F492081
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1240 | 547 | 1236 | 91 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_101275967|Ga0070707_1012759672 |
| Length | 109 |
| Sequence | MCLGIPGTIVEIDEDRPDLAKVDVSGVRRMINIGLLENEVIEPGDWILIHVGFALSKIDEEEAASAMAFLEGIGTAYEEELAALSSSQIEAGFIQAGRDIESRWAAEEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 3 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 137 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 138 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 139 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 140 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 142 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 143 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 144 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 145 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 146 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 147 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 148 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 149 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 150 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 151 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 174 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 179 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 180 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 181 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 182 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 250 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 251 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 258 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 266 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 267 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 273 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 275 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 280 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 281 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 282 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 283 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 285 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 286 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 289 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 290 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 291 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 292 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 293 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 294 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 295 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 296 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 297 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 298 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 299 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 300 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 304 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 306 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 308 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 309 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 312 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 313 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 314 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 315 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 316 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 317 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 319 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 320 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 323 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 334 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 335 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 336 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 337 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 338 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 339 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 340 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 341 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 342 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 343 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 344 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 345 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 346 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 347 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 348 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 349 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 350 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 351 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 352 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 353 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 354 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 355 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 356 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 357 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 358 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 359 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 360 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 361 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 362 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 363 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 364 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 365 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 366 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 367 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 368 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 369 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 370 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 371 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 372 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 373 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 374 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 375 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 376 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 377 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 378 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 379 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 380 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 381 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 382 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 383 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 384 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 385 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 386 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 387 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 388 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 389 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 390 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 391 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 392 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 393 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 459 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 460 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 461 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 462 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 463 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 464 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 467 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 468 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 469 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 470 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 471 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 472 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 473 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 474 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 475 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 476 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 477 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 478 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 479 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 513 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 515 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 516 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 533 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 535 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 536 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 537 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 538 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 546 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 547 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.56 |
| Metatranscriptomes | 4.11 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 4.19 |
| Rhizosphere | 90.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3941096 | 2162886012 | Unclassified | 1067 |
| 2 | MBSR1b_contig_907293 | 2162886012 | Bacteria | 940 |
| 3 | JGI24747J21853_1035595 | 3300001978 | Bacteria | 579 |
| 4 | JGI24740J21852_10106836 | 3300001979 | Bacteria | 708 |
| 5 | JGI25406J46586_10005292 | 3300003203 | Bacteria | 5986 |
| 6 | rootH1_10194767 | 3300003323 | Bacteria | 3584 |
| 7 | JGI25407J50210_10000833 | 3300003373 | Bacteria | 6609 |
| 8 | JGI25407J50210_10016676 | 3300003373 | Bacteria | 1903 |
| 9 | JGI25407J50210_10056702 | 3300003373 | Bacteria | 987 |
| 10 | JGI25407J50210_10088080 | 3300003373 | Bacteria | 769 |
| 11 | JGI25404J52841_10009969 | 3300003659 | Bacteria | 2039 |
| 12 | JGI25405J52794_10055288 | 3300003911 | Bacteria | 854 |
| 13 | Ga0058859_11645648 | 3300004798 | Bacteria | 506 |
| 14 | Ga0058863_10899516 | 3300004799 | Bacteria | 1022 |
| 15 | Ga0058863_11599248 | 3300004799 | Bacteria | 544 |
| 16 | Ga0058861_12077379 | 3300004800 | Bacteria | 730 |
| 17 | Ga0058860_11560143 | 3300004801 | Bacteria | 529 |
| 18 | Ga0058860_11738255 | 3300004801 | Bacteria | 671 |
| 19 | Ga0058860_12151675 | 3300004801 | Bacteria | 569 |
| 20 | Ga0058860_12178315 | 3300004801 | Bacteria | 1223 |
| 21 | Ga0058862_12586157 | 3300004803 | Bacteria | 1140 |
| 22 | Ga0065712_10274254 | 3300005290 | Bacteria | 909 |
| 23 | Ga0065715_10289222 | 3300005293 | Unclassified | 1067 |
| 24 | Ga0065715_10730475 | 3300005293 | Bacteria | 639 |
| 25 | Ga0070658_10331868 | 3300005327 | Bacteria | 1300 |
| 26 | Ga0070658_11303641 | 3300005327 | Bacteria | 631 |
| 27 | Ga0070676_10160328 | 3300005328 | Bacteria | 1447 |
| 28 | Ga0070676_10172052 | 3300005328 | Bacteria | 1402 |
| 29 | Ga0070676_11106245 | 3300005328 | Bacteria | 599 |
| 30 | Ga0070683_100078885 | 3300005329 | Bacteria | 3081 |
| 31 | Ga0070683_101523177 | 3300005329 | Bacteria | 643 |
| 32 | Ga0070690_100021786 | 3300005330 | Bacteria | 3916 |
| 33 | Ga0070690_100158076 | 3300005330 | Bacteria | 1551 |
| 34 | Ga0070670_100341741 | 3300005331 | Bacteria | 1314 |
| 35 | Ga0070677_10633582 | 3300005333 | Bacteria | 596 |
| 36 | Ga0068869_100200806 | 3300005334 | Bacteria | 1572 |
| 37 | Ga0068869_101409204 | 3300005334 | Bacteria | 617 |
| 38 | Ga0068869_101601707 | 3300005334 | Bacteria | 580 |
| 39 | Ga0070666_10027739 | 3300005335 | Bacteria | 3711 |
| 40 | Ga0070680_100029072 | 3300005336 | Bacteria | 4438 |
| 41 | Ga0070680_101599057 | 3300005336 | Bacteria | 565 |
| 42 | Ga0070680_101687462 | 3300005336 | Bacteria | 549 |
| 43 | Ga0070682_101357266 | 3300005337 | Bacteria | 606 |
| 44 | Ga0070682_101537110 | 3300005337 | Unclassified | 573 |
| 45 | Ga0068868_100157214 | 3300005338 | Bacteria | 1875 |
| 46 | Ga0068868_100795308 | 3300005338 | Bacteria | 853 |
| 47 | Ga0068868_101582979 | 3300005338 | Bacteria | 615 |
| 48 | Ga0068868_102259794 | 3300005338 | Bacteria | 518 |
| 49 | Ga0070660_100094455 | 3300005339 | Bacteria | 2362 |
| 50 | Ga0070689_100156161 | 3300005340 | Bacteria | 1842 |
| 51 | Ga0070689_100301426 | 3300005340 | Bacteria | 1334 |
| 52 | Ga0070691_10158041 | 3300005341 | Bacteria | 1167 |
| 53 | Ga0070691_10159590 | 3300005341 | Bacteria | 1161 |
| 54 | Ga0070687_100079062 | 3300005343 | Bacteria | 1789 |
| 55 | Ga0070687_100116027 | 3300005343 | Bacteria | 1523 |
| 56 | Ga0070661_100442954 | 3300005344 | Bacteria | 1033 |
| 57 | Ga0070661_101401537 | 3300005344 | Bacteria | 588 |
| 58 | Ga0070661_101702382 | 3300005344 | Bacteria | 534 |
| 59 | Ga0070692_10129584 | 3300005345 | Bacteria | 1416 |
| 60 | Ga0070692_10166930 | 3300005345 | Bacteria | 1266 |
| 61 | Ga0070692_10511515 | 3300005345 | Bacteria | 780 |
| 62 | Ga0070692_10964705 | 3300005345 | Bacteria | 594 |
| 63 | Ga0070668_100033387 | 3300005347 | Bacteria | 3918 |
| 64 | Ga0070668_100060524 | 3300005347 | Bacteria | 2932 |
| 65 | Ga0070668_101119947 | 3300005347 | Unclassified | 711 |
| 66 | Ga0070668_101656047 | 3300005347 | Bacteria | 587 |
| 67 | Ga0070669_100728507 | 3300005353 | Bacteria | 839 |
| 68 | Ga0070675_100008751 | 3300005354 | Bacteria | 7863 |
| 69 | Ga0070671_100126208 | 3300005355 | Bacteria | 2154 |
| 70 | Ga0070671_100195879 | 3300005355 | Bacteria | 1713 |
| 71 | Ga0070671_101053297 | 3300005355 | Bacteria | 714 |
| 72 | Ga0070674_100077219 | 3300005356 | Bacteria | 2370 |
| 73 | Ga0070673_100223684 | 3300005364 | Bacteria | 1630 |
| 74 | Ga0070673_101506029 | 3300005364 | Bacteria | 634 |
| 75 | Ga0070688_100947161 | 3300005365 | Bacteria | 681 |
| 76 | Ga0070659_100034617 | 3300005366 | Bacteria | 3929 |
| 77 | Ga0070659_100516752 | 3300005366 | Bacteria | 1019 |
| 78 | Ga0070667_100193332 | 3300005367 | Bacteria | 1803 |
| 79 | Ga0070667_100516214 | 3300005367 | Bacteria | 1096 |
| 80 | Ga0070709_10036426 | 3300005434 | Bacteria | 2997 |
| 81 | Ga0070714_100006392 | 3300005435 | Bacteria | 9097 |
| 82 | Ga0070714_100055323 | 3300005435 | Bacteria | 3391 |
| 83 | Ga0070713_100054063 | 3300005436 | Bacteria | 3330 |
| 84 | Ga0070713_100192759 | 3300005436 | Bacteria | 1837 |
| 85 | Ga0070713_100948922 | 3300005436 | Bacteria | 828 |
| 86 | Ga0070713_101863858 | 3300005436 | Bacteria | 583 |
| 87 | Ga0070710_10026356 | 3300005437 | Bacteria | 3087 |
| 88 | Ga0070710_10929638 | 3300005437 | Bacteria | 629 |
| 89 | Ga0070701_10013994 | 3300005438 | Bacteria | 3666 |
| 90 | Ga0070701_10019016 | 3300005438 | Bacteria | 3239 |
| 91 | Ga0070711_100001426 | 3300005439 | Bacteria | 13128 |
| 92 | Ga0070711_100357553 | 3300005439 | Bacteria | 1175 |
| 93 | Ga0070711_100863563 | 3300005439 | Bacteria | 770 |
| 94 | Ga0070711_101074934 | 3300005439 | Bacteria | 692 |
| 95 | Ga0070711_101173638 | 3300005439 | Unclassified | 663 |
| 96 | Ga0070711_101477800 | 3300005439 | Bacteria | 592 |
| 97 | Ga0070705_100463586 | 3300005440 | Bacteria | 953 |
| 98 | Ga0070705_100852967 | 3300005440 | Bacteria | 729 |
| 99 | Ga0070705_101439097 | 3300005440 | Unclassified | 575 |
| 100 | Ga0070700_100033958 | 3300005441 | Bacteria | 3076 |
| 101 | Ga0070694_101238563 | 3300005444 | Bacteria | 626 |
| 102 | Ga0070708_100072487 | 3300005445 | Bacteria | 3103 |
| 103 | Ga0070708_100425108 | 3300005445 | Bacteria | 1253 |
| 104 | Ga0070708_100450243 | 3300005445 | Bacteria | 1214 |
| 105 | Ga0070708_102077276 | 3300005445 | Bacteria | 526 |
| 106 | Ga0070663_100174784 | 3300005455 | Bacteria | 1662 |
| 107 | Ga0070663_100611315 | 3300005455 | Bacteria | 918 |
| 108 | Ga0070663_100618747 | 3300005455 | Bacteria | 913 |
| 109 | Ga0070678_100092333 | 3300005456 | Bacteria | 2325 |
| 110 | Ga0070678_100244244 | 3300005456 | Bacteria | 1502 |
| 111 | Ga0070678_101477888 | 3300005456 | Bacteria | 636 |
| 112 | Ga0070662_100204352 | 3300005457 | Bacteria | 1569 |
| 113 | Ga0070662_100291802 | 3300005457 | Bacteria | 1322 |
| 114 | Ga0070662_101867194 | 3300005457 | Bacteria | 519 |
| 115 | Ga0070681_10068567 | 3300005458 | Bacteria | 3513 |
| 116 | Ga0070681_10611244 | 3300005458 | Bacteria | 1004 |
| 117 | Ga0070681_10639694 | 3300005458 | Bacteria | 978 |
| 118 | Ga0070681_10694981 | 3300005458 | Bacteria | 933 |
| 119 | Ga0070681_11745870 | 3300005458 | Bacteria | 549 |
| 120 | Ga0068867_100318504 | 3300005459 | Bacteria | 1288 |
| 121 | Ga0068867_100858644 | 3300005459 | Bacteria | 814 |
| 122 | Ga0068867_101180951 | 3300005459 | Bacteria | 702 |
| 123 | Ga0068867_102217962 | 3300005459 | Unclassified | 521 |
| 124 | Ga0070685_10011703 | 3300005466 | Bacteria | 4598 |
| 125 | Ga0070685_10346031 | 3300005466 | Bacteria | 1015 |
| 126 | Ga0070685_10565146 | 3300005466 | Bacteria | 814 |
| 127 | Ga0070685_11129105 | 3300005466 | Bacteria | 593 |
| 128 | Ga0070706_100423089 | 3300005467 | Bacteria | 1240 |
| 129 | Ga0070706_100426688 | 3300005467 | Bacteria | 1234 |
| 130 | Ga0070706_100476267 | 3300005467 | Bacteria | 1161 |
| 131 | Ga0070706_101738191 | 3300005467 | Bacteria | 568 |
| 132 | Ga0070706_101747147 | 3300005467 | Bacteria | 566 |
| 133 | Ga0070707_100078604 | 3300005468 | Bacteria | 3183 |
| 134 | Ga0070707_100719183 | 3300005468 | Bacteria | 961 |
| 135 | Ga0070707_101275967 | 3300005468 | Bacteria | 701 |
| 136 | Ga0070698_100028747 | 3300005471 | Bacteria | 5771 |
| 137 | Ga0070698_100102261 | 3300005471 | Bacteria | 2836 |
| 138 | Ga0070698_100198840 | 3300005471 | Bacteria | 1940 |
| 139 | Ga0070699_100136318 | 3300005518 | Bacteria | 2165 |
| 140 | Ga0070699_100169295 | 3300005518 | Bacteria | 1935 |
| 141 | Ga0070699_100221686 | 3300005518 | Bacteria | 1685 |
| 142 | Ga0070699_101007202 | 3300005518 | Bacteria | 764 |
| 143 | Ga0070699_101677945 | 3300005518 | Unclassified | 582 |
| 144 | Ga0070699_101986071 | 3300005518 | Bacteria | 532 |
| 145 | Ga0070679_100019756 | 3300005530 | Bacteria | 6558 |
| 146 | Ga0070679_100063188 | 3300005530 | Bacteria | 3691 |
| 147 | Ga0070679_100683549 | 3300005530 | Bacteria | 969 |
| 148 | Ga0070679_100921245 | 3300005530 | Bacteria | 817 |
| 149 | Ga0070684_100116279 | 3300005535 | Bacteria | 2402 |
| 150 | Ga0070684_100726946 | 3300005535 | Bacteria | 926 |
| 151 | Ga0070697_100455830 | 3300005536 | Bacteria | 1114 |
| 152 | Ga0068853_100061482 | 3300005539 | Bacteria | 3248 |
| 153 | Ga0068853_100315627 | 3300005539 | Bacteria | 1448 |
| 154 | Ga0070672_100027866 | 3300005543 | Bacteria | 4218 |
| 155 | Ga0070672_100739761 | 3300005543 | Bacteria | 863 |
| 156 | Ga0070686_100015286 | 3300005544 | Bacteria | 4441 |
| 157 | Ga0070686_100498965 | 3300005544 | Bacteria | 944 |
| 158 | Ga0070695_100048509 | 3300005545 | Bacteria | 2715 |
| 159 | Ga0070695_100123103 | 3300005545 | Bacteria | 1777 |
| 160 | Ga0070696_100004836 | 3300005546 | Bacteria | 9004 |
| 161 | Ga0070693_100019269 | 3300005547 | Bacteria | 3573 |
| 162 | Ga0070693_101584368 | 3300005547 | Bacteria | 514 |
| 163 | Ga0070665_100503215 | 3300005548 | Bacteria | 1223 |
| 164 | Ga0070665_100996374 | 3300005548 | Bacteria | 850 |
| 165 | Ga0070665_101004512 | 3300005548 | Bacteria | 846 |
| 166 | Ga0070704_100296736 | 3300005549 | Bacteria | 1345 |
| 167 | Ga0070704_101813862 | 3300005549 | Bacteria | 564 |
| 168 | Ga0068855_100599164 | 3300005563 | Bacteria | 1188 |
| 169 | Ga0068855_101802898 | 3300005563 | Bacteria | 622 |
| 170 | Ga0068855_102495585 | 3300005563 | Bacteria | 514 |
| 171 | Ga0070664_100026709 | 3300005564 | Bacteria | 4792 |
| 172 | Ga0068857_100026603 | 3300005577 | Bacteria | 5099 |
| 173 | Ga0068857_100039067 | 3300005577 | Bacteria | 4203 |
| 174 | Ga0068854_100028549 | 3300005578 | Bacteria | 3856 |
| 175 | Ga0068854_100152768 | 3300005578 | Bacteria | 1782 |
| 176 | Ga0068856_100211973 | 3300005614 | Bacteria | 1952 |
| 177 | Ga0070702_100051134 | 3300005615 | Bacteria | 2364 |
| 178 | Ga0068852_100088656 | 3300005616 | Bacteria | 2763 |
| 179 | Ga0068852_100181073 | 3300005616 | Bacteria | 1982 |
| 180 | Ga0068852_100920473 | 3300005616 | Bacteria | 892 |
| 181 | Ga0068859_100054371 | 3300005617 | Bacteria | 4026 |
| 182 | Ga0068859_100447429 | 3300005617 | Bacteria | 1388 |
| 183 | Ga0068864_100027927 | 3300005618 | Bacteria | 4769 |
| 184 | Ga0068864_100401860 | 3300005618 | Bacteria | 1302 |
| 185 | Ga0068864_100509781 | 3300005618 | Bacteria | 1158 |
| 186 | Ga0068864_102200130 | 3300005618 | Bacteria | 558 |
| 187 | Ga0068866_10125816 | 3300005718 | Bacteria | 1451 |
| 188 | Ga0068861_100043723 | 3300005719 | Bacteria | 3364 |
| 189 | Ga0068861_100272308 | 3300005719 | Bacteria | 1454 |
| 190 | Ga0068861_100702140 | 3300005719 | Bacteria | 940 |
| 191 | Ga0068861_101345442 | 3300005719 | Bacteria | 696 |
| 192 | Ga0068851_10048255 | 3300005834 | Bacteria | 2158 |
| 193 | Ga0068851_10872544 | 3300005834 | Bacteria | 562 |
| 194 | Ga0068870_10024232 | 3300005840 | Bacteria | 3001 |
| 195 | Ga0068870_10113483 | 3300005840 | Bacteria | 1551 |
| 196 | Ga0068863_100026524 | 3300005841 | Bacteria | 5526 |
| 197 | Ga0068863_100258157 | 3300005841 | Bacteria | 1684 |
