Ga0163162_10045574 | Ga0163162_100455743 | 296 |
| 506 | 3300013306 | Ga0163162_10450821 | Ga0163162_104508212 | 296 |
| 507 | 3300013307 | Ga0157372_10040903 | Ga0157372_100409037 | 296 |
| 508 | 3300013307 | Ga0157372_10457375 | Ga0157372_104573752 | 296 |
| 509 | 3300013307 | Ga0157372_10563574 | Ga0157372_105635742 | 296 |
| 510 | 3300013308 | Ga0157375_10590914 | Ga0157375_105909141 | 296 |
| 511 | 3300014325 | Ga0163163_10042310 | Ga0163163_100423101 | 296 |
| 512 | 3300014325 | Ga0163163_10063147 | Ga0163163_100631473 | 296 |
| 513 | 3300014326 | Ga0157380_10542290 | Ga0157380_105422902 | 296 |
| 514 | 3300014968 | Ga0157379_10010629 | Ga0157379_100106292 | 296 |
| 515 | 3300014968 | Ga0157379_10032040 | Ga0157379_100320402 | 296 |
| 516 | 3300014968 | Ga0157379_10113642 | Ga0157379_101136422 | 296 |
| 517 | 3300014968 | Ga0157379_10249132 | Ga0157379_102491321 | 296 |
| 518 | 3300014968 | Ga0157379_10353174 | Ga0157379_103531741 | 296 |
| 519 | 3300014969 | Ga0157376_10002411 | Ga0157376_1000241112 | 296 |
| 520 | 3300014969 | Ga0157376_10063454 | Ga0157376_100634544 | 296 |
| 521 | 3300014969 | Ga0157376_10067933 | Ga0157376_100679334 | 296 |
| 522 | 3300014969 | Ga0157376_10211875 | Ga0157376_102118751 | 296 |
| 523 | 3300017792 | Ga0163161_10001476 | Ga0163161_1000147622 | 296 |
| 524 | 3300017792 | Ga0163161_10058906 | Ga0163161_100589065 | 296 |
| 525 | 3300017792 | Ga0163161_10090221 | Ga0163161_100902212 | 296 |
| 526 | 3300017792 | Ga0163161_10140284 | Ga0163161_101402842 | 296 |
| 527 | 3300021361 | Ga0213872_10021480 | Ga0213872_100214801 | 296 |
| 528 | 3300021384 | Ga0213876_10011677 | Ga0213876_100116772 | 296 |
| 529 | 3300021384 | Ga0213876_10126063 | Ga0213876_101260632 | 296 |
| 530 | 3300024225 | Ga0224572_1004661 | Ga0224572_10046612 | 296 |
| 531 | 3300024227 | Ga0228598_1002219 | Ga0228598_10022193 | 296 |
| 532 | 3300025290 | Ga0207673_1000001 | Ga0207673_100000115 | 296 |
| 533 | 3300025315 | Ga0207697_10013424 | Ga0207697_100134242 | 296 |
| 534 | 3300025321 | Ga0207656_10074393 | Ga0207656_100743932 | 296 |
| 535 | 3300025893 | Ga0207682_10000056 | Ga0207682_1000005611 | 296 |
| 536 | 3300025898 | Ga0207692_10001234 | Ga0207692_100012348 | 296 |
| 537 | 3300025898 | Ga0207692_10011799 | Ga0207692_100117995 | 296 |
| 538 | 3300025898 | Ga0207692_10013842 | Ga0207692_100138422 | 296 |
| 539 | 3300025900 | Ga0207710_10004332 | Ga0207710_100043325 | 296 |
| 540 | 3300025900 | Ga0207710_10008537 | Ga0207710_100085372 | 296 |
| 541 | 3300025900 | Ga0207710_10049812 | Ga0207710_100498122 | 296 |
| 542 | 3300025901 | Ga0207688_10001105 | Ga0207688_100011056 | 296 |
| 543 | 3300025901 | Ga0207688_10030510 | Ga0207688_100305102 | 296 |
| 544 | 3300025903 | Ga0207680_10030467 | Ga0207680_100304672 | 296 |
| 545 | 3300025903 | Ga0207680_10085902 | Ga0207680_100859021 | 296 |
| 546 | 3300025904 | Ga0207647_10014078 | Ga0207647_100140784 | 296 |
| 547 | 3300025904 | Ga0207647_10019467 | Ga0207647_100194674 | 296 |
| 548 | 3300025905 | Ga0207685_10014369 | Ga0207685_100143692 | 296 |
| 549 | 3300025906 | Ga0207699_10002060 | Ga0207699_100020605 | 296 |
| 550 | 3300025906 | Ga0207699_10269338 | Ga0207699_102693382 | 296 |
| 551 | 3300025907 | Ga0207645_10000249 | Ga0207645_1000024930 | 296 |
| 552 | 3300025907 | Ga0207645_10031831 | Ga0207645_100318312 | 296 |
| 553 | 3300025907 | Ga0207645_10046288 | Ga0207645_100462881 | 296 |
| 554 | 3300025908 | Ga0207643_10000187 | Ga0207643_100001875 | 296 |
| 555 | 3300025908 | Ga0207643_10000387 | Ga0207643_100003876 | 296 |
| 556 | 3300025909 | Ga0207705_10015260 | Ga0207705_100152605 | 296 |
| 557 | 3300025909 | Ga0207705_10369973 | Ga0207705_103699731 | 296 |
| 558 | 3300025910 | Ga0207684_10240569 | Ga0207684_102405691 | 296 |
| 559 | 3300025910 | Ga0207684_10451070 | Ga0207684_104510701 | 296 |
| 560 | 3300025911 | Ga0207654_10033440 | Ga0207654_100334402 | 296 |
| 561 | 3300025911 | Ga0207654_10322388 | Ga0207654_103223881 | 296 |
| 562 | 3300025915 | Ga0207693_10014672 | Ga0207693_100146721 | 296 |
| 563 | 3300025915 | Ga0207693_10018411 | Ga0207693_100184115 | 296 |
| 564 | 3300025915 | Ga0207693_10018746 | Ga0207693_100187465 | 296 |
| 565 | 3300025915 | Ga0207693_10084543 | Ga0207693_100845432 | 296 |
| 566 | 3300025915 | Ga0207693_10100120 | Ga0207693_101001202 | 296 |
| 567 | 3300025916 | Ga0207663_10037400 | Ga0207663_100374003 | 296 |
| 568 | 3300025916 | Ga0207663_10247647 | Ga0207663_102476472 | 296 |
| 569 | 3300025917 | Ga0207660_10000647 | Ga0207660_1000064715 | 296 |
| 570 | 3300025918 | Ga0207662_10010233 | Ga0207662_100102331 | 296 |
| 571 | 3300025918 | Ga0207662_10108064 | Ga0207662_101080642 | 296 |
| 572 | 3300025919 | Ga0207657_10132608 | Ga0207657_101326082 | 296 |
| 573 | 3300025920 | Ga0207649_10123225 | Ga0207649_101232253 | 296 |
| 574 | 3300025920 | Ga0207649_10298348 | Ga0207649_102983481 | 296 |
| 575 | 3300025921 | Ga0207652_10030686 | Ga0207652_100306862 | 296 |
| 576 | 3300025921 | Ga0207652_10088661 | Ga0207652_100886612 | 296 |
| 577 | 3300025921 | Ga0207652_10177499 | Ga0207652_101774992 | 296 |
| 578 | 3300025923 | Ga0207681_10064261 | Ga0207681_100642611 | 296 |
| 579 | 3300025924 | Ga0207694_10016005 | Ga0207694_100160057 | 296 |
| 580 | 3300025925 | Ga0207650_10002475 | Ga0207650_100024757 | 296 |
| 581 | 3300025926 | Ga0207659_10001692 | Ga0207659_100016926 | 296 |
| 582 | 3300025926 | Ga0207659_10130622 | Ga0207659_101306221 | 296 |
| 583 | 3300025927 | Ga0207687_10003004 | Ga0207687_1000300411 | 296 |
| 584 | 3300025927 | Ga0207687_10012483 | Ga0207687_100124836 | 296 |
| 585 | 3300025928 | Ga0207700_10000623 | Ga0207700_1000062323 | 296 |
| 586 | 3300025928 | Ga0207700_10025105 | Ga0207700_100251054 | 296 |
| 587 | 3300025928 | Ga0207700_10205103 | Ga0207700_102051032 | 296 |
| 588 | 3300025929 | Ga0207664_10014641 | Ga0207664_100146417 | 296 |
| 589 | 3300025929 | Ga0207664_10073350 | Ga0207664_100733505 | 296 |
| 590 | 3300025929 | Ga0207664_10277010 | Ga0207664_102770101 | 296 |
| 591 | 3300025929 | Ga0207664_10531698 | Ga0207664_105316981 | 296 |
| 592 | 3300025931 | Ga0207644_10041278 | Ga0207644_100412783 | 296 |
| 593 | 3300025931 | Ga0207644_10045679 | Ga0207644_100456792 | 296 |
| 594 | 3300025932 | Ga0207690_10000546 | Ga0207690_100005469 | 296 |
| 595 | 3300025932 | Ga0207690_10290302 | Ga0207690_102903022 | 296 |
| 596 | 3300025933 | Ga0207706_10001175 | Ga0207706_1000117517 | 296 |
| 597 | 3300025933 | Ga0207706_10003621 | Ga0207706_100036215 | 296 |
| 598 | 3300025933 | Ga0207706_10033074 | Ga0207706_100330742 | 296 |
| 599 | 3300025933 | Ga0207706_10034253 | Ga0207706_100342532 | 296 |
| 600 | 3300025934 | Ga0207686_10048630 | Ga0207686_100486302 | 296 |
| 601 | 3300025934 | Ga0207686_10082937 | Ga0207686_100829372 | 296 |
| 602 | 3300025935 | Ga0207709_10037740 | Ga0207709_100377402 | 296 |
| 603 | 3300025935 | Ga0207709_10056475 | Ga0207709_100564752 | 296 |
| 604 | 3300025936 | Ga0207670_10010169 | Ga0207670_100101693 | 296 |
| 605 | 3300025936 | Ga0207670_10020270 | Ga0207670_100202702 | 296 |
| 606 | 3300025936 | Ga0207670_10109304 | Ga0207670_101093042 | 296 |
| 607 | 3300025937 | Ga0207669_10000534 | Ga0207669_100005342 | 296 |
| 608 | 3300025938 | Ga0207704_10002477 | Ga0207704_100024773 | 296 |
| 609 | 3300025939 | Ga0207665_10001717 | Ga0207665_100017179 | 296 |