| 198 | Ga0068863_101662527 | 3300005841 | Bacteria | 648 |
| 199 | Ga0068863_102228089 | 3300005841 | Bacteria | 558 |
| 200 | Ga0068863_102721301 | 3300005841 | Bacteria | 503 |
| 201 | Ga0068858_100167892 | 3300005842 | Bacteria | 2068 |
| 202 | Ga0068860_100162837 | 3300005843 | Bacteria | 2151 |
| 203 | Ga0068860_102178642 | 3300005843 | Bacteria | 575 |
| 204 | Ga0068860_102380252 | 3300005843 | Bacteria | 550 |
| 205 | Ga0068862_100756231 | 3300005844 | Bacteria | 946 |
| 206 | Ga0081455_10005075 | 3300005937 | Bacteria | 14533 |
| 207 | Ga0081538_10000212 | 3300005981 | Bacteria | 64889 |
| 208 | Ga0081538_10000947 | 3300005981 | Bacteria | 31238 |
| 209 | Ga0081538_10006746 | 3300005981 | Bacteria | 10036 |
| 210 | Ga0081538_10015131 | 3300005981 | Bacteria | 5992 |
| 211 | Ga0081538_10015846 | 3300005981 | Bacteria | 5813 |
| 212 | Ga0081538_10021750 | 3300005981 | Bacteria | 4668 |
| 213 | Ga0081538_10049026 | 3300005981 | Bacteria | 2567 |
| 214 | Ga0081538_10113811 | 3300005981 | Bacteria | 1320 |
| 215 | Ga0081540_1000125 | 3300005983 | Bacteria | 81285 |
| 216 | Ga0081540_1030082 | 3300005983 | Bacteria | 3014 |
| 217 | Ga0081540_1252644 | 3300005983 | Bacteria | 615 |
| 218 | Ga0081540_1261816 | 3300005983 | Bacteria | 601 |
| 219 | Ga0081539_10000179 | 3300005985 | Bacteria | 149126 |
| 220 | Ga0081539_10005342 | 3300005985 | Bacteria | 13183 |
| 221 | Ga0081539_10183721 | 3300005985 | Bacteria | 979 |
| 222 | Ga0070717_10020829 | 3300006028 | Bacteria | 5162 |
| 223 | Ga0070717_10144230 | 3300006028 | Bacteria | 2056 |
| 224 | Ga0070717_10401489 | 3300006028 | Bacteria | 1231 |
| 225 | Ga0070717_11049117 | 3300006028 | Bacteria | 742 |
| 226 | Ga0070717_11049118 | 3300006028 | Bacteria | 742 |
| 227 | Ga0070717_11565935 | 3300006028 | Bacteria | 597 |
| 228 | Ga0070717_11981335 | 3300006028 | Bacteria | 525 |
| 229 | Ga0075365_10336000 | 3300006038 | Bacteria | 1064 |
| 230 | Ga0075363_100027439 | 3300006048 | Bacteria | 2920 |
| 231 | Ga0075364_10364038 | 3300006051 | Bacteria | 986 |
| 232 | Ga0075364_11159608 | 3300006051 | Bacteria | 524 |
| 233 | Ga0075432_10003415 | 3300006058 | Bacteria | 5381 |
| 234 | Ga0075432_10564123 | 3300006058 | Bacteria | 516 |
| 235 | Ga0075432_10592169 | 3300006058 | Bacteria | 506 |
| 236 | Ga0070715_10062596 | 3300006163 | Bacteria | 1638 |
| 237 | Ga0070716_100010618 | 3300006173 | Bacteria | 4622 |
| 238 | Ga0070716_100246465 | 3300006173 | Bacteria | 1214 |
| 239 | Ga0070716_100637153 | 3300006173 | Bacteria | 806 |
| 240 | Ga0070712_100497448 | 3300006175 | Bacteria | 1021 |
| 241 | Ga0070712_100647742 | 3300006175 | Bacteria | 897 |
| 242 | Ga0070712_101338183 | 3300006175 | Bacteria | 624 |
| 243 | Ga0075367_10233781 | 3300006178 | Bacteria | 1151 |
| 244 | Ga0075369_10655235 | 3300006186 | Bacteria | 504 |
| 245 | Ga0097621_100138858 | 3300006237 | Bacteria | 2075 |
| 246 | Ga0097621_101186722 | 3300006237 | Bacteria | 719 |
| 247 | Ga0075370_10171354 | 3300006353 | Bacteria | 1276 |
| 248 | Ga0075370_10592296 | 3300006353 | Bacteria | 671 |
| 249 | Ga0068871_100829597 | 3300006358 | Bacteria | 854 |
| 250 | Ga0068871_101273919 | 3300006358 | Bacteria | 691 |
| 251 | Ga0075428_100012144 | 3300006844 | Bacteria | 9581 |
| 252 | Ga0075428_100083713 | 3300006844 | Bacteria | 3480 |
| 253 | Ga0075428_100914291 | 3300006844 | Bacteria | 930 |
| 254 | Ga0075428_102677222 | 3300006844 | Bacteria | 509 |
| 255 | Ga0075430_100008071 | 3300006846 | Bacteria | 8897 |
| 256 | Ga0075430_100017068 | 3300006846 | Bacteria | 6183 |
| 257 | Ga0075430_100038408 | 3300006846 | Bacteria | 4055 |
| 258 | Ga0075431_100000246 | 3300006847 | Bacteria | 41024 |
| 259 | Ga0075431_100017656 | 3300006847 | Bacteria | 7254 |
| 260 | Ga0075431_100522370 | 3300006847 | Bacteria | 1176 |
| 261 | Ga0075433_10099639 | 3300006852 | Bacteria | 2572 |
| 262 | Ga0075433_10758212 | 3300006852 | Bacteria | 849 |
| 263 | Ga0075433_11554971 | 3300006852 | Bacteria | 571 |
| 264 | Ga0075434_101166867 | 3300006871 | Bacteria | 783 |
| 265 | Ga0075434_102378702 | 3300006871 | Bacteria | 532 |
| 266 | Ga0075429_100003454 | 3300006880 | Bacteria | 13490 |
| 267 | Ga0075429_100049390 | 3300006880 | Bacteria | 3658 |
| 268 | Ga0068865_100187050 | 3300006881 | Bacteria | 1599 |
| 269 | Ga0068865_100426121 | 3300006881 | Bacteria | 1092 |
| 270 | Ga0068865_100768273 | 3300006881 | Bacteria | 829 |
| 271 | Ga0075436_100207579 | 3300006914 | Bacteria | 1388 |
| 272 | Ga0075436_100844124 | 3300006914 | Bacteria | 683 |
| 273 | Ga0097620_100054371 | 3300006931 | Bacteria | 4026 |
| 274 | Ga0097620_100447376 | 3300006931 | Bacteria | 1388 |
| 275 | Ga0075435_100303590 | 3300007076 | Bacteria | 1365 |
| 276 | Ga0075435_100307606 | 3300007076 | Bacteria | 1356 |
| 277 | Ga0075435_100330870 | 3300007076 | Bacteria | 1305 |
| 278 | Ga0075435_100837093 | 3300007076 | Bacteria | 801 |
| 279 | Ga0105251_10018255 | 3300009011 | Bacteria | 3734 |
| 280 | Ga0105251_10085736 | 3300009011 | Bacteria | 1451 |
| 281 | Ga0105244_10099659 | 3300009036 | Bacteria | 1422 |
| 282 | Ga0105250_10240481 | 3300009092 | Bacteria | 772 |
| 283 | Ga0105240_10393500 | 3300009093 | Bacteria | 1562 |
| 284 | Ga0111539_10053806 | 3300009094 | Bacteria | 4792 |
| 285 | Ga0111539_10157593 | 3300009094 | Bacteria | 2656 |
| 286 | Ga0111539_10161724 | 3300009094 | Bacteria | 2618 |
| 287 | Ga0111539_10394425 | 3300009094 | Bacteria | 1612 |
| 288 | Ga0111539_10555773 | 3300009094 | Bacteria | 1337 |
| 289 | Ga0111539_11579225 | 3300009094 | Bacteria | 761 |
| 290 | Ga0111539_12066323 | 3300009094 | Bacteria | 661 |
| 291 | Ga0105245_10064792 | 3300009098 | Bacteria | 3303 |
| 292 | Ga0105245_10115988 | 3300009098 | Bacteria | 2497 |
| 293 | Ga0105245_10429208 | 3300009098 | Bacteria | 1326 |
| 294 | Ga0105245_10694743 | 3300009098 | Bacteria | 1050 |
| 295 | Ga0105245_11284516 | 3300009098 | Bacteria | 781 |
| 296 | Ga0105247_10105653 | 3300009101 | Bacteria | 1806 |
| 297 | Ga0105247_10124036 | 3300009101 | Bacteria | 1677 |
| 298 | Ga0114129_10146873 | 3300009147 | Bacteria | 3229 |
| 299 | Ga0114129_10173387 | 3300009147 | Bacteria | 2939 |
| 300 | Ga0114129_10304138 | 3300009147 | Bacteria | 2124 |
| 301 | Ga0114129_10448341 | 3300009147 | Bacteria | 1693 |
| 302 | Ga0114129_10916141 | 3300009147 | Bacteria | 1110 |
| 303 | Ga0114129_10956757 | 3300009147 | Bacteria | 1081 |
| 304 | Ga0114129_10982315 | 3300009147 | Bacteria | 1064 |
| 305 | Ga0114129_11311959 | 3300009147 | Bacteria | 896 |
| 306 | Ga0105243_10312695 | 3300009148 | Bacteria | 1428 |
| 307 | Ga0105243_11296439 | 3300009148 | Unclassified | 745 |
| 308 | Ga0105241_10047409 | 3300009174 | Bacteria | 3267 |
| 309 | Ga0105241_10395807 | 3300009174 | Unclassified | 1210 |
| 310 | Ga0105241_11927088 | 3300009174 | Bacteria | 580 |
| 311 | Ga0105241_12320882 | 3300009174 | Bacteria | 534 |
| 312 | Ga0105242_10131871 | 3300009176 | Bacteria | 2158 |
| 313 | Ga0105248_10055968 | 3300009177 | Bacteria | 4424 |
| 314 | Ga0105248_10305272 | 3300009177 | Bacteria | 1792 |
| 315 | Ga0105248_10318407 | 3300009177 | Bacteria | 1752 |
| 316 | Ga0105237_11010517 | 3300009545 | Bacteria | 838 |
| 317 | Ga0105237_11079414 | 3300009545 | Bacteria | 810 |
| 318 | Ga0105237_11300885 | 3300009545 | Bacteria | 733 |
| 319 | Ga0105238_10024849 | 3300009551 | Bacteria | 6106 |
| 320 | Ga0105238_10186972 | 3300009551 | Bacteria | 2048 |
| 321 | Ga0105238_10479500 | 3300009551 | Bacteria | 1243 |
| 322 | Ga0105238_11264875 | 3300009551 | Bacteria | 763 |
| 323 | Ga0105238_11354494 | 3300009551 | Bacteria | 738 |
| 324 | Ga0105249_10013769 | 3300009553 | Bacteria | 7144 |
| 325 | Ga0105249_10188458 | 3300009553 | Bacteria | 2012 |
| 326 | Ga0105249_10772584 | 3300009553 | Bacteria | 1024 |
| 327 | Ga0105249_10859814 | 3300009553 | Bacteria | 973 |
| 328 | Ga0105249_11096500 | 3300009553 | Bacteria | 866 |
| 329 | Ga0105249_13526288 | 3300009553 | Bacteria | 504 |
| 330 | Ga0105239_10797698 | 3300010375 | Bacteria | 1082 |
| 331 | Ga0105239_10821910 | 3300010375 | Bacteria | 1065 |
| 332 | Ga0105239_11112190 | 3300010375 | Bacteria | 910 |
| 333 | Ga0105239_11381293 | 3300010375 | Bacteria | 813 |
| 334 | Ga0105239_12968151 | 3300010375 | Bacteria | 553 |
| 335 | Ga0105239_12980143 | 3300010375 | Bacteria | 552 |
| 336 | Ga0105239_13620492 | 3300010375 | Bacteria | 502 |
| 337 | Ga0105246_10073676 | 3300011119 | Bacteria | 2411 |
| 338 | Ga0105246_10311226 | 3300011119 | Bacteria | 1276 |
| 339 | Ga0105246_10319735 | 3300011119 | Bacteria | 1261 |
| 340 | Ga0105246_11113452 | 3300011119 | Bacteria | 722 |
| 341 | Ga0157344_1001452 | 3300012476 | Bacteria | 1131 |
| 342 | Ga0157328_1006624 | 3300012478 | Bacteria | 710 |
| 343 | Ga0157320_1004341 | 3300012481 | Bacteria | 901 |
| 344 | Ga0157318_1002382 | 3300012482 | Bacteria | 1018 |
| 345 | Ga0157337_1012173 | 3300012483 | Bacteria | 690 |
| 346 | Ga0157321_1001536 | 3300012487 | Bacteria | 1190 |
| 347 | Ga0157321_1001672 | 3300012487 | Bacteria | 1161 |
| 348 | Ga0157329_1010619 | 3300012491 | Bacteria | 724 |
| 349 | Ga0157335_1000732 | 3300012492 | Bacteria | 1601 |
| 350 | Ga0157341_1001329 | 3300012494 | Bacteria | 1478 |
| 351 | Ga0157319_1005116 | 3300012497 | Bacteria | 890 |
| 352 | Ga0157345_1004555 | 3300012498 | Bacteria | 1044 |
| 353 | Ga0157339_1029903 | 3300012505 | Bacteria | 631 |
| 354 | Ga0157339_1042471 | 3300012505 | Bacteria | 575 |
| 355 | Ga0157342_1034889 | 3300012507 | Bacteria | 650 |
| 356 | Ga0157316_1054880 | 3300012510 | Bacteria | 561 |
| 357 | Ga0157326_1007534 | 3300012513 | Bacteria | 1177 |
| 358 | Ga0157326_1011009 | 3300012513 | Bacteria | 1015 |
| 359 | Ga0154016_118101 | 3300013045 | Bacteria | 538 |
| 360 | Ga0154012_168450 | 3300013059 | Bacteria | 2407 |
| 361 | Ga0157373_10059673 | 3300013100 | Bacteria | 2703 |
| 362 | Ga0157371_10040069 | 3300013102 | Bacteria | 3348 |
| 363 | Ga0157371_10425723 | 3300013102 | Bacteria | 974 |
| 364 | Ga0157370_10215352 | 3300013104 | Bacteria | 1780 |
| 365 | Ga0157369_10676920 | 3300013105 | Bacteria | 1063 |
| 366 | Ga0157374_11165652 | 3300013296 | Bacteria | 792 |
| 367 | Ga0157374_12329021 | 3300013296 | Bacteria | 563 |
| 368 | Ga0157374_12591812 | 3300013296 | Bacteria | 535 |
| 369 | Ga0157378_10367541 | 3300013297 | Bacteria | 1409 |
| 370 | Ga0157378_11645108 | 3300013297 | Bacteria | 688 |
| 371 | Ga0163162_10081706 | 3300013306 | Bacteria | 3302 |
| 372 | Ga0163162_10431206 | 3300013306 | Bacteria | 1450 |
| 373 | Ga0163162_13309803 | 3300013306 | Bacteria | 516 |
| 374 | Ga0157372_10150306 | 3300013307 | Bacteria | 2688 |
| 375 | Ga0157372_11362142 | 3300013307 | Bacteria | 818 |
| 376 | Ga0157372_11762408 | 3300013307 | Bacteria | 712 |
| 377 | Ga0157375_10252686 | 3300013308 | Bacteria | 1924 |
| 378 | Ga0157375_10353462 | 3300013308 | Bacteria | 1635 |
| 379 | Ga0157375_10575080 | 3300013308 | Bacteria | 1287 |
| 380 | Ga0157375_11026372 | 3300013308 | Bacteria | 963 |
| 381 | Ga0163163_10080375 | 3300014325 | Bacteria | 3260 |
| 382 | Ga0163163_10199818 | 3300014325 | Bacteria | 2047 |
| 383 | Ga0163163_10544726 | 3300014325 | Bacteria | 1223 |
| 384 | Ga0163163_11259353 | 3300014325 | Bacteria | 802 |
| 385 | Ga0157380_10162222 | 3300014326 | Bacteria | 1944 |
| 386 | Ga0157380_10299943 | 3300014326 | Bacteria | 1480 |
| 387 | Ga0157380_10744554 | 3300014326 | Bacteria | 991 |
| 388 | Ga0157380_11091886 | 3300014326 | Bacteria | 836 |
| 389 | Ga0182008_10246229 | 3300014497 | Bacteria | 921 |
| 390 | Ga0182008_10260871 | 3300014497 | Bacteria | 896 |
| 391 | Ga0157377_10021726 | 3300014745 | Bacteria | 3380 |
| 392 | Ga0157377_10954972 | 3300014745 | Bacteria | 645 |
| 393 | Ga0157379_10955709 | 3300014968 | Bacteria | 815 |
| 394 | Ga0157376_10328465 | 3300014969 | Bacteria | 1456 |
| 395 | Ga0182005_1085550 | 3300015265 | Bacteria | 874 |
| 396 | Ga0163161_10028629 | 3300017792 | Bacteria | 3957 |
| 397 | Ga0163161_11140830 | 3300017792 | Bacteria | 672 |
| 398 | Ga0197907_10062224 | 3300020069 | Bacteria | 522 |
| 399 | Ga0197907_10589343 | 3300020069 | Bacteria | 7139 |
| 400 | Ga0197907_10600103 | 3300020069 | Bacteria | 1054 |
| 401 | Ga0197907_10771716 | 3300020069 | Bacteria | 1288 |
| 402 | Ga0197907_10917418 | 3300020069 | Bacteria | 2203 |
| 403 | Ga0206356_10151201 | 3300020070 | Bacteria | 3411 |
| 404 | Ga0206356_10756000 | 3300020070 | Bacteria | 934 |
| 405 | Ga0206356_11021398 | 3300020070 | Bacteria | 700 |
| 406 | Ga0206356_11659164 | 3300020070 | Bacteria | 723 |
| 407 | Ga0206349_1167587 | 3300020075 | Bacteria | 537 |
| 408 | Ga0206355_1486302 | 3300020076 | Bacteria | 936 |
| 409 | Ga0206355_1647528 | 3300020076 | Bacteria | 1326 |
| 410 | Ga0206352_11247908 | 3300020078 | Bacteria | 794 |
| 411 | Ga0206352_11337198 | 3300020078 | Bacteria | 2126 |
| 412 | Ga0206350_10512250 | 3300020080 | Bacteria | 1547 |
| 413 | Ga0206350_10550630 | 3300020080 | Bacteria | 1609 |
| 414 | Ga0206350_10991633 | 3300020080 | Bacteria | 532 |
| 415 | Ga0206350_11266182 | 3300020080 | Bacteria | 1131 |
| 416 | Ga0206354_10260094 | 3300020081 | Bacteria | 1198 |
| 417 | Ga0206353_10778556 | 3300020082 | Bacteria | 912 |
| 418 | Ga0206353_10908020 | 3300020082 | Bacteria | 561 |
| 419 | Ga0206353_11681707 | 3300020082 | Bacteria | 729 |
| 420 | Ga0213873_10079077 | 3300021358 | Bacteria | 918 |
| 421 | Ga0213873_10150173 | 3300021358 | Bacteria | 701 |
| 422 | Ga0213876_10120256 | 3300021384 | Bacteria | 1394 |
| 423 | Ga0213875_10000287 | 3300021388 | Bacteria | 48929 |
| 424 | Ga0213875_10002379 | 3300021388 | Bacteria | 11316 |
| 425 | Ga0213875_10143022 | 3300021388 | Bacteria | 1120 |
| 426 | Ga0213875_10343934 | 3300021388 | Bacteria | 708 |
| 427 | Ga0213871_10115050 | 3300021441 | Bacteria | 798 |
| 428 | Ga0213871_10200801 | 3300021441 | Unclassified | 622 |
| 429 | Ga0224712_10174171 | 3300022467 | Bacteria | 966 |
| 430 | Ga0224712_10254322 | 3300022467 | Bacteria | 812 |
| 431 | Ga0224712_10489968 | 3300022467 | Bacteria | 593 |
| 432 | Ga0224712_10503000 | 3300022467 | Bacteria | 586 |
| 433 | Ga0224712_10601044 | 3300022467 | Bacteria | 537 |
| 434 | Ga0207656_10278524 | 3300025321 | Bacteria | 824 |
| 435 | Ga0207713_1141770 | 3300025735 | Bacteria | 784 |
| 436 | Ga0207653_10005525 | 3300025885 | Bacteria | 3947 |
| 437 | Ga0207682_10419999 | 3300025893 | Bacteria | 632 |
| 438 | Ga0207692_10051175 | 3300025898 | Bacteria | 2093 |
| 439 | Ga0207692_10202706 | 3300025898 | Bacteria | 1167 |
| 440 | Ga0207642_10043317 | 3300025899 | Bacteria | 1984 |
| 441 | Ga0207710_10322946 | 3300025900 | Bacteria | 783 |
| 442 | Ga0207710_10482988 | 3300025900 | Bacteria | 642 |
| 443 | Ga0207688_10023261 | 3300025901 | Bacteria | 3392 |
| 444 | Ga0207688_10172938 | 3300025901 | Bacteria | 1285 |
| 445 | Ga0207688_10184011 | 3300025901 | Bacteria | 1247 |
| 446 | Ga0207680_10257363 | 3300025903 | Bacteria | 1207 |
| 447 | Ga0207647_10297266 | 3300025904 | Bacteria | 920 |
| 448 | Ga0207647_10361474 | 3300025904 | Bacteria | 821 |
| 449 | Ga0207685_10082938 | 3300025905 | Bacteria | 1331 |
| 450 | Ga0207685_10518598 | 3300025905 | Bacteria | 630 |
| 451 | Ga0207699_10021404 | 3300025906 | Bacteria | 3484 |
| 452 | Ga0207699_10137991 | 3300025906 | Bacteria | 1599 |
| 453 | Ga0207699_10190074 | 3300025906 | Bacteria | 1385 |
| 454 | Ga0207699_11336195 | 3300025906 | Bacteria | 530 |
| 455 | Ga0207645_10024982 | 3300025907 | Bacteria | 3870 |
| 456 | Ga0207643_10022011 | 3300025908 | Bacteria | 3508 |
| 457 | Ga0207643_10169114 | 3300025908 | Bacteria | 1318 |
| 458 | Ga0207705_10052746 | 3300025909 | Bacteria | 2929 |
| 459 | Ga0207684_10337153 | 3300025910 | Bacteria | 1299 |
| 460 | Ga0207684_10374096 | 3300025910 | Bacteria | 1226 |
| 461 | Ga0207684_10838960 | 3300025910 | Bacteria | 775 |
| 462 | Ga0207684_11166818 | 3300025910 | Bacteria | 639 |
| 463 | Ga0207654_10193483 | 3300025911 | Bacteria | 1335 |
| 464 | Ga0207707_10019452 | 3300025912 | Bacteria | 5928 |
| 465 | Ga0207707_10433096 | 3300025912 | Bacteria | 1126 |
| 466 | Ga0207707_10568362 | 3300025912 | Bacteria | 962 |
| 467 | Ga0207707_10859034 | 3300025912 | Bacteria | 752 |
| 468 | Ga0207707_10913937 | 3300025912 | Bacteria | 725 |
| 469 | Ga0207671_10837532 | 3300025914 | Bacteria | 729 |
| 470 | Ga0207671_11476763 | 3300025914 | Bacteria | 525 |
| 471 | Ga0207693_10083464 | 3300025915 | Bacteria | 2503 |
| 472 | Ga0207693_11104438 | 3300025915 | Bacteria | 602 |
| 473 | Ga0207693_11407296 | 3300025915 | Bacteria | 518 |
| 474 | Ga0207663_10002343 | 3300025916 | Bacteria | 9098 |
| 475 | Ga0207663_10055972 | 3300025916 | Bacteria | 2477 |
| 476 | Ga0207663_10188479 | 3300025916 | Bacteria | 1479 |
| 477 | Ga0207663_10285881 | 3300025916 | Bacteria | 1227 |
| 478 | Ga0207663_11731693 | 3300025916 | Bacteria | 503 |
| 479 | Ga0207660_10822083 | 3300025917 | Bacteria | 758 |
| 480 | Ga0207660_11056137 | 3300025917 | Bacteria | 662 |
| 481 | Ga0207662_10008902 | 3300025918 | Bacteria | 5506 |
| 482 | Ga0207657_10010851 | 3300025919 | Bacteria | 9064 |
| 483 | Ga0207649_10047085 | 3300025920 | Bacteria | 2652 |
| 484 | Ga0207649_10757696 | 3300025920 | Bacteria | 756 |
| 485 | Ga0207652_10059326 | 3300025921 | Bacteria | 3298 |
| 486 | Ga0207652_10079514 | 3300025921 | Bacteria | 2864 |
| 487 | Ga0207652_10429524 | 3300025921 | Bacteria | 1191 |
| 488 | Ga0207646_10563090 | 3300025922 | Bacteria | 1024 |
| 489 | Ga0207646_11117306 | 3300025922 | Bacteria | 693 |
| 490 | Ga0207646_11307934 | 3300025922 | Bacteria | 633 |
| 491 | Ga0207694_10206350 | 3300025924 | Bacteria | 1600 |
| 492 | Ga0207694_10276150 | 3300025924 | Bacteria | 1379 |
| 493 | Ga0207694_10577387 | 3300025924 | Bacteria | 945 |
| 494 | Ga0207694_11236932 | 3300025924 | Bacteria | 632 |
| 495 | Ga0207650_10028329 | 3300025925 | Bacteria | 4015 |
| 496 | Ga0207659_10320733 | 3300025926 | Bacteria | 1278 |
| 497 | Ga0207687_10037346 | 3300025927 | Bacteria | 3313 |
| 498 | Ga0207687_10119070 | 3300025927 | Bacteria | 1972 |
| 499 | Ga0207687_10617870 | 3300025927 | Bacteria | 915 |
| 500 | Ga0207687_10701226 | 3300025927 | Bacteria | 859 |
| 501 | Ga0207687_11198204 | 3300025927 | Bacteria | 653 |
| 502 | Ga0207700_10003084 | 3300025928 | Bacteria | 9617 |
| 503 | Ga0207700_10008397 | 3300025928 | Bacteria | 6396 |
| 504 | Ga0207700_10103401 | 3300025928 | Bacteria | 2277 |
| 505 | Ga0207700_10116091 | 3300025928 | Bacteria | 2162 |
| 506 | Ga0207700_10176926 | 3300025928 | Bacteria | 1784 |
| 507 | Ga0207664_10002753 | 3300025929 | Bacteria | 11671 |
| 508 | Ga0207664_10026416 | 3300025929 | Bacteria | 4388 |
| 509 | Ga0207664_10063610 | 3300025929 | Bacteria | 2949 |
| 510 | Ga0207664_10090973 | 3300025929 | Bacteria | 2501 |
| 511 | Ga0207664_10282636 | 3300025929 | Bacteria | 1456 |
| 512 | Ga0207644_10043226 | 3300025931 | Bacteria | 3196 |
| 513 | Ga0207644_11026482 | 3300025931 | Bacteria | 692 |
| 514 | Ga0207690_10253540 | 3300025932 | Bacteria | 1360 |
| 515 | Ga0207690_10511687 | 3300025932 | Bacteria | 972 |
| 516 | Ga0207706_10012770 | 3300025933 | Bacteria | 7645 |
| 517 | Ga0207706_10048071 | 3300025933 | Bacteria | 3774 |
| 518 | Ga0207706_11219651 | 3300025933 | Bacteria | 624 |
| 519 | Ga0207706_11303192 | 3300025933 | Bacteria | 600 |
| 520 | Ga0207686_11372257 | 3300025934 | Bacteria | 581 |
| 521 | Ga0207709_10024317 | 3300025935 | Bacteria | 3458 |
| 522 | Ga0207709_11051138 | 3300025935 | Bacteria | 667 |
| 523 | Ga0207670_10160518 | 3300025936 | Bacteria | 1677 |
| 524 | Ga0207670_11249769 | 3300025936 | Bacteria | 629 |
| 525 | Ga0207669_10124215 | 3300025937 | Bacteria | 1759 |
| 526 | Ga0207669_10167788 | 3300025937 | Bacteria | 1559 |
| 527 | Ga0207669_11089734 | 3300025937 | Bacteria | 674 |
| 528 | Ga0207669_11359742 | 3300025937 | Bacteria | 604 |
| 529 | Ga0207704_10302887 | 3300025938 | Bacteria | 1225 |
| 530 | Ga0207704_10336036 | 3300025938 | Bacteria | 1171 |
| 531 | Ga0207704_10710173 | 3300025938 | Bacteria | 833 |
| 532 | Ga0207704_11625475 | 3300025938 | Bacteria | 555 |
| 533 | Ga0207665_10025970 | 3300025939 | Bacteria | 3864 |
| 534 | Ga0207665_10131467 | 3300025939 | Bacteria | 1777 |
| 535 | Ga0207665_10508859 | 3300025939 | Bacteria | 931 |
| 536 | Ga0207691_10033856 | 3300025940 | Bacteria | 4756 |
| 537 | Ga0207691_10385097 | 3300025940 | Bacteria | 1197 |
| 538 | Ga0207691_10758526 | 3300025940 | Bacteria | 817 |
| 539 | Ga0207711_10190803 | 3300025941 | Bacteria | 1867 |
| 540 | Ga0207711_10483241 | 3300025941 | Bacteria | 1154 |
| 541 | Ga0207711_10556045 | 3300025941 | Bacteria | 1070 |
| 542 | Ga0207711_10612788 | 3300025941 | Bacteria | 1016 |
| 543 | Ga0207689_10035855 | 3300025942 | Bacteria | 4118 |
| 544 | Ga0207689_10040929 | 3300025942 | Bacteria | 3834 |
| 545 | Ga0207661_11836559 | 3300025944 | Bacteria | 552 |
| 546 | Ga0207679_10751108 | 3300025945 | Bacteria | 887 |
| 547 | Ga0207667_10946181 | 3300025949 | Bacteria | 851 |
| 548 | Ga0207651_10193251 | 3300025960 | Bacteria | 1625 |
| 549 | Ga0207651_10505767 | 3300025960 | Bacteria | 1045 |
| 550 | Ga0207651_11297176 | 3300025960 | Bacteria | 655 |
| 551 | Ga0207712_10055319 | 3300025961 | Bacteria | 2791 |
| 552 | Ga0207712_10375322 | 3300025961 | Bacteria | 1189 |
| 553 | Ga0207668_10056825 | 3300025972 | Bacteria | 2727 |
| 554 | Ga0207668_10065230 | 3300025972 | Bacteria | 2577 |
| 555 | Ga0207668_10094577 | 3300025972 | Bacteria | 2204 |
| 556 | Ga0207668_10585122 | 3300025972 | Unclassified | 971 |
| 557 | Ga0207668_10783903 | 3300025972 | Bacteria | 843 |
| 558 | Ga0207640_10251188 | 3300025981 | Bacteria | 1373 |
| 559 | Ga0207658_10018375 | 3300025986 | Bacteria | 4828 |
| 560 | Ga0207658_10083168 | 3300025986 | Bacteria | 2460 |
| 561 | Ga0207677_10194477 | 3300026023 | Bacteria | 1607 |
| 562 | Ga0207677_10759838 | 3300026023 | Bacteria | 865 |
| 563 | Ga0207703_10055288 | 3300026035 | Bacteria | 3229 |
| 564 | Ga0207703_10812590 | 3300026035 | Bacteria | 893 |
| 565 | Ga0207703_12079678 | 3300026035 | Bacteria | 544 |
| 566 | Ga0207639_11353182 | 3300026041 | Bacteria | 668 |
| 567 | Ga0207678_10004755 | 3300026067 | Bacteria | 12199 |
| 568 | Ga0207678_10170136 | 3300026067 | Bacteria | 1860 |
| 569 | Ga0207678_10457647 | 3300026067 | Bacteria | 1110 |
| 570 | Ga0207708_10023470 | 3300026075 | Bacteria | 4663 |
| 571 | Ga0207708_11020813 | 3300026075 | Unclassified | 719 |
| 572 | Ga0207702_10062363 | 3300026078 | Bacteria | 3183 |
| 573 | Ga0207702_11951081 | 3300026078 | Bacteria | 578 |
| 574 | Ga0207702_12234160 | 3300026078 | Bacteria | 536 |
| 575 | Ga0207641_10291425 | 3300026088 | Bacteria | 1538 |
| 576 | Ga0207641_10574458 | 3300026088 | Bacteria | 1102 |
| 577 | Ga0207648_10335248 | 3300026089 | Bacteria | 1361 |
| 578 | Ga0207648_10368350 | 3300026089 | Bacteria | 1297 |
| 579 | Ga0207648_10759156 | 3300026089 | Bacteria | 901 |
| 580 | Ga0207676_10065958 | 3300026095 | Bacteria | 2884 |
| 581 | Ga0207676_10141666 | 3300026095 | Bacteria | 2059 |
| 582 | Ga0207676_10167283 | 3300026095 | Bacteria | 1912 |
| 583 | Ga0207676_10249835 | 3300026095 | Bacteria | 1596 |
| 584 | Ga0207676_10971899 | 3300026095 | Bacteria | 836 |
| 585 | Ga0207674_10003916 | 3300026116 | Bacteria | 18112 |
| 586 | Ga0207674_10014777 | 3300026116 | Bacteria | 8611 |
| 587 | Ga0207674_11205013 | 3300026116 | Bacteria | 727 |
| 588 | Ga0207675_100002273 | 3300026118 | Bacteria | 19097 |
| 589 | Ga0207675_100014841 | 3300026118 | Bacteria | 7271 |
| 590 | Ga0207675_100596371 | 3300026118 | Bacteria | 1107 |
| 591 | Ga0207675_100667383 | 3300026118 | Bacteria | 1047 |
| 592 | Ga0207683_10002629 | 3300026121 | Bacteria | 15702 |
| 593 | Ga0207683_10286074 | 3300026121 | Bacteria | 1507 |
| 594 | Ga0207698_10136783 | 3300026142 | Bacteria | 2103 |
| 595 | Ga0207698_10228086 | 3300026142 | Bacteria | 1689 |
| 596 | Ga0207698_10880820 | 3300026142 | Bacteria | 902 |
| 597 | Ga0207698_11293937 | 3300026142 | Bacteria | 744 |
| 598 | Ga0207428_10001336 | 3300027907 | Bacteria | 26222 |
| 599 | Ga0207428_10581183 | 3300027907 | Bacteria | 808 |
| 600 | Ga0207428_10927328 | 3300027907 | Bacteria | 614 |
| 601 | Ga0265357_1013765 | 3300028023 | Bacteria | 843 |
| 602 | Ga0268266_10215026 | 3300028379 | Bacteria | 1764 |
| 603 | Ga0268266_10406341 | 3300028379 | Bacteria | 1288 |
| 604 | Ga0268266_11248177 | 3300028379 | Unclassified | 718 |
| 605 | Ga0268266_11677443 | 3300028379 | Bacteria | 611 |
| 606 | Ga0268265_10704499 | 3300028380 | Bacteria | 976 |
| 607 | Ga0268265_11084822 | 3300028380 | Bacteria | 794 |
| 608 | Ga0268265_11147400 | 3300028380 | Bacteria | 773 |
| 609 | Ga0268264_10359495 | 3300028381 | Bacteria | 1388 |
| 610 | Ga0268264_10685510 | 3300028381 | Bacteria | 1017 |
| 611 | Ga0268264_12284514 | 3300028381 | Bacteria | 548 |
| 612 | Ga0265334_10024295 | 3300028573 | Bacteria | 2460 |
| 613 | Ga0307515_10234593 | 3300028794 | Bacteria | 1619 |
| 614 | Ga0265338_10010522 | 3300028800 | Bacteria | 10820 |
| 615 | Ga0307511_10000212 | 3300030521 | Bacteria | 59189 |
| 616 | Ga0307511_10088246 | 3300030521 | Bacteria | 2123 |
| 617 | Ga0265762_1092595 | 3300030760 | Bacteria | 661 |
| 618 | Ga0265762_1137384 | 3300030760 | Bacteria | 572 |
| 619 | Ga0265763_1002351 | 3300030763 | Bacteria | 1446 |
| 620 | Ga0265767_105926 | 3300030836 | Bacteria | 751 |
| 621 | Ga0265766_1001087 | 3300030863 | Bacteria | 1311 |
| 622 | Ga0265768_101295 | 3300030963 | Bacteria | 1149 |
| 623 | Ga0265773_1000888 | 3300031018 | Bacteria | 1423 |
| 624 | Ga0265320_10011837 | 3300031240 | Bacteria | 5112 |
| 625 | Ga0265325_10011636 | 3300031241 | Bacteria | 5053 |
| 626 | Ga0265329_10041183 | 3300031242 | Bacteria | 1482 |
| 627 | Ga0265340_10015634 | 3300031247 | Bacteria | 3941 |
| 628 | Ga0265339_10003699 | 3300031249 | Bacteria | 10671 |
| 629 | Ga0265331_10484126 | 3300031250 | Unclassified | 556 |
| 630 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 631 | Ga0307513_10006720 | 3300031456 | Bacteria | 15013 |
| 632 | Ga0307408_100008957 | 3300031548 | Bacteria | 6610 |
| 633 | Ga0307408_100019064 | 3300031548 | Bacteria | 4616 |
| 634 | Ga0307408_100217991 | 3300031548 | Bacteria | 1555 |
| 635 | Ga0307408_101083270 | 3300031548 | Bacteria | 742 |
| 636 | Ga0265313_10077855 | 3300031595 | Bacteria | 1513 |
| 637 | Ga0316579_10101216 | 3300031691 | Bacteria | 1380 |
| 638 | Ga0265314_10010164 | 3300031711 | Bacteria | 7885 |
| 639 | Ga0265342_10071088 | 3300031712 | Bacteria | 2029 |
| 640 | Ga0307405_10025197 | 3300031731 | Bacteria | 3410 |
| 641 | Ga0307405_10090349 | 3300031731 | Bacteria | 2026 |
| 642 | Ga0307405_10139218 | 3300031731 | Bacteria | 1689 |
| 643 | Ga0307405_10763750 | 3300031731 | Bacteria | 806 |
| 644 | Ga0307405_11174205 | 3300031731 | Bacteria | 663 |
| 645 | Ga0316577_10175745 | 3300031733 | Bacteria | 1209 |
| 646 | Ga0307413_10020604 | 3300031824 | Bacteria | 3511 |
| 647 | Ga0307413_10057908 | 3300031824 | Bacteria | 2372 |
| 648 | Ga0307413_11317294 | 3300031824 | Bacteria | 632 |
| 649 | Ga0307410_10004986 | 3300031852 | Bacteria | 6963 |
| 650 | Ga0307410_10069920 | 3300031852 | Bacteria | 2430 |
| 651 | Ga0307410_10571537 | 3300031852 | Bacteria | 939 |
| 652 | Ga0307410_11037091 | 3300031852 | Bacteria | 709 |
| 653 | Ga0307410_11168073 | 3300031852 | Bacteria | 669 |
| 654 | Ga0307406_10127083 | 3300031901 | Bacteria | 1783 |
| 655 | Ga0307406_10229811 | 3300031901 | Bacteria | 1384 |
| 656 | Ga0307406_10244303 | 3300031901 | Bacteria | 1348 |
| 657 | Ga0307406_10252465 | 3300031901 | Bacteria | 1329 |
| 658 | Ga0307406_10860565 | 3300031901 | Bacteria | 769 |
| 659 | Ga0307406_10920514 | 3300031901 | Bacteria | 745 |
| 660 | Ga0307406_11421424 | 3300031901 | Bacteria | 608 |
| 661 | Ga0307407_10004283 | 3300031903 | Bacteria | 6024 |
| 662 | Ga0307407_10137462 | 3300031903 | Bacteria | 1572 |
| 663 | Ga0307407_10214977 | 3300031903 | Bacteria | 1296 |
| 664 | Ga0307407_10350275 | 3300031903 | Bacteria | 1045 |
| 665 | Ga0307407_11474433 | 3300031903 | Bacteria | 537 |
| 666 | Ga0307412_10153876 | 3300031911 | Bacteria | 1700 |
| 667 | Ga0307412_10432161 | 3300031911 | Bacteria | 1080 |
| 668 | Ga0307412_10539889 | 3300031911 | Bacteria | 977 |
| 669 | Ga0307412_11130256 | 3300031911 | Bacteria | 698 |
| 670 | Ga0307409_100006641 | 3300031995 | Bacteria | 6826 |
| 671 | Ga0307409_100022131 | 3300031995 | Bacteria | 4375 |
| 672 | Ga0307409_100051560 | 3300031995 | Bacteria | 3149 |
| 673 | Ga0307409_100108333 | 3300031995 | Bacteria | 2323 |
| 674 | Ga0307409_100154335 | 3300031995 | Bacteria | 1998 |
| 675 | Ga0307409_100609978 | 3300031995 | Bacteria | 1079 |
| 676 | Ga0307416_100082530 | 3300032002 | Bacteria | 2723 |
| 677 | Ga0307416_100167011 | 3300032002 | Bacteria | 2042 |
| 678 | Ga0307416_100441418 | 3300032002 | Bacteria | 1351 |
| 679 | Ga0307416_101163551 | 3300032002 | Bacteria | 877 |
| 680 | Ga0307416_101554318 | 3300032002 | Bacteria | 767 |
| 681 | Ga0307414_10107170 | 3300032004 | Bacteria | 2117 |
| 682 | Ga0307414_10212664 | 3300032004 | Bacteria | 1582 |
| 683 | Ga0307414_10821594 | 3300032004 | Bacteria | 848 |
| 684 | Ga0307414_11132289 | 3300032004 | Bacteria | 723 |
| 685 | Ga0307414_11934555 | 3300032004 | Bacteria | 550 |
| 686 | Ga0307411_10025146 | 3300032005 | Bacteria | 3562 |
| 687 | Ga0307411_10134400 | 3300032005 | Bacteria | 1813 |
| 688 | Ga0307411_10188023 | 3300032005 | Bacteria | 1574 |
| 689 | Ga0307411_10435782 | 3300032005 | Bacteria | 1092 |
| 690 | Ga0307411_11661178 | 3300032005 | Bacteria | 590 |
| 691 | Ga0307415_100011821 | 3300032126 | Bacteria | 5017 |
| 692 | Ga0307415_100581803 | 3300032126 | Bacteria | 993 |
| 693 | Ga0307415_100898092 | 3300032126 | Bacteria | 816 |
| 694 | Ga0307415_101155936 | 3300032126 | Bacteria | 727 |
| 695 | Ga0316583_10040852 | 3300032133 | Bacteria | 1642 |
| 696 | Ga0307507_10000329 | 3300033179 | Bacteria | 96032 |
| 697 | Ga0307507_10085237 | 3300033179 | Bacteria | 2749 |
| 698 | Ga0316215_1017545 | 3300033544 | Bacteria | 723 |
| 699 | Ga0316214_1002972 | 3300033545 | Bacteria | 2115 |
| 700 | Ga0316214_1008567 | 3300033545 | Bacteria | 1377 |
| 701 | Ga0316212_1006199 | 3300033547 | Bacteria | 1736 |
| 702 | Ga0373930_0030062 | 3300034816 | Bacteria | 1113 |
| 703 | Ga0373950_0062746 | 3300034818 | Bacteria | 749 |
| 704 | Ga0373959_0014093 | 3300034820 | Bacteria | 1451 |
| 705 | Ga0373938_0004895 | 3300034957 | Bacteria | 2255 |
| 706 | Ga0373926_0001004 | 3300035083 | Bacteria | 8245 |
| 707 | Ga0373926_0105762 | 3300035083 | Bacteria | 1055 |
| 708 | Ga0373929_0027832 | 3300035085 | Bacteria | 1190 |
| 709 | Ga0373934_0005441 | 3300035086 | Bacteria | 4718 |
| 710 | Ga0373940_0207423 | 3300035088 | Bacteria | 646 |
| 711 | Ga0373944_0006255 | 3300035089 | Bacteria | 3156 |
| 712 | Ga0373944_0030808 | 3300035089 | Bacteria | 1610 |
| 713 | Ga0373944_0288706 | 3300035089 | Bacteria | 613 |
| 714 | Ga0373949_0019283 | 3300035090 | Bacteria | 1552 |
| 715 | Ga0373951_0197736 | 3300035091 | Bacteria | 584 |
| 716 | Ga0373952_0025270 | 3300035092 | Bacteria | 1281 |
| 717 | Ga0373923_0008519 | 3300035111 | Bacteria | 3661 |
| 718 | Ga0373923_0028820 | 3300035111 | Bacteria | 2222 |
| 719 | Ga0373936_0000482 | 3300035113 | Bacteria | 13475 |
| 720 | Ga0373936_0004605 | 3300035113 | Bacteria | 5218 |
| 721 | Ga0373936_0462800 | 3300035113 | Bacteria | 587 |
| 722 | Ga0373936_0631953 | 3300035113 | Bacteria | 504 |
| 723 | Ga0373939_0115153 | 3300035114 | Bacteria | 941 |
| 724 | Ga0373939_0185296 | 3300035114 | Bacteria | 779 |
| 725 | Ga0373941_0007620 | 3300035115 | Bacteria | 2655 |
| 726 | Ga0373941_0079923 | 3300035115 | Bacteria | 1102 |
| 727 | Ga0373945_0000485 | 3300035116 | Bacteria | 11271 |
| 728 | Ga0373945_0002240 | 3300035116 | Bacteria | 6049 |
| 729 | Ga0373954_0012340 | 3300035118 | Bacteria | 3797 |
| 730 | Ga0373954_0567360 | 3300035118 | Bacteria | 562 |
| 731 | Ga0373956_0004367 | 3300035119 | Bacteria | 5665 |
| 732 | Ga0373956_0013013 | 3300035119 | Bacteria | 3458 |
| 733 | Ga0373956_0139935 | 3300035119 | Bacteria | 1136 |
| 734 | Ga0373957_0118082 | 3300035120 | Bacteria | 1072 |
| 735 | Ga0373943_0000368 | 3300035170 | Bacteria | 19143 |
| 736 | Ga0373943_0014761 | 3300035170 | Bacteria | 3542 |
| 737 | Ga0373943_0061321 | 3300035170 | Bacteria | 1880 |
| 738 | Ga0373946_0002015 | 3300035171 | Bacteria | 7115 |
| 739 | Ga0373946_0003630 | 3300035171 | Bacteria | 5465 |
| 740 | Ga0373955_0007874 | 3300035172 | Bacteria | 4916 |
| 741 | Ga0373955_0034979 | 3300035172 | Bacteria | 2657 |
| 742 | Ga0373955_0081613 | 3300035172 | Bacteria | 1828 |
| 743 | Ga0373942_0024119 | 3300035207 | Bacteria | 1558 |
| 744 | Ga0316574_0003093 | 3300035398 | Bacteria | 8496 |
| 745 | Ga0373924_0034235 | 3300035410 | Bacteria | 2055 |
| 746 | Ga0373924_0299081 | 3300035410 | Bacteria | 714 |
| 747 | Ga0373931_0071382 | 3300035691 | Bacteria | 1896 |
| 748 | Ga0373931_0364852 | 3300035691 | Bacteria | 907 |
| 749 | Ga0373935_0003807 | 3300035692 | Bacteria | 8809 |
| 750 | Ga0373935_0015929 | 3300035692 | Bacteria | 4549 |
| 751 | Ga0373935_0088136 | 3300035692 | Bacteria | 2027 |
| 752 | Ga0373927_0002270 | 3300035695 | Bacteria | 14086 |
| 753 | Ga0373927_0936832 | 3300035695 | Bacteria | 571 |
| 754 | Ga0373933_0035134 | 3300035724 | Bacteria | 2925 |
| 755 | Ga0373933_0389210 | 3300035724 | Bacteria | 908 |
| 756 | Ga0373947_0009607 | 3300035725 | Bacteria | 5551 |
| 757 | Ga0373947_0070086 | 3300035725 | Bacteria | 2147 |
| 758 | Ga0373937_0064872 | 3300036401 | Bacteria | 3360 |
| 759 | Ga0373937_0098972 | 3300036401 | Bacteria | 2705 |
| 760 | Ga0373937_0374115 | 3300036401 | Bacteria | 1351 |
| 761 | Ga0373937_0378462 | 3300036401 | Bacteria | 1342 |
| 762 | Ga0373925_0045325 | 3300037068 | Bacteria | 3266 |
| 763 | Ga0373925_0512065 | 3300037068 | Bacteria | 985 |
| 764 | Ga0395899_0082700 | 3300037312 | Bacteria | 2335 |
| 765 | Ga0395900_0283544 | 3300037418 | Bacteria | 1648 |
| 766 | Ga0395900_0445110 | 3300037418 | Bacteria | 1252 |
| 767 | Ga0395900_1678598 | 3300037418 | Bacteria | 546 |
| 768 | Ga0395898_0012815 | 3300037466 | Bacteria | 8655 |
| 769 | Ga0395898_0956201 | 3300037466 | Bacteria | 793 |
| 770 | Ga0395898_1474465 | 3300037466 | Unclassified | 607 |
| 771 | Ga0395905_0026295 | 3300037471 | Bacteria | 5488 |
| 772 | Ga0395905_1839631 | 3300037471 | Bacteria | 511 |
| 773 | Ga0436364_0154596 | 3300037853 | Bacteria | 62862 |
| 774 | Ga0436364_0182444 | 3300037853 | Bacteria | 708 |
| 775 | Ga0436364_0323152 | 3300037853 | Bacteria | 724 |
| 776 | Ga0436364_1125035 | 3300037853 | Bacteria | 36092 |
| 777 | Ga0395901_0013659 | 3300038443 | Bacteria | 8256 |
| 778 | Ga0395901_2131658 | 3300038443 | Bacteria | 505 |
| 779 | Ga0400483_004249 | 3300039062 | Bacteria | 2618 |
| 780 | Ga0400483_175799 | 3300039062 | Bacteria | 7247 |
| 781 | Ga0436365_0800928 | 3300039437 | Bacteria | 779 |
| 782 | Ga0436365_0984038 | 3300039437 | Bacteria | 20730 |
| 783 | Ga0436360_0027561 | 3300039438 | Bacteria | 1539 |
| 784 | Ga0436360_0070157 | 3300039438 | Bacteria | 1125 |
| 785 | Ga0436360_0914144 | 3300039438 | Bacteria | 946 |
| 786 | Ga0436361_0883200 | 3300039447 | Bacteria | 699 |
| 787 | Ga0436363_1306040 | 3300039450 | Bacteria | 510 |
| 788 | Ga0436362_0513142 | 3300039453 | Bacteria | 4048 |
| 789 | Ga0436362_0916296 | 3300039453 | Bacteria | 7523 |
| 790 | Ga0439439_0017977 | 3300041406 | Bacteria | 1743 |
| 791 | Ga0439453_0069259 | 3300041408 | Bacteria | 744 |
| 792 | Ga0439461_0050733 | 3300041410 | Bacteria | 920 |
| 793 | Ga0439466_0042362 | 3300041411 | Bacteria | 1516 |
| 794 | Ga0451793_0948911 | 3300041452 | Bacteria | 4142 |
| 795 | Ga0451797_0891010 | 3300041453 | Bacteria | 550 |
| 796 | Ga0451795_0533444 | 3300041456 | Bacteria | 531 |
| 797 | Ga0451795_0637961 | 3300041456 | Bacteria | 601 |
| 798 | Ga0451800_0242290 | 3300041459 | Bacteria | 638 |
| 799 | Ga0451833_0713203 | 3300041491 | Bacteria | 3171 |
| 800 | Ga0451837_0535912 | 3300041494 | Bacteria | 4102 |
| 801 | Ga0451839_0403005 | 3300041496 | Bacteria | 691 |
| 802 | Ga0451839_0498698 | 3300041496 | Bacteria | 3406 |
| 803 | Ga0451841_0874204 | 3300041498 | Bacteria | 1016 |
| 804 | Ga0451843_0712501 | 3300041509 | Bacteria | 853 |
| 805 | Ga0451843_1206816 | 3300041509 | Bacteria | 569 |
| 806 | Ga0451853_3042104 | 3300041512 | Bacteria | 628 |
| 807 | Ga0451853_3804823 | 3300041512 | Bacteria | 722 |
| 808 | Ga0439443_007118 | 3300042003 | Bacteria | 1550 |
| 809 | Ga0439443_016281 | 3300042003 | Bacteria | 1135 |
| 810 | Ga0439448_0036946 | 3300042005 | Bacteria | 1567 |
| 811 | Ga0439448_0038275 | 3300042005 | Bacteria | 1543 |
| 812 | Ga0439448_0046624 | 3300042005 | Bacteria | 1412 |
| 813 | Ga0439448_0061139 | 3300042005 | Bacteria | 1245 |
| 814 | Ga0439448_0107677 | 3300042005 | Bacteria | 951 |
| 815 | Ga0439450_000035 | 3300042008 | Bacteria | 11242 |
| 816 | Ga0439450_011775 | 3300042008 | Bacteria | 1721 |
| 817 | Ga0439450_018018 | 3300042008 | Bacteria | 1479 |
| 818 | Ga0439450_120507 | 3300042008 | Bacteria | 675 |
| 819 | Ga0439452_067965 | 3300042010 | Bacteria | 788 |
| 820 | Ga0439454_001686 | 3300042011 | Bacteria | 2185 |
| 821 | Ga0439454_003306 | 3300042011 | Bacteria | 1783 |
| 822 | Ga0439454_033156 | 3300042011 | Bacteria | 818 |
| 823 | Ga0439455_0018810 | 3300042012 | Bacteria | 1623 |
| 824 | Ga0439455_0038123 | 3300042012 | Bacteria | 1222 |
| 825 | Ga0439455_0136136 | 3300042012 | Bacteria | 694 |
| 826 | Ga0439456_051974 | 3300042013 | Bacteria | 896 |
| 827 | Ga0439457_192138 | 3300042014 | Bacteria | 501 |
| 828 | Ga0439463_001477 | 3300042016 | Bacteria | 6215 |
| 829 | Ga0439463_004777 | 3300042016 | Bacteria | 3385 |
| 830 | Ga0439463_010669 | 3300042016 | Bacteria | 2258 |
| 831 | Ga0439463_064242 | 3300042016 | Bacteria | 938 |
| 832 | Ga0450913_002761 | 3300042117 | Bacteria | 1105 |
| 833 | Ga0450914_008018 | 3300042118 | Bacteria | 967 |
| 834 | Ga0450915_011382 | 3300042119 | Bacteria | 631 |
| 835 | Ga0450917_026067 | 3300042120 | Bacteria | 541 |
| 836 | Ga0450891_035994 | 3300042129 | Bacteria | 523 |
| 837 | Ga0450898_094537 | 3300042134 | Bacteria | 620 |
| 838 | Ga0450900_021541 | 3300042136 | Bacteria | 901 |
| 839 | Ga0450900_037249 | 3300042136 | Bacteria | 720 |
| 840 | Ga0450900_071804 | 3300042136 | Bacteria | 550 |
| 841 | Ga0450902_026391 | 3300042137 | Bacteria | 971 |
| 842 | Ga0450904_023465 | 3300042139 | Bacteria | 631 |
| 843 | Ga0450905_002654 | 3300042142 | Bacteria | 2309 |
| 844 | Ga0450905_092082 | 3300042142 | Bacteria | 536 |
| 845 | Ga0439458_0139124 | 3300042157 | Bacteria | 646 |
| 846 | Ga0439458_0189281 | 3300042157 | Bacteria | 560 |
| 847 | Ga0439435_0009970 | 3300042436 | Bacteria | 2242 |
| 848 | Ga0439444_0002183 | 3300042437 | Bacteria | 2646 |
| 849 | Ga0439444_0060942 | 3300042437 | Bacteria | 788 |
| 850 | Ga0439459_0042238 | 3300042438 | Bacteria | 973 |
| 851 | Ga0439459_0048877 | 3300042438 | Bacteria | 922 |
| 852 | Ga0439459_0053458 | 3300042438 | Bacteria | 893 |
| 853 | Ga0439459_0102746 | 3300042438 | Bacteria | 701 |
| 854 | Ga0439464_0010913 | 3300042439 | Bacteria | 2401 |
| 855 | Ga0439464_0194462 | 3300042439 | Bacteria | 645 |
| 856 | Ga0439460_0003195 | 3300042461 | Bacteria | 3958 |
| 857 | Ga0439460_0010060 | 3300042461 | Bacteria | 2412 |
| 858 | Ga0439460_0019662 | 3300042461 | Bacteria | 1831 |
| 859 | Ga0439460_0284883 | 3300042461 | Bacteria | 576 |
| 860 | Ga0450916_024509 | 3300042530 | Bacteria | 847 |
| 861 | Ga0439440_0000128 | 3300042993 | Bacteria | 10663 |
| 862 | Ga0439440_0000836 | 3300042993 | Bacteria | 5352 |
| 863 | Ga0439440_0002296 | 3300042993 | Bacteria | 3594 |
| 864 | Ga0466972_0209223 | 3300044658 | Bacteria | 913 |
| 865 | Ga0453683_0285305 | 3300044673 | Bacteria | 1055 |
| 866 | Ga0466966_0091496 | 3300044684 | Bacteria | 1888 |
| 867 | Ga0466961_0070627 | 3300044693 | Bacteria | 2217 |
| 868 | Ga0466961_0224672 | 3300044693 | Bacteria | 1157 |
| 869 | Ga0466963_0098154 | 3300044694 | Bacteria | 2002 |
| 870 | Ga0466963_0599349 | 3300044694 | Unclassified | 778 |
| 871 | Ga0466964_0767142 | 3300044706 | Bacteria | 543 |
| 872 | Ga0466964_0795879 | 3300044706 | Bacteria | 534 |
| 873 | Ga0466971_0308557 | 3300044719 | Bacteria | 761 |
| 874 | Ga0466970_0172981 | 3300044765 | Bacteria | 1197 |
| 875 | Ga0466970_0450724 | 3300044765 | Bacteria | 738 |
| 876 | Ga0466970_0834115 | 3300044765 | Bacteria | 541 |
| 877 | Ga0466957_0253442 | 3300044842 | Bacteria | 1171 |
| 878 | Ga0466957_0387446 | 3300044842 | Bacteria | 954 |
| 879 | Ga0466960_0199184 | 3300044901 | Bacteria | 1093 |
| 880 | Ga0466959_0072169 | 3300045049 | Bacteria | 2499 |
| 881 | Ga0466959_1178682 | 3300045049 | Unclassified | 509 |
| 882 | Ga0466958_0394228 | 3300045836 | Bacteria | 893 |
| 883 | Ga0466958_0550939 | 3300045836 | Bacteria | 749 |
| 884 | Ga0466967_0142653 | 3300045976 | Bacteria | 2232 |
| 885 | Ga0466967_1312802 | 3300045976 | Unclassified | 721 |
| 886 | Ga0466967_1586905 | 3300045976 | Bacteria | 652 |
| 887 | Ga0495627_173053 | 3300046453 | Bacteria | 599 |
| 888 | Ga0495592_0060290 | 3300046454 | Bacteria | 2791 |
| 889 | Ga0495592_0227188 | 3300046454 | Bacteria | 1244 |
| 890 | Ga0495592_0756328 | 3300046454 | Bacteria | 580 |
| 891 | Ga0495592_0950261 | 3300046454 | Bacteria | 503 |
| 892 | Ga0495603_0256857 | 3300046455 | Bacteria | 1006 |
| 893 | Ga0495603_0318036 | 3300046455 | Bacteria | 893 |
| 894 | Ga0495629_0016977 | 3300046459 | Bacteria | 5222 |
| 895 | Ga0495629_0205101 | 3300046459 | Bacteria | 1362 |
| 896 | Ga0495641_0015396 | 3300046461 | Bacteria | 4085 |
| 897 | Ga0495641_0171219 | 3300046461 | Bacteria | 972 |
| 898 | Ga0495651_0032413 | 3300046462 | Bacteria | 4075 |
| 899 | Ga0495651_0151987 | 3300046462 | Bacteria | 1667 |
| 900 | Ga0495653_0015253 | 3300046463 | Bacteria | 6261 |