| 610 | 3300025939 | Ga0207665_10025158 | Ga0207665_100251582 | 296 |
| 611 | 3300025939 | Ga0207665_10152258 | Ga0207665_101522583 | 296 |
| 612 | 3300025939 | Ga0207665_10169870 | Ga0207665_101698702 | 296 |
| 613 | 3300025940 | Ga0207691_10001992 | Ga0207691_1000199217 | 296 |
| 614 | 3300025940 | Ga0207691_10009096 | Ga0207691_100090968 | 296 |
| 615 | 3300025941 | Ga0207711_10008662 | Ga0207711_100086624 | 296 |
| 616 | 3300025941 | Ga0207711_10019334 | Ga0207711_100193342 | 296 |
| 617 | 3300025941 | Ga0207711_10039618 | Ga0207711_100396182 | 296 |
| 618 | 3300025941 | Ga0207711_10095339 | Ga0207711_100953393 | 296 |
| 619 | 3300025942 | Ga0207689_10000424 | Ga0207689_1000042430 | 296 |
| 620 | 3300025942 | Ga0207689_10002173 | Ga0207689_100021736 | 296 |
| 621 | 3300025942 | Ga0207689_10010839 | Ga0207689_100108395 | 296 |
| 622 | 3300025945 | Ga0207679_10000187 | Ga0207679_100001875 | 296 |
| 623 | 3300025949 | Ga0207667_10011279 | Ga0207667_100112794 | 296 |
| 624 | 3300025949 | Ga0207667_10023894 | Ga0207667_100238947 | 296 |
| 625 | 3300025960 | Ga0207651_10005649 | Ga0207651_100056494 | 296 |
| 626 | 3300025960 | Ga0207651_10013062 | Ga0207651_100130624 | 296 |
| 627 | 3300025960 | Ga0207651_10097459 | Ga0207651_100974592 | 296 |
| 628 | 3300025961 | Ga0207712_10001563 | Ga0207712_100015637 | 296 |
| 629 | 3300025961 | Ga0207712_10015028 | Ga0207712_100150283 | 296 |
| 630 | 3300025961 | Ga0207712_10017851 | Ga0207712_100178512 | 296 |
| 631 | 3300025972 | Ga0207668_10000807 | Ga0207668_100008073 | 296 |
| 632 | 3300025981 | Ga0207640_10001794 | Ga0207640_100017948 | 296 |
| 633 | 3300025986 | Ga0207658_10015810 | Ga0207658_100158101 | 296 |
| 634 | 3300025986 | Ga0207658_10058657 | Ga0207658_100586574 | 296 |
| 635 | 3300026023 | Ga0207677_10002480 | Ga0207677_100024806 | 296 |
| 636 | 3300026023 | Ga0207677_10008071 | Ga0207677_100080713 | 296 |
| 637 | 3300026023 | Ga0207677_10009309 | Ga0207677_100093094 | 296 |
| 638 | 3300026035 | Ga0207703_10059722 | Ga0207703_100597222 | 296 |
| 639 | 3300026041 | Ga0207639_10039012 | Ga0207639_100390122 | 296 |
| 640 | 3300026041 | Ga0207639_10230764 | Ga0207639_102307642 | 296 |
| 641 | 3300026041 | Ga0207639_10276707 | Ga0207639_102767072 | 296 |
| 642 | 3300026041 | Ga0207639_10485280 | Ga0207639_104852802 | 296 |
| 643 | 3300026067 | Ga0207678_10021453 | Ga0207678_100214534 | 296 |
| 644 | 3300026067 | Ga0207678_10058216 | Ga0207678_100582162 | 296 |
| 645 | 3300026067 | Ga0207678_10505189 | Ga0207678_105051891 | 296 |
| 646 | 3300026075 | Ga0207708_10001620 | Ga0207708_100016209 | 296 |
| 647 | 3300026078 | Ga0207702_10011282 | Ga0207702_100112822 | 296 |
| 648 | 3300026078 | Ga0207702_10067339 | Ga0207702_100673394 | 296 |
| 649 | 3300026078 | Ga0207702_10099674 | Ga0207702_100996744 | 296 |
| 650 | 3300026078 | Ga0207702_10170780 | Ga0207702_101707801 | 296 |
| 651 | 3300026078 | Ga0207702_10175935 | Ga0207702_101759352 | 296 |
| 652 | 3300026088 | Ga0207641_10001747 | Ga0207641_1000174711 | 296 |
| 653 | 3300026088 | Ga0207641_10042162 | Ga0207641_100421624 | 296 |
| 654 | 3300026089 | Ga0207648_10006315 | Ga0207648_100063157 | 296 |
| 655 | 3300026089 | Ga0207648_10031587 | Ga0207648_100315875 | 296 |
| 656 | 3300026089 | Ga0207648_10099231 | Ga0207648_100992312 | 296 |
| 657 | 3300026089 | Ga0207648_10412078 | Ga0207648_104120782 | 296 |
| 658 | 3300026095 | Ga0207676_10005369 | Ga0207676_100053692 | 296 |
| 659 | 3300026095 | Ga0207676_10006683 | Ga0207676_100066835 | 296 |
| 660 | 3300026095 | Ga0207676_10028355 | Ga0207676_100283554 | 296 |
| 661 | 3300026116 | Ga0207674_10099023 | Ga0207674_100990232 | 296 |
| 662 | 3300026116 | Ga0207674_10120373 | Ga0207674_101203733 | 296 |
| 663 | 3300026116 | Ga0207674_10169960 | Ga0207674_101699604 | 296 |
| 664 | 3300026118 | Ga0207675_100002650 | Ga0207675_10000265016 | 296 |
| 665 | 3300026118 | Ga0207675_100029584 | Ga0207675_1000295844 | 296 |
| 666 | 3300026118 | Ga0207675_100149945 | Ga0207675_1001499454 | 296 |
| 667 | 3300026118 | Ga0207675_100344747 | Ga0207675_1003447471 | 296 |
| 668 | 3300026121 | Ga0207683_10000727 | Ga0207683_1000072723 | 296 |
| 669 | 3300026121 | Ga0207683_10003304 | Ga0207683_1000330417 | 296 |
| 670 | 3300026121 | Ga0207683_10006260 | Ga0207683_100062605 | 296 |
| 671 | 3300026121 | Ga0207683_10024882 | Ga0207683_100248825 | 296 |
| 672 | 3300026142 | Ga0207698_10001591 | Ga0207698_1000159113 | 296 |
| 673 | 3300027424 | Ga0209984_1004387 | Ga0209984_10043872 | 296 |
| 674 | 3300027543 | Ga0209999_1013478 | Ga0209999_10134782 | 296 |
| 675 | 3300027617 | Ga0210002_1000292 | Ga0210002_10002922 | 296 |
| 676 | 3300027665 | Ga0209983_1004894 | Ga0209983_10048942 | 296 |
| 677 | 3300027682 | Ga0209971_1010091 | Ga0209971_10100912 | 296 |
| 678 | 3300027695 | Ga0209966_1003324 | Ga0209966_10033242 | 296 |
| 679 | 3300027907 | Ga0207428_10000150 | Ga0207428_1000015080 | 296 |
| 680 | 3300027907 | Ga0207428_10001312 | Ga0207428_1000131212 | 296 |
| 681 | 3300028379 | Ga0268266_10028928 | Ga0268266_100289287 | 296 |
| 682 | 3300028379 | Ga0268266_10127675 | Ga0268266_101276752 | 296 |
| 683 | 3300028379 | Ga0268266_10474231 | Ga0268266_104742312 | 296 |
| 684 | 3300028380 | Ga0268265_10003058 | Ga0268265_1000305812 | 296 |
| 685 | 3300028380 | Ga0268265_10021946 | Ga0268265_100219462 | 296 |
| 686 | 3300028577 | Ga0265318_10050700 | Ga0265318_100507002 | 296 |
| 687 | 3300031235 | Ga0265330_10132773 | Ga0265330_101327732 | 296 |
| 688 | 3300031238 | Ga0265332_10027965 | Ga0265332_100279653 | 296 |
| 689 | 3300031241 | Ga0265325_10003669 | Ga0265325_1000366910 | 296 |
| 690 | 3300031241 | Ga0265325_10048000 | Ga0265325_100480002 | 296 |
| 691 | 3300031241 | Ga0265325_10057470 | Ga0265325_100574702 | 296 |
| 692 | 3300031242 | Ga0265329_10014152 | Ga0265329_100141523 | 296 |
| 693 | 3300031247 | Ga0265340_10020356 | Ga0265340_100203563 | 296 |
| 694 | 3300031250 | Ga0265331_10114966 | Ga0265331_101149661 | 296 |
| 695 | 3300031344 | Ga0265316_10062118 | Ga0265316_100621182 | 296 |
| 696 | 3300031595 | Ga0265313_10000339 | Ga0265313_1000033928 | 296 |
| 697 | 3300031595 | Ga0265313_10009086 | Ga0265313_100090866 | 296 |
| 698 | 3300031595 | Ga0265313_10019348 | Ga0265313_100193482 | 296 |
| 699 | 3300031595 | Ga0265313_10033359 | Ga0265313_100333592 | 296 |
| 700 | 3300031711 | Ga0265314_10040172 | Ga0265314_100401722 | 296 |
| 701 | 3300031711 | Ga0265314_10119536 | Ga0265314_101195362 | 296 |
| 702 | 3300031712 | Ga0265342_10004131 | Ga0265342_1000413110 | 296 |
| 703 | 3300031712 | Ga0265342_10037020 | Ga0265342_100370202 | 296 |
| 704 | 3300034816 | Ga0373930_0000047 | Ga0373930_0000047_2386_3276 | 296 |
| 705 | 3300034816 | Ga0373930_0006240 | Ga0373930_0006240_767_1657 | 296 |
| 706 | 3300034817 | Ga0373948_0000024 | Ga0373948_0000024_5898_6788 | 296 |
| 707 | 3300034817 | Ga0373948_0005463 | Ga0373948_0005463_602_1492 | 296 |
| 708 | 3300034818 | Ga0373950_0016164 | Ga0373950_0016164_50_940 | 296 |
| 709 | 3300034819 | Ga0373958_0000655 | Ga0373958_0000655_2117_3007 | 296 |
| 710 | 3300034819 | Ga0373958_0011872 | Ga0373958_0011872_116_1006 | 296 |
| 711 | 3300034820 | Ga0373959_0013683 | Ga0373959_0013683_251_1141 | 296 |
| 712 | 3300034957 | Ga0373938_0000288 | Ga0373938_0000288_2781_3671 | 296 |
| 713 | 3300035083 | Ga0373926_0006670 | Ga0373926_0006670_1804_2694 | 296 |
| 714 | 3300035083 | Ga0373926_0027700 | Ga0373926_0027700_776_1720 | 296 |
| 715 | 3300035083 | Ga0373926_0035211 | Ga0373926_0035211_411_1301 | 296 |
| 716 | 3300035084 | Ga0373928_0000269 | Ga0373928_0000269_2292_3182 | 296 |
| 717 | 3300035084 | Ga0373928_0002346 | Ga0373928_0002346_2081_3016 | 296 |
| 718 | 3300035086 | Ga0373934_0008776 | Ga0373934_0008776_1623_2513 | 296 |
| 719 | 3300035088 | Ga0373940_0000152 | Ga0373940_0000152_6639_7529 | 296 |
| 720 | 3300035088 | Ga0373940_0009981 | Ga0373940_0009981_881_1771 | 296 |
| 721 | 3300035089 | Ga0373944_0000529 | Ga0373944_0000529_1409_2299 | 296 |
| 722 | 3300035089 | Ga0373944_0010817 | Ga0373944_0010817_910_1854 | 296 |
| 723 | 3300035090 | Ga0373949_0000315 | Ga0373949_0000315_9693_10583 | 296 |
| 724 | 3300035090 | Ga0373949_0006098 | Ga0373949_0006098_261_1151 | 296 |
| 725 | 3300035091 | Ga0373951_0003234 | Ga0373951_0003234_596_1486 | 296 |
| 726 | 3300035092 | Ga0373952_0000084 | Ga0373952_0000084_9234_10124 | 296 |
| 727 | 3300035092 | Ga0373952_0001863 | Ga0373952_0001863_508_1398 | 296 |
| 728 | 3300035092 | Ga0373952_0011890 | Ga0373952_0011890_538_1428 | 296 |
| 729 | 3300035111 | Ga0373923_0003265 | Ga0373923_0003265_1967_2857 | 296 |
| 730 | 3300035111 | Ga0373923_0005474 | Ga0373923_0005474_2097_2987 | 296 |
| 731 | 3300035111 | Ga0373923_0018969 | Ga0373923_0018969_461_1402 | 296 |
| 732 | 3300035111 | Ga0373923_0049207 | Ga0373923_0049207_51_992 | 296 |
| 733 | 3300035112 | Ga0373932_0001167 | Ga0373932_0001167_3439_4329 | 296 |
| 734 | 3300035113 | Ga0373936_0000722 | Ga0373936_0000722_634_1629 | 296 |
| 735 | 3300035113 | Ga0373936_0072224 | Ga0373936_0072224_283_1218 | 296 |
| 736 | 3300035113 | Ga0373936_0109845 | Ga0373936_0109845_98_1033 | 296 |
| 737 | 3300035114 | Ga0373939_0001213 | Ga0373939_0001213_467_1357 | 296 |
| 738 | 3300035114 | Ga0373939_0001845 | Ga0373939_0001845_718_1608 | 296 |
| 739 | 3300035115 | Ga0373941_0000158 | Ga0373941_0000158_6221_7111 | 296 |
| 740 | 3300035115 | Ga0373941_0039953 | Ga0373941_0039953_135_1025 | 296 |
| 741 | 3300035116 | Ga0373945_0002014 | Ga0373945_0002014_1741_2685 | 296 |
| 742 | 3300035116 | Ga0373945_0024203 | Ga0373945_0024203_604_1494 | 296 |
| 743 | 3300035117 | Ga0373953_0004608 | Ga0373953_0004608_765_1706 | 296 |
| 744 | 3300035117 | Ga0373953_0008792 | Ga0373953_0008792_1813_2748 | 296 |
| 745 | 3300035117 | Ga0373953_0049685 | Ga0373953_0049685_512_1402 | 296 |
| 746 | 3300035118 | Ga0373954_0002688 | Ga0373954_0002688_5007_5948 | 296 |
| 747 | 3300035118 | Ga0373954_0018825 | Ga0373954_0018825_880_1770 | 296 |
| 748 | 3300035118 | Ga0373954_0031726 | Ga0373954_0031726_475_1416 | 296 |
| 749 | 3300035118 | Ga0373954_0050459 | Ga0373954_0050459_131_1066 | 296 |
| 750 | 3300035119 | Ga0373956_0007670 | Ga0373956_0007670_1439_2374 | 296 |
| 751 | 3300035119 | Ga0373956_0031671 | Ga0373956_0031671_326_1216 | 296 |
| 752 | 3300035119 | Ga0373956_0041589 | Ga0373956_0041589_745_1686 | 296 |
| 753 | 3300035119 | Ga0373956_0072435 | Ga0373956_0072435_137_1027 | 296 |
| 754 | 3300035170 | Ga0373943_0000757 | Ga0373943_0000757_7383_8324 | 296 |
| 755 | 3300035170 | Ga0373943_0011141 | Ga0373943_0011141_2133_3023 | 296 |
| 756 | 3300035170 | Ga0373943_0013910 | Ga0373943_0013910_13_957 | 296 |
| 757 | 3300035170 | Ga0373943_0099946 | Ga0373943_0099946_355_1245 | 296 |
| 758 | 3300035171 | Ga0373946_0031860 | Ga0373946_0031860_349_1293 | 296 |
| 759 | 3300035171 | Ga0373946_0034850 | Ga0373946_0034850_909_1799 | 296 |
| 760 | 3300035171 | Ga0373946_0104575 | Ga0373946_0104575_370_1260 | 296 |
| 761 | 3300035172 | Ga0373955_0000713 | Ga0373955_0000713_12617_13558 | 296 |
| 762 | 3300035172 | Ga0373955_0003253 | Ga0373955_0003253_3444_4334 | 296 |
| 763 | 3300035172 | Ga0373955_0010615 | Ga0373955_0010615_2792_3682 | 296 |
| 764 | 3300035172 | Ga0373955_0095658 | Ga0373955_0095658_93_1034 | 296 |
| 765 | 3300035241 | Ga0373961_0000464 | Ga0373961_0000464_11611_12501 | 296 |
| 766 | 3300035241 | Ga0373961_0016441 | Ga0373961_0016441_28_918 | 296 |
| 767 | 3300035242 | Ga0373962_0003173 | Ga0373962_0003173_2110_3000 | 296 |
| 768 | 3300035242 | Ga0373962_0007894 | Ga0373962_0007894_1511_2401 | 296 |
| 769 | 3300035410 | Ga0373924_0010553 | Ga0373924_0010553_541_1482 | 296 |
| 770 | 3300035410 | Ga0373924_0022450 | Ga0373924_0022450_27_917 | 296 |
| 771 | 3300035691 | Ga0373931_0000291 | Ga0373931_0000291_8742_9632 | 296 |
| 772 | 3300035691 | Ga0373931_0001643 | Ga0373931_0001643_6000_6890 | 296 |
| 773 | 3300035691 | Ga0373931_0007687 | Ga0373931_0007687_2645_3535 | 296 |
| 774 | 3300035691 | Ga0373931_0136848 | Ga0373931_0136848_91_1026 | 296 |
| 775 | 3300035692 | Ga0373935_0001165 | Ga0373935_0001165_1930_2871 | 296 |
| 776 | 3300035692 | Ga0373935_0030524 | Ga0373935_0030524_1031_1921 | 296 |
| 777 | 3300035692 | Ga0373935_0056027 | Ga0373935_0056027_699_1643 | 296 |
| 778 | 3300035692 | Ga0373935_0093851 | Ga0373935_0093851_740_1675 | 296 |
| 779 | 3300035692 | Ga0373935_0101292 | Ga0373935_0101292_592_1533 | 296 |
| 780 | 3300035692 | Ga0373935_0157303 | Ga0373935_0157303_236_1126 | 296 |
| 781 | 3300035695 | Ga0373927_0001051 | Ga0373927_0001051_10106_11050 | 296 |
| 782 | 3300035695 | Ga0373927_0002713 | Ga0373927_0002713_6174_7115 | 296 |
| 783 | 3300035695 | Ga0373927_0026537 | Ga0373927_0026537_1169_2059 | 296 |
| 784 | 3300035695 | Ga0373927_0041094 | Ga0373927_0041094_1842_2777 | 296 |
| 785 | 3300035695 | Ga0373927_0062052 | Ga0373927_0062052_504_1445 | 296 |
| 786 | 3300035695 | Ga0373927_0210020 | Ga0373927_0210020_358_1248 | 296 |
| 787 | 3300035724 | Ga0373933_0005438 | Ga0373933_0005438_4389_5279 | 296 |
| 788 | 3300035724 | Ga0373933_0016565 | Ga0373933_0016565_1476_2366 | 296 |
| 789 | 3300035725 | Ga0373947_0006809 | Ga0373947_0006809_3692_4633 | 296 |
| 790 | 3300035725 | Ga0373947_0013134 | Ga0373947_0013134_3824_4714 | 296 |
| 791 | 3300035725 | Ga0373947_0014697 | Ga0373947_0014697_2655_3599 | 296 |
| 792 | 3300035725 | Ga0373947_0054394 | Ga0373947_0054394_421_1311 | 296 |
| 793 | 3300035725 | Ga0373947_0061602 | Ga0373947_0061602_639_1580 | 296 |
| 794 | 3300036401 | Ga0373937_0002067 | Ga0373937_0002067_15124_16014 | 296 |
| 795 | 3300036401 | Ga0373937_0003621 | Ga0373937_0003621_2948_3889 | 296 |
| 796 | 3300036401 | Ga0373937_0144123 | Ga0373937_0144123_120_1010 | 296 |
| 797 | 3300036401 | Ga0373937_0233721 | Ga0373937_0233721_545_1486 | 296 |
| 798 | 3300037068 | Ga0373925_0000249 | Ga0373925_0000249_22820_23761 | 296 |
| 799 | 3300037068 | Ga0373925_0001925 | Ga0373925_0001925_2616_3560 | 296 |
| 800 | 3300037068 | Ga0373925_0096181 | Ga0373925_0096181_333_1268 | 296 |
| 801 | 3300037068 | Ga0373925_0182855 | Ga0373925_0182855_463_1353 | 296 |
| 802 | 3300037312 | Ga0395899_0014008 | Ga0395899_0014008_4548_5438 | 296 |
| 803 | 3300037312 | Ga0395899_0084987 | Ga0395899_0084987_829_1764 | 296 |
| 804 | 3300037418 | Ga0395900_0046094 | Ga0395900_0046094_26_916 | 296 |
| 805 | 3300037418 | Ga0395900_0295055 | Ga0395900_0295055_223_1158 | 296 |
| 806 | 3300037466 | Ga0395898_0145754 | Ga0395898_0145754_662_1552 | 296 |
| 807 | 3300037471 | Ga0395905_0110725 | Ga0395905_0110725_159_1094 | 296 |
| 808 | 3300038443 | Ga0395901_0097273 | Ga0395901_0097273_958_1893 | 296 |