| 901 | Ga0495653_0102962 | 3300046463 | Bacteria | 2065 |
| 902 | Ga0495653_0869221 | 3300046463 | Bacteria | 539 |
| 903 | Ga0495580_0124984 | 3300046472 | Bacteria | 1785 |
| 904 | Ga0495580_0938835 | 3300046472 | Bacteria | 554 |
| 905 | Ga0495582_0010972 | 3300046473 | Bacteria | 4986 |
| 906 | Ga0495639_0049730 | 3300046475 | Bacteria | 1903 |
| 907 | Ga0495662_0027556 | 3300046476 | Bacteria | 2744 |
| 908 | Ga0495662_0056693 | 3300046476 | Bacteria | 1892 |
| 909 | Ga0495662_0079873 | 3300046476 | Bacteria | 1590 |
| 910 | Ga0495662_0220375 | 3300046476 | Bacteria | 935 |
| 911 | Ga0495664_0028425 | 3300046477 | Bacteria | 3265 |
| 912 | Ga0495664_0039374 | 3300046477 | Bacteria | 2792 |
| 913 | Ga0495664_0440607 | 3300046477 | Bacteria | 780 |
| 914 | Ga0495584_0085481 | 3300046491 | Bacteria | 1589 |
| 915 | Ga0495585_0571628 | 3300046492 | Bacteria | 533 |
| 916 | Ga0495594_0015240 | 3300046499 | Bacteria | 4038 |
| 917 | Ga0495594_0050670 | 3300046499 | Bacteria | 2284 |
| 918 | Ga0495596_0052010 | 3300046500 | Bacteria | 1604 |
| 919 | Ga0495608_0063052 | 3300046511 | Bacteria | 2433 |
| 920 | Ga0495608_0076737 | 3300046511 | Bacteria | 2175 |
| 921 | Ga0495618_0068945 | 3300046514 | Bacteria | 2248 |
| 922 | Ga0495618_0348073 | 3300046514 | Bacteria | 913 |
| 923 | Ga0495628_0025142 | 3300046516 | Bacteria | 4866 |
| 924 | Ga0495628_0110770 | 3300046516 | Bacteria | 2111 |
| 925 | Ga0495630_0009083 | 3300046517 | Bacteria | 7143 |
| 926 | Ga0495630_0111063 | 3300046517 | Bacteria | 2076 |
| 927 | Ga0495630_0180311 | 3300046517 | Bacteria | 1610 |
| 928 | Ga0495632_0481617 | 3300046519 | Bacteria | 536 |
| 929 | Ga0495666_0008049 | 3300046526 | Bacteria | 5284 |
| 930 | Ga0495652_0035058 | 3300046529 | Bacteria | 4368 |
| 931 | Ga0495652_0100099 | 3300046529 | Bacteria | 2352 |
| 932 | Ga0495652_0249945 | 3300046529 | Bacteria | 1314 |
| 933 | Ga0495652_0509199 | 3300046529 | Bacteria | 833 |
| 934 | Ga0495654_0292749 | 3300046530 | Bacteria | 667 |
| 935 | Ga0495665_0003251 | 3300046531 | Bacteria | 8794 |
| 936 | Ga0495665_0003452 | 3300046531 | Bacteria | 8584 |
| 937 | Ga0495665_0028246 | 3300046531 | Bacteria | 3008 |
| 938 | Ga0495665_0068728 | 3300046531 | Bacteria | 1868 |
| 939 | Ga0495665_0078996 | 3300046531 | Bacteria | 1731 |
| 940 | Ga0495640_0016803 | 3300046533 | Bacteria | 5470 |
| 941 | Ga0495640_0195666 | 3300046533 | Bacteria | 1283 |
| 942 | Ga0495640_0350980 | 3300046533 | Bacteria | 910 |
| 943 | Ga0495586_0017383 | 3300046535 | Bacteria | 3823 |
| 944 | Ga0495586_0028005 | 3300046535 | Bacteria | 3015 |
| 945 | Ga0495587_0048774 | 3300046536 | Bacteria | 2507 |
| 946 | Ga0495587_0444498 | 3300046536 | Bacteria | 718 |
| 947 | Ga0495587_0481664 | 3300046536 | Bacteria | 686 |
| 948 | Ga0495609_0022560 | 3300046538 | Bacteria | 2899 |
| 949 | Ga0495621_0036101 | 3300046539 | Bacteria | 1714 |
| 950 | Ga0495621_0049098 | 3300046539 | Bacteria | 1505 |
| 951 | Ga0495645_0158007 | 3300046543 | Bacteria | 1569 |
| 952 | Ga0495645_0387711 | 3300046543 | Bacteria | 892 |
| 953 | Ga0495622_0073197 | 3300046557 | Bacteria | 1581 |
| 954 | Ga0495667_0030332 | 3300046559 | Bacteria | 3635 |
| 955 | Ga0495667_0044382 | 3300046559 | Bacteria | 2944 |
| 956 | Ga0495667_0953623 | 3300046559 | Bacteria | 524 |
| 957 | Ga0495656_0009807 | 3300046615 | Bacteria | 3457 |
| 958 | Ga0495634_0072421 | 3300046642 | Bacteria | 2266 |
| 959 | Ga0495634_0139446 | 3300046642 | Bacteria | 1540 |
| 960 | Ga0495634_0153533 | 3300046642 | Bacteria | 1454 |
| 961 | Ga0495611_0121512 | 3300046648 | Bacteria | 1218 |
| 962 | Ga0495635_0000658 | 3300046663 | Bacteria | 22137 |
| 963 | Ga0495635_0056326 | 3300046663 | Bacteria | 2706 |
| 964 | Ga0495635_0067430 | 3300046663 | Bacteria | 2454 |
| 965 | Ga0495588_0626313 | 3300046674 | Bacteria | 563 |
| 966 | Ga0495657_0070320 | 3300046675 | Bacteria | 2287 |
| 967 | Ga0495657_0133453 | 3300046675 | Bacteria | 1553 |
| 968 | Ga0495657_0491080 | 3300046675 | Bacteria | 716 |
| 969 | Ga0495599_0036981 | 3300046678 | Bacteria | 3067 |
| 970 | Ga0495599_0056549 | 3300046678 | Bacteria | 2456 |
| 971 | Ga0495623_0113935 | 3300046679 | Bacteria | 1635 |
| 972 | Ga0495623_0197230 | 3300046679 | Bacteria | 1159 |
| 973 | Ga0495646_0070249 | 3300046680 | Bacteria | 2063 |
| 974 | Ga0495646_0214735 | 3300046680 | Bacteria | 1042 |
| 975 | Ga0495646_0445064 | 3300046680 | Bacteria | 669 |
| 976 | Ga0495647_0135939 | 3300046681 | Bacteria | 1045 |
| 977 | Ga0495647_0405850 | 3300046681 | Bacteria | 626 |
| 978 | Ga0495658_0194985 | 3300046683 | Bacteria | 1261 |
| 979 | Ga0495658_0226256 | 3300046683 | Bacteria | 1172 |
| 980 | Ga0495669_0034011 | 3300046684 | Bacteria | 2246 |
| 981 | Ga0495613_0006122 | 3300046689 | Bacteria | 9002 |
| 982 | Ga0495613_0167325 | 3300046689 | Bacteria | 1561 |
| 983 | Ga0495624_0035552 | 3300046690 | Bacteria | 3216 |
| 984 | Ga0495624_0068963 | 3300046690 | Bacteria | 2204 |
| 985 | Ga0495624_0304014 | 3300046690 | Bacteria | 961 |
| 986 | Ga0495670_0250846 | 3300046691 | Bacteria | 943 |
| 987 | Ga0495649_0430873 | 3300046694 | Bacteria | 660 |
| 988 | Ga0495589_0087574 | 3300046794 | Bacteria | 1512 |
| 989 | Ga0495600_0018569 | 3300046809 | Bacteria | 4432 |
| 990 | Ga0495600_0091470 | 3300046809 | Bacteria | 1984 |
| 991 | Ga0495600_0350001 | 3300046809 | Bacteria | 925 |
| 992 | Ga0495581_0007400 | 3300047315 | Bacteria | 6350 |
| 993 | Ga0495581_0015967 | 3300047315 | Bacteria | 4364 |
| 994 | Ga0495581_0251668 | 3300047315 | Bacteria | 1033 |
| 995 | Ga0495581_0569927 | 3300047315 | Bacteria | 657 |
| 996 | Ga0495604_0121375 | 3300047317 | Bacteria | 1891 |
| 997 | Ga0495604_0201907 | 3300047317 | Bacteria | 1378 |
| 998 | Ga0495636_0032597 | 3300047318 | Bacteria | 2138 |
| 999 | Ga0495674_0088142 | 3300047319 | Bacteria | 2654 |
| 1000 | Ga0495676_0035969 | 3300047321 | Bacteria | 4139 |
| 1001 | Ga0495676_0276273 | 3300047321 | Bacteria | 1138 |
| 1002 | Ga0495680_0150464 | 3300047322 | Bacteria | 1697 |
| 1003 | Ga0495680_0828427 | 3300047322 | Bacteria | 602 |
| 1004 | Ga0495675_0084221 | 3300047444 | Bacteria | 2001 |
| 1005 | Ga0495675_0324314 | 3300047444 | Bacteria | 910 |
| 1006 | Ga0495684_0054691 | 3300047471 | Bacteria | 3044 |
| 1007 | Ga0495684_0086267 | 3300047471 | Bacteria | 2379 |
| 1008 | Ga0495684_0768151 | 3300047471 | Bacteria | 632 |
| 1009 | Ga0495593_0045304 | 3300047673 | Bacteria | 2348 |
| 1010 | Ga0495593_0400310 | 3300047673 | Bacteria | 686 |
| 1011 | Ga0495602_0113980 | 3300048088 | Bacteria | 2190 |
| 1012 | Ga0495602_0424457 | 3300048088 | Bacteria | 943 |
| 1013 | Ga0495602_0797006 | 3300048088 | Bacteria | 635 |
| 1014 | Ga0495614_0052179 | 3300048089 | Bacteria | 1753 |
| 1015 | Ga0495615_0235681 | 3300048090 | Bacteria | 576 |
| 1016 | Ga0496100_0019542 | 3300048903 | Bacteria | 4044 |
| 1017 | Ga0496101_0052070 | 3300048904 | Bacteria | 2951 |
| 1018 | Ga0496101_0606292 | 3300048904 | Bacteria | 865 |
| 1019 | Ga0496102_0306075 | 3300048905 | Bacteria | 1498 |
| 1020 | Ga0496102_0797744 | 3300048905 | Bacteria | 866 |
| 1021 | Ga0496102_1852370 | 3300048905 | Bacteria | 520 |
| 1022 | Ga0496102_1901948 | 3300048905 | Bacteria | 512 |
| 1023 | Ga0496103_0024921 | 3300048906 | Bacteria | 3611 |
| 1024 | Ga0496104_0169357 | 3300048907 | Bacteria | 2094 |
| 1025 | Ga0496104_0178488 | 3300048907 | Bacteria | 2034 |
| 1026 | Ga0496104_0192871 | 3300048907 | Bacteria | 1949 |
| 1027 | Ga0496104_0909186 | 3300048907 | Bacteria | 785 |
| 1028 | Ga0496105_0016547 | 3300048908 | Bacteria | 5888 |
| 1029 | Ga0496105_0132875 | 3300048908 | Bacteria | 2051 |
| 1030 | Ga0496105_1291832 | 3300048908 | Bacteria | 533 |
| 1031 | Ga0496106_0862544 | 3300048909 | Bacteria | 716 |
| 1032 | Ga0496107_0096143 | 3300048910 | Bacteria | 2167 |
| 1033 | Ga0496108_0225681 | 3300048911 | Bacteria | 1628 |
| 1034 | Ga0496108_0311649 | 3300048911 | Bacteria | 1371 |
| 1035 | Ga0496108_0449639 | 3300048911 | Bacteria | 1125 |
| 1036 | Ga0496108_0470252 | 3300048911 | Bacteria | 1098 |
| 1037 | Ga0496109_0059001 | 3300048912 | Bacteria | 3506 |
| 1038 | Ga0496109_1299259 | 3300048912 | Bacteria | 663 |
| 1039 | Ga0496109_1344953 | 3300048912 | Bacteria | 650 |
| 1040 | Ga0496109_1552522 | 3300048912 | Bacteria | 597 |
| 1041 | Ga0496109_1858059 | 3300048912 | Bacteria | 535 |
| 1042 | Ga0496110_0070071 | 3300048913 | Bacteria | 3106 |
| 1043 | Ga0496110_0073263 | 3300048913 | Bacteria | 3039 |
| 1044 | Ga0496110_0506179 | 3300048913 | Bacteria | 1099 |
| 1045 | Ga0496110_0612221 | 3300048913 | Bacteria | 987 |
| 1046 | Ga0496111_0222421 | 3300048914 | Bacteria | 1402 |
| 1047 | Ga0496111_0443665 | 3300048914 | Bacteria | 958 |
| 1048 | Ga0496111_1183767 | 3300048914 | Bacteria | 542 |
| 1049 | Ga0496112_0128615 | 3300048915 | Bacteria | 2503 |
| 1050 | Ga0496112_0467682 | 3300048915 | Bacteria | 1198 |
| 1051 | Ga0496112_0694556 | 3300048915 | Bacteria | 945 |
| 1052 | Ga0496113_0016306 | 3300048916 | Bacteria | 5130 |
| 1053 | Ga0496113_0070923 | 3300048916 | Bacteria | 2649 |
| 1054 | Ga0496113_0088993 | 3300048916 | Bacteria | 2376 |
| 1055 | Ga0496113_0577319 | 3300048916 | Bacteria | 901 |
| 1056 | Ga0496113_0870307 | 3300048916 | Bacteria | 714 |
| 1057 | Ga0496114_0172345 | 3300048917 | Bacteria | 1886 |
| 1058 | Ga0496114_0673297 | 3300048917 | Bacteria | 909 |
| 1059 | Ga0496114_0898941 | 3300048917 | Bacteria | 767 |
| 1060 | Ga0496114_1459927 | 3300048917 | Bacteria | 572 |
| 1061 | Ga0496115_0267680 | 3300048918 | Bacteria | 1404 |
| 1062 | Ga0496115_0393115 | 3300048918 | Bacteria | 1126 |
| 1063 | Ga0496118_0331690 | 3300048921 | Unclassified | 820 |
| 1064 | Ga0496119_0036955 | 3300048922 | Bacteria | 3180 |
| 1065 | Ga0496120_0254820 | 3300048923 | Bacteria | 822 |
| 1066 | Ga0496122_0011095 | 3300048925 | Bacteria | 9185 |
| 1067 | Ga0496123_0001686 | 3300048926 | Bacteria | 29566 |
| 1068 | Ga0496125_0277027 | 3300048928 | Bacteria | 1042 |
| 1069 | Ga0496126_0000007 | 3300048929 | Bacteria | 787364 |
| 1070 | Ga0496126_0001977 | 3300048929 | Bacteria | 29041 |
| 1071 | Ga0496126_0162886 | 3300048929 | Bacteria | 1905 |
| 1072 | Ga0496126_0936235 | 3300048929 | Bacteria | 654 |
| 1073 | Ga0501031_0007036 | 3300049568 | Bacteria | 7343 |
| 1074 | Ga0501031_0016176 | 3300049568 | Bacteria | 4845 |
| 1075 | Ga0501032_0035526 | 3300049569 | Bacteria | 3407 |
| 1076 | Ga0501032_0132383 | 3300049569 | Bacteria | 1644 |
| 1077 | Ga0501032_0822093 | 3300049569 | Unclassified | 586 |
| 1078 | Ga0501033_0024312 | 3300049570 | Bacteria | 4571 |
| 1079 | Ga0501033_0044866 | 3300049570 | Bacteria | 3291 |
| 1080 | Ga0501033_1174323 | 3300049570 | Bacteria | 509 |
| 1081 | Ga0501034_0386300 | 3300049571 | Bacteria | 1324 |
| 1082 | Ga0501036_0001139 | 3300049572 | Bacteria | 20210 |
| 1083 | Ga0501036_0011323 | 3300049572 | Bacteria | 7381 |
| 1084 | Ga0501037_0007729 | 3300049573 | Bacteria | 7869 |
| 1085 | Ga0501037_0045918 | 3300049573 | Bacteria | 3205 |
| 1086 | Ga0501037_0826243 | 3300049573 | Bacteria | 611 |
| 1087 | Ga0501038_0027050 | 3300049574 | Bacteria | 5106 |
| 1088 | Ga0501038_0186185 | 3300049574 | Bacteria | 1673 |
| 1089 | Ga0501038_0214282 | 3300049574 | Bacteria | 1539 |
| 1090 | Ga0501039_0003019 | 3300049575 | Bacteria | 12587 |
| 1091 | Ga0501039_0015614 | 3300049575 | Bacteria | 5811 |
| 1092 | Ga0501039_1132676 | 3300049575 | Bacteria | 606 |
| 1093 | Ga0501040_0000293 | 3300049576 | Bacteria | 29155 |
| 1094 | Ga0501040_0003652 | 3300049576 | Bacteria | 9963 |
| 1095 | Ga0501040_0033161 | 3300049576 | Bacteria | 3497 |
| 1096 | Ga0501040_0219142 | 3300049576 | Bacteria | 1354 |
| 1097 | Ga0501040_0226478 | 3300049576 | Bacteria | 1331 |
| 1098 | Ga0501041_0000165 | 3300049577 | Bacteria | 29328 |
| 1099 | Ga0501041_0000404 | 3300049577 | Bacteria | 21758 |
| 1100 | Ga0501041_0283498 | 3300049577 | Bacteria | 1043 |
| 1101 | Ga0501041_0980098 | 3300049577 | Bacteria | 544 |
| 1102 | Ga0501042_0000007 | 3300049578 | Bacteria | 63673 |
| 1103 | Ga0501042_0002086 | 3300049578 | Bacteria | 12133 |
| 1104 | Ga0501042_0085211 | 3300049578 | Bacteria | 2266 |
| 1105 | Ga0501042_0176411 | 3300049578 | Bacteria | 1542 |
| 1106 | Ga0501043_0003703 | 3300049579 | Bacteria | 12561 |
| 1107 | Ga0501043_0017819 | 3300049579 | Bacteria | 5567 |
| 1108 | Ga0501043_0234102 | 3300049579 | Bacteria | 1418 |
| 1109 | Ga0501046_0002500 | 3300049580 | Bacteria | 17210 |
| 1110 | Ga0501046_0003651 | 3300049580 | Bacteria | 14096 |
| 1111 | Ga0501046_0787204 | 3300049580 | Bacteria | 667 |
| 1112 | Ga0501047_0033679 | 3300049581 | Bacteria | 4944 |
| 1113 | Ga0501047_0045921 | 3300049581 | Bacteria | 4223 |
| 1114 | Ga0501048_0001431 | 3300049582 | Bacteria | 18080 |
| 1115 | Ga0501048_0172156 | 3300049582 | Bacteria | 1534 |
| 1116 | Ga0501067_0235194 | 3300049583 | Bacteria | 1020 |
| 1117 | Ga0501067_0299764 | 3300049583 | Bacteria | 895 |
| 1118 | Ga0501067_0644431 | 3300049583 | Bacteria | 595 |
| 1119 | Ga0501067_0865505 | 3300049583 | Bacteria | 510 |
| 1120 | Ga0501068_0010885 | 3300049584 | Bacteria | 5119 |
| 1121 | Ga0501069_0280931 | 3300049585 | Bacteria | 974 |
| 1122 | Ga0501069_0400763 | 3300049585 | Bacteria | 812 |
| 1123 | Ga0501069_0422873 | 3300049585 | Bacteria | 790 |
| 1124 | Ga0501070_0411927 | 3300049586 | Bacteria | 1092 |
| 1125 | Ga0501070_1488881 | 3300049586 | Bacteria | 512 |
| 1126 | Ga0501071_0021545 | 3300049587 | Bacteria | 4488 |
| 1127 | Ga0501071_0041011 | 3300049587 | Bacteria | 3314 |
| 1128 | Ga0501071_0371799 | 3300049587 | Bacteria | 1089 |
| 1129 | Ga0501072_0221046 | 3300049588 | Bacteria | 1509 |
| 1130 | Ga0501072_0246899 | 3300049588 | Bacteria | 1422 |
| 1131 | Ga0501073_0214621 | 3300049589 | Bacteria | 1329 |
| 1132 | Ga0501074_0000297 | 3300049590 | Bacteria | 28572 |
| 1133 | Ga0501075_0000238 | 3300049591 | Bacteria | 29445 |
| 1134 | Ga0501075_0000795 | 3300049591 | Bacteria | 19734 |
| 1135 | Ga0501075_0107829 | 3300049591 | Bacteria | 2117 |
| 1136 | Ga0501076_0000380 | 3300049592 | Bacteria | 27776 |
| 1137 | Ga0501076_0017302 | 3300049592 | Bacteria | 5476 |
| 1138 | Ga0501076_0185186 | 3300049592 | Bacteria | 1698 |
| 1139 | Ga0501076_1185423 | 3300049592 | Bacteria | 629 |
| 1140 | Ga0501077_0000459 | 3300049593 | Bacteria | 24732 |
| 1141 | Ga0501077_0203344 | 3300049593 | Bacteria | 1258 |
| 1142 | Ga0501077_0288684 | 3300049593 | Bacteria | 1044 |
| 1143 | Ga0501077_0329672 | 3300049593 | Bacteria | 973 |
| 1144 | Ga0501079_0000448 | 3300049741 | Bacteria | 26890 |
| 1145 | Ga0501079_0003137 | 3300049741 | Bacteria | 12106 |
| 1146 | Ga0501079_0153645 | 3300049741 | Bacteria | 1794 |
| 1147 | Ga0501080_0013285 | 3300049742 | Bacteria | 7566 |
| 1148 | Ga0501080_0166091 | 3300049742 | Bacteria | 2036 |
| 1149 | Ga0501080_0468815 | 3300049742 | Bacteria | 1127 |
| 1150 | Ga0501081_0000172 | 3300049743 | Bacteria | 30389 |
| 1151 | Ga0501081_0001115 | 3300049743 | Bacteria | 16137 |
| 1152 | Ga0501083_0262544 | 3300049744 | Bacteria | 1123 |
| 1153 | Ga0501035_0026090 | 3300049822 | Bacteria | 5351 |
| 1154 | Ga0501035_0026525 | 3300049822 | Bacteria | 5300 |
| 1155 | Ga0501044_0002377 | 3300049823 | Bacteria | 21431 |
| 1156 | Ga0501044_0009795 | 3300049823 | Bacteria | 10419 |
| 1157 | Ga0501044_0081049 | 3300049823 | Bacteria | 3286 |
| 1158 | Ga0501044_0241056 | 3300049823 | Bacteria | 1752 |
| 1159 | Ga0501045_0000063 | 3300049824 | Bacteria | 48972 |
| 1160 | Ga0501045_0011785 | 3300049824 | Bacteria | 6143 |
| 1161 | Ga0501045_0017782 | 3300049824 | Bacteria | 5049 |
| 1162 | nmdc:mga00v17_310187_c1 | 3300050491 | Bacteria | 1025 |
| 1163 | nmdc:mga00v17_856535_c1 | 3300050491 | Bacteria | 577 |
| 1164 | nmdc:mga0yw44_455915_c1 | 3300050492 | Bacteria | 867 |
| 1165 | nmdc:mga06z11_93588_c2 | 3300050494 | Bacteria | 1162 |
| 1166 | nmdc:mga07m45_763810_c1 | 3300050496 | Bacteria | 555 |
| 1167 | nmdc:mga05p37_1110226_c1 | 3300050507 | Bacteria | 827 |
| 1168 | nmdc:mga05p37_1191869_c1 | 3300050507 | Bacteria | 788 |
| 1169 | nmdc:mga05p37_1273092_c1 | 3300050507 | Bacteria | 752 |
| 1170 | nmdc:mga05p37_134314_c1 | 3300050507 | Bacteria | 2487 |
| 1171 | nmdc:mga05p37_193279_c1 | 3300050507 | Bacteria | 2469 |
| 1172 | nmdc:mga05p37_2197224_c1 | 3300050507 | Bacteria | 513 |
| 1173 | nmdc:mga05p37_2792_c1 | 3300050507 | Bacteria | 20305 |
| 1174 | nmdc:mga05p37_322292_c1 | 3300050507 | Bacteria | 1828 |
| 1175 | nmdc:mga09592_1585_c1 | 3300050508 | Bacteria | 18320 |
| 1176 | nmdc:mga09592_207142_c1 | 3300050508 | Bacteria | 1699 |
| 1177 | nmdc:mga09592_919107_c1 | 3300050508 | Bacteria | 735 |
| 1178 | nmdc:mga0qj67_1434_c1 | 3300050509 | Bacteria | 16697 |
| 1179 | nmdc:mga0qj67_2253_c1 | 3300050509 | Bacteria | 13712 |
| 1180 | nmdc:mga0qj67_748267_c1 | 3300050509 | Bacteria | 776 |
| 1181 | nmdc:mga06r32_116842_c1 | 3300050510 | Bacteria | 2629 |
| 1182 | nmdc:mga06r32_15984_c1 | 3300050510 | Bacteria | 6830 |
| 1183 | nmdc:mga06r32_515_c1 | 3300050510 | Bacteria | 33313 |
| 1184 | nmdc:mga08y16_1095853_c1 | 3300050511 | Bacteria | 772 |
| 1185 | nmdc:mga08y16_1679234_c1 | 3300050511 | Bacteria | 591 |
| 1186 | nmdc:mga08y16_1960028_c1 | 3300050511 | Bacteria | 536 |
| 1187 | nmdc:mga08y16_21682_c1 | 3300050511 | Bacteria | 6781 |
| 1188 | nmdc:mga08y16_754336_c1 | 3300050511 | Bacteria | 969 |
| 1189 | nmdc:mga08y16_8919_c1 | 3300050511 | Bacteria | 10531 |
| 1190 | nmdc:mga0n895_1240757_c1 | 3300050512 | Bacteria | 718 |
| 1191 | nmdc:mga0n895_132835_c1 | 3300050512 | Bacteria | 2515 |
| 1192 | nmdc:mga0n895_1679580_c1 | 3300050512 | Bacteria | 598 |
| 1193 | nmdc:mga0n895_247609_c1 | 3300050512 | Bacteria | 1809 |
| 1194 | nmdc:mga0n895_372676_c1 | 3300050512 | Bacteria | 1445 |
| 1195 | nmdc:mga0rr50_106334_c1 | 3300050513 | Bacteria | 2214 |
| 1196 | nmdc:mga0rr50_964687_c1 | 3300050513 | Bacteria | 727 |
| 1197 | nmdc:mga08x19_1010546_c1 | 3300050514 | Bacteria | 591 |
| 1198 | nmdc:mga08x19_1204744_c1 | 3300050514 | Bacteria | 537 |
| 1199 | nmdc:mga08x19_749848_c1 | 3300050514 | Bacteria | 693 |
| 1200 | nmdc:mga0a205_394795_c1 | 3300050515 | Bacteria | 1247 |
| 1201 | nmdc:mga0a205_5116_c1 | 3300050515 | Bacteria | 11795 |
| 1202 | Ga0495601_0040021 | 3300053077 | Bacteria | 2936 |
| 1203 | Ga0495612_0050108 | 3300053078 | Bacteria | 1714 |
| 1204 | Ga0495612_0171165 | 3300053078 | Bacteria | 951 |
| 1205 | Ga0495595_0012380 | 3300053084 | Bacteria | 3586 |
| 1206 | Ga0495595_0241559 | 3300053084 | Bacteria | 903 |
| 1207 | Ga0495619_0004418 | 3300053085 | Bacteria | 8969 |
| 1208 | Ga0495619_0299361 | 3300053085 | Bacteria | 1114 |
| 1209 | Ga0500644_0056969 | 3300053088 | Bacteria | 1362 |
| 1210 | Ga0500577_0089278 | 3300053142 | Bacteria | 1242 |
| 1211 | Ga0500616_0018678 | 3300053153 | Bacteria | 3917 |
| 1212 | Ga0500599_000374 | 3300053736 | Bacteria | 4499 |
| 1213 | Ga0501084_0005801 | 3300054114 | Bacteria | 10160 |
| 1214 | Ga0501084_0012141 | 3300054114 | Bacteria | 7130 |
| 1215 | Ga0501084_0615357 | 3300054114 | Bacteria | 917 |
| 1216 | Ga0590071_005793 | 3300059421 | Bacteria | 2962 |
| 1217 | Ga0590071_100303 | 3300059421 | Bacteria | 729 |
| 1218 | Ga0590071_163384 | 3300059421 | Bacteria | 580 |
| 1219 | Ga0590074_005445 | 3300059423 | Bacteria | 2108 |
| 1220 | Ga0590075_001535 | 3300059424 | Bacteria | 5743 |
| 1221 | Ga0590077_002621 | 3300059426 | Bacteria | 3814 |
| 1222 | Ga0590077_114768 | 3300059426 | Bacteria | 634 |
| 1223 | Ga0587073_0276292 | 3300059492 | Bacteria | 537 |
| 1224 | Ga0587083_0016055 | 3300059505 | Bacteria | 1318 |
| 1225 | Ga0587086_006600 | 3300059507 | Bacteria | 1301 |
| 1226 | Ga0587088_035167 | 3300059508 | Unclassified | 917 |
| 1227 | Ga0587128_006456 | 3300059630 | Bacteria | 1443 |
| 1228 | Ga0587071_198685 | 3300060344 | Bacteria | 523 |
| 1229 | Ga0501082_0000373 | 3300060353 | Bacteria | 39570 |
| 1230 | Ga0501082_0000696 | 3300060353 | Bacteria | 29645 |
| 1231 | Ga0501082_0186428 | 3300060353 | Bacteria | 1805 |
| 1232 | Ga0501082_1136514 | 3300060353 | Bacteria | 683 |
| 1233 | Ga0501082_1277207 | 3300060353 | Bacteria | 641 |
| 1234 | Ga0530510_0000454 | 3300061734 | Bacteria | 26524 |
| 1235 | Ga0530510_0002560 | 3300061734 | Bacteria | 12499 |
| 1236 | Ga0530510_0028241 | 3300061734 | Bacteria | 4022 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_11051138 | Ga0207709_110511382 | 81 |
| 2 | 3300025937 | Ga0207669_11089734 | Ga0207669_110897342 | 81 |
| 3 | 3300005340 | Ga0070689_100156161 | Ga0070689_1001561613 | 84 |
| 4 | 3300005343 | Ga0070687_100079062 | Ga0070687_1000790623 | 84 |
| 5 | 3300005345 | Ga0070692_10129584 | Ga0070692_101295841 | 84 |
| 6 | 3300005438 | Ga0070701_10019016 | Ga0070701_100190162 | 84 |
| 7 | 3300005467 | Ga0070706_101747147 | Ga0070706_1017471471 | 84 |
| 8 | 3300005545 | Ga0070695_100123103 | Ga0070695_1001231033 | 84 |
| 9 | 3300005841 | Ga0068863_101662527 | Ga0068863_1016625272 | 84 |