| 809 | 3300038996 | Ga0242420_000772 | Ga0242420_000772_212_1102 | 296 |
| 810 | 3300039437 | Ga0436365_0330093 | Ga0436365_0330093_1144_2079 | 296 |
| 811 | 3300039437 | Ga0436365_0397707 | Ga0436365_0397707_601_1497 | 296 |
| 812 | 3300039437 | Ga0436365_0794950 | Ga0436365_0794950_1691_2587 | 296 |
| 813 | 3300039437 | Ga0436365_1923592 | Ga0436365_1923592_59_955 | 296 |
| 814 | 3300039438 | Ga0436360_0500596 | Ga0436360_0500596_568_1509 | 296 |
| 815 | 3300039447 | Ga0436361_0327070 | Ga0436361_0327070_7734_8669 | 296 |
| 816 | 3300039447 | Ga0436361_0474885 | Ga0436361_0474885_2473_3408 | 296 |
| 817 | 3300039447 | Ga0436361_0492112 | Ga0436361_0492112_4938_5879 | 296 |
| 818 | 3300039450 | Ga0436363_1120598 | Ga0436363_1120598_17_952 | 296 |
| 819 | 3300042001 | Ga0439441_002555 | Ga0439441_002555_1646_2536 | 296 |
| 820 | 3300042005 | Ga0439448_0031169 | Ga0439448_0031169_598_1488 | 296 |
| 821 | 3300042436 | Ga0439435_0041639 | Ga0439435_0041639_218_1153 | 296 |
| 822 | 3300042461 | Ga0439460_0045021 | Ga0439460_0045021_119_1054 | 296 |
| 823 | 3300042876 | Ga0451577_0255522 | Ga0451577_0255522_527_1417 | 296 |
| 824 | 3300042993 | Ga0439440_0008383 | Ga0439440_0008383_1043_1978 | 296 |
| 825 | 3300044694 | Ga0466963_0014372 | Ga0466963_0014372_575_1468 | 296 |
| 826 | 3300044694 | Ga0466963_0100809 | Ga0466963_0100809_138_1028 | 296 |
| 827 | 3300044712 | Ga0453684_0080311 | Ga0453684_0080311_1236_2126 | 296 |
| 828 | 3300044842 | Ga0466957_0017880 | Ga0466957_0017880_41_931 | 296 |
| 829 | 3300044842 | Ga0466957_0203949 | Ga0466957_0203949_59_949 | 296 |
| 830 | 3300045049 | Ga0466959_0316392 | Ga0466959_0316392_38_931 | 296 |
| 831 | 3300046454 | Ga0495592_0000022 | Ga0495592_0000022_28956_29897 | 296 |
| 832 | 3300046454 | Ga0495592_0008608 | Ga0495592_0008608_5563_6453 | 296 |
| 833 | 3300046454 | Ga0495592_0011867 | Ga0495592_0011867_477_1418 | 296 |
| 834 | 3300046454 | Ga0495592_0013017 | Ga0495592_0013017_4228_5118 | 296 |
| 835 | 3300046454 | Ga0495592_0161415 | Ga0495592_0161415_415_1350 | 296 |
| 836 | 3300046455 | Ga0495603_0033766 | Ga0495603_0033766_350_1240 | 296 |
| 837 | 3300046455 | Ga0495603_0047555 | Ga0495603_0047555_1058_1948 | 296 |
| 838 | 3300046455 | Ga0495603_0051826 | Ga0495603_0051826_479_1369 | 296 |
| 839 | 3300046455 | Ga0495603_0193777 | Ga0495603_0193777_29_970 | 296 |
| 840 | 3300046459 | Ga0495629_0000026 | Ga0495629_0000026_103308_104198 | 296 |
| 841 | 3300046459 | Ga0495629_0000409 | Ga0495629_0000409_3768_4709 | 296 |
| 842 | 3300046459 | Ga0495629_0012401 | Ga0495629_0012401_5195_6136 | 296 |
| 843 | 3300046461 | Ga0495641_0017376 | Ga0495641_0017376_2503_3393 | 296 |
| 844 | 3300046462 | Ga0495651_0001051 | Ga0495651_0001051_3653_4594 | 296 |
| 845 | 3300046462 | Ga0495651_0001548 | Ga0495651_0001548_10730_11671 | 296 |
| 846 | 3300046462 | Ga0495651_0013614 | Ga0495651_0013614_2674_3564 | 296 |
| 847 | 3300046462 | Ga0495651_0017121 | Ga0495651_0017121_3104_3994 | 296 |
| 848 | 3300046462 | Ga0495651_0137371 | Ga0495651_0137371_151_1041 | 296 |
| 849 | 3300046463 | Ga0495653_0000055 | Ga0495653_0000055_31667_32608 | 296 |
| 850 | 3300046463 | Ga0495653_0009787 | Ga0495653_0009787_3317_4207 | 296 |
| 851 | 3300046463 | Ga0495653_0012003 | Ga0495653_0012003_982_1872 | 296 |
| 852 | 3300046463 | Ga0495653_0018050 | Ga0495653_0018050_1010_1951 | 296 |
| 853 | 3300046463 | Ga0495653_0051356 | Ga0495653_0051356_2055_2999 | 296 |
| 854 | 3300046472 | Ga0495580_0006887 | Ga0495580_0006887_557_1447 | 296 |
| 855 | 3300046472 | Ga0495580_0025051 | Ga0495580_0025051_287_1231 | 296 |
| 856 | 3300046472 | Ga0495580_0061749 | Ga0495580_0061749_592_1482 | 296 |
| 857 | 3300046473 | Ga0495582_0006073 | Ga0495582_0006073_4292_5182 | 296 |
| 858 | 3300046473 | Ga0495582_0013298 | Ga0495582_0013298_31_921 | 296 |
| 859 | 3300046473 | Ga0495582_0052396 | Ga0495582_0052396_151_1041 | 296 |
| 860 | 3300046475 | Ga0495639_0042911 | Ga0495639_0042911_795_1685 | 296 |
| 861 | 3300046475 | Ga0495639_0069063 | Ga0495639_0069063_86_1021 | 296 |
| 862 | 3300046475 | Ga0495639_0095392 | Ga0495639_0095392_31_921 | 296 |
| 863 | 3300046476 | Ga0495662_0001894 | Ga0495662_0001894_230_1171 | 296 |
| 864 | 3300046476 | Ga0495662_0003150 | Ga0495662_0003150_6917_7861 | 296 |
| 865 | 3300046476 | Ga0495662_0010784 | Ga0495662_0010784_549_1439 | 296 |
| 866 | 3300046476 | Ga0495662_0056662 | Ga0495662_0056662_241_1182 | 296 |
| 867 | 3300046477 | Ga0495664_0000006 | Ga0495664_0000006_263985_264926 | 296 |
| 868 | 3300046477 | Ga0495664_0005906 | Ga0495664_0005906_2765_3709 | 296 |
| 869 | 3300046477 | Ga0495664_0007402 | Ga0495664_0007402_2384_3274 | 296 |
| 870 | 3300046477 | Ga0495664_0072871 | Ga0495664_0072871_983_1924 | 296 |
| 871 | 3300046492 | Ga0495585_0049171 | Ga0495585_0049171_1090_1980 | 296 |
| 872 | 3300046499 | Ga0495594_0012401 | Ga0495594_0012401_2681_3571 | 296 |
| 873 | 3300046499 | Ga0495594_0019299 | Ga0495594_0019299_1380_2270 | 296 |
| 874 | 3300046499 | Ga0495594_0085576 | Ga0495594_0085576_558_1448 | 296 |
| 875 | 3300046501 | Ga0495607_0010403 | Ga0495607_0010403_1529_2419 | 296 |
| 876 | 3300046501 | Ga0495607_0056603 | Ga0495607_0056603_949_1884 | 296 |
| 877 | 3300046511 | Ga0495608_0000002 | Ga0495608_0000002_263933_264874 | 296 |
| 878 | 3300046511 | Ga0495608_0006088 | Ga0495608_0006088_6892_7782 | 296 |
| 879 | 3300046511 | Ga0495608_0006648 | Ga0495608_0006648_6563_7504 | 296 |
| 880 | 3300046514 | Ga0495618_0000001 | Ga0495618_0000001_120875_121816 | 296 |
| 881 | 3300046514 | Ga0495618_0002201 | Ga0495618_0002201_7329_8270 | 296 |
| 882 | 3300046514 | Ga0495618_0059037 | Ga0495618_0059037_18_962 | 296 |
| 883 | 3300046516 | Ga0495628_0000004 | Ga0495628_0000004_163485_164426 | 296 |
| 884 | 3300046516 | Ga0495628_0021376 | Ga0495628_0021376_3527_4417 | 296 |
| 885 | 3300046516 | Ga0495628_0042157 | Ga0495628_0042157_915_1856 | 296 |
| 886 | 3300046517 | Ga0495630_0003468 | Ga0495630_0003468_2357_3298 | 296 |
| 887 | 3300046517 | Ga0495630_0011056 | Ga0495630_0011056_2969_3910 | 296 |
| 888 | 3300046517 | Ga0495630_0064058 | Ga0495630_0064058_479_1369 | 296 |
| 889 | 3300046517 | Ga0495630_0128836 | Ga0495630_0128836_943_1878 | 296 |
| 890 | 3300046517 | Ga0495630_0184910 | Ga0495630_0184910_315_1205 | 296 |
| 891 | 3300046520 | Ga0495637_0080842 | Ga0495637_0080842_138_1073 | 296 |
| 892 | 3300046523 | Ga0495644_0000312 | Ga0495644_0000312_4005_4895 | 296 |
| 893 | 3300046525 | Ga0495663_0058803 | Ga0495663_0058803_186_1076 | 296 |
| 894 | 3300046526 | Ga0495666_0009011 | Ga0495666_0009011_3494_4384 | 296 |
| 895 | 3300046526 | Ga0495666_0012241 | Ga0495666_0012241_1694_2638 | 296 |
| 896 | 3300046526 | Ga0495666_0019754 | Ga0495666_0019754_1262_2152 | 296 |
| 897 | 3300046529 | Ga0495652_0000007 | Ga0495652_0000007_153067_154008 | 296 |
| 898 | 3300046529 | Ga0495652_0030506 | Ga0495652_0030506_907_1797 | 296 |
| 899 | 3300046529 | Ga0495652_0049908 | Ga0495652_0049908_1587_2531 | 296 |
| 900 | 3300046529 | Ga0495652_0088050 | Ga0495652_0088050_849_1739 | 296 |
| 901 | 3300046529 | Ga0495652_0221580 | Ga0495652_0221580_394_1335 | 296 |
| 902 | 3300046531 | Ga0495665_0008576 | Ga0495665_0008576_1638_2528 | 296 |
| 903 | 3300046531 | Ga0495665_0009133 | Ga0495665_0009133_3982_4872 | 296 |
| 904 | 3300046531 | Ga0495665_0059593 | Ga0495665_0059593_396_1337 | 296 |
| 905 | 3300046531 | Ga0495665_0159736 | Ga0495665_0159736_75_965 | 296 |
| 906 | 3300046533 | Ga0495640_0000004 | Ga0495640_0000004_286050_286991 | 296 |
| 907 | 3300046533 | Ga0495640_0007732 | Ga0495640_0007732_4498_5442 | 296 |
| 908 | 3300046533 | Ga0495640_0017299 | Ga0495640_0017299_1145_2086 | 296 |
| 909 | 3300046535 | Ga0495586_0023372 | Ga0495586_0023372_412_1302 | 296 |
| 910 | 3300046535 | Ga0495586_0029905 | Ga0495586_0029905_53_943 | 296 |
| 911 | 3300046536 | Ga0495587_0000002 | Ga0495587_0000002_160421_161362 | 296 |
| 912 | 3300046536 | Ga0495587_0002925 | Ga0495587_0002925_3428_4318 | 296 |
| 913 | 3300046536 | Ga0495587_0005039 | Ga0495587_0005039_5074_6015 | 296 |
| 914 | 3300046536 | Ga0495587_0020800 | Ga0495587_0020800_2314_3204 | 296 |
| 915 | 3300046536 | Ga0495587_0025016 | Ga0495587_0025016_2039_2980 | 296 |
| 916 | 3300046538 | Ga0495609_0027480 | Ga0495609_0027480_1397_2287 | 296 |
| 917 | 3300046538 | Ga0495609_0033690 | Ga0495609_0033690_15_905 | 296 |
| 918 | 3300046543 | Ga0495645_0000008 | Ga0495645_0000008_66535_67476 | 296 |
| 919 | 3300046543 | Ga0495645_0003668 | Ga0495645_0003668_1897_2787 | 296 |
| 920 | 3300046543 | Ga0495645_0021226 | Ga0495645_0021226_2392_3282 | 296 |
| 921 | 3300046543 | Ga0495645_0054915 | Ga0495645_0054915_715_1656 | 296 |
| 922 | 3300046558 | Ga0495633_0001295 | Ga0495633_0001295_15840_16730 | 296 |
| 923 | 3300046559 | Ga0495667_0000006 | Ga0495667_0000006_160408_161349 | 296 |
| 924 | 3300046559 | Ga0495667_0002953 | Ga0495667_0002953_6376_7266 | 296 |
| 925 | 3300046559 | Ga0495667_0003478 | Ga0495667_0003478_3767_4657 | 296 |
| 926 | 3300046559 | Ga0495667_0007034 | Ga0495667_0007034_4452_5393 | 296 |
| 927 | 3300046559 | Ga0495667_0039564 | Ga0495667_0039564_312_1202 | 296 |
| 928 | 3300046559 | Ga0495667_0128741 | Ga0495667_0128741_512_1453 | 296 |
| 929 | 3300046615 | Ga0495656_0000522 | Ga0495656_0000522_1071_1961 | 296 |
| 930 | 3300046642 | Ga0495634_0000001 | Ga0495634_0000001_138507_139448 | 296 |
| 931 | 3300046642 | Ga0495634_0015929 | Ga0495634_0015929_3102_3992 | 296 |
| 932 | 3300046642 | Ga0495634_0023747 | Ga0495634_0023747_2781_3722 | 296 |
| 933 | 3300046642 | Ga0495634_0040721 | Ga0495634_0040721_262_1152 | 296 |
| 934 | 3300046648 | Ga0495611_0013926 | Ga0495611_0013926_554_1444 | 296 |
| 935 | 3300046663 | Ga0495635_0000004 | Ga0495635_0000004_286006_286947 | 296 |
| 936 | 3300046663 | Ga0495635_0000123 | Ga0495635_0000123_33668_34612 | 296 |
| 937 | 3300046663 | Ga0495635_0011422 | Ga0495635_0011422_2952_3842 | 296 |
| 938 | 3300046663 | Ga0495635_0016155 | Ga0495635_0016155_2418_3308 | 296 |
| 939 | 3300046663 | Ga0495635_0017382 | Ga0495635_0017382_2930_3820 | 296 |
| 940 | 3300046663 | Ga0495635_0028200 | Ga0495635_0028200_2333_3274 | 296 |
| 941 | 3300046663 | Ga0495635_0117984 | Ga0495635_0117984_596_1486 | 296 |
| 942 | 3300046663 | Ga0495635_0124318 | Ga0495635_0124318_744_1685 | 296 |
| 943 | 3300046664 | Ga0495659_0068501 | Ga0495659_0068501_240_1175 | 296 |
| 944 | 3300046664 | Ga0495659_0077831 | Ga0495659_0077831_200_1090 | 296 |
| 945 | 3300046674 | Ga0495588_0009872 | Ga0495588_0009872_617_1507 | 296 |
| 946 | 3300046675 | Ga0495657_0000139 | Ga0495657_0000139_28972_29913 | 296 |
| 947 | 3300046675 | Ga0495657_0009876 | Ga0495657_0009876_4442_5332 | 296 |
| 948 | 3300046675 | Ga0495657_0053038 | Ga0495657_0053038_973_1914 | 296 |
| 949 | 3300046678 | Ga0495599_0000003 | Ga0495599_0000003_54146_55087 | 296 |
| 950 | 3300046678 | Ga0495599_0010016 | Ga0495599_0010016_3856_4746 | 296 |
| 951 | 3300046678 | Ga0495599_0117601 | Ga0495599_0117601_686_1576 | 296 |
| 952 | 3300046678 | Ga0495599_0156758 | Ga0495599_0156758_270_1211 | 296 |
| 953 | 3300046679 | Ga0495623_0000048 | Ga0495623_0000048_22680_23621 | 296 |
| 954 | 3300046679 | Ga0495623_0002450 | Ga0495623_0002450_1332_2222 | 296 |
| 955 | 3300046680 | Ga0495646_0000001 | Ga0495646_0000001_264042_264983 | 296 |
| 956 | 3300046680 | Ga0495646_0006974 | Ga0495646_0006974_2618_3559 | 296 |
| 957 | 3300046680 | Ga0495646_0060709 | Ga0495646_0060709_1001_1891 | 296 |
| 958 | 3300046681 | Ga0495647_0012751 | Ga0495647_0012751_1129_2019 | 296 |
| 959 | 3300046681 | Ga0495647_0032742 | Ga0495647_0032742_919_1863 | 296 |
| 960 | 3300046683 | Ga0495658_0004396 | Ga0495658_0004396_3838_4728 | 296 |
| 961 | 3300046683 | Ga0495658_0031443 | Ga0495658_0031443_1948_2838 | 296 |
| 962 | 3300046683 | Ga0495658_0036565 | Ga0495658_0036565_1808_2698 | 296 |
| 963 | 3300046683 | Ga0495658_0042330 | Ga0495658_0042330_139_1029 | 296 |
| 964 | 3300046684 | Ga0495669_0031031 | Ga0495669_0031031_562_1497 | 296 |
| 965 | 3300046689 | Ga0495613_0003849 | Ga0495613_0003849_8868_9758 | 296 |
| 966 | 3300046689 | Ga0495613_0011297 | Ga0495613_0011297_388_1332 | 296 |
| 967 | 3300046689 | Ga0495613_0031905 | Ga0495613_0031905_577_1512 | 296 |
| 968 | 3300046689 | Ga0495613_0061800 | Ga0495613_0061800_326_1216 | 296 |
| 969 | 3300046690 | Ga0495624_0002831 | Ga0495624_0002831_8421_9362 | 296 |
| 970 | 3300046690 | Ga0495624_0007113 | Ga0495624_0007113_6647_7591 | 296 |
| 971 | 3300046690 | Ga0495624_0016426 | Ga0495624_0016426_3205_4095 | 296 |
| 972 | 3300046690 | Ga0495624_0032056 | Ga0495624_0032056_1792_2733 | 296 |
| 973 | 3300046690 | Ga0495624_0098731 | Ga0495624_0098731_302_1192 | 296 |
| 974 | 3300046691 | Ga0495670_0000701 | Ga0495670_0000701_1088_1978 | 296 |
| 975 | 3300046691 | Ga0495670_0149171 | Ga0495670_0149171_236_1171 | 296 |
| 976 | 3300046694 | Ga0495649_0052194 | Ga0495649_0052194_747_1682 | 296 |
| 977 | 3300046809 | Ga0495600_0000083 | Ga0495600_0000083_19618_20559 | 296 |
| 978 | 3300046809 | Ga0495600_0003659 | Ga0495600_0003659_2843_3784 | 296 |
| 979 | 3300046809 | Ga0495600_0008685 | Ga0495600_0008685_3044_3934 | 296 |
| 980 | 3300046809 | Ga0495600_0016229 | Ga0495600_0016229_2313_3203 | 296 |
| 981 | 3300046809 | Ga0495600_0194031 | Ga0495600_0194031_290_1231 | 296 |
| 982 | 3300047315 | Ga0495581_0003328 | Ga0495581_0003328_4531_5421 | 296 |
| 983 | 3300047315 | Ga0495581_0030379 | Ga0495581_0030379_1554_2444 | 296 |
| 984 | 3300047315 | Ga0495581_0052466 | Ga0495581_0052466_459_1403 | 296 |
| 985 | 3300047315 | Ga0495581_0071628 | Ga0495581_0071628_965_1855 | 296 |
| 986 | 3300047315 | Ga0495581_0092475 | Ga0495581_0092475_751_1692 | 296 |
| 987 | 3300047317 | Ga0495604_0000003 | Ga0495604_0000003_263907_264848 | 296 |
| 988 | 3300047317 | Ga0495604_0001090 | Ga0495604_0001090_13475_14416 | 296 |
| 989 | 3300047317 | Ga0495604_0009839 | Ga0495604_0009839_779_1669 | 296 |
| 990 | 3300047317 | Ga0495604_0012255 | Ga0495604_0012255_5139_6029 | 296 |
| 991 | 3300047317 | Ga0495604_0096576 | Ga0495604_0096576_1102_2043 | 296 |
| 992 | 3300047319 | Ga0495674_0000006 | Ga0495674_0000006_202991_203932 | 296 |
| 993 | 3300047319 | Ga0495674_0003125 | Ga0495674_0003125_11806_12747 | 296 |
| 994 | 3300047319 | Ga0495674_0003227 | Ga0495674_0003227_4500_5444 | 296 |
| 995 | 3300047319 | Ga0495674_0011118 | Ga0495674_0011118_1100_1990 | 296 |
| 996 | 3300047321 | Ga0495676_0052656 | Ga0495676_0052656_1964_2899 | 296 |
| 997 | 3300047321 | Ga0495676_0124665 | Ga0495676_0124665_375_1265 | 296 |
| 998 | 3300047321 | Ga0495676_0222156 | Ga0495676_0222156_211_1155 | 296 |