| 10 | 3300025910 | Ga0207684_11166818 | Ga0207684_111668182 | 84 |
| 11 | 3300025936 | Ga0207670_10160518 | Ga0207670_101605183 | 84 |
| 12 | 3300025942 | Ga0207689_10040929 | Ga0207689_100409294 | 84 |
| 13 | 3300035114 | Ga0373939_0185296 | Ga0373939_0185296_452_718 | 84 |
| 14 | 3300035115 | Ga0373941_0079923 | Ga0373941_0079923_168_434 | 84 |
| 15 | iso_pu_bacteria | 2744054611 | 2744955251 | 86 |
| 16 | iso_pu_bacteria | 2863067949 | 2863068059 | 86 |
| 17 | iso_pu_bacteria | 8055066027 | 8055071739 | 86 |
| 18 | iso_pu_bacteria | 8055172936 | 8055179248 | 86 |
| 19 | 3300031731 | Ga0307405_11174205 | Ga0307405_111742051 | 87 |
| 20 | 3300032126 | Ga0307415_101155936 | Ga0307415_1011559363 | 87 |
| 21 | 3300005327 | Ga0070658_11303641 | Ga0070658_113036412 | 88 |
| 22 | 3300005329 | Ga0070683_101523177 | Ga0070683_1015231771 | 88 |
| 23 | 3300005347 | Ga0070668_101119947 | Ga0070668_1011199472 | 88 |
| 24 | 3300005444 | Ga0070694_101238563 | Ga0070694_1012385632 | 88 |
| 25 | 3300005459 | Ga0068867_102217962 | Ga0068867_1022179622 | 88 |
| 26 | 3300005543 | Ga0070672_100739761 | Ga0070672_1007397613 | 88 |
| 27 | 3300009098 | Ga0105245_11284516 | Ga0105245_112845162 | 88 |
| 28 | 3300009148 | Ga0105243_11296439 | Ga0105243_112964392 | 88 |
| 29 | 3300009174 | Ga0105241_11927088 | Ga0105241_119270881 | 88 |
| 30 | 3300014326 | Ga0157380_10162222 | Ga0157380_101622222 | 88 |
| 31 | 3300025940 | Ga0207691_10385097 | Ga0207691_103850973 | 88 |
| 32 | 3300025944 | Ga0207661_11836559 | Ga0207661_118365591 | 88 |
| 33 | 3300025972 | Ga0207668_10585122 | Ga0207668_105851223 | 88 |
| 34 | 3300028379 | Ga0268266_11248177 | Ga0268266_112481772 | 88 |
| 35 | 3300037418 | Ga0395900_1678598 | Ga0395900_1678598_194_460 | 88 |
| 36 | 3300048905 | Ga0496102_1852370 | Ga0496102_1852370_203_469 | 88 |
| 37 | 3300048907 | Ga0496104_0178488 | Ga0496104_0178488_644_910 | 88 |
| 38 | 3300048911 | Ga0496108_0470252 | Ga0496108_0470252_376_642 | 88 |
| 39 | 3300048912 | Ga0496109_0059001 | Ga0496109_0059001_1876_2142 | 88 |
| 40 | 3300048913 | Ga0496110_0506179 | Ga0496110_0506179_350_616 | 88 |
| 41 | 3300048914 | Ga0496111_0443665 | Ga0496111_0443665_52_318 | 88 |
| 42 | 3300048917 | Ga0496114_0673297 | Ga0496114_0673297_52_318 | 88 |
| 43 | 3300004799 | Ga0058863_11599248 | Ga0058863_115992481 | 89 |
| 44 | 3300004803 | Ga0058862_12586157 | Ga0058862_125861571 | 89 |
| 45 | 3300005328 | Ga0070676_10160328 | Ga0070676_101603282 | 89 |
| 46 | 3300005336 | Ga0070680_101599057 | Ga0070680_1015990572 | 89 |
| 47 | 3300005338 | Ga0068868_101582979 | Ga0068868_1015829791 | 89 |
| 48 | 3300005355 | Ga0070671_100195879 | Ga0070671_1001958794 | 89 |
| 49 | 3300005435 | Ga0070714_100055323 | Ga0070714_1000553236 | 89 |
| 50 | 3300005530 | Ga0070679_100063188 | Ga0070679_1000631884 | 89 |
| 51 | 3300005548 | Ga0070665_100503215 | Ga0070665_1005032152 | 89 |
| 52 | 3300005617 | Ga0068859_100447429 | Ga0068859_1004474292 | 89 |
| 53 | 3300005618 | Ga0068864_100027927 | Ga0068864_1000279275 | 89 |
| 54 | 3300005841 | Ga0068863_100026524 | Ga0068863_1000265241 | 89 |
| 55 | 3300005841 | Ga0068863_102721301 | Ga0068863_1027213012 | 89 |
| 56 | 3300006178 | Ga0075367_10233781 | Ga0075367_102337812 | 89 |
| 57 | 3300006931 | Ga0097620_100447376 | Ga0097620_1004473762 | 89 |
| 58 | 3300009011 | Ga0105251_10085736 | Ga0105251_100857362 | 89 |
| 59 | 3300009098 | Ga0105245_10064792 | Ga0105245_100647924 | 89 |
| 60 | 3300009101 | Ga0105247_10105653 | Ga0105247_101056532 | 89 |
| 61 | 3300009174 | Ga0105241_10395807 | Ga0105241_103958073 | 89 |
| 62 | 3300009177 | Ga0105248_10055968 | Ga0105248_100559683 | 89 |
| 63 | 3300009545 | Ga0105237_11300885 | Ga0105237_113008852 | 89 |
| 64 | 3300009551 | Ga0105238_10479500 | Ga0105238_104795002 | 89 |
| 65 | 3300009553 | Ga0105249_13526288 | Ga0105249_135262882 | 89 |
| 66 | 3300010375 | Ga0105239_10821910 | Ga0105239_108219102 | 89 |
| 67 | 3300013297 | Ga0157378_11645108 | Ga0157378_116451082 | 89 |
| 68 | 3300014968 | Ga0157379_10955709 | Ga0157379_109557092 | 89 |
| 69 | 3300020069 | Ga0197907_10062224 | Ga0197907_100622242 | 89 |
| 70 | 3300020070 | Ga0206356_10756000 | Ga0206356_107560002 | 89 |
| 71 | 3300021358 | Ga0213873_10079077 | Ga0213873_100790772 | 89 |
| 72 | 3300021441 | Ga0213871_10200801 | Ga0213871_102008012 | 89 |
| 73 | 3300025900 | Ga0207710_10322946 | Ga0207710_103229462 | 89 |
| 74 | 3300025912 | Ga0207707_10859034 | Ga0207707_108590341 | 89 |
| 75 | 3300025917 | Ga0207660_11056137 | Ga0207660_110561372 | 89 |
| 76 | 3300025921 | Ga0207652_10079514 | Ga0207652_100795143 | 89 |
| 77 | 3300025924 | Ga0207694_10577387 | Ga0207694_105773872 | 89 |
| 78 | 3300025925 | Ga0207650_10028329 | Ga0207650_100283292 | 89 |
| 79 | 3300025927 | Ga0207687_10037346 | Ga0207687_100373464 | 89 |
| 80 | 3300025929 | Ga0207664_10063610 | Ga0207664_100636107 | 89 |
| 81 | 3300025931 | Ga0207644_11026482 | Ga0207644_110264821 | 89 |
| 82 | 3300025941 | Ga0207711_10483241 | Ga0207711_104832412 | 89 |
| 83 | 3300025972 | Ga0207668_10094577 | Ga0207668_100945772 | 89 |
| 84 | 3300026035 | Ga0207703_10812590 | Ga0207703_108125902 | 89 |
| 85 | 3300026089 | Ga0207648_10759156 | Ga0207648_107591562 | 89 |
| 86 | 3300026095 | Ga0207676_10141666 | Ga0207676_101416664 | 89 |
| 87 | 3300026095 | Ga0207676_10167283 | Ga0207676_101672832 | 89 |
| 88 | 3300028379 | Ga0268266_10406341 | Ga0268266_104063412 | 89 |
| 89 | 3300031456 | Ga0307513_10006720 | Ga0307513_1000672019 | 89 |
| 90 | 3300031691 | Ga0316579_10101216 | Ga0316579_101012162 | 89 |
| 91 | 3300032002 | Ga0307416_101163551 | Ga0307416_1011635512 | 89 |
| 92 | 3300032133 | Ga0316583_10040852 | Ga0316583_100408522 | 89 |
| 93 | 3300033179 | Ga0307507_10085237 | Ga0307507_100852372 | 89 |
| 94 | 3300039062 | Ga0400483_004249 | Ga0400483_004249_1425_1718 | 89 |
| 95 | 3300039062 | Ga0400483_175799 | Ga0400483_175799_397_690 | 89 |
| 96 | 3300039438 | Ga0436360_0070157 | Ga0436360_0070157_289_582 | 89 |
| 97 | 3300039453 | Ga0436362_0916296 | Ga0436362_0916296_3360_3629 | 89 |
| 98 | 3300041456 | Ga0451795_0637961 | Ga0451795_0637961_171_440 | 89 |
| 99 | 3300042438 | Ga0439459_0048877 | Ga0439459_0048877_515_787 | 89 |
| 100 | 3300046461 | Ga0495641_0171219 | Ga0495641_0171219_375_644 | 89 |
| 101 | 3300046472 | Ga0495580_0938835 | Ga0495580_0938835_243_512 | 89 |
| 102 | 3300046476 | Ga0495662_0220375 | Ga0495662_0220375_282_551 | 89 |
| 103 | 3300046499 | Ga0495594_0050670 | Ga0495594_0050670_903_1172 | 89 |
| 104 | 3300047315 | Ga0495581_0569927 | Ga0495581_0569927_314_583 | 89 |
| 105 | 3300048907 | Ga0496104_0192871 | Ga0496104_0192871_833_1102 | 89 |
| 106 | 3300048908 | Ga0496105_0132875 | Ga0496105_0132875_477_746 | 89 |
| 107 | 3300048912 | Ga0496109_1858059 | Ga0496109_1858059_84_353 | 89 |
| 108 | 3300048914 | Ga0496111_1183767 | Ga0496111_1183767_43_324 | 89 |
| 109 | 3300048915 | Ga0496112_0128615 | Ga0496112_0128615_1611_1880 | 89 |
| 110 | 3300048915 | Ga0496112_0467682 | Ga0496112_0467682_66_347 | 89 |
| 111 | 3300048916 | Ga0496113_0088993 | Ga0496113_0088993_1048_1317 | 89 |
| 112 | 3300048916 | Ga0496113_0870307 | Ga0496113_0870307_288_581 | 89 |
| 113 | 3300049570 | Ga0501033_1174323 | Ga0501033_1174323_33_329 | 89 |
| 114 | 3300049575 | Ga0501039_1132676 | Ga0501039_1132676_23_319 | 89 |
| 115 | 3300049576 | Ga0501040_0219142 | Ga0501040_0219142_857_1153 | 89 |
| 116 | 3300050494 | nmdc:mga06z11_93588_c2 | nmdc:mga06z11_93588_c2_309_590 | 89 |
| 117 | 2162886012 | MBSR1b_contig_3941096 | MBSR1b_0118.00000630 | 90 |
| 118 | 2162886012 | MBSR1b_contig_907293 | MBSR1b_0527.00001330 | 90 |
| 119 | 3300001978 | JGI24747J21853_1035595 | JGI24747J21853_10355952 | 90 |
| 120 | 3300001979 | JGI24740J21852_10106836 | JGI24740J21852_101068362 | 90 |
| 121 | 3300003203 | JGI25406J46586_10005292 | JGI25406J46586_100052925 | 90 |
| 122 | 3300003323 | rootH1_10194767 | rootH1_101947674 | 90 |
| 123 | 3300003373 | JGI25407J50210_10000833 | JGI25407J50210_100008334 | 90 |
| 124 | 3300003373 | JGI25407J50210_10016676 | JGI25407J50210_100166763 | 90 |
| 125 | 3300003373 | JGI25407J50210_10056702 | JGI25407J50210_100567021 | 90 |
| 126 | 3300003373 | JGI25407J50210_10088080 | JGI25407J50210_100880801 | 90 |
| 127 | 3300003659 | JGI25404J52841_10009969 | JGI25404J52841_100099694 | 90 |
| 128 | 3300003911 | JGI25405J52794_10055288 | JGI25405J52794_100552883 | 90 |
| 129 | 3300004798 | Ga0058859_11645648 | Ga0058859_116456481 | 90 |
| 130 | 3300004799 | Ga0058863_10899516 | Ga0058863_108995162 | 90 |
| 131 | 3300004800 | Ga0058861_12077379 | Ga0058861_120773792 | 90 |
| 132 | 3300004801 | Ga0058860_11560143 | Ga0058860_115601431 | 90 |
| 133 | 3300004801 | Ga0058860_11738255 | Ga0058860_117382552 | 90 |
| 134 | 3300004801 | Ga0058860_12151675 | Ga0058860_121516752 | 90 |
| 135 | 3300004801 | Ga0058860_12178315 | Ga0058860_121783152 | 90 |
| 136 | 3300005290 | Ga0065712_10274254 | Ga0065712_102742542 | 90 |
| 137 | 3300005293 | Ga0065715_10289222 | Ga0065715_102892222 | 90 |
| 138 | 3300005293 | Ga0065715_10730475 | Ga0065715_107304752 | 90 |
| 139 | 3300005327 | Ga0070658_10331868 | Ga0070658_103318681 | 90 |
| 140 | 3300005328 | Ga0070676_10172052 | Ga0070676_101720522 | 90 |
| 141 | 3300005328 | Ga0070676_11106245 | Ga0070676_111062452 | 90 |
| 142 | 3300005329 | Ga0070683_100078885 | Ga0070683_1000788853 | 90 |
| 143 | 3300005330 | Ga0070690_100021786 | Ga0070690_1000217865 | 90 |
| 144 | 3300005330 | Ga0070690_100158076 | Ga0070690_1001580763 | 90 |
| 145 | 3300005331 | Ga0070670_100341741 | Ga0070670_1003417412 | 90 |
| 146 | 3300005333 | Ga0070677_10633582 | Ga0070677_106335822 | 90 |
| 147 | 3300005334 | Ga0068869_100200806 | Ga0068869_1002008063 | 90 |
| 148 | 3300005334 | Ga0068869_101409204 | Ga0068869_1014092042 | 90 |
| 149 | 3300005334 | Ga0068869_101601707 | Ga0068869_1016017072 | 90 |
| 150 | 3300005335 | Ga0070666_10027739 | Ga0070666_100277394 | 90 |
| 151 | 3300005336 | Ga0070680_100029072 | Ga0070680_1000290725 | 90 |
| 152 | 3300005336 | Ga0070680_101687462 | Ga0070680_1016874622 | 90 |
| 153 | 3300005337 | Ga0070682_101357266 | Ga0070682_1013572662 | 90 |
| 154 | 3300005337 | Ga0070682_101537110 | Ga0070682_1015371102 | 90 |
| 155 | 3300005338 | Ga0068868_100157214 | Ga0068868_1001572142 | 90 |
| 156 | 3300005338 | Ga0068868_100795308 | Ga0068868_1007953082 | 90 |
| 157 | 3300005338 | Ga0068868_102259794 | Ga0068868_1022597942 | 90 |
| 158 | 3300005339 | Ga0070660_100094455 | Ga0070660_1000944554 | 90 |
| 159 | 3300005340 | Ga0070689_100301426 | Ga0070689_1003014262 | 90 |
| 160 | 3300005341 | Ga0070691_10158041 | Ga0070691_101580411 | 90 |
| 161 | 3300005341 | Ga0070691_10159590 | Ga0070691_101595902 | 90 |
| 162 | 3300005343 | Ga0070687_100116027 | Ga0070687_1001160272 | 90 |
| 163 | 3300005344 | Ga0070661_100442954 | Ga0070661_1004429542 | 90 |
| 164 | 3300005344 | Ga0070661_101401537 | Ga0070661_1014015372 | 90 |
| 165 | 3300005344 | Ga0070661_101702382 | Ga0070661_1017023822 | 90 |
| 166 | 3300005345 | Ga0070692_10166930 | Ga0070692_101669302 | 90 |
| 167 | 3300005345 | Ga0070692_10511515 | Ga0070692_105115152 | 90 |
| 168 | 3300005345 | Ga0070692_10964705 | Ga0070692_109647052 | 90 |
| 169 | 3300005347 | Ga0070668_100033387 | Ga0070668_1000333874 | 90 |
| 170 | 3300005347 | Ga0070668_100060524 | Ga0070668_1000605242 | 90 |
| 171 | 3300005347 | Ga0070668_101656047 | Ga0070668_1016560472 | 90 |
| 172 | 3300005353 | Ga0070669_100728507 | Ga0070669_1007285072 | 90 |
| 173 | 3300005354 | Ga0070675_100008751 | Ga0070675_1000087515 | 90 |
| 174 | 3300005355 | Ga0070671_100126208 | Ga0070671_1001262082 | 90 |
| 175 | 3300005355 | Ga0070671_101053297 | Ga0070671_1010532972 | 90 |
| 176 | 3300005356 | Ga0070674_100077219 | Ga0070674_1000772192 | 90 |
| 177 | 3300005364 | Ga0070673_100223684 | Ga0070673_1002236842 | 90 |
| 178 | 3300005364 | Ga0070673_101506029 | Ga0070673_1015060292 | 90 |
| 179 | 3300005365 | Ga0070688_100947161 | Ga0070688_1009471612 | 90 |
| 180 | 3300005366 | Ga0070659_100034617 | Ga0070659_1000346173 | 90 |
| 181 | 3300005366 | Ga0070659_100516752 | Ga0070659_1005167522 | 90 |
| 182 | 3300005367 | Ga0070667_100193332 | Ga0070667_1001933323 | 90 |
| 183 | 3300005367 | Ga0070667_100516214 | Ga0070667_1005162142 | 90 |
| 184 | 3300005434 | Ga0070709_10036426 | Ga0070709_100364262 | 90 |
| 185 | 3300005435 | Ga0070714_100006392 | Ga0070714_10000639210 | 90 |
| 186 | 3300005436 | Ga0070713_100054063 | Ga0070713_1000540634 | 90 |
| 187 | 3300005436 | Ga0070713_100192759 | Ga0070713_1001927592 | 90 |
| 188 | 3300005436 | Ga0070713_100948922 | Ga0070713_1009489222 | 90 |
| 189 | 3300005436 | Ga0070713_101863858 | Ga0070713_1018638582 | 90 |
| 190 | 3300005437 | Ga0070710_10026356 | Ga0070710_100263563 | 90 |
| 191 | 3300005437 | Ga0070710_10929638 | Ga0070710_109296381 | 90 |
| 192 | 3300005438 | Ga0070701_10013994 | Ga0070701_100139942 | 90 |
| 193 | 3300005439 | Ga0070711_100001426 | Ga0070711_1000014269 | 90 |
| 194 | 3300005439 | Ga0070711_100357553 | Ga0070711_1003575532 | 90 |
| 195 | 3300005439 | Ga0070711_100863563 | Ga0070711_1008635632 | 90 |
| 196 | 3300005439 | Ga0070711_101074934 | Ga0070711_1010749341 | 90 |
| 197 | 3300005439 | Ga0070711_101173638 | Ga0070711_1011736382 | 90 |
| 198 | 3300005439 | Ga0070711_101477800 | Ga0070711_1014778002 | 90 |
| 199 | 3300005440 | Ga0070705_100463586 | Ga0070705_1004635862 | 90 |
| 200 | 3300005440 | Ga0070705_100852967 | Ga0070705_1008529672 | 90 |
| 201 | 3300005440 | Ga0070705_101439097 | Ga0070705_1014390971 | 90 |
| 202 | 3300005441 | Ga0070700_100033958 | Ga0070700_1000339583 | 90 |
| 203 | 3300005445 | Ga0070708_100072487 | Ga0070708_1000724872 | 90 |
| 204 | 3300005445 | Ga0070708_100425108 | Ga0070708_1004251082 | 90 |
| 205 | 3300005445 | Ga0070708_100450243 | Ga0070708_1004502432 | 90 |
| 206 | 3300005445 | Ga0070708_102077276 | Ga0070708_1020772762 | 90 |
| 207 | 3300005455 | Ga0070663_100174784 | Ga0070663_1001747844 | 90 |
| 208 | 3300005455 | Ga0070663_100611315 | Ga0070663_1006113152 | 90 |
| 209 | 3300005455 | Ga0070663_100618747 | Ga0070663_1006187471 | 90 |
| 210 | 3300005456 | Ga0070678_100092333 | Ga0070678_1000923332 | 90 |
| 211 | 3300005456 | Ga0070678_100244244 | Ga0070678_1002442443 | 90 |
| 212 | 3300005456 | Ga0070678_101477888 | Ga0070678_1014778882 | 90 |
| 213 | 3300005457 | Ga0070662_100204352 | Ga0070662_1002043522 | 90 |
| 214 | 3300005457 | Ga0070662_100291802 | Ga0070662_1002918022 | 90 |
| 215 | 3300005457 | Ga0070662_101867194 | Ga0070662_1018671942 | 90 |
| 216 | 3300005458 | Ga0070681_10068567 | Ga0070681_100685674 | 90 |
| 217 | 3300005458 | Ga0070681_10611244 | Ga0070681_106112441 | 90 |
| 218 | 3300005458 | Ga0070681_10639694 | Ga0070681_106396942 | 90 |
| 219 | 3300005458 | Ga0070681_10694981 | Ga0070681_106949812 | 90 |
| 220 | 3300005458 | Ga0070681_11745870 | Ga0070681_117458702 | 90 |
| 221 | 3300005459 | Ga0068867_100318504 | Ga0068867_1003185043 | 90 |
| 222 | 3300005459 | Ga0068867_100858644 | Ga0068867_1008586442 | 90 |
| 223 | 3300005459 | Ga0068867_101180951 | Ga0068867_1011809511 | 90 |
| 224 | 3300005466 | Ga0070685_10011703 | Ga0070685_100117034 | 90 |
| 225 | 3300005466 | Ga0070685_10346031 | Ga0070685_103460312 | 90 |
| 226 | 3300005466 | Ga0070685_10565146 | Ga0070685_105651462 | 90 |
| 227 | 3300005466 | Ga0070685_11129105 | Ga0070685_111291052 | 90 |
| 228 | 3300005467 | Ga0070706_100423089 | Ga0070706_1004230892 | 90 |
| 229 | 3300005467 | Ga0070706_100426688 | Ga0070706_1004266882 | 90 |
| 230 | 3300005467 | Ga0070706_100476267 | Ga0070706_1004762672 | 90 |
| 231 | 3300005467 | Ga0070706_101738191 | Ga0070706_1017381911 | 90 |
| 232 | 3300005468 | Ga0070707_100078604 | Ga0070707_1000786043 | 90 |
| 233 | 3300005468 | Ga0070707_100719183 | Ga0070707_1007191832 | 90 |
| 234 | 3300005468 | Ga0070707_101275967 | Ga0070707_1012759672 | 90 |
| 235 | 3300005471 | Ga0070698_100028747 | Ga0070698_1000287472 | 90 |
| 236 | 3300005471 | Ga0070698_100102261 | Ga0070698_1001022612 | 90 |
| 237 | 3300005471 | Ga0070698_100198840 | Ga0070698_1001988402 | 90 |
| 238 | 3300005518 | Ga0070699_100136318 | Ga0070699_1001363184 | 90 |
| 239 | 3300005518 | Ga0070699_100169295 | Ga0070699_1001692953 | 90 |
| 240 | 3300005518 | Ga0070699_100221686 | Ga0070699_1002216862 | 90 |
| 241 | 3300005518 | Ga0070699_101007202 | Ga0070699_1010072022 | 90 |
| 242 | 3300005518 | Ga0070699_101677945 | Ga0070699_1016779452 | 90 |
| 243 | 3300005518 | Ga0070699_101986071 | Ga0070699_1019860712 | 90 |
| 244 | 3300005530 | Ga0070679_100019756 | Ga0070679_1000197567 | 90 |
| 245 | 3300005530 | Ga0070679_100683549 | Ga0070679_1006835492 | 90 |
| 246 | 3300005530 | Ga0070679_100921245 | Ga0070679_1009212452 | 90 |
| 247 | 3300005535 | Ga0070684_100116279 | Ga0070684_1001162792 | 90 |
| 248 | 3300005535 | Ga0070684_100726946 | Ga0070684_1007269463 | 90 |
| 249 | 3300005536 | Ga0070697_100455830 | Ga0070697_1004558302 | 90 |
| 250 | 3300005539 | Ga0068853_100061482 | Ga0068853_1000614822 | 90 |
| 251 | 3300005539 | Ga0068853_100315627 | Ga0068853_1003156272 | 90 |
| 252 | 3300005543 | Ga0070672_100027866 | Ga0070672_1000278664 | 90 |
| 253 | 3300005544 | Ga0070686_100015286 | Ga0070686_1000152864 | 90 |
| 254 | 3300005544 | Ga0070686_100498965 | Ga0070686_1004989652 | 90 |
| 255 | 3300005545 | Ga0070695_100048509 | Ga0070695_1000485095 | 90 |
| 256 | 3300005546 | Ga0070696_100004836 | Ga0070696_1000048365 | 90 |
| 257 | 3300005547 | Ga0070693_100019269 | Ga0070693_1000192693 | 90 |
| 258 | 3300005547 | Ga0070693_101584368 | Ga0070693_1015843681 | 90 |
| 259 | 3300005548 | Ga0070665_100996374 | Ga0070665_1009963742 | 90 |
| 260 | 3300005548 | Ga0070665_101004512 | Ga0070665_1010045122 | 90 |
| 261 | 3300005549 | Ga0070704_100296736 | Ga0070704_1002967363 | 90 |
| 262 | 3300005549 | Ga0070704_101813862 | Ga0070704_1018138622 | 90 |
| 263 | 3300005563 | Ga0068855_100599164 | Ga0068855_1005991642 | 90 |
| 264 | 3300005563 | Ga0068855_101802898 | Ga0068855_1018028982 | 90 |
| 265 | 3300005563 | Ga0068855_102495585 | Ga0068855_1024955852 | 90 |
| 266 | 3300005564 | Ga0070664_100026709 | Ga0070664_1000267091 | 90 |
| 267 | 3300005577 | Ga0068857_100026603 | Ga0068857_1000266036 | 90 |
| 268 | 3300005577 | Ga0068857_100039067 | Ga0068857_1000390672 | 90 |
| 269 | 3300005578 | Ga0068854_100028549 | Ga0068854_1000285493 | 90 |
| 270 | 3300005578 | Ga0068854_100152768 | Ga0068854_1001527683 | 90 |
| 271 | 3300005614 | Ga0068856_100211973 | Ga0068856_1002119733 | 90 |
| 272 | 3300005615 | Ga0070702_100051134 | Ga0070702_1000511342 | 90 |
| 273 | 3300005616 | Ga0068852_100088656 | Ga0068852_1000886562 | 90 |
| 274 | 3300005616 | Ga0068852_100181073 | Ga0068852_1001810732 | 90 |
| 275 | 3300005616 | Ga0068852_100920473 | Ga0068852_1009204731 | 90 |
| 276 | 3300005617 | Ga0068859_100054371 | Ga0068859_1000543713 | 90 |
| 277 | 3300005618 | Ga0068864_100401860 | Ga0068864_1004018602 | 90 |
| 278 | 3300005618 | Ga0068864_100509781 | Ga0068864_1005097812 | 90 |
| 279 | 3300005618 | Ga0068864_102200130 | Ga0068864_1022001301 | 90 |
| 280 | 3300005718 | Ga0068866_10125816 | Ga0068866_101258162 | 90 |
| 281 | 3300005719 | Ga0068861_100043723 | Ga0068861_1000437235 | 90 |
| 282 | 3300005719 | Ga0068861_100272308 | Ga0068861_1002723082 | 90 |
| 283 | 3300005719 | Ga0068861_100702140 | Ga0068861_1007021403 | 90 |
| 284 | 3300005719 | Ga0068861_101345442 | Ga0068861_1013454423 | 90 |
| 285 | 3300005834 | Ga0068851_10048255 | Ga0068851_100482552 | 90 |
| 286 | 3300005834 | Ga0068851_10872544 | Ga0068851_108725442 | 90 |
| 287 | 3300005840 | Ga0068870_10024232 | Ga0068870_100242322 | 90 |
| 288 | 3300005840 | Ga0068870_10113483 | Ga0068870_101134833 | 90 |
| 289 | 3300005841 | Ga0068863_100258157 | Ga0068863_1002581572 | 90 |
| 290 | 3300005841 | Ga0068863_102228089 | Ga0068863_1022280893 | 90 |
| 291 | 3300005842 | Ga0068858_100167892 | Ga0068858_1001678924 | 90 |
| 292 | 3300005843 | Ga0068860_100162837 | Ga0068860_1001628372 | 90 |
| 293 | 3300005843 | Ga0068860_102178642 | Ga0068860_1021786422 | 90 |
| 294 | 3300005843 | Ga0068860_102380252 | Ga0068860_1023802522 | 90 |
| 295 | 3300005844 | Ga0068862_100756231 | Ga0068862_1007562312 | 90 |
| 296 | 3300005937 | Ga0081455_10005075 | Ga0081455_100050754 | 90 |
| 297 | 3300005981 | Ga0081538_10000212 | Ga0081538_1000021236 | 90 |
| 298 | 3300005981 | Ga0081538_10000947 | Ga0081538_1000094717 | 90 |
| 299 | 3300005981 | Ga0081538_10006746 | Ga0081538_100067465 | 90 |
| 300 | 3300005981 | Ga0081538_10015131 | Ga0081538_100151312 | 90 |
| 301 | 3300005981 | Ga0081538_10015846 | Ga0081538_100158465 | 90 |
| 302 | 3300005981 | Ga0081538_10021750 | Ga0081538_100217502 | 90 |
| 303 | 3300005981 | Ga0081538_10049026 | Ga0081538_100490262 | 90 |
| 304 | 3300005981 | Ga0081538_10113811 | Ga0081538_101138114 | 90 |
| 305 | 3300005983 | Ga0081540_1000125 | Ga0081540_100012576 | 90 |
| 306 | 3300005983 | Ga0081540_1030082 | Ga0081540_10300823 | 90 |
| 307 | 3300005983 | Ga0081540_1252644 | Ga0081540_12526442 | 90 |
| 308 | 3300005983 | Ga0081540_1261816 | Ga0081540_12618162 | 90 |
| 309 | 3300005985 | Ga0081539_10000179 | Ga0081539_1000017952 | 90 |
| 310 | 3300005985 | Ga0081539_10005342 | Ga0081539_1000534216 | 90 |
| 311 | 3300005985 | Ga0081539_10183721 | Ga0081539_101837214 | 90 |
| 312 | 3300006028 | Ga0070717_10020829 | Ga0070717_100208295 | 90 |
| 313 | 3300006028 | Ga0070717_10144230 | Ga0070717_101442302 | 90 |
| 314 | 3300006028 | Ga0070717_10401489 | Ga0070717_104014892 | 90 |
| 315 | 3300006028 | Ga0070717_11049117 | Ga0070717_110491172 | 90 |
| 316 | 3300006028 | Ga0070717_11049118 | Ga0070717_110491182 | 90 |
| 317 | 3300006028 | Ga0070717_11565935 | Ga0070717_115659352 | 90 |
| 318 | 3300006028 | Ga0070717_11981335 | Ga0070717_119813352 | 90 |
| 319 | 3300006038 | Ga0075365_10336000 | Ga0075365_103360002 | 90 |
| 320 | 3300006048 | Ga0075363_100027439 | Ga0075363_1000274393 | 90 |
| 321 | 3300006051 | Ga0075364_10364038 | Ga0075364_103640382 | 90 |
| 322 | 3300006051 | Ga0075364_11159608 | Ga0075364_111596082 | 90 |
| 323 | 3300006058 | Ga0075432_10003415 | Ga0075432_100034155 | 90 |
| 324 | 3300006058 | Ga0075432_10564123 | Ga0075432_105641232 | 90 |
| 325 | 3300006058 | Ga0075432_10592169 | Ga0075432_105921692 | 90 |
| 326 | 3300006163 | Ga0070715_10062596 | Ga0070715_100625962 | 90 |
| 327 | 3300006173 | Ga0070716_100010618 | Ga0070716_1000106188 | 90 |
| 328 | 3300006173 | Ga0070716_100246465 | Ga0070716_1002464652 | 90 |
| 329 | 3300006173 | Ga0070716_100637153 | Ga0070716_1006371532 | 90 |
| 330 | 3300006175 | Ga0070712_100497448 | Ga0070712_1004974482 | 90 |
| 331 | 3300006175 | Ga0070712_100647742 | Ga0070712_1006477422 | 90 |
| 332 | 3300006175 | Ga0070712_101338183 | Ga0070712_1013381832 | 90 |
| 333 | 3300006186 | Ga0075369_10655235 | Ga0075369_106552352 | 90 |
| 334 | 3300006237 | Ga0097621_100138858 | Ga0097621_1001388584 | 90 |
| 335 | 3300006237 | Ga0097621_101186722 | Ga0097621_1011867222 | 90 |
| 336 | 3300006353 | Ga0075370_10171354 | Ga0075370_101713542 | 90 |
| 337 | 3300006353 | Ga0075370_10592296 | Ga0075370_105922962 | 90 |
| 338 | 3300006358 | Ga0068871_100829597 | Ga0068871_1008295972 | 90 |
| 339 | 3300006358 | Ga0068871_101273919 | Ga0068871_1012739193 | 90 |
| 340 | 3300006844 | Ga0075428_100012144 | Ga0075428_1000121444 | 90 |
| 341 | 3300006844 | Ga0075428_100083713 | Ga0075428_1000837132 | 90 |
| 342 | 3300006844 | Ga0075428_100914291 | Ga0075428_1009142912 | 90 |
| 343 | 3300006844 | Ga0075428_102677222 | Ga0075428_1026772221 | 90 |
| 344 | 3300006846 | Ga0075430_100008071 | Ga0075430_10000807111 | 90 |
| 345 | 3300006846 | Ga0075430_100017068 | Ga0075430_1000170683 | 90 |
| 346 | 3300006846 | Ga0075430_100038408 | Ga0075430_1000384084 | 90 |
| 347 | 3300006847 | Ga0075431_100000246 | Ga0075431_10000024623 | 90 |
| 348 | 3300006847 | Ga0075431_100017656 | Ga0075431_1000176569 | 90 |
| 349 | 3300006847 | Ga0075431_100522370 | Ga0075431_1005223702 | 90 |
| 350 | 3300006852 | Ga0075433_10099639 | Ga0075433_100996392 | 90 |
| 351 | 3300006852 | Ga0075433_10758212 | Ga0075433_107582122 | 90 |
| 352 | 3300006852 | Ga0075433_11554971 | Ga0075433_115549712 | 90 |
| 353 | 3300006871 | Ga0075434_101166867 | Ga0075434_1011668672 | 90 |
| 354 | 3300006871 | Ga0075434_102378702 | Ga0075434_1023787021 | 90 |
| 355 | 3300006880 | Ga0075429_100003454 | Ga0075429_1000034543 | 90 |
| 356 | 3300006880 | Ga0075429_100049390 | Ga0075429_1000493904 | 90 |
| 357 | 3300006881 | Ga0068865_100187050 | Ga0068865_1001870502 | 90 |
| 358 | 3300006881 | Ga0068865_100426121 | Ga0068865_1004261212 | 90 |
| 359 | 3300006881 | Ga0068865_100768273 | Ga0068865_1007682732 | 90 |
| 360 | 3300006914 | Ga0075436_100207579 | Ga0075436_1002075791 | 90 |
| 361 | 3300006914 | Ga0075436_100844124 | Ga0075436_1008441241 | 90 |
| 362 | 3300006931 | Ga0097620_100054371 | Ga0097620_1000543713 | 90 |
| 363 | 3300007076 | Ga0075435_100303590 | Ga0075435_1003035902 | 90 |
| 364 | 3300007076 | Ga0075435_100307606 | Ga0075435_1003076062 | 90 |
| 365 | 3300007076 | Ga0075435_100330870 | Ga0075435_1003308703 | 90 |
| 366 | 3300007076 | Ga0075435_100837093 | Ga0075435_1008370932 | 90 |
| 367 | 3300009011 | Ga0105251_10018255 | Ga0105251_100182555 | 90 |
| 368 | 3300009036 | Ga0105244_10099659 | Ga0105244_100996592 | 90 |
| 369 | 3300009092 | Ga0105250_10240481 | Ga0105250_102404812 | 90 |
| 370 | 3300009093 | Ga0105240_10393500 | Ga0105240_103935002 | 90 |
| 371 | 3300009094 | Ga0111539_10053806 | Ga0111539_100538069 | 90 |
| 372 | 3300009094 | Ga0111539_10157593 | Ga0111539_101575932 | 90 |
| 373 | 3300009094 | Ga0111539_10161724 | Ga0111539_101617243 | 90 |
| 374 | 3300009094 | Ga0111539_10394425 | Ga0111539_103944255 | 90 |
| 375 | 3300009094 | Ga0111539_10555773 | Ga0111539_105557732 | 90 |
| 376 | 3300009094 | Ga0111539_11579225 | Ga0111539_115792253 | 90 |
| 377 | 3300009094 | Ga0111539_12066323 | Ga0111539_120663232 | 90 |
| 378 | 3300009098 | Ga0105245_10115988 | Ga0105245_101159885 | 90 |
| 379 | 3300009098 | Ga0105245_10429208 | Ga0105245_104292082 | 90 |
| 380 | 3300009098 | Ga0105245_10694743 | Ga0105245_106947432 | 90 |
| 381 | 3300009101 | Ga0105247_10124036 | Ga0105247_101240364 | 90 |
| 382 | 3300009147 | Ga0114129_10146873 | Ga0114129_101468735 | 90 |
| 383 | 3300009147 | Ga0114129_10173387 | Ga0114129_101733872 | 90 |
| 384 | 3300009147 | Ga0114129_10304138 | Ga0114129_103041382 | 90 |
| 385 | 3300009147 | Ga0114129_10448341 | Ga0114129_104483412 | 90 |
| 386 | 3300009147 | Ga0114129_10916141 | Ga0114129_109161412 | 90 |
| 387 | 3300009147 | Ga0114129_10956757 | Ga0114129_109567572 | 90 |
| 388 | 3300009147 | Ga0114129_10982315 | Ga0114129_109823153 | 90 |
| 389 | 3300009147 | Ga0114129_11311959 | Ga0114129_113119592 | 90 |
| 390 | 3300009148 | Ga0105243_10312695 | Ga0105243_103126954 | 90 |
| 391 | 3300009174 | Ga0105241_10047409 | Ga0105241_100474093 | 90 |
| 392 | 3300009174 | Ga0105241_12320882 | Ga0105241_123208821 | 90 |
| 393 | 3300009176 | Ga0105242_10131871 | Ga0105242_101318712 | 90 |
| 394 | 3300009177 | Ga0105248_10305272 | Ga0105248_103052723 | 90 |
| 395 | 3300009177 | Ga0105248_10318407 | Ga0105248_103184072 | 90 |
| 396 | 3300009545 | Ga0105237_11010517 | Ga0105237_110105172 | 90 |
| 397 | 3300009545 | Ga0105237_11079414 | Ga0105237_110794142 | 90 |
| 398 | 3300009551 | Ga0105238_10024849 | Ga0105238_100248492 | 90 |
| 399 | 3300009551 | Ga0105238_10186972 | Ga0105238_101869723 | 90 |
| 400 | 3300009551 | Ga0105238_11264875 | Ga0105238_112648753 | 90 |
| 401 | 3300009551 | Ga0105238_11354494 | Ga0105238_113544942 | 90 |
| 402 | 3300009553 | Ga0105249_10013769 | Ga0105249_100137699 | 90 |
| 403 | 3300009553 | Ga0105249_10188458 | Ga0105249_101884582 | 90 |
| 404 | 3300009553 | Ga0105249_10772584 | Ga0105249_107725842 | 90 |
| 405 | 3300009553 | Ga0105249_10859814 | Ga0105249_108598142 | 90 |
| 406 | 3300009553 | Ga0105249_11096500 | Ga0105249_110965001 | 90 |
| 407 | 3300010375 | Ga0105239_10797698 | Ga0105239_107976982 | 90 |
| 408 | 3300010375 | Ga0105239_11112190 | Ga0105239_111121902 | 90 |
| 409 | 3300010375 | Ga0105239_11381293 | Ga0105239_113812932 | 90 |
| 410 | 3300010375 | Ga0105239_12968151 | Ga0105239_129681512 | 90 |
| 411 | 3300010375 | Ga0105239_12980143 | Ga0105239_129801431 | 90 |
| 412 | 3300010375 | Ga0105239_13620492 | Ga0105239_136204921 | 90 |
| 413 | 3300011119 | Ga0105246_10073676 | Ga0105246_100736765 | 90 |
| 414 | 3300011119 | Ga0105246_10311226 | Ga0105246_103112262 | 90 |
| 415 | 3300011119 | Ga0105246_10319735 | Ga0105246_103197352 | 90 |
| 416 | 3300011119 | Ga0105246_11113452 | Ga0105246_111134522 | 90 |
| 417 | 3300012476 | Ga0157344_1001452 | Ga0157344_10014522 | 90 |
| 418 | 3300012478 | Ga0157328_1006624 | Ga0157328_10066242 | 90 |
| 419 | 3300012481 | Ga0157320_1004341 | Ga0157320_10043412 | 90 |
| 420 | 3300012482 | Ga0157318_1002382 | Ga0157318_10023822 | 90 |
| 421 | 3300012483 | Ga0157337_1012173 | Ga0157337_10121732 | 90 |
| 422 | 3300012487 | Ga0157321_1001536 | Ga0157321_10015363 | 90 |
| 423 | 3300012487 | Ga0157321_1001672 | Ga0157321_10016723 | 90 |
| 424 | 3300012491 | Ga0157329_1010619 | Ga0157329_10106192 | 90 |
| 425 | 3300012492 | Ga0157335_1000732 | Ga0157335_10007322 | 90 |
| 426 | 3300012494 | Ga0157341_1001329 | Ga0157341_10013294 | 90 |
| 427 | 3300012497 | Ga0157319_1005116 | Ga0157319_10051162 | 90 |
| 428 | 3300012498 | Ga0157345_1004555 | Ga0157345_10045552 | 90 |
| 429 | 3300012505 | Ga0157339_1029903 | Ga0157339_10299033 | 90 |
| 430 | 3300012505 | Ga0157339_1042471 | Ga0157339_10424711 | 90 |
| 431 | 3300012507 | Ga0157342_1034889 | Ga0157342_10348891 | 90 |
| 432 | 3300012510 | Ga0157316_1054880 | Ga0157316_10548802 | 90 |
| 433 | 3300012513 | Ga0157326_1007534 | Ga0157326_10075343 | 90 |
| 434 | 3300012513 | Ga0157326_1011009 | Ga0157326_10110092 | 90 |
| 435 | 3300013045 | Ga0154016_118101 | Ga0154016_1181012 | 90 |
| 436 | 3300013059 | Ga0154012_168450 | Ga0154012_1684504 | 90 |
| 437 | 3300013100 | Ga0157373_10059673 | Ga0157373_100596733 | 90 |
| 438 | 3300013102 | Ga0157371_10040069 | Ga0157371_100400694 | 90 |
| 439 | 3300013102 | Ga0157371_10425723 | Ga0157371_104257232 | 90 |
| 440 | 3300013104 | Ga0157370_10215352 | Ga0157370_102153523 | 90 |
| 441 | 3300013105 | Ga0157369_10676920 | Ga0157369_106769202 | 90 |
| 442 | 3300013296 | Ga0157374_11165652 | Ga0157374_111656522 | 90 |
| 443 | 3300013296 | Ga0157374_12329021 | Ga0157374_123290211 | 90 |
| 444 | 3300013296 | Ga0157374_12591812 | Ga0157374_125918122 | 90 |
| 445 | 3300013297 | Ga0157378_10367541 | Ga0157378_103675412 | 90 |
| 446 | 3300013306 | Ga0163162_10081706 | Ga0163162_100817065 | 90 |
| 447 | 3300013306 | Ga0163162_10431206 | Ga0163162_104312062 | 90 |
| 448 | 3300013306 | Ga0163162_13309803 | Ga0163162_133098031 | 90 |
| 449 | 3300013307 | Ga0157372_10150306 | Ga0157372_101503063 | 90 |
| 450 | 3300013307 | Ga0157372_11362142 | Ga0157372_113621422 | 90 |
| 451 | 3300013307 | Ga0157372_11762408 | Ga0157372_117624082 | 90 |
| 452 | 3300013308 | Ga0157375_10252686 | Ga0157375_102526862 | 90 |
| 453 | 3300013308 | Ga0157375_10353462 | Ga0157375_103534622 | 90 |
| 454 | 3300013308 | Ga0157375_10575080 | Ga0157375_105750802 | 90 |
| 455 | 3300013308 | Ga0157375_11026372 | Ga0157375_110263722 | 90 |
| 456 | 3300014325 | Ga0163163_10080375 | Ga0163163_100803756 | 90 |
| 457 | 3300014325 | Ga0163163_10199818 | Ga0163163_101998182 | 90 |
| 458 | 3300014325 | Ga0163163_10544726 | Ga0163163_105447262 | 90 |
| 459 | 3300014325 | Ga0163163_11259353 | Ga0163163_112593532 | 90 |
| 460 | 3300014326 | Ga0157380_10299943 | Ga0157380_102999432 | 90 |
| 461 | 3300014326 | Ga0157380_10744554 | Ga0157380_107445542 | 90 |
| 462 | 3300014326 | Ga0157380_11091886 | Ga0157380_110918862 | 90 |
| 463 | 3300014497 | Ga0182008_10246229 | Ga0182008_102462292 | 90 |
| 464 | 3300014497 | Ga0182008_10260871 | Ga0182008_102608712 | 90 |
| 465 | 3300014745 | Ga0157377_10021726 | Ga0157377_100217262 | 90 |
| 466 | 3300014745 | Ga0157377_10954972 | Ga0157377_109549723 | 90 |
| 467 | 3300014969 | Ga0157376_10328465 | Ga0157376_103284652 | 90 |
| 468 | 3300015265 | Ga0182005_1085550 | Ga0182005_10855502 | 90 |
| 469 | 3300017792 | Ga0163161_10028629 | Ga0163161_100286292 | 90 |
| 470 | 3300017792 | Ga0163161_11140830 | Ga0163161_111408302 | 90 |
| 471 | 3300020069 | Ga0197907_10589343 | Ga0197907_105893437 | 90 |
| 472 | 3300020069 | Ga0197907_10600103 | Ga0197907_106001033 | 90 |
| 473 | 3300020069 | Ga0197907_10771716 | Ga0197907_107717162 | 90 |
| 474 | 3300020069 | Ga0197907_10917418 | Ga0197907_109174185 | 90 |
| 475 | 3300020070 | Ga0206356_10151201 | Ga0206356_101512016 | 90 |
| 476 | 3300020070 | Ga0206356_11021398 | Ga0206356_110213982 | 90 |
| 477 | 3300020070 | Ga0206356_11659164 | Ga0206356_116591641 | 90 |
| 478 | 3300020075 | Ga0206349_1167587 | Ga0206349_11675872 | 90 |
| 479 | 3300020076 | Ga0206355_1486302 | Ga0206355_14863022 | 90 |
| 480 | 3300020076 | Ga0206355_1647528 | Ga0206355_16475283 | 90 |
| 481 | 3300020078 | Ga0206352_11247908 | Ga0206352_112479082 | 90 |
| 482 | 3300020078 | Ga0206352_11337198 | Ga0206352_113371982 | 90 |
| 483 | 3300020080 | Ga0206350_10512250 | Ga0206350_105122503 | 90 |
| 484 | 3300020080 | Ga0206350_10550630 | Ga0206350_105506303 | 90 |
| 485 | 3300020080 | Ga0206350_10991633 | Ga0206350_109916331 | 90 |
| 486 | 3300020080 | Ga0206350_11266182 | Ga0206350_112661822 | 90 |
| 487 | 3300020081 | Ga0206354_10260094 | Ga0206354_102600942 | 90 |
| 488 | 3300020082 | Ga0206353_10778556 | Ga0206353_107785562 | 90 |
| 489 | 3300020082 | Ga0206353_10908020 | Ga0206353_109080202 | 90 |
| 490 | 3300020082 | Ga0206353_11681707 | Ga0206353_116817072 | 90 |
| 491 | 3300021358 | Ga0213873_10150173 | Ga0213873_101501733 | 90 |
| 492 | 3300021384 | Ga0213876_10120256 | Ga0213876_101202561 | 90 |
| 493 | 3300021388 | Ga0213875_10000287 | Ga0213875_1000028712 | 90 |
| 494 | 3300021388 | Ga0213875_10002379 | Ga0213875_100023798 | 90 |
| 495 | 3300021388 | Ga0213875_10143022 | Ga0213875_101430222 | 90 |
| 496 | 3300021388 | Ga0213875_10343934 | Ga0213875_103439342 | 90 |
| 497 | 3300021441 | Ga0213871_10115050 | Ga0213871_101150502 | 90 |
| 498 | 3300022467 | Ga0224712_10174171 | Ga0224712_101741712 | 90 |
| 499 | 3300022467 | Ga0224712_10254322 | Ga0224712_102543222 | 90 |
| 500 | 3300022467 | Ga0224712_10489968 | Ga0224712_104899682 | 90 |
| 501 | 3300022467 | Ga0224712_10503000 | Ga0224712_105030001 | 90 |
| 502 | 3300022467 | Ga0224712_10601044 | Ga0224712_106010442 | 90 |
| 503 | 3300025321 | Ga0207656_10278524 | Ga0207656_102785242 | 90 |
| 504 | 3300025735 | Ga0207713_1141770 | Ga0207713_11417702 | 90 |
| 505 | 3300025885 | Ga0207653_10005525 | Ga0207653_100055254 | 90 |
| 506 | 3300025893 | Ga0207682_10419999 | Ga0207682_104199992 | 90 |
| 507 | 3300025898 | Ga0207692_10051175 | Ga0207692_100511752 | 90 |
| 508 | 3300025898 | Ga0207692_10202706 | Ga0207692_102027062 | 90 |
| 509 | 3300025899 | Ga0207642_10043317 | Ga0207642_100433173 | 90 |
| 510 | 3300025900 | Ga0207710_10482988 | Ga0207710_104829881 | 90 |
| 511 | 3300025901 | Ga0207688_10023261 | Ga0207688_100232615 | 90 |
| 512 | 3300025901 | Ga0207688_10172938 | Ga0207688_101729383 | 90 |
| 513 | 3300025901 | Ga0207688_10184011 | Ga0207688_101840113 | 90 |
| 514 | 3300025903 | Ga0207680_10257363 | Ga0207680_102573632 | 90 |
| 515 | 3300025904 | Ga0207647_10297266 | Ga0207647_102972662 | 90 |
| 516 | 3300025904 | Ga0207647_10361474 | Ga0207647_103614741 | 90 |
| 517 | 3300025905 | Ga0207685_10082938 | Ga0207685_100829382 | 90 |
| 518 | 3300025905 | Ga0207685_10518598 | Ga0207685_105185981 | 90 |
| 519 | 3300025906 | Ga0207699_10021404 | Ga0207699_100214042 | 90 |
| 520 | 3300025906 | Ga0207699_10137991 | Ga0207699_101379913 | 90 |
| 521 | 3300025906 | Ga0207699_10190074 | Ga0207699_101900742 | 90 |
| 522 | 3300025906 | Ga0207699_11336195 | Ga0207699_113361952 | 90 |
| 523 | 3300025907 | Ga0207645_10024982 | Ga0207645_100249824 | 90 |
| 524 | 3300025908 | Ga0207643_10022011 | Ga0207643_100220112 | 90 |
| 525 | 3300025908 | Ga0207643_10169114 | Ga0207643_101691142 | 90 |
| 526 | 3300025909 | Ga0207705_10052746 | Ga0207705_100527461 | 90 |
| 527 | 3300025910 | Ga0207684_10337153 | Ga0207684_103371532 | 90 |
| 528 | 3300025910 | Ga0207684_10374096 | Ga0207684_103740962 | 90 |
| 529 | 3300025910 | Ga0207684_10838960 | Ga0207684_108389602 | 90 |
| 530 | 3300025911 | Ga0207654_10193483 | Ga0207654_101934832 | 90 |
| 531 | 3300025912 | Ga0207707_10019452 | Ga0207707_100194522 | 90 |
| 532 | 3300025912 | Ga0207707_10433096 | Ga0207707_104330962 | 90 |
| 533 | 3300025912 | Ga0207707_10568362 | Ga0207707_105683622 | 90 |
| 534 | 3300025912 | Ga0207707_10913937 | Ga0207707_109139372 | 90 |
| 535 | 3300025914 | Ga0207671_10837532 | Ga0207671_108375321 | 90 |
| 536 | 3300025914 | Ga0207671_11476763 | Ga0207671_114767632 | 90 |
| 537 | 3300025915 | Ga0207693_10083464 | Ga0207693_100834644 | 90 |
| 538 | 3300025915 | Ga0207693_11104438 | Ga0207693_111044381 | 90 |
| 539 | 3300025915 | Ga0207693_11407296 | Ga0207693_114072961 | 90 |
| 540 | 3300025916 | Ga0207663_10002343 | Ga0207663_100023437 | 90 |
| 541 | 3300025916 | Ga0207663_10055972 | Ga0207663_100559722 | 90 |
| 542 | 3300025916 | Ga0207663_10188479 | Ga0207663_101884792 | 90 |
| 543 | 3300025916 | Ga0207663_10285881 | Ga0207663_102858812 | 90 |
| 544 | 3300025916 | Ga0207663_11731693 | Ga0207663_117316932 | 90 |
| 545 | 3300025917 | Ga0207660_10822083 | Ga0207660_108220832 | 90 |
| 546 | 3300025918 | Ga0207662_10008902 | Ga0207662_100089024 | 90 |
| 547 | 3300025919 | Ga0207657_10010851 | Ga0207657_100108516 | 90 |
| 548 | 3300025920 | Ga0207649_10047085 | Ga0207649_100470852 | 90 |
| 549 | 3300025920 | Ga0207649_10757696 | Ga0207649_107576961 | 90 |
| 550 | 3300025921 | Ga0207652_10059326 | Ga0207652_100593262 | 90 |
| 551 | 3300025921 | Ga0207652_10429524 | Ga0207652_104295242 | 90 |
| 552 | 3300025922 | Ga0207646_10563090 | Ga0207646_105630902 | 90 |
| 553 | 3300025922 | Ga0207646_11117306 | Ga0207646_111173062 | 90 |
| 554 | 3300025922 | Ga0207646_11307934 | Ga0207646_113079342 | 90 |
| 555 | 3300025924 | Ga0207694_10206350 | Ga0207694_102063502 | 90 |
| 556 | 3300025924 | Ga0207694_10276150 | Ga0207694_102761502 | 90 |
| 557 | 3300025924 | Ga0207694_11236932 | Ga0207694_112369322 | 90 |
| 558 | 3300025926 | Ga0207659_10320733 | Ga0207659_103207332 | 90 |
| 559 | 3300025927 | Ga0207687_10119070 | Ga0207687_101190703 | 90 |
| 560 | 3300025927 | Ga0207687_10617870 | Ga0207687_106178701 | 90 |
| 561 | 3300025927 | Ga0207687_10701226 | Ga0207687_107012262 | 90 |
| 562 | 3300025927 | Ga0207687_11198204 | Ga0207687_111982042 | 90 |
| 563 | 3300025928 | Ga0207700_10003084 | Ga0207700_100030848 | 90 |
| 564 | 3300025928 | Ga0207700_10008397 | Ga0207700_100083979 | 90 |
| 565 | 3300025928 | Ga0207700_10103401 | Ga0207700_101034014 | 90 |
| 566 | 3300025928 | Ga0207700_10116091 | Ga0207700_101160913 | 90 |
| 567 | 3300025928 | Ga0207700_10176926 | Ga0207700_101769262 | 90 |
| 568 | 3300025929 | Ga0207664_10002753 | Ga0207664_1000275310 | 90 |
| 569 | 3300025929 | Ga0207664_10026416 | Ga0207664_100264162 | 90 |
| 570 | 3300025929 | Ga0207664_10090973 | Ga0207664_100909733 | 90 |
| 571 | 3300025929 | Ga0207664_10282636 | Ga0207664_102826362 | 90 |
| 572 | 3300025931 | Ga0207644_10043226 | Ga0207644_100432262 | 90 |
| 573 | 3300025932 | Ga0207690_10253540 | Ga0207690_102535402 | 90 |
| 574 | 3300025932 | Ga0207690_10511687 | Ga0207690_105116872 | 90 |
| 575 | 3300025933 | Ga0207706_10012770 | Ga0207706_100127704 | 90 |
| 576 | 3300025933 | Ga0207706_10048071 | Ga0207706_100480712 | 90 |
| 577 | 3300025933 | Ga0207706_11219651 | Ga0207706_112196512 | 90 |
| 578 | 3300025933 | Ga0207706_11303192 | Ga0207706_113031922 | 90 |
| 579 | 3300025934 | Ga0207686_11372257 | Ga0207686_113722572 | 90 |
| 580 | 3300025935 | Ga0207709_10024317 | Ga0207709_100243173 | 90 |
| 581 | 3300025936 | Ga0207670_11249769 | Ga0207670_112497692 | 90 |
| 582 | 3300025937 | Ga0207669_10124215 | Ga0207669_101242151 | 90 |
| 583 | 3300025937 | Ga0207669_10167788 | Ga0207669_101677882 | 90 |
| 584 | 3300025937 | Ga0207669_11359742 | Ga0207669_113597422 | 90 |
| 585 | 3300025938 | Ga0207704_10302887 | Ga0207704_103028872 | 90 |
| 586 | 3300025938 | Ga0207704_10336036 | Ga0207704_103360362 | 90 |
| 587 | 3300025938 | Ga0207704_10710173 | Ga0207704_107101731 | 90 |
| 588 | 3300025938 | Ga0207704_11625475 | Ga0207704_116254752 | 90 |
| 589 | 3300025939 | Ga0207665_10025970 | Ga0207665_100259707 | 90 |
| 590 | 3300025939 | Ga0207665_10131467 | Ga0207665_101314673 | 90 |
| 591 | 3300025939 | Ga0207665_10508859 | Ga0207665_105088592 | 90 |
| 592 | 3300025940 | Ga0207691_10033856 | Ga0207691_100338563 | 90 |
| 593 | 3300025940 | Ga0207691_10758526 | Ga0207691_107585262 | 90 |
| 594 | 3300025941 | Ga0207711_10190803 | Ga0207711_101908032 | 90 |
| 595 | 3300025941 | Ga0207711_10556045 | Ga0207711_105560452 | 90 |
| 596 | 3300025941 | Ga0207711_10612788 | Ga0207711_106127883 | 90 |
| 597 | 3300025942 | Ga0207689_10035855 | Ga0207689_100358554 | 90 |
| 598 | 3300025945 | Ga0207679_10751108 | Ga0207679_107511081 | 90 |
| 599 | 3300025949 | Ga0207667_10946181 | Ga0207667_109461812 | 90 |
| 600 | 3300025960 | Ga0207651_10193251 | Ga0207651_101932514 | 90 |
| 601 | 3300025960 | Ga0207651_10505767 | Ga0207651_105057672 | 90 |
| 602 | 3300025960 | Ga0207651_11297176 | Ga0207651_112971762 | 90 |
| 603 | 3300025961 | Ga0207712_10055319 | Ga0207712_100553193 | 90 |
| 604 | 3300025961 | Ga0207712_10375322 | Ga0207712_103753222 | 90 |
| 605 | 3300025972 | Ga0207668_10056825 | Ga0207668_100568252 | 90 |
| 606 | 3300025972 | Ga0207668_10065230 | Ga0207668_100652305 | 90 |
| 607 | 3300025972 | Ga0207668_10783903 | Ga0207668_107839033 | 90 |