| 999 | 3300047322 | Ga0495680_0000795 | Ga0495680_0000795_24160_25101 | 296 |
| 1000 | 3300047322 | Ga0495680_0000825 | Ga0495680_0000825_2006_2896 | 296 |
| 1001 | 3300047322 | Ga0495680_0002001 | Ga0495680_0002001_15829_16770 | 296 |
| 1002 | 3300047322 | Ga0495680_0037655 | Ga0495680_0037655_2953_3843 | 296 |
| 1003 | 3300047322 | Ga0495680_0042963 | Ga0495680_0042963_2525_3415 | 296 |
| 1004 | 3300047322 | Ga0495680_0087177 | Ga0495680_0087177_225_1115 | 296 |
| 1005 | 3300047323 | Ga0495683_0144629 | Ga0495683_0144629_130_1065 | 296 |
| 1006 | 3300047444 | Ga0495675_0000109 | Ga0495675_0000109_23134_24075 | 296 |
| 1007 | 3300047444 | Ga0495675_0004145 | Ga0495675_0004145_6261_7151 | 296 |
| 1008 | 3300047444 | Ga0495675_0018767 | Ga0495675_0018767_82_1023 | 296 |
| 1009 | 3300047471 | Ga0495684_0000003 | Ga0495684_0000003_177361_178302 | 296 |
| 1010 | 3300047471 | Ga0495684_0005001 | Ga0495684_0005001_2201_3142 | 296 |
| 1011 | 3300047471 | Ga0495684_0005490 | Ga0495684_0005490_5608_6498 | 296 |
| 1012 | 3300047471 | Ga0495684_0251615 | Ga0495684_0251615_81_1025 | 296 |
| 1013 | 3300047673 | Ga0495593_0000767 | Ga0495593_0000767_8396_9337 | 296 |
| 1014 | 3300047673 | Ga0495593_0015854 | Ga0495593_0015854_1094_2038 | 296 |
| 1015 | 3300047673 | Ga0495593_0023159 | Ga0495593_0023159_816_1706 | 296 |
| 1016 | 3300048088 | Ga0495602_0000011 | Ga0495602_0000011_63370_64311 | 296 |
| 1017 | 3300048088 | Ga0495602_0001877 | Ga0495602_0001877_824_1714 | 296 |
| 1018 | 3300048088 | Ga0495602_0010500 | Ga0495602_0010500_2796_3737 | 296 |
| 1019 | 3300048088 | Ga0495602_0065204 | Ga0495602_0065204_25_966 | 296 |
| 1020 | 3300048088 | Ga0495602_0297384 | Ga0495602_0297384_93_983 | 296 |
| 1021 | 3300048089 | Ga0495614_0024177 | Ga0495614_0024177_606_1496 | 296 |
| 1022 | 3300048089 | Ga0495614_0058038 | Ga0495614_0058038_466_1356 | 296 |
| 1023 | 3300048903 | Ga0496100_0002097 | Ga0496100_0002097_3370_4260 | 296 |
| 1024 | 3300048903 | Ga0496100_0006356 | Ga0496100_0006356_3844_4779 | 296 |
| 1025 | 3300048903 | Ga0496100_0025496 | Ga0496100_0025496_1115_2056 | 296 |
| 1026 | 3300048903 | Ga0496100_0037227 | Ga0496100_0037227_1146_2081 | 296 |
| 1027 | 3300048903 | Ga0496100_0067752 | Ga0496100_0067752_1082_1972 | 296 |
| 1028 | 3300048904 | Ga0496101_0001573 | Ga0496101_0001573_8447_9382 | 296 |
| 1029 | 3300048904 | Ga0496101_0003612 | Ga0496101_0003612_2819_3709 | 296 |
| 1030 | 3300048904 | Ga0496101_0006966 | Ga0496101_0006966_68_1003 | 296 |
| 1031 | 3300048904 | Ga0496101_0084085 | Ga0496101_0084085_1273_2163 | 296 |
| 1032 | 3300048905 | Ga0496102_0014548 | Ga0496102_0014548_5855_6790 | 296 |
| 1033 | 3300048905 | Ga0496102_0016207 | Ga0496102_0016207_4668_5603 | 296 |
| 1034 | 3300048905 | Ga0496102_0203036 | Ga0496102_0203036_741_1631 | 296 |
| 1035 | 3300048905 | Ga0496102_0223176 | Ga0496102_0223176_275_1216 | 296 |
| 1036 | 3300048905 | Ga0496102_0337506 | Ga0496102_0337506_106_1041 | 296 |
| 1037 | 3300048906 | Ga0496103_0000963 | Ga0496103_0000963_3369_4259 | 296 |
| 1038 | 3300048906 | Ga0496103_0012426 | Ga0496103_0012426_2710_3645 | 296 |
| 1039 | 3300048907 | Ga0496104_0003080 | Ga0496104_0003080_572_1507 | 296 |
| 1040 | 3300048907 | Ga0496104_0008002 | Ga0496104_0008002_7347_8282 | 296 |
| 1041 | 3300048907 | Ga0496104_0017091 | Ga0496104_0017091_873_1808 | 296 |
| 1042 | 3300048907 | Ga0496104_0057914 | Ga0496104_0057914_2533_3423 | 296 |
| 1043 | 3300048907 | Ga0496104_0060617 | Ga0496104_0060617_1186_2076 | 296 |
| 1044 | 3300048907 | Ga0496104_0208634 | Ga0496104_0208634_104_994 | 296 |
| 1045 | 3300048908 | Ga0496105_0006839 | Ga0496105_0006839_4286_5176 | 296 |
| 1046 | 3300048908 | Ga0496105_0016436 | Ga0496105_0016436_4192_5082 | 296 |
| 1047 | 3300048908 | Ga0496105_0017193 | Ga0496105_0017193_4441_5376 | 296 |
| 1048 | 3300048908 | Ga0496105_0020989 | Ga0496105_0020989_878_1813 | 296 |
| 1049 | 3300048908 | Ga0496105_0042813 | Ga0496105_0042813_952_1887 | 296 |
| 1050 | 3300048908 | Ga0496105_0061855 | Ga0496105_0061855_1721_2611 | 296 |
| 1051 | 3300048909 | Ga0496106_0007022 | Ga0496106_0007022_772_1662 | 296 |
| 1052 | 3300048909 | Ga0496106_0008577 | Ga0496106_0008577_4441_5376 | 296 |
| 1053 | 3300048909 | Ga0496106_0010388 | Ga0496106_0010388_5543_6433 | 296 |
| 1054 | 3300048909 | Ga0496106_0049674 | Ga0496106_0049674_1417_2352 | 296 |
| 1055 | 3300048909 | Ga0496106_0052883 | Ga0496106_0052883_1600_2490 | 296 |
| 1056 | 3300048909 | Ga0496106_0068739 | Ga0496106_0068739_317_1252 | 296 |
| 1057 | 3300048909 | Ga0496106_0497504 | Ga0496106_0497504_14_949 | 296 |
| 1058 | 3300048910 | Ga0496107_0004013 | Ga0496107_0004013_4364_5299 | 296 |
| 1059 | 3300048910 | Ga0496107_0012549 | Ga0496107_0012549_1202_2092 | 296 |
| 1060 | 3300048910 | Ga0496107_0023797 | Ga0496107_0023797_1007_1942 | 296 |
| 1061 | 3300048910 | Ga0496107_0031391 | Ga0496107_0031391_2742_3632 | 296 |
| 1062 | 3300048911 | Ga0496108_0000626 | Ga0496108_0000626_13769_14704 | 296 |
| 1063 | 3300048911 | Ga0496108_0001093 | Ga0496108_0001093_4567_5502 | 296 |
| 1064 | 3300048911 | Ga0496108_0010782 | Ga0496108_0010782_515_1450 | 296 |
| 1065 | 3300048911 | Ga0496108_0014245 | Ga0496108_0014245_1716_2606 | 296 |
| 1066 | 3300048911 | Ga0496108_0017276 | Ga0496108_0017276_4901_5836 | 296 |
| 1067 | 3300048911 | Ga0496108_0080063 | Ga0496108_0080063_795_1685 | 296 |
| 1068 | 3300048911 | Ga0496108_0110276 | Ga0496108_0110276_1057_1947 | 296 |
| 1069 | 3300048912 | Ga0496109_0001690 | Ga0496109_0001690_8429_9319 | 296 |
| 1070 | 3300048912 | Ga0496109_0002491 | Ga0496109_0002491_1222_2157 | 296 |
| 1071 | 3300048912 | Ga0496109_0002725 | Ga0496109_0002725_7423_8358 | 296 |
| 1072 | 3300048912 | Ga0496109_0028465 | Ga0496109_0028465_15_950 | 296 |
| 1073 | 3300048912 | Ga0496109_0045631 | Ga0496109_0045631_2454_3389 | 296 |
| 1074 | 3300048912 | Ga0496109_0093967 | Ga0496109_0093967_1082_1972 | 296 |
| 1075 | 3300048912 | Ga0496109_0110973 | Ga0496109_0110973_900_1790 | 296 |
| 1076 | 3300048912 | Ga0496109_0428696 | Ga0496109_0428696_263_1198 | 296 |
| 1077 | 3300048913 | Ga0496110_0005926 | Ga0496110_0005926_1589_2524 | 296 |
| 1078 | 3300048913 | Ga0496110_0009277 | Ga0496110_0009277_6662_7597 | 296 |
| 1079 | 3300048913 | Ga0496110_0009396 | Ga0496110_0009396_2188_3123 | 296 |
| 1080 | 3300048913 | Ga0496110_0126494 | Ga0496110_0126494_798_1733 | 296 |
| 1081 | 3300048913 | Ga0496110_0553494 | Ga0496110_0553494_137_1027 | 296 |
| 1082 | 3300048914 | Ga0496111_0002392 | Ga0496111_0002392_8946_9881 | 296 |
| 1083 | 3300048914 | Ga0496111_0010978 | Ga0496111_0010978_5021_5956 | 296 |
| 1084 | 3300048914 | Ga0496111_0014108 | Ga0496111_0014108_1281_2171 | 296 |
| 1085 | 3300048914 | Ga0496111_0020330 | Ga0496111_0020330_1295_2230 | 296 |
| 1086 | 3300048914 | Ga0496111_0022206 | Ga0496111_0022206_2267_3157 | 296 |
| 1087 | 3300048914 | Ga0496111_0032758 | Ga0496111_0032758_1987_2877 | 296 |
| 1088 | 3300048914 | Ga0496111_0327728 | Ga0496111_0327728_185_1120 | 296 |
| 1089 | 3300048915 | Ga0496112_0002087 | Ga0496112_0002087_14381_15271 | 296 |
| 1090 | 3300048915 | Ga0496112_0006295 | Ga0496112_0006295_6373_7308 | 296 |
| 1091 | 3300048915 | Ga0496112_0009904 | Ga0496112_0009904_3409_4344 | 296 |
| 1092 | 3300048915 | Ga0496112_0013016 | Ga0496112_0013016_1036_1926 | 296 |