| 608 | 3300025981 | Ga0207640_10251188 | Ga0207640_102511883 | 90 |
| 609 | 3300025986 | Ga0207658_10018375 | Ga0207658_100183754 | 90 |
| 610 | 3300025986 | Ga0207658_10083168 | Ga0207658_100831682 | 90 |
| 611 | 3300026023 | Ga0207677_10194477 | Ga0207677_101944772 | 90 |
| 612 | 3300026023 | Ga0207677_10759838 | Ga0207677_107598383 | 90 |
| 613 | 3300026035 | Ga0207703_10055288 | Ga0207703_100552885 | 90 |
| 614 | 3300026035 | Ga0207703_12079678 | Ga0207703_120796781 | 90 |
| 615 | 3300026041 | Ga0207639_11353182 | Ga0207639_113531822 | 90 |
| 616 | 3300026067 | Ga0207678_10004755 | Ga0207678_100047554 | 90 |
| 617 | 3300026067 | Ga0207678_10170136 | Ga0207678_101701364 | 90 |
| 618 | 3300026067 | Ga0207678_10457647 | Ga0207678_104576472 | 90 |
| 619 | 3300026075 | Ga0207708_10023470 | Ga0207708_100234702 | 90 |
| 620 | 3300026075 | Ga0207708_11020813 | Ga0207708_110208132 | 90 |
| 621 | 3300026078 | Ga0207702_10062363 | Ga0207702_100623634 | 90 |
| 622 | 3300026078 | Ga0207702_11951081 | Ga0207702_119510812 | 90 |
| 623 | 3300026078 | Ga0207702_12234160 | Ga0207702_122341602 | 90 |
| 624 | 3300026088 | Ga0207641_10291425 | Ga0207641_102914252 | 90 |
| 625 | 3300026088 | Ga0207641_10574458 | Ga0207641_105744582 | 90 |
| 626 | 3300026089 | Ga0207648_10335248 | Ga0207648_103352482 | 90 |
| 627 | 3300026089 | Ga0207648_10368350 | Ga0207648_103683501 | 90 |
| 628 | 3300026095 | Ga0207676_10065958 | Ga0207676_100659583 | 90 |
| 629 | 3300026095 | Ga0207676_10249835 | Ga0207676_102498353 | 90 |
| 630 | 3300026095 | Ga0207676_10971899 | Ga0207676_109718992 | 90 |
| 631 | 3300026116 | Ga0207674_10003916 | Ga0207674_100039168 | 90 |
| 632 | 3300026116 | Ga0207674_10014777 | Ga0207674_100147775 | 90 |
| 633 | 3300026116 | Ga0207674_11205013 | Ga0207674_112050132 | 90 |
| 634 | 3300026118 | Ga0207675_100002273 | Ga0207675_10000227322 | 90 |
| 635 | 3300026118 | Ga0207675_100014841 | Ga0207675_1000148412 | 90 |
| 636 | 3300026118 | Ga0207675_100596371 | Ga0207675_1005963712 | 90 |
| 637 | 3300026118 | Ga0207675_100667383 | Ga0207675_1006673833 | 90 |
| 638 | 3300026121 | Ga0207683_10002629 | Ga0207683_100026298 | 90 |
| 639 | 3300026121 | Ga0207683_10286074 | Ga0207683_102860744 | 90 |
| 640 | 3300026142 | Ga0207698_10136783 | Ga0207698_101367831 | 90 |
| 641 | 3300026142 | Ga0207698_10228086 | Ga0207698_102280862 | 90 |
| 642 | 3300026142 | Ga0207698_10880820 | Ga0207698_108808201 | 90 |
| 643 | 3300026142 | Ga0207698_11293937 | Ga0207698_112939371 | 90 |
| 644 | 3300027907 | Ga0207428_10001336 | Ga0207428_1000133619 | 90 |
| 645 | 3300027907 | Ga0207428_10581183 | Ga0207428_105811832 | 90 |
| 646 | 3300027907 | Ga0207428_10927328 | Ga0207428_109273283 | 90 |
| 647 | 3300028023 | Ga0265357_1013765 | Ga0265357_10137652 | 90 |
| 648 | 3300028379 | Ga0268266_10215026 | Ga0268266_102150264 | 90 |
| 649 | 3300028379 | Ga0268266_11677443 | Ga0268266_116774432 | 90 |
| 650 | 3300028380 | Ga0268265_10704499 | Ga0268265_107044993 | 90 |
| 651 | 3300028380 | Ga0268265_11084822 | Ga0268265_110848222 | 90 |
| 652 | 3300028380 | Ga0268265_11147400 | Ga0268265_111474002 | 90 |
| 653 | 3300028381 | Ga0268264_10359495 | Ga0268264_103594952 | 90 |
| 654 | 3300028381 | Ga0268264_10685510 | Ga0268264_106855102 | 90 |
| 655 | 3300028381 | Ga0268264_12284514 | Ga0268264_122845142 | 90 |
| 656 | 3300028573 | Ga0265334_10024295 | Ga0265334_100242953 | 90 |
| 657 | 3300028794 | Ga0307515_10234593 | Ga0307515_102345933 | 90 |
| 658 | 3300028800 | Ga0265338_10010522 | Ga0265338_100105225 | 90 |
| 659 | 3300030521 | Ga0307511_10000212 | Ga0307511_1000021257 | 90 |
| 660 | 3300030521 | Ga0307511_10088246 | Ga0307511_100882462 | 90 |
| 661 | 3300030760 | Ga0265762_1092595 | Ga0265762_10925952 | 90 |
| 662 | 3300030760 | Ga0265762_1137384 | Ga0265762_11373842 | 90 |
| 663 | 3300030763 | Ga0265763_1002351 | Ga0265763_10023512 | 90 |
| 664 | 3300030836 | Ga0265767_105926 | Ga0265767_1059262 | 90 |
| 665 | 3300030863 | Ga0265766_1001087 | Ga0265766_10010872 | 90 |
| 666 | 3300030963 | Ga0265768_101295 | Ga0265768_1012952 | 90 |
| 667 | 3300031018 | Ga0265773_1000888 | Ga0265773_10008882 | 90 |
| 668 | 3300031240 | Ga0265320_10011837 | Ga0265320_100118375 | 90 |
| 669 | 3300031241 | Ga0265325_10011636 | Ga0265325_100116366 | 90 |
| 670 | 3300031242 | Ga0265329_10041183 | Ga0265329_100411832 | 90 |
| 671 | 3300031247 | Ga0265340_10015634 | Ga0265340_100156345 | 90 |
| 672 | 3300031249 | Ga0265339_10003699 | Ga0265339_1000369913 | 90 |
| 673 | 3300031250 | Ga0265331_10484126 | Ga0265331_104841261 | 90 |
| 674 | 3300031251 | Ga0265327_10000019 | Ga0265327_10000019307 | 90 |
| 675 | 3300031548 | Ga0307408_100008957 | Ga0307408_1000089574 | 90 |
| 676 | 3300031548 | Ga0307408_100019064 | Ga0307408_1000190642 | 90 |
| 677 | 3300031548 | Ga0307408_100217991 | Ga0307408_1002179911 | 90 |
| 678 | 3300031548 | Ga0307408_101083270 | Ga0307408_1010832702 | 90 |
| 679 | 3300031595 | Ga0265313_10077855 | Ga0265313_100778552 | 90 |
| 680 | 3300031711 | Ga0265314_10010164 | Ga0265314_100101647 | 90 |
| 681 | 3300031712 | Ga0265342_10071088 | Ga0265342_100710883 | 90 |
| 682 | 3300031731 | Ga0307405_10025197 | Ga0307405_100251972 | 90 |
| 683 | 3300031731 | Ga0307405_10090349 | Ga0307405_100903492 | 90 |
| 684 | 3300031731 | Ga0307405_10139218 | Ga0307405_101392185 | 90 |
| 685 | 3300031731 | Ga0307405_10763750 | Ga0307405_107637503 | 90 |
| 686 | 3300031733 | Ga0316577_10175745 | Ga0316577_101757452 | 90 |
| 687 | 3300031824 | Ga0307413_10020604 | Ga0307413_100206042 | 90 |
| 688 | 3300031824 | Ga0307413_10057908 | Ga0307413_100579082 | 90 |
| 689 | 3300031824 | Ga0307413_11317294 | Ga0307413_113172942 | 90 |
| 690 | 3300031852 | Ga0307410_10004986 | Ga0307410_100049866 | 90 |
| 691 | 3300031852 | Ga0307410_10069920 | Ga0307410_100699203 | 90 |
| 692 | 3300031852 | Ga0307410_10571537 | Ga0307410_105715372 | 90 |
| 693 | 3300031852 | Ga0307410_11037091 | Ga0307410_110370912 | 90 |
| 694 | 3300031852 | Ga0307410_11168073 | Ga0307410_111680732 | 90 |
| 695 | 3300031901 | Ga0307406_10127083 | Ga0307406_101270832 | 90 |
| 696 | 3300031901 | Ga0307406_10229811 | Ga0307406_102298112 | 90 |
| 697 | 3300031901 | Ga0307406_10244303 | Ga0307406_102443031 | 90 |
| 698 | 3300031901 | Ga0307406_10252465 | Ga0307406_102524651 | 90 |
| 699 | 3300031901 | Ga0307406_10860565 | Ga0307406_108605652 | 90 |
| 700 | 3300031901 | Ga0307406_10920514 | Ga0307406_109205142 | 90 |
| 701 | 3300031901 | Ga0307406_11421424 | Ga0307406_114214242 | 90 |
| 702 | 3300031903 | Ga0307407_10004283 | Ga0307407_100042837 | 90 |
| 703 | 3300031903 | Ga0307407_10137462 | Ga0307407_101374624 | 90 |
| 704 | 3300031903 | Ga0307407_10214977 | Ga0307407_102149771 | 90 |
| 705 | 3300031903 | Ga0307407_10350275 | Ga0307407_103502754 | 90 |
| 706 | 3300031903 | Ga0307407_11474433 | Ga0307407_114744332 | 90 |
| 707 | 3300031911 | Ga0307412_10153876 | Ga0307412_101538762 | 90 |
| 708 | 3300031911 | Ga0307412_10432161 | Ga0307412_104321611 | 90 |
| 709 | 3300031911 | Ga0307412_10539889 | Ga0307412_105398892 | 90 |
| 710 | 3300031911 | Ga0307412_11130256 | Ga0307412_111302561 | 90 |
| 711 | 3300031995 | Ga0307409_100006641 | Ga0307409_1000066412 | 90 |
| 712 | 3300031995 | Ga0307409_100022131 | Ga0307409_1000221317 | 90 |
| 713 | 3300031995 | Ga0307409_100051560 | Ga0307409_1000515603 | 90 |
| 714 | 3300031995 | Ga0307409_100108333 | Ga0307409_1001083333 | 90 |
| 715 | 3300031995 | Ga0307409_100154335 | Ga0307409_1001543355 | 90 |
| 716 | 3300031995 | Ga0307409_100609978 | Ga0307409_1006099782 | 90 |
| 717 | 3300032002 | Ga0307416_100082530 | Ga0307416_1000825302 | 90 |
| 718 | 3300032002 | Ga0307416_100167011 | Ga0307416_1001670113 | 90 |
| 719 | 3300032002 | Ga0307416_100441418 | Ga0307416_1004414184 | 90 |
| 720 | 3300032002 | Ga0307416_101554318 | Ga0307416_1015543182 | 90 |
| 721 | 3300032004 | Ga0307414_10107170 | Ga0307414_101071701 | 90 |
| 722 | 3300032004 | Ga0307414_10212664 | Ga0307414_102126643 | 90 |
| 723 | 3300032004 | Ga0307414_10821594 | Ga0307414_108215942 | 90 |
| 724 | 3300032004 | Ga0307414_11132289 | Ga0307414_111322892 | 90 |
| 725 | 3300032004 | Ga0307414_11934555 | Ga0307414_119345552 | 90 |
| 726 | 3300032005 | Ga0307411_10025146 | Ga0307411_100251462 | 90 |
| 727 | 3300032005 | Ga0307411_10134400 | Ga0307411_101344005 | 90 |
| 728 | 3300032005 | Ga0307411_10188023 | Ga0307411_101880232 | 90 |
| 729 | 3300032005 | Ga0307411_10435782 | Ga0307411_104357822 | 90 |
| 730 | 3300032005 | Ga0307411_11661178 | Ga0307411_116611781 | 90 |
| 731 | 3300032126 | Ga0307415_100011821 | Ga0307415_1000118212 | 90 |
| 732 | 3300032126 | Ga0307415_100581803 | Ga0307415_1005818034 | 90 |
| 733 | 3300032126 | Ga0307415_100898092 | Ga0307415_1008980922 | 90 |
| 734 | 3300033179 | Ga0307507_10000329 | Ga0307507_1000032926 | 90 |
| 735 | 3300033544 | Ga0316215_1017545 | Ga0316215_10175452 | 90 |
| 736 | 3300033545 | Ga0316214_1002972 | Ga0316214_10029722 | 90 |
| 737 | 3300033545 | Ga0316214_1008567 | Ga0316214_10085673 | 90 |
| 738 | 3300033547 | Ga0316212_1006199 | Ga0316212_10061992 | 90 |
| 739 | 3300034816 | Ga0373930_0030062 | Ga0373930_0030062_618_890 | 90 |
| 740 | 3300034818 | Ga0373950_0062746 | Ga0373950_0062746_77_349 | 90 |
| 741 | 3300034820 | Ga0373959_0014093 | Ga0373959_0014093_866_1138 | 90 |
| 742 | 3300034957 | Ga0373938_0004895 | Ga0373938_0004895_1731_2003 | 90 |
| 743 | 3300035083 | Ga0373926_0001004 | Ga0373926_0001004_2573_2845 | 90 |
| 744 | 3300035083 | Ga0373926_0105762 | Ga0373926_0105762_536_808 | 90 |
| 745 | 3300035085 | Ga0373929_0027832 | Ga0373929_0027832_406_678 | 90 |
| 746 | 3300035086 | Ga0373934_0005441 | Ga0373934_0005441_1615_1887 | 90 |
| 747 | 3300035088 | Ga0373940_0207423 | Ga0373940_0207423_52_324 | 90 |
| 748 | 3300035089 | Ga0373944_0006255 | Ga0373944_0006255_1233_1505 | 90 |
| 749 | 3300035089 | Ga0373944_0030808 | Ga0373944_0030808_27_299 | 90 |
| 750 | 3300035089 | Ga0373944_0288706 | Ga0373944_0288706_106_378 | 90 |
| 751 | 3300035090 | Ga0373949_0019283 | Ga0373949_0019283_912_1184 | 90 |
| 752 | 3300035091 | Ga0373951_0197736 | Ga0373951_0197736_205_477 | 90 |
| 753 | 3300035092 | Ga0373952_0025270 | Ga0373952_0025270_315_587 | 90 |
| 754 | 3300035111 | Ga0373923_0008519 | Ga0373923_0008519_1881_2153 | 90 |
| 755 | 3300035111 | Ga0373923_0028820 | Ga0373923_0028820_182_454 | 90 |
| 756 | 3300035113 | Ga0373936_0000482 | Ga0373936_0000482_12899_13171 | 90 |
| 757 | 3300035113 | Ga0373936_0004605 | Ga0373936_0004605_483_755 | 90 |
| 758 | 3300035113 | Ga0373936_0462800 | Ga0373936_0462800_30_302 | 90 |
| 759 | 3300035113 | Ga0373936_0631953 | Ga0373936_0631953_56_328 | 90 |
| 760 | 3300035114 | Ga0373939_0115153 | Ga0373939_0115153_329_601 | 90 |
| 761 | 3300035115 | Ga0373941_0007620 | Ga0373941_0007620_321_593 | 90 |
| 762 | 3300035116 | Ga0373945_0000485 | Ga0373945_0000485_2574_2846 | 90 |
| 763 | 3300035116 | Ga0373945_0002240 | Ga0373945_0002240_160_432 | 90 |
| 764 | 3300035118 | Ga0373954_0012340 | Ga0373954_0012340_2636_2908 | 90 |
| 765 | 3300035118 | Ga0373954_0567360 | Ga0373954_0567360_246_518 | 90 |
| 766 | 3300035119 | Ga0373956_0004367 | Ga0373956_0004367_396_668 | 90 |
| 767 | 3300035119 | Ga0373956_0013013 | Ga0373956_0013013_1115_1387 | 90 |
| 768 | 3300035119 | Ga0373956_0139935 | Ga0373956_0139935_526_798 | 90 |
| 769 | 3300035120 | Ga0373957_0118082 | Ga0373957_0118082_201_473 | 90 |
| 770 | 3300035170 | Ga0373943_0000368 | Ga0373943_0000368_10813_11085 | 90 |
| 771 | 3300035170 | Ga0373943_0014761 | Ga0373943_0014761_1491_1763 | 90 |
| 772 | 3300035170 | Ga0373943_0061321 | Ga0373943_0061321_1135_1407 | 90 |
| 773 | 3300035171 | Ga0373946_0002015 | Ga0373946_0002015_1619_1891 | 90 |
| 774 | 3300035171 | Ga0373946_0003630 | Ga0373946_0003630_148_420 | 90 |
| 775 | 3300035172 | Ga0373955_0007874 | Ga0373955_0007874_4576_4848 | 90 |
| 776 | 3300035172 | Ga0373955_0034979 | Ga0373955_0034979_971_1243 | 90 |
| 777 | 3300035172 | Ga0373955_0081613 | Ga0373955_0081613_223_495 | 90 |
| 778 | 3300035207 | Ga0373942_0024119 | Ga0373942_0024119_1174_1446 | 90 |
| 779 | 3300035398 | Ga0316574_0003093 | Ga0316574_0003093_511_816 | 90 |
| 780 | 3300035410 | Ga0373924_0034235 | Ga0373924_0034235_387_659 | 90 |
| 781 | 3300035410 | Ga0373924_0299081 | Ga0373924_0299081_170_442 | 90 |
| 782 | 3300035691 | Ga0373931_0071382 | Ga0373931_0071382_837_1109 | 90 |
| 783 | 3300035691 | Ga0373931_0364852 | Ga0373931_0364852_94_366 | 90 |
| 784 | 3300035692 | Ga0373935_0003807 | Ga0373935_0003807_1903_2175 | 90 |
| 785 | 3300035692 | Ga0373935_0015929 | Ga0373935_0015929_3769_4041 | 90 |
| 786 | 3300035692 | Ga0373935_0088136 | Ga0373935_0088136_636_908 | 90 |
| 787 | 3300035695 | Ga0373927_0002270 | Ga0373927_0002270_2377_2649 | 90 |
| 788 | 3300035695 | Ga0373927_0936832 | Ga0373927_0936832_255_527 | 90 |
| 789 | 3300035724 | Ga0373933_0035134 | Ga0373933_0035134_2453_2725 | 90 |
| 790 | 3300035724 | Ga0373933_0389210 | Ga0373933_0389210_106_378 | 90 |
| 791 | 3300035725 | Ga0373947_0009607 | Ga0373947_0009607_1617_1889 | 90 |
| 792 | 3300035725 | Ga0373947_0070086 | Ga0373947_0070086_565_837 | 90 |
| 793 | 3300036401 | Ga0373937_0064872 | Ga0373937_0064872_596_868 | 90 |
| 794 | 3300036401 | Ga0373937_0098972 | Ga0373937_0098972_979_1251 | 90 |
| 795 | 3300036401 | Ga0373937_0374115 | Ga0373937_0374115_664_945 | 90 |
| 796 | 3300036401 | Ga0373937_0378462 | Ga0373937_0378462_274_546 | 90 |
| 797 | 3300037068 | Ga0373925_0045325 | Ga0373925_0045325_1238_1510 | 90 |
| 798 | 3300037068 | Ga0373925_0512065 | Ga0373925_0512065_479_751 | 90 |
| 799 | 3300037312 | Ga0395899_0082700 | Ga0395899_0082700_780_1052 | 90 |
| 800 | 3300037418 | Ga0395900_0283544 | Ga0395900_0283544_480_758 | 90 |
| 801 | 3300037418 | Ga0395900_0445110 | Ga0395900_0445110_962_1234 | 90 |
| 802 | 3300037466 | Ga0395898_0012815 | Ga0395898_0012815_826_1104 | 90 |
| 803 | 3300037466 | Ga0395898_0956201 | Ga0395898_0956201_281_553 | 90 |
| 804 | 3300037466 | Ga0395898_1474465 | Ga0395898_1474465_136_414 | 90 |
| 805 | 3300037471 | Ga0395905_0026295 | Ga0395905_0026295_1168_1440 | 90 |
| 806 | 3300037471 | Ga0395905_1839631 | Ga0395905_1839631_79_351 | 90 |
| 807 | 3300037853 | Ga0436364_0154596 | Ga0436364_0154596_25018_25290 | 90 |
| 808 | 3300037853 | Ga0436364_0182444 | Ga0436364_0182444_397_669 | 90 |
| 809 | 3300037853 | Ga0436364_0323152 | Ga0436364_0323152_325_597 | 90 |
| 810 | 3300037853 | Ga0436364_1125035 | Ga0436364_1125035_7230_7502 | 90 |
| 811 | 3300038443 | Ga0395901_0013659 | Ga0395901_0013659_6971_7249 | 90 |
| 812 | 3300038443 | Ga0395901_2131658 | Ga0395901_2131658_121_393 | 90 |
| 813 | 3300039437 | Ga0436365_0800928 | Ga0436365_0800928_125_397 | 90 |
| 814 | 3300039437 | Ga0436365_0984038 | Ga0436365_0984038_5067_5345 | 90 |
| 815 | 3300039438 | Ga0436360_0027561 | Ga0436360_0027561_1010_1282 | 90 |
| 816 | 3300039438 | Ga0436360_0914144 | Ga0436360_0914144_366_638 | 90 |
| 817 | 3300039447 | Ga0436361_0883200 | Ga0436361_0883200_416_688 | 90 |
| 818 | 3300039450 | Ga0436363_1306040 | Ga0436363_1306040_86_358 | 90 |
| 819 | 3300039453 | Ga0436362_0513142 | Ga0436362_0513142_1808_2086 | 90 |
| 820 | 3300041406 | Ga0439439_0017977 | Ga0439439_0017977_1347_1676 | 90 |
| 821 | 3300041408 | Ga0439453_0069259 | Ga0439453_0069259_50_322 | 90 |
| 822 | 3300041410 | Ga0439461_0050733 | Ga0439461_0050733_476_748 | 90 |
| 823 | 3300041411 | Ga0439466_0042362 | Ga0439466_0042362_448_720 | 90 |
| 824 | 3300041452 | Ga0451793_0948911 | Ga0451793_0948911_2332_2604 | 90 |
| 825 | 3300041453 | Ga0451797_0891010 | Ga0451797_0891010_232_504 | 90 |
| 826 | 3300041456 | Ga0451795_0533444 | Ga0451795_0533444_34_306 | 90 |
| 827 | 3300041459 | Ga0451800_0242290 | Ga0451800_0242290_325_618 | 90 |
| 828 | 3300041491 | Ga0451833_0713203 | Ga0451833_0713203_1327_1599 | 90 |
| 829 | 3300041494 | Ga0451837_0535912 | Ga0451837_0535912_2169_2441 | 90 |
| 830 | 3300041496 | Ga0451839_0403005 | Ga0451839_0403005_377_649 | 90 |
| 831 | 3300041496 | Ga0451839_0498698 | Ga0451839_0498698_229_501 | 90 |
| 832 | 3300041498 | Ga0451841_0874204 | Ga0451841_0874204_477_749 | 90 |
| 833 | 3300041509 | Ga0451843_0712501 | Ga0451843_0712501_396_668 | 90 |
| 834 | 3300041509 | Ga0451843_1206816 | Ga0451843_1206816_274_552 | 90 |
| 835 | 3300041512 | Ga0451853_3042104 | Ga0451853_3042104_159_446 | 90 |
| 836 | 3300041512 | Ga0451853_3804823 | Ga0451853_3804823_317_589 | 90 |
| 837 | 3300042003 | Ga0439443_007118 | Ga0439443_007118_891_1163 | 90 |
| 838 | 3300042003 | Ga0439443_016281 | Ga0439443_016281_204_476 | 90 |
| 839 | 3300042005 | Ga0439448_0036946 | Ga0439448_0036946_1058_1330 | 90 |
| 840 | 3300042005 | Ga0439448_0038275 | Ga0439448_0038275_87_359 | 90 |
| 841 | 3300042005 | Ga0439448_0046624 | Ga0439448_0046624_574_846 | 90 |
| 842 | 3300042005 | Ga0439448_0061139 | Ga0439448_0061139_667_957 | 90 |
| 843 | 3300042005 | Ga0439448_0107677 | Ga0439448_0107677_605_877 | 90 |
| 844 | 3300042008 | Ga0439450_000035 | Ga0439450_000035_5834_6106 | 90 |
| 845 | 3300042008 | Ga0439450_011775 | Ga0439450_011775_26_298 | 90 |
| 846 | 3300042008 | Ga0439450_018018 | Ga0439450_018018_254_526 | 90 |
| 847 | 3300042008 | Ga0439450_120507 | Ga0439450_120507_130_402 | 90 |
| 848 | 3300042010 | Ga0439452_067965 | Ga0439452_067965_216_545 | 90 |
| 849 | 3300042011 | Ga0439454_001686 | Ga0439454_001686_1722_1994 | 90 |
| 850 | 3300042011 | Ga0439454_003306 | Ga0439454_003306_309_599 | 90 |
| 851 | 3300042011 | Ga0439454_033156 | Ga0439454_033156_261_533 | 90 |
| 852 | 3300042012 | Ga0439455_0018810 | Ga0439455_0018810_500_772 | 90 |
| 853 | 3300042012 | Ga0439455_0038123 | Ga0439455_0038123_144_416 | 90 |
| 854 | 3300042012 | Ga0439455_0136136 | Ga0439455_0136136_265_537 | 90 |
| 855 | 3300042013 | Ga0439456_051974 | Ga0439456_051974_222_494 | 90 |
| 856 | 3300042014 | Ga0439457_192138 | Ga0439457_192138_146_418 | 90 |
| 857 | 3300042016 | Ga0439463_001477 | Ga0439463_001477_1225_1497 | 90 |
| 858 | 3300042016 | Ga0439463_004777 | Ga0439463_004777_1366_1656 | 90 |
| 859 | 3300042016 | Ga0439463_010669 | Ga0439463_010669_637_909 | 90 |
| 860 | 3300042016 | Ga0439463_064242 | Ga0439463_064242_458_730 | 90 |
| 861 | 3300042117 | Ga0450913_002761 | Ga0450913_002761_756_1028 | 90 |
| 862 | 3300042118 | Ga0450914_008018 | Ga0450914_008018_537_809 | 90 |
| 863 | 3300042119 | Ga0450915_011382 | Ga0450915_011382_144_416 | 90 |
| 864 | 3300042120 | Ga0450917_026067 | Ga0450917_026067_143_415 | 90 |
| 865 | 3300042129 | Ga0450891_035994 | Ga0450891_035994_45_317 | 90 |
| 866 | 3300042134 | Ga0450898_094537 | Ga0450898_094537_112_441 | 90 |
| 867 | 3300042136 | Ga0450900_021541 | Ga0450900_021541_517_789 | 90 |
| 868 | 3300042136 | Ga0450900_037249 | Ga0450900_037249_39_311 | 90 |
| 869 | 3300042136 | Ga0450900_071804 | Ga0450900_071804_204_476 | 90 |
| 870 | 3300042137 | Ga0450902_026391 | Ga0450902_026391_11_283 | 90 |
| 871 | 3300042139 | Ga0450904_023465 | Ga0450904_023465_270_542 | 90 |
| 872 | 3300042142 | Ga0450905_002654 | Ga0450905_002654_1011_1283 | 90 |
| 873 | 3300042142 | Ga0450905_092082 | Ga0450905_092082_104_376 | 90 |
| 874 | 3300042157 | Ga0439458_0139124 | Ga0439458_0139124_158_430 | 90 |
| 875 | 3300042157 | Ga0439458_0189281 | Ga0439458_0189281_84_356 | 90 |
| 876 | 3300042436 | Ga0439435_0009970 | Ga0439435_0009970_1098_1370 | 90 |
| 877 | 3300042437 | Ga0439444_0002183 | Ga0439444_0002183_432_704 | 90 |
| 878 | 3300042437 | Ga0439444_0060942 | Ga0439444_0060942_473_745 | 90 |
| 879 | 3300042438 | Ga0439459_0042238 | Ga0439459_0042238_20_292 | 90 |
| 880 | 3300042438 | Ga0439459_0053458 | Ga0439459_0053458_477_749 | 90 |
| 881 | 3300042438 | Ga0439459_0102746 | Ga0439459_0102746_197_469 | 90 |
| 882 | 3300042439 | Ga0439464_0010913 | Ga0439464_0010913_1080_1352 | 90 |
| 883 | 3300042439 | Ga0439464_0194462 | Ga0439464_0194462_310_582 | 90 |
| 884 | 3300042461 | Ga0439460_0003195 | Ga0439460_0003195_3570_3860 | 90 |
| 885 | 3300042461 | Ga0439460_0010060 | Ga0439460_0010060_1748_2020 | 90 |
| 886 | 3300042461 | Ga0439460_0019662 | Ga0439460_0019662_1546_1818 | 90 |
| 887 | 3300042461 | Ga0439460_0284883 | Ga0439460_0284883_239_511 | 90 |
| 888 | 3300042530 | Ga0450916_024509 | Ga0450916_024509_495_767 | 90 |
| 889 | 3300042993 | Ga0439440_0000128 | Ga0439440_0000128_3633_3905 | 90 |
| 890 | 3300042993 | Ga0439440_0000836 | Ga0439440_0000836_4155_4427 | 90 |
| 891 | 3300042993 | Ga0439440_0002296 | Ga0439440_0002296_3106_3378 | 90 |
| 892 | 3300044658 | Ga0466972_0209223 | Ga0466972_0209223_421_699 | 90 |
| 893 | 3300044673 | Ga0453683_0285305 | Ga0453683_0285305_16_288 | 90 |
| 894 | 3300044684 | Ga0466966_0091496 | Ga0466966_0091496_1461_1739 | 90 |
| 895 | 3300044693 | Ga0466961_0070627 | Ga0466961_0070627_1869_2144 | 90 |
| 896 | 3300044693 | Ga0466961_0224672 | Ga0466961_0224672_536_808 | 90 |
| 897 | 3300044694 | Ga0466963_0098154 | Ga0466963_0098154_277_549 | 90 |
| 898 | 3300044694 | Ga0466963_0599349 | Ga0466963_0599349_328_600 | 90 |
| 899 | 3300044706 | Ga0466964_0767142 | Ga0466964_0767142_223_495 | 90 |
| 900 | 3300044706 | Ga0466964_0795879 | Ga0466964_0795879_98_370 | 90 |
| 901 | 3300044719 | Ga0466971_0308557 | Ga0466971_0308557_160_432 | 90 |
| 902 | 3300044765 | Ga0466970_0172981 | Ga0466970_0172981_822_1097 | 90 |
| 903 | 3300044765 | Ga0466970_0450724 | Ga0466970_0450724_198_470 | 90 |
| 904 | 3300044765 | Ga0466970_0834115 | Ga0466970_0834115_179_457 | 90 |
| 905 | 3300044842 | Ga0466957_0253442 | Ga0466957_0253442_252_524 | 90 |
| 906 | 3300044842 | Ga0466957_0387446 | Ga0466957_0387446_380_655 | 90 |
| 907 | 3300044901 | Ga0466960_0199184 | Ga0466960_0199184_319_591 | 90 |
| 908 | 3300045049 | Ga0466959_0072169 | Ga0466959_0072169_1256_1528 | 90 |
| 909 | 3300045049 | Ga0466959_1178682 | Ga0466959_1178682_189_467 | 90 |
| 910 | 3300045836 | Ga0466958_0394228 | Ga0466958_0394228_580_855 | 90 |
| 911 | 3300045836 | Ga0466958_0550939 | Ga0466958_0550939_34_306 | 90 |
| 912 | 3300045976 | Ga0466967_0142653 | Ga0466967_0142653_570_842 | 90 |
| 913 | 3300045976 | Ga0466967_1312802 | Ga0466967_1312802_439_711 | 90 |
| 914 | 3300045976 | Ga0466967_1586905 | Ga0466967_1586905_286_564 | 90 |
| 915 | 3300046453 | Ga0495627_173053 | Ga0495627_173053_212_484 | 90 |
| 916 | 3300046454 | Ga0495592_0060290 | Ga0495592_0060290_1010_1282 | 90 |
| 917 | 3300046454 | Ga0495592_0227188 | Ga0495592_0227188_160_432 | 90 |
| 918 | 3300046454 | Ga0495592_0756328 | Ga0495592_0756328_12_284 | 90 |
| 919 | 3300046454 | Ga0495592_0950261 | Ga0495592_0950261_116_394 | 90 |
| 920 | 3300046455 | Ga0495603_0256857 | Ga0495603_0256857_650_922 | 90 |
| 921 | 3300046455 | Ga0495603_0318036 | Ga0495603_0318036_271_543 | 90 |
| 922 | 3300046459 | Ga0495629_0016977 | Ga0495629_0016977_2342_2614 | 90 |
| 923 | 3300046459 | Ga0495629_0205101 | Ga0495629_0205101_688_960 | 90 |
| 924 | 3300046461 | Ga0495641_0015396 | Ga0495641_0015396_2818_3090 | 90 |
| 925 | 3300046462 | Ga0495651_0032413 | Ga0495651_0032413_2829_3101 | 90 |
| 926 | 3300046462 | Ga0495651_0151987 | Ga0495651_0151987_127_399 | 90 |
| 927 | 3300046463 | Ga0495653_0015253 | Ga0495653_0015253_4813_5085 | 90 |
| 928 | 3300046463 | Ga0495653_0102962 | Ga0495653_0102962_202_474 | 90 |
| 929 | 3300046463 | Ga0495653_0869221 | Ga0495653_0869221_233_505 | 90 |
| 930 | 3300046472 | Ga0495580_0124984 | Ga0495580_0124984_1496_1768 | 90 |
| 931 | 3300046473 | Ga0495582_0010972 | Ga0495582_0010972_4509_4781 | 90 |
| 932 | 3300046475 | Ga0495639_0049730 | Ga0495639_0049730_610_882 | 90 |
| 933 | 3300046476 | Ga0495662_0027556 | Ga0495662_0027556_1598_1870 | 90 |
| 934 | 3300046476 | Ga0495662_0056693 | Ga0495662_0056693_835_1107 | 90 |
| 935 | 3300046476 | Ga0495662_0079873 | Ga0495662_0079873_1032_1304 | 90 |
| 936 | 3300046477 | Ga0495664_0028425 | Ga0495664_0028425_1619_1891 | 90 |
| 937 | 3300046477 | Ga0495664_0039374 | Ga0495664_0039374_1006_1278 | 90 |
| 938 | 3300046477 | Ga0495664_0440607 | Ga0495664_0440607_387_659 | 90 |
| 939 | 3300046491 | Ga0495584_0085481 | Ga0495584_0085481_506_778 | 90 |
| 940 | 3300046492 | Ga0495585_0571628 | Ga0495585_0571628_20_292 | 90 |
| 941 | 3300046499 | Ga0495594_0015240 | Ga0495594_0015240_3666_3938 | 90 |
| 942 | 3300046500 | Ga0495596_0052010 | Ga0495596_0052010_735_1007 | 90 |
| 943 | 3300046511 | Ga0495608_0063052 | Ga0495608_0063052_966_1238 | 90 |
| 944 | 3300046511 | Ga0495608_0076737 | Ga0495608_0076737_1517_1789 | 90 |
| 945 | 3300046514 | Ga0495618_0068945 | Ga0495618_0068945_1953_2225 | 90 |
| 946 | 3300046514 | Ga0495618_0348073 | Ga0495618_0348073_255_527 | 90 |
| 947 | 3300046516 | Ga0495628_0025142 | Ga0495628_0025142_4464_4736 | 90 |
| 948 | 3300046516 | Ga0495628_0110770 | Ga0495628_0110770_1106_1378 | 90 |
| 949 | 3300046517 | Ga0495630_0009083 | Ga0495630_0009083_5225_5497 | 90 |
| 950 | 3300046517 | Ga0495630_0111063 | Ga0495630_0111063_1554_1826 | 90 |
| 951 | 3300046517 | Ga0495630_0180311 | Ga0495630_0180311_736_1008 | 90 |
| 952 | 3300046519 | Ga0495632_0481617 | Ga0495632_0481617_98_370 | 90 |
| 953 | 3300046526 | Ga0495666_0008049 | Ga0495666_0008049_4671_4943 | 90 |
| 954 | 3300046529 | Ga0495652_0035058 | Ga0495652_0035058_3055_3327 | 90 |
| 955 | 3300046529 | Ga0495652_0100099 | Ga0495652_0100099_936_1208 | 90 |
| 956 | 3300046529 | Ga0495652_0249945 | Ga0495652_0249945_255_527 | 90 |
| 957 | 3300046529 | Ga0495652_0509199 | Ga0495652_0509199_512_784 | 90 |
| 958 | 3300046530 | Ga0495654_0292749 | Ga0495654_0292749_46_318 | 90 |
| 959 | 3300046531 | Ga0495665_0003251 | Ga0495665_0003251_6181_6453 | 90 |
| 960 | 3300046531 | Ga0495665_0003452 | Ga0495665_0003452_5251_5523 | 90 |
| 961 | 3300046531 | Ga0495665_0028246 | Ga0495665_0028246_1372_1644 | 90 |
| 962 | 3300046531 | Ga0495665_0068728 | Ga0495665_0068728_1102_1374 | 90 |
| 963 | 3300046531 | Ga0495665_0078996 | Ga0495665_0078996_479_751 | 90 |
| 964 | 3300046533 | Ga0495640_0016803 | Ga0495640_0016803_202_474 | 90 |
| 965 | 3300046533 | Ga0495640_0195666 | Ga0495640_0195666_199_471 | 90 |
| 966 | 3300046533 | Ga0495640_0350980 | Ga0495640_0350980_70_342 | 90 |
| 967 | 3300046535 | Ga0495586_0017383 | Ga0495586_0017383_3066_3338 | 90 |
| 968 | 3300046535 | Ga0495586_0028005 | Ga0495586_0028005_2397_2669 | 90 |
| 969 | 3300046536 | Ga0495587_0048774 | Ga0495587_0048774_727_999 | 90 |
| 970 | 3300046536 | Ga0495587_0444498 | Ga0495587_0444498_49_321 | 90 |
| 971 | 3300046536 | Ga0495587_0481664 | Ga0495587_0481664_255_527 | 90 |
| 972 | 3300046538 | Ga0495609_0022560 | Ga0495609_0022560_1805_2077 | 90 |
| 973 | 3300046539 | Ga0495621_0036101 | Ga0495621_0036101_568_840 | 90 |
| 974 | 3300046539 | Ga0495621_0049098 | Ga0495621_0049098_312_584 | 90 |
| 975 | 3300046543 | Ga0495645_0158007 | Ga0495645_0158007_572_844 | 90 |
| 976 | 3300046543 | Ga0495645_0387711 | Ga0495645_0387711_366_638 | 90 |
| 977 | 3300046557 | Ga0495622_0073197 | Ga0495622_0073197_1221_1493 | 90 |
| 978 | 3300046559 | Ga0495667_0030332 | Ga0495667_0030332_1352_1624 | 90 |
| 979 | 3300046559 | Ga0495667_0044382 | Ga0495667_0044382_1338_1610 | 90 |
| 980 | 3300046559 | Ga0495667_0953623 | Ga0495667_0953623_44_316 | 90 |
| 981 | 3300046615 | Ga0495656_0009807 | Ga0495656_0009807_2402_2674 | 90 |
| 982 | 3300046642 | Ga0495634_0072421 | Ga0495634_0072421_1421_1693 | 90 |
| 983 | 3300046642 | Ga0495634_0139446 | Ga0495634_0139446_779_1051 | 90 |
| 984 | 3300046642 | Ga0495634_0153533 | Ga0495634_0153533_370_642 | 90 |
| 985 | 3300046648 | Ga0495611_0121512 | Ga0495611_0121512_681_953 | 90 |
| 986 | 3300046663 | Ga0495635_0000658 | Ga0495635_0000658_20277_20549 | 90 |
| 987 | 3300046663 | Ga0495635_0056326 | Ga0495635_0056326_1538_1810 | 90 |
| 988 | 3300046663 | Ga0495635_0067430 | Ga0495635_0067430_14_286 | 90 |
| 989 | 3300046674 | Ga0495588_0626313 | Ga0495588_0626313_21_293 | 90 |
| 990 | 3300046675 | Ga0495657_0070320 | Ga0495657_0070320_616_888 | 90 |
| 991 | 3300046675 | Ga0495657_0133453 | Ga0495657_0133453_1222_1494 | 90 |
| 992 | 3300046675 | Ga0495657_0491080 | Ga0495657_0491080_268_540 | 90 |
| 993 | 3300046678 | Ga0495599_0036981 | Ga0495599_0036981_582_854 | 90 |
| 994 | 3300046678 | Ga0495599_0056549 | Ga0495599_0056549_722_994 | 90 |
| 995 | 3300046679 | Ga0495623_0113935 | Ga0495623_0113935_822_1094 | 90 |
| 996 | 3300046679 | Ga0495623_0197230 | Ga0495623_0197230_671_943 | 90 |
| 997 | 3300046680 | Ga0495646_0070249 | Ga0495646_0070249_723_995 | 90 |
| 998 | 3300046680 | Ga0495646_0214735 | Ga0495646_0214735_444_716 | 90 |
| 999 | 3300046680 | Ga0495646_0445064 | Ga0495646_0445064_255_527 | 90 |
| 1000 | 3300046681 | Ga0495647_0135939 | Ga0495647_0135939_315_587 | 90 |
| 1001 | 3300046681 | Ga0495647_0405850 | Ga0495647_0405850_237_509 | 90 |
| 1002 | 3300046683 | Ga0495658_0194985 | Ga0495658_0194985_348_620 | 90 |
| 1003 | 3300046683 | Ga0495658_0226256 | Ga0495658_0226256_421_693 | 90 |
| 1004 | 3300046684 | Ga0495669_0034011 | Ga0495669_0034011_100_372 | 90 |
| 1005 | 3300046689 | Ga0495613_0006122 | Ga0495613_0006122_3759_4031 | 90 |
| 1006 | 3300046689 | Ga0495613_0167325 | Ga0495613_0167325_650_922 | 90 |
| 1007 | 3300046690 | Ga0495624_0035552 | Ga0495624_0035552_1720_1992 | 90 |
| 1008 | 3300046690 | Ga0495624_0068963 | Ga0495624_0068963_303_575 | 90 |
| 1009 | 3300046690 | Ga0495624_0304014 | Ga0495624_0304014_291_563 | 90 |
| 1010 | 3300046691 | Ga0495670_0250846 | Ga0495670_0250846_578_850 | 90 |
| 1011 | 3300046694 | Ga0495649_0430873 | Ga0495649_0430873_98_370 | 90 |
| 1012 | 3300046794 | Ga0495589_0087574 | Ga0495589_0087574_202_474 | 90 |
| 1013 | 3300046809 | Ga0495600_0018569 | Ga0495600_0018569_1766_2038 | 90 |
| 1014 | 3300046809 | Ga0495600_0091470 | Ga0495600_0091470_1396_1668 | 90 |
| 1015 | 3300046809 | Ga0495600_0350001 | Ga0495600_0350001_406_678 | 90 |
| 1016 | 3300047315 | Ga0495581_0007400 | Ga0495581_0007400_5985_6257 | 90 |
| 1017 | 3300047315 | Ga0495581_0015967 | Ga0495581_0015967_2500_2772 | 90 |
| 1018 | 3300047315 | Ga0495581_0251668 | Ga0495581_0251668_433_705 | 90 |
| 1019 | 3300047317 | Ga0495604_0121375 | Ga0495604_0121375_1350_1622 | 90 |
| 1020 | 3300047317 | Ga0495604_0201907 | Ga0495604_0201907_1094_1366 | 90 |
| 1021 | 3300047318 | Ga0495636_0032597 | Ga0495636_0032597_143_415 | 90 |
| 1022 | 3300047319 | Ga0495674_0088142 | Ga0495674_0088142_1401_1673 | 90 |
| 1023 | 3300047321 | Ga0495676_0035969 | Ga0495676_0035969_2259_2531 | 90 |
| 1024 | 3300047321 | Ga0495676_0276273 | Ga0495676_0276273_473_745 | 90 |
| 1025 | 3300047322 | Ga0495680_0150464 | Ga0495680_0150464_1242_1514 | 90 |
| 1026 | 3300047322 | Ga0495680_0828427 | Ga0495680_0828427_316_588 | 90 |
| 1027 | 3300047444 | Ga0495675_0084221 | Ga0495675_0084221_1222_1494 | 90 |
| 1028 | 3300047444 | Ga0495675_0324314 | Ga0495675_0324314_252_524 | 90 |
| 1029 | 3300047471 | Ga0495684_0054691 | Ga0495684_0054691_349_621 | 90 |
| 1030 | 3300047471 | Ga0495684_0086267 | Ga0495684_0086267_1379_1651 | 90 |
| 1031 | 3300047471 | Ga0495684_0768151 | Ga0495684_0768151_143_415 | 90 |
| 1032 | 3300047673 | Ga0495593_0045304 | Ga0495593_0045304_808_1080 | 90 |
| 1033 | 3300047673 | Ga0495593_0400310 | Ga0495593_0400310_160_432 | 90 |
| 1034 | 3300048088 | Ga0495602_0113980 | Ga0495602_0113980_1360_1632 | 90 |
| 1035 | 3300048088 | Ga0495602_0424457 | Ga0495602_0424457_370_642 | 90 |
| 1036 | 3300048088 | Ga0495602_0797006 | Ga0495602_0797006_295_573 | 90 |
| 1037 | 3300048089 | Ga0495614_0052179 | Ga0495614_0052179_1212_1484 | 90 |
| 1038 | 3300048090 | Ga0495615_0235681 | Ga0495615_0235681_85_357 | 90 |
| 1039 | 3300048903 | Ga0496100_0019542 | Ga0496100_0019542_1051_1323 | 90 |
| 1040 | 3300048904 | Ga0496101_0052070 | Ga0496101_0052070_1113_1385 | 90 |
| 1041 | 3300048904 | Ga0496101_0606292 | Ga0496101_0606292_88_360 | 90 |
| 1042 | 3300048905 | Ga0496102_0306075 | Ga0496102_0306075_494_766 | 90 |
| 1043 | 3300048905 | Ga0496102_0797744 | Ga0496102_0797744_397_669 | 90 |
| 1044 | 3300048905 | Ga0496102_1901948 | Ga0496102_1901948_20_292 | 90 |
| 1045 | 3300048906 | Ga0496103_0024921 | Ga0496103_0024921_2097_2369 | 90 |
| 1046 | 3300048907 | Ga0496104_0169357 | Ga0496104_0169357_53_325 | 90 |
| 1047 | 3300048907 | Ga0496104_0909186 | Ga0496104_0909186_225_497 | 90 |
| 1048 | 3300048908 | Ga0496105_0016547 | Ga0496105_0016547_2932_3204 | 90 |
| 1049 | 3300048908 | Ga0496105_1291832 | Ga0496105_1291832_206_478 | 90 |
| 1050 | 3300048909 | Ga0496106_0862544 | Ga0496106_0862544_47_322 | 90 |
| 1051 | 3300048910 | Ga0496107_0096143 | Ga0496107_0096143_1627_1899 | 90 |
| 1052 | 3300048911 | Ga0496108_0225681 | Ga0496108_0225681_746_1021 | 90 |
| 1053 | 3300048911 | Ga0496108_0311649 | Ga0496108_0311649_422_694 | 90 |
| 1054 | 3300048911 | Ga0496108_0449639 | Ga0496108_0449639_684_956 | 90 |
| 1055 | 3300048912 | Ga0496109_1299259 | Ga0496109_1299259_170_442 | 90 |
| 1056 | 3300048912 | Ga0496109_1344953 | Ga0496109_1344953_309_608 | 90 |
| 1057 | 3300048912 | Ga0496109_1552522 | Ga0496109_1552522_155_427 | 90 |
| 1058 | 3300048913 | Ga0496110_0070071 | Ga0496110_0070071_1535_1807 | 90 |
| 1059 | 3300048913 | Ga0496110_0073263 | Ga0496110_0073263_1070_1342 | 90 |
| 1060 | 3300048913 | Ga0496110_0612221 | Ga0496110_0612221_17_289 | 90 |
| 1061 | 3300048914 | Ga0496111_0222421 | Ga0496111_0222421_755_1027 | 90 |
| 1062 | 3300048915 | Ga0496112_0694556 | Ga0496112_0694556_504_776 | 90 |
| 1063 | 3300048916 | Ga0496113_0016306 | Ga0496113_0016306_1275_1547 | 90 |
| 1064 | 3300048916 | Ga0496113_0070923 | Ga0496113_0070923_680_952 | 90 |
| 1065 | 3300048916 | Ga0496113_0577319 | Ga0496113_0577319_33_305 | 90 |
| 1066 | 3300048917 | Ga0496114_0172345 | Ga0496114_0172345_12_284 | 90 |
| 1067 | 3300048917 | Ga0496114_0898941 | Ga0496114_0898941_287_559 | 90 |
| 1068 | 3300048917 | Ga0496114_1459927 | Ga0496114_1459927_131_421 | 90 |
| 1069 | 3300048918 | Ga0496115_0267680 | Ga0496115_0267680_637_909 | 90 |
| 1070 | 3300048918 | Ga0496115_0393115 | Ga0496115_0393115_770_1042 | 90 |
| 1071 | 3300048921 | Ga0496118_0331690 | Ga0496118_0331690_191_466 | 90 |
| 1072 | 3300048922 | Ga0496119_0036955 | Ga0496119_0036955_498_770 | 90 |
| 1073 | 3300048923 | Ga0496120_0254820 | Ga0496120_0254820_331_603 | 90 |
| 1074 | 3300048925 | Ga0496122_0011095 | Ga0496122_0011095_8496_8768 | 90 |
| 1075 | 3300048926 | Ga0496123_0001686 | Ga0496123_0001686_26107_26379 | 90 |
| 1076 | 3300048928 | Ga0496125_0277027 | Ga0496125_0277027_294_566 | 90 |
| 1077 | 3300048929 | Ga0496126_0000007 | Ga0496126_0000007_615622_615897 | 90 |
| 1078 | 3300048929 | Ga0496126_0001977 | Ga0496126_0001977_6438_6710 | 90 |
| 1079 | 3300048929 | Ga0496126_0162886 | Ga0496126_0162886_42_314 | 90 |
| 1080 | 3300048929 | Ga0496126_0936235 | Ga0496126_0936235_297_569 | 90 |
| 1081 | 3300049568 | Ga0501031_0007036 | Ga0501031_0007036_2073_2345 | 90 |
| 1082 | 3300049568 | Ga0501031_0016176 | Ga0501031_0016176_642_914 | 90 |
| 1083 | 3300049569 | Ga0501032_0035526 | Ga0501032_0035526_756_1028 | 90 |
| 1084 | 3300049569 | Ga0501032_0132383 | Ga0501032_0132383_898_1170 | 90 |
| 1085 | 3300049569 | Ga0501032_0822093 | Ga0501032_0822093_281_553 | 90 |
| 1086 | 3300049570 | Ga0501033_0024312 | Ga0501033_0024312_430_702 | 90 |
| 1087 | 3300049570 | Ga0501033_0044866 | Ga0501033_0044866_2398_2670 | 90 |
| 1088 | 3300049571 | Ga0501034_0386300 | Ga0501034_0386300_71_349 | 90 |
| 1089 | 3300049572 | Ga0501036_0001139 | Ga0501036_0001139_5139_5411 | 90 |
| 1090 | 3300049572 | Ga0501036_0011323 | Ga0501036_0011323_5359_5631 | 90 |
| 1091 | 3300049573 | Ga0501037_0007729 | Ga0501037_0007729_1495_1773 | 90 |
| 1092 | 3300049573 | Ga0501037_0045918 | Ga0501037_0045918_2818_3090 | 90 |
| 1093 | 3300049573 | Ga0501037_0826243 | Ga0501037_0826243_262_552 | 90 |
| 1094 | 3300049574 | Ga0501038_0027050 | Ga0501038_0027050_564_836 | 90 |
| 1095 | 3300049574 | Ga0501038_0186185 | Ga0501038_0186185_1074_1364 | 90 |
| 1096 | 3300049574 | Ga0501038_0214282 | Ga0501038_0214282_991_1269 | 90 |
| 1097 | 3300049575 | Ga0501039_0003019 | Ga0501039_0003019_2767_3039 | 90 |
| 1098 | 3300049575 | Ga0501039_0015614 | Ga0501039_0015614_4802_5074 | 90 |
| 1099 | 3300049576 | Ga0501040_0000293 | Ga0501040_0000293_22907_23179 | 90 |
| 1100 | 3300049576 | Ga0501040_0003652 | Ga0501040_0003652_4503_4775 | 90 |
| 1101 | 3300049576 | Ga0501040_0033161 | Ga0501040_0033161_1334_1624 | 90 |
| 1102 | 3300049576 | Ga0501040_0226478 | Ga0501040_0226478_529_801 | 90 |
| 1103 | 3300049577 | Ga0501041_0000165 | Ga0501041_0000165_5416_5688 | 90 |
| 1104 | 3300049577 | Ga0501041_0000404 | Ga0501041_0000404_7120_7392 | 90 |
| 1105 | 3300049577 | Ga0501041_0283498 | Ga0501041_0283498_254_526 | 90 |
| 1106 | 3300049577 | Ga0501041_0980098 | Ga0501041_0980098_194_466 | 90 |
| 1107 | 3300049578 | Ga0501042_0000007 | Ga0501042_0000007_4138_4410 | 90 |
| 1108 | 3300049578 | Ga0501042_0002086 | Ga0501042_0002086_6672_6944 | 90 |
| 1109 | 3300049578 | Ga0501042_0085211 | Ga0501042_0085211_581_871 | 90 |
| 1110 | 3300049578 | Ga0501042_0176411 | Ga0501042_0176411_350_622 | 90 |
| 1111 | 3300049579 | Ga0501043_0003703 | Ga0501043_0003703_3147_3419 | 90 |
| 1112 | 3300049579 | Ga0501043_0017819 | Ga0501043_0017819_442_714 | 90 |
| 1113 | 3300049579 | Ga0501043_0234102 | Ga0501043_0234102_216_506 | 90 |
| 1114 | 3300049580 | Ga0501046_0002500 | Ga0501046_0002500_9805_10077 | 90 |
| 1115 | 3300049580 | Ga0501046_0003651 | Ga0501046_0003651_8487_8759 | 90 |
| 1116 | 3300049580 | Ga0501046_0787204 | Ga0501046_0787204_43_333 | 90 |
| 1117 | 3300049581 | Ga0501047_0033679 | Ga0501047_0033679_819_1091 | 90 |
| 1118 | 3300049581 | Ga0501047_0045921 | Ga0501047_0045921_2224_2502 | 90 |
| 1119 | 3300049582 | Ga0501048_0001431 | Ga0501048_0001431_12741_13013 | 90 |
| 1120 | 3300049582 | Ga0501048_0172156 | Ga0501048_0172156_360_632 | 90 |
| 1121 | 3300049583 | Ga0501067_0235194 | Ga0501067_0235194_30_359 | 90 |
| 1122 | 3300049583 | Ga0501067_0299764 | Ga0501067_0299764_188_460 | 90 |
| 1123 | 3300049583 | Ga0501067_0644431 | Ga0501067_0644431_207_536 | 90 |
| 1124 | 3300049583 | Ga0501067_0865505 | Ga0501067_0865505_37_309 | 90 |
| 1125 | 3300049584 | Ga0501068_0010885 | Ga0501068_0010885_747_1019 | 90 |
| 1126 | 3300049585 | Ga0501069_0280931 | Ga0501069_0280931_684_956 | 90 |
| 1127 | 3300049585 | Ga0501069_0400763 | Ga0501069_0400763_394_672 | 90 |
| 1128 | 3300049585 | Ga0501069_0422873 | Ga0501069_0422873_111_401 | 90 |
| 1129 | 3300049586 | Ga0501070_0411927 | Ga0501070_0411927_613_885 | 90 |
| 1130 | 3300049586 | Ga0501070_1488881 | Ga0501070_1488881_123_395 | 90 |
| 1131 | 3300049587 | Ga0501071_0021545 | Ga0501071_0021545_300_572 | 90 |
| 1132 | 3300049587 | Ga0501071_0041011 | Ga0501071_0041011_1384_1656 | 90 |
| 1133 | 3300049587 | Ga0501071_0371799 | Ga0501071_0371799_583_855 | 90 |
| 1134 | 3300049588 | Ga0501072_0221046 | Ga0501072_0221046_50_340 | 90 |
| 1135 | 3300049588 | Ga0501072_0246899 | Ga0501072_0246899_443_715 | 90 |
| 1136 | 3300049589 | Ga0501073_0214621 | Ga0501073_0214621_502_774 | 90 |
| 1137 | 3300049590 | Ga0501074_0000297 | Ga0501074_0000297_23205_23477 | 90 |
| 1138 | 3300049591 | Ga0501075_0000238 | Ga0501075_0000238_22786_23058 | 90 |
| 1139 | 3300049591 | Ga0501075_0000795 | Ga0501075_0000795_5300_5572 | 90 |
| 1140 | 3300049591 | Ga0501075_0107829 | Ga0501075_0107829_1418_1708 | 90 |
| 1141 | 3300049592 | Ga0501076_0000380 | Ga0501076_0000380_11535_11807 | 90 |
| 1142 | 3300049592 | Ga0501076_0017302 | Ga0501076_0017302_4693_4965 | 90 |
| 1143 | 3300049592 | Ga0501076_0185186 | Ga0501076_0185186_792_1082 | 90 |
| 1144 | 3300049592 | Ga0501076_1185423 | Ga0501076_1185423_317_598 | 90 |
| 1145 | 3300049593 | Ga0501077_0000459 | Ga0501077_0000459_22902_23174 | 90 |
| 1146 | 3300049593 | Ga0501077_0203344 | Ga0501077_0203344_303_593 | 90 |
| 1147 | 3300049593 | Ga0501077_0288684 | Ga0501077_0288684_246_518 | 90 |
| 1148 | 3300049593 | Ga0501077_0329672 | Ga0501077_0329672_198_470 | 90 |
| 1149 | 3300049741 | Ga0501079_0000448 | Ga0501079_0000448_14141_14413 | 90 |
| 1150 | 3300049741 | Ga0501079_0003137 | Ga0501079_0003137_5144_5434 | 90 |
| 1151 | 3300049741 | Ga0501079_0153645 | Ga0501079_0153645_394_666 | 90 |
| 1152 | 3300049742 | Ga0501080_0013285 | Ga0501080_0013285_1864_2136 | 90 |
| 1153 | 3300049742 | Ga0501080_0166091 | Ga0501080_0166091_767_1045 | 90 |
| 1154 | 3300049742 | Ga0501080_0468815 | Ga0501080_0468815_730_1002 | 90 |
| 1155 | 3300049743 | Ga0501081_0000172 | Ga0501081_0000172_25325_25597 | 90 |
| 1156 | 3300049743 | Ga0501081_0001115 | Ga0501081_0001115_11803_12075 | 90 |
| 1157 | 3300049744 | Ga0501083_0262544 | Ga0501083_0262544_632_904 | 90 |
| 1158 | 3300049822 | Ga0501035_0026090 | Ga0501035_0026090_2629_2901 | 90 |
| 1159 | 3300049822 | Ga0501035_0026525 | Ga0501035_0026525_1040_1312 | 90 |
| 1160 | 3300049823 | Ga0501044_0002377 | Ga0501044_0002377_18848_19120 | 90 |
| 1161 | 3300049823 | Ga0501044_0009795 | Ga0501044_0009795_7176_7454 | 90 |
| 1162 | 3300049823 | Ga0501044_0081049 | Ga0501044_0081049_2171_2443 | 90 |
| 1163 | 3300049823 | Ga0501044_0241056 | Ga0501044_0241056_95_367 | 90 |
| 1164 | 3300049824 | Ga0501045_0000063 | Ga0501045_0000063_43147_43419 | 90 |
| 1165 | 3300049824 | Ga0501045_0011785 | Ga0501045_0011785_5134_5406 | 90 |
| 1166 | 3300049824 | Ga0501045_0017782 | Ga0501045_0017782_1362_1652 | 90 |
| 1167 | 3300050491 | nmdc:mga00v17_310187_c1 | nmdc:mga00v17_310187_c1_141_413 | 90 |
| 1168 | 3300050491 | nmdc:mga00v17_856535_c1 | nmdc:mga00v17_856535_c1_13_285 | 90 |
| 1169 | 3300050492 | nmdc:mga0yw44_455915_c1 | nmdc:mga0yw44_455915_c1_406_678 | 90 |
| 1170 | 3300050496 | nmdc:mga07m45_763810_c1 | nmdc:mga07m45_763810_c1_177_449 | 90 |
| 1171 | 3300050507 | nmdc:mga05p37_1110226_c1 | nmdc:mga05p37_1110226_c1_529_801 | 90 |
| 1172 | 3300050507 | nmdc:mga05p37_1191869_c1 | nmdc:mga05p37_1191869_c1_96_413 | 90 |
| 1173 | 3300050507 | nmdc:mga05p37_1273092_c1 | nmdc:mga05p37_1273092_c1_52_324 | 90 