| 1093 | 3300048915 | Ga0496112_0035200 | Ga0496112_0035200_2697_3638 | 296 |
| 1094 | 3300048915 | Ga0496112_0088433 | Ga0496112_0088433_1854_2789 | 296 |
| 1095 | 3300048915 | Ga0496112_0103374 | Ga0496112_0103374_670_1560 | 296 |
| 1096 | 3300048916 | Ga0496113_0000329 | Ga0496113_0000329_18880_19770 | 296 |
| 1097 | 3300048916 | Ga0496113_0000855 | Ga0496113_0000855_3791_4726 | 296 |
| 1098 | 3300048916 | Ga0496113_0007129 | Ga0496113_0007129_4117_5052 | 296 |
| 1099 | 3300048916 | Ga0496113_0023131 | Ga0496113_0023131_3367_4257 | 296 |
| 1100 | 3300048916 | Ga0496113_0034534 | Ga0496113_0034534_1528_2463 | 296 |
| 1101 | 3300048916 | Ga0496113_0069969 | Ga0496113_0069969_1363_2253 | 296 |
| 1102 | 3300048916 | Ga0496113_0177889 | Ga0496113_0177889_563_1504 | 296 |
| 1103 | 3300048917 | Ga0496114_0001660 | Ga0496114_0001660_13538_14428 | 296 |
| 1104 | 3300048917 | Ga0496114_0048532 | Ga0496114_0048532_2197_3087 | 296 |
| 1105 | 3300048917 | Ga0496114_0158674 | Ga0496114_0158674_235_1125 | 296 |
| 1106 | 3300048918 | Ga0496115_0001117 | Ga0496115_0001117_16514_17404 | 296 |
| 1107 | 3300048918 | Ga0496115_0152187 | Ga0496115_0152187_448_1338 | 296 |
| 1108 | 3300048918 | Ga0496115_0228020 | Ga0496115_0228020_96_986 | 296 |
| 1109 | 3300048918 | Ga0496115_0278007 | Ga0496115_0278007_396_1331 | 296 |
| 1110 | 3300048928 | Ga0496125_0122443 | Ga0496125_0122443_652_1542 | 296 |
| 1111 | 3300049568 | Ga0501031_0077351 | Ga0501031_0077351_1053_1949 | 296 |
| 1112 | 3300049569 | Ga0501032_0033654 | Ga0501032_0033654_1328_2224 | 296 |
| 1113 | 3300049569 | Ga0501032_0079696 | Ga0501032_0079696_95_991 | 296 |
| 1114 | 3300049569 | Ga0501032_0114952 | Ga0501032_0114952_134_1030 | 296 |
| 1115 | 3300049570 | Ga0501033_0082791 | Ga0501033_0082791_409_1305 | 296 |
| 1116 | 3300049571 | Ga0501034_0000772 | Ga0501034_0000772_39174_40070 | 296 |
| 1117 | 3300049571 | Ga0501034_0019501 | Ga0501034_0019501_127_1023 | 296 |
| 1118 | 3300049571 | Ga0501034_0031173 | Ga0501034_0031173_2177_3073 | 296 |
| 1119 | 3300049571 | Ga0501034_0156132 | Ga0501034_0156132_1310_2206 | 296 |
| 1120 | 3300049571 | Ga0501034_0350334 | Ga0501034_0350334_204_1094 | 296 |
| 1121 | 3300049572 | Ga0501036_0001347 | Ga0501036_0001347_14760_15656 | 296 |
| 1122 | 3300049572 | Ga0501036_0005113 | Ga0501036_0005113_2944_3840 | 296 |
| 1123 | 3300049572 | Ga0501036_0005897 | Ga0501036_0005897_820_1716 | 296 |
| 1124 | 3300049572 | Ga0501036_0012992 | Ga0501036_0012992_1768_2739 | 296 |
| 1125 | 3300049572 | Ga0501036_0203394 | Ga0501036_0203394_653_1549 | 296 |
| 1126 | 3300049573 | Ga0501037_0006285 | Ga0501037_0006285_4884_5780 | 296 |
| 1127 | 3300049573 | Ga0501037_0008680 | Ga0501037_0008680_2550_3446 | 296 |
| 1128 | 3300049573 | Ga0501037_0025041 | Ga0501037_0025041_2699_3595 | 296 |
| 1129 | 3300049574 | Ga0501038_0026586 | Ga0501038_0026586_3392_4288 | 296 |
| 1130 | 3300049574 | Ga0501038_0076017 | Ga0501038_0076017_257_1153 | 296 |
| 1131 | 3300049574 | Ga0501038_0121374 | Ga0501038_0121374_45_941 | 296 |
| 1132 | 3300049575 | Ga0501039_0009445 | Ga0501039_0009445_2663_3559 | 296 |
| 1133 | 3300049575 | Ga0501039_0050088 | Ga0501039_0050088_1500_2396 | 296 |
| 1134 | 3300049576 | Ga0501040_0375304 | Ga0501040_0375304_56_952 | 296 |
| 1135 | 3300049578 | Ga0501042_0292404 | Ga0501042_0292404_244_1140 | 296 |
| 1136 | 3300049579 | Ga0501043_0006610 | Ga0501043_0006610_3799_4695 | 296 |
| 1137 | 3300049579 | Ga0501043_0035066 | Ga0501043_0035066_1823_2719 | 296 |
| 1138 | 3300049580 | Ga0501046_0028930 | Ga0501046_0028930_2990_3886 | 296 |
| 1139 | 3300049580 | Ga0501046_0029341 | Ga0501046_0029341_900_1871 | 296 |
| 1140 | 3300049580 | Ga0501046_0031961 | Ga0501046_0031961_2615_3511 | 296 |
| 1141 | 3300049580 | Ga0501046_0079870 | Ga0501046_0079870_750_1646 | 296 |
| 1142 | 3300049581 | Ga0501047_0000136 | Ga0501047_0000136_83762_84658 | 296 |
| 1143 | 3300049581 | Ga0501047_0007923 | Ga0501047_0007923_6989_7879 | 296 |
| 1144 | 3300049581 | Ga0501047_0089349 | Ga0501047_0089349_2019_2915 | 296 |
| 1145 | 3300049581 | Ga0501047_0093053 | Ga0501047_0093053_1269_2165 | 296 |
| 1146 | 3300049582 | Ga0501048_0000039 | Ga0501048_0000039_35607_36503 | 296 |
| 1147 | 3300049582 | Ga0501048_0014119 | Ga0501048_0014119_1451_2422 | 296 |
| 1148 | 3300049582 | Ga0501048_0072602 | Ga0501048_0072602_1506_2402 | 296 |
| 1149 | 3300049583 | Ga0501067_0019377 | Ga0501067_0019377_1255_2151 | 296 |
| 1150 | 3300049584 | Ga0501068_0019636 | Ga0501068_0019636_2883_3779 | 296 |
| 1151 | 3300049584 | Ga0501068_0053873 | Ga0501068_0053873_876_1772 | 296 |
| 1152 | 3300049584 | Ga0501068_0058714 | Ga0501068_0058714_1260_2156 | 296 |
| 1153 | 3300049586 | Ga0501070_0048115 | Ga0501070_0048115_883_1779 | 296 |
| 1154 | 3300049586 | Ga0501070_0064092 | Ga0501070_0064092_933_1829 | 296 |
| 1155 | 3300049586 | Ga0501070_0071174 | Ga0501070_0071174_773_1669 | 296 |
| 1156 | 3300049588 | Ga0501072_0041737 | Ga0501072_0041737_1041_1982 | 296 |
| 1157 | 3300049588 | Ga0501072_0140764 | Ga0501072_0140764_761_1657 | 296 |
| 1158 | 3300049588 | Ga0501072_0299083 | Ga0501072_0299083_265_1161 | 296 |
| 1159 | 3300049589 | Ga0501073_0007504 | Ga0501073_0007504_4374_5270 | 296 |
| 1160 | 3300049589 | Ga0501073_0072356 | Ga0501073_0072356_674_1570 | 296 |
| 1161 | 3300049589 | Ga0501073_0363455 | Ga0501073_0363455_12_908 | 296 |
| 1162 | 3300049590 | Ga0501074_0011889 | Ga0501074_0011889_3549_4445 | 296 |
| 1163 | 3300049590 | Ga0501074_0034926 | Ga0501074_0034926_1679_2575 | 296 |
| 1164 | 3300049591 | Ga0501075_0010046 | Ga0501075_0010046_3519_4490 | 296 |
| 1165 | 3300049591 | Ga0501075_0028210 | Ga0501075_0028210_1205_2146 | 296 |
| 1166 | 3300049592 | Ga0501076_0003117 | Ga0501076_0003117_3704_4675 | 296 |
| 1167 | 3300049592 | Ga0501076_0027114 | Ga0501076_0027114_1462_2403 | 296 |
| 1168 | 3300049593 | Ga0501077_0013675 | Ga0501077_0013675_2475_3365 | 296 |
| 1169 | 3300049593 | Ga0501077_0046503 | Ga0501077_0046503_338_1309 | 296 |
| 1170 | 3300049741 | Ga0501079_0008450 | Ga0501079_0008450_2405_3376 | 296 |
| 1171 | 3300049741 | Ga0501079_0046472 | Ga0501079_0046472_1984_2877 | 296 |
| 1172 | 3300049741 | Ga0501079_0074600 | Ga0501079_0074600_422_1318 | 296 |
| 1173 | 3300049741 | Ga0501079_0173682 | Ga0501079_0173682_426_1367 | 296 |
| 1174 | 3300049742 | Ga0501080_0000022 | Ga0501080_0000022_25229_26125 | 296 |
| 1175 | 3300049742 | Ga0501080_0028092 | Ga0501080_0028092_81_977 | 296 |
| 1176 | 3300049742 | Ga0501080_0058994 | Ga0501080_0058994_806_1702 | 296 |
| 1177 | 3300049742 | Ga0501080_0118905 | Ga0501080_0118905_1095_1988 | 296 |
| 1178 | 3300049742 | Ga0501080_0183106 | Ga0501080_0183106_894_1865 | 296 |
| 1179 | 3300049743 | Ga0501081_0005161 | Ga0501081_0005161_2999_3892 | 296 |
| 1180 | 3300049743 | Ga0501081_0022554 | Ga0501081_0022554_2658_3629 | 296 |
| 1181 | 3300049744 | Ga0501083_0009158 | Ga0501083_0009158_3945_4835 | 296 |
| 1182 | 3300049744 | Ga0501083_0031756 | Ga0501083_0031756_1478_2374 | 296 |
| 1183 | 3300049744 | Ga0501083_0058740 | Ga0501083_0058740_475_1371 | 296 |
| 1184 | 3300049744 | Ga0501083_0080094 | Ga0501083_0080094_889_1785 | 296 |
| 1185 | 3300049744 | Ga0501083_0136140 | Ga0501083_0136140_40_936 | 296 |
| 1186 | 3300049822 | Ga0501035_0038898 | Ga0501035_0038898_2807_3778 | 296 |
| 1187 | 3300049822 | Ga0501035_0039580 | Ga0501035_0039580_3114_4010 | 296 |
| 1188 | 3300049822 | Ga0501035_0067613 | Ga0501035_0067613_469_1359 | 296 |
| 1189 | 3300049822 | Ga0501035_0205427 | Ga0501035_0205427_95_991 | 296 |
| 1190 | 3300049822 | Ga0501035_0256786 | Ga0501035_0256786_572_1468 | 296 |
| 1191 | 3300049823 | Ga0501044_0005112 | Ga0501044_0005112_4701_5597 | 296 |
| 1192 | 3300049823 | Ga0501044_0037235 | Ga0501044_0037235_2007_2903 | 296 |
| 1193 | 3300049823 | Ga0501044_0057707 | Ga0501044_0057707_818_1714 | 296 |
| 1194 | 3300049823 | Ga0501044_0133556 | Ga0501044_0133556_1011_1907 | 296 |
| 1195 | 3300049824 | Ga0501045_0022917 | Ga0501045_0022917_2576_3547 | 296 |
| 1196 | 3300049824 | Ga0501045_0199719 | Ga0501045_0199719_409_1350 | 296 |
| 1197 | 3300050494 | nmdc:mga06z11_17026_c1 | nmdc:mga06z11_17026_c1_820_1755 | 296 |
| 1198 | 3300050494 | nmdc:mga06z11_259108_c1 | nmdc:mga06z11_259108_c1_89_979 | 296 |
| 1199 | 3300050507 | nmdc:mga05p37_16217_c1 | nmdc:mga05p37_16217_c1_1373_2308 | 296 |
| 1200 | 3300050507 | nmdc:mga05p37_248326_c1 | nmdc:mga05p37_248326_c1_682_1572 | 296 |
| 1201 | 3300050507 | nmdc:mga05p37_35915_c1 | nmdc:mga05p37_35915_c1_2965_3936 | 296 |
| 1202 | 3300050507 | nmdc:mga05p37_5080_c1 | nmdc:mga05p37_5080_c1_10062_10997 | 296 |
| 1203 | 3300050508 | nmdc:mga09592_9145_c1 | nmdc:mga09592_9145_c1_5202_6143 | 296 |
| 1204 | 3300050509 | nmdc:mga0qj67_113891_c1 | nmdc:mga0qj67_113891_c1_59_994 | 296 |
| 1205 | 3300050510 | nmdc:mga06r32_72029_c1 | nmdc:mga06r32_72029_c1_889_1830 | 296 |
| 1206 | 3300050511 | nmdc:mga08y16_1115_c1 | nmdc:mga08y16_1115_c1_8720_9610 | 296 |
| 1207 | 3300050511 | nmdc:mga08y16_146103_c1 | nmdc:mga08y16_146103_c1_132_1067 | 296 |
| 1208 | 3300050511 | nmdc:mga08y16_279183_c1 | nmdc:mga08y16_279183_c1_637_1608 | 296 |
| 1209 | 3300050511 | nmdc:mga08y16_335349_c1 | nmdc:mga08y16_335349_c1_368_1303 | 296 |
| 1210 | 3300050511 | nmdc:mga08y16_58759_c1 | nmdc:mga08y16_58759_c1_3032_3922 | 296 |
| 1211 | 3300050511 | nmdc:mga08y16_940_c1 | nmdc:mga08y16_940_c1_9411_10301 | 296 |
| 1212 | 3300050512 | nmdc:mga0n895_580510_c1 | nmdc:mga0n895_580510_c1_66_1037 | 296 |
| 1213 | 3300050512 | nmdc:mga0n895_6093_c1 | nmdc:mga0n895_6093_c1_5659_6549 | 296 |
| 1214 | 3300050512 | nmdc:mga0n895_68710_c1 | nmdc:mga0n895_68710_c1_353_1243 | 296 |
| 1215 | 3300050513 | nmdc:mga0rr50_124793_c1 | nmdc:mga0rr50_124793_c1_876_1766 | 296 |
| 1216 | 3300050513 | nmdc:mga0rr50_24181_c1 | nmdc:mga0rr50_24181_c1_2043_2933 | 296 |
| 1217 | 3300050513 | nmdc:mga0rr50_269319_c1 | nmdc:mga0rr50_269319_c1_341_1276 | 296 |
| 1218 | 3300050514 | nmdc:mga08x19_23812_c1 | nmdc:mga08x19_23812_c1_2380_3321 | 296 |
| 1219 | 3300050515 | nmdc:mga0a205_14863_c1 | nmdc:mga0a205_14863_c1_3649_4539 | 296 |
| 1220 | 3300050515 | nmdc:mga0a205_183933_c1 | nmdc:mga0a205_183933_c1_494_1384 | 296 |
| 1221 | 3300050515 | nmdc:mga0a205_213_c1 | nmdc:mga0a205_213_c1_14810_15700 | 296 |
| 1222 | 3300053077 | Ga0495601_0000004 | Ga0495601_0000004_184104_185045 | 296 |
| 1223 | 3300053077 | Ga0495601_0000347 | Ga0495601_0000347_22858_23748 | 296 |
| 1224 | 3300053077 | Ga0495601_0000993 | Ga0495601_0000993_9810_10754 | 296 |
| 1225 | 3300053077 | Ga0495601_0001303 | Ga0495601_0001303_7224_8114 | 296 |
| 1226 | 3300053078 | Ga0495612_0000008 | Ga0495612_0000008_28217_29158 | 296 |
| 1227 | 3300053078 | Ga0495612_0002372 | Ga0495612_0002372_1469_2413 | 296 |
| 1228 | 3300053078 | Ga0495612_0004290 | Ga0495612_0004290_4268_5209 | 296 |
| 1229 | 3300053078 | Ga0495612_0007390 | Ga0495612_0007390_2006_2896 | 296 |
| 1230 | 3300053078 | Ga0495612_0045915 | Ga0495612_0045915_30_920 | 296 |
| 1231 | 3300053084 | Ga0495595_0000231 | Ga0495595_0000231_9417_10358 | 296 |
| 1232 | 3300053084 | Ga0495595_0001232 | Ga0495595_0001232_4847_5788 | 296 |
| 1233 | 3300053084 | Ga0495595_0005605 | Ga0495595_0005605_1390_2280 | 296 |
| 1234 | 3300053084 | Ga0495595_0009841 | Ga0495595_0009841_1187_2077 | 296 |
| 1235 | 3300053085 | Ga0495619_0000005 | Ga0495619_0000005_264048_264989 | 296 |
| 1236 | 3300053085 | Ga0495619_0000083 | Ga0495619_0000083_43123_44013 | 296 |
| 1237 | 3300053085 | Ga0495619_0000360 | Ga0495619_0000360_10174_11064 | 296 |
| 1238 | 3300053085 | Ga0495619_0001190 | Ga0495619_0001190_15683_16624 | 296 |
| 1239 | 3300053085 | Ga0495619_0013867 | Ga0495619_0013867_1588_2532 | 296 |
| 1240 | 3300053085 | Ga0495619_0023486 | Ga0495619_0023486_1058_1948 | 296 |
| 1241 | 3300053085 | Ga0495619_0091584 | Ga0495619_0091584_251_1192 | 296 |
| 1242 | 3300053094 | Ga0500566_0122855 | Ga0500566_0122855_415_1305 | 296 |
| 1243 | 3300053096 | Ga0500641_0015864 | Ga0500641_0015864_776_1666 | 296 |
| 1244 | 3300054114 | Ga0501084_0044973 | Ga0501084_0044973_2074_3045 | 296 |
| 1245 | 3300054114 | Ga0501084_0050694 | Ga0501084_0050694_1062_1955 | 296 |
| 1246 | 3300054114 | Ga0501084_0239560 | Ga0501084_0239560_481_1377 | 296 |
| 1247 | 3300060353 | Ga0501082_0009209 | Ga0501082_0009209_5965_6855 | 296 |
| 1248 | 3300060353 | Ga0501082_0012714 | Ga0501082_0012714_4938_5831 | 296 |
| 1249 | 3300060353 | Ga0501082_0018728 | Ga0501082_0018728_2468_3439 | 296 |
| 1250 | 3300060353 | Ga0501082_0263132 | Ga0501082_0263132_377_1318 | 296 |
| 1251 | 3300061719 | Ga0466962_0079558 | Ga0466962_0079558_258_1148 | 296 |
| 1252 | 3300061734 | Ga0530510_0025912 | Ga0530510_0025912_2658_3629 | 296 |
| 1253 | 3300061734 | Ga0530510_0029751 | Ga0530510_0029751_920_1861 | 296 |
| 1254 | 3300061734 | Ga0530510_0134102 | Ga0530510_0134102_740_1675 | 296 |
| 1255 | 3300061734 | Ga0530510_0192710 | Ga0530510_0192710_481_1434 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tmx-assembly1.cif.gz_B | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.9414 | 5 | 286 |
| 1tmx-assembly1.cif.gz_B | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.913 | 5 | 286 |
| 1tmx-assembly1.cif.gz_A | crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e | 0.9074 | 5 | 286 |
| 3th1-assembly1.cif.gz_A-2 | crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida | 0.8942 | 21 | 284 |
| 3n9t-assembly1.cif.gz_A-2 | cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4 | 0.8917 | 6 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P86029_1_299_2.60.130.10 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.9171 | 7 | 285 | 2.60.130.10 |
| af_Q59Z18_7_293_2.60.130.10 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.9114 | 1 | 283 | 2.60.130.10 |
| 1tmxA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.9074 | 5 | 286 | 2.60.130.10 |
| 3th1A00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8942 | 21 | 284 | 2.60.130.10 |
| af_Q59Z18_7_293_2.60.130.10 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8935 | 1 | 283 | 2.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E8VIE8-F1-model_v4 | Catechol 1,2-dioxygenase | 0.9843 | 1 | 296 |
GO:0008199
GO:0009712 GO:0018576 |
| AF-A5VH88-F1-model_v4 | deleted | 0.9831 | 2 | 296 |
|
| AF-A0A7W5KI92-F1-model_v4 | deleted | 0.9829 | 33 | 296 |
|
| AF-A0A5E8VIE8-F1-model_v4 | Catechol 1,2-dioxygenase | 0.981 | 1 | 296 |
GO:0008199
GO:0009712 GO:0018576 |
| AF-A0A840SSC0-F1-model_v4 | Catechol 1,2-dioxygenase (EC 1.13.11.1) | 0.9741 | 2 | 296 |
GO:0008199
GO:0009712 GO:0018576 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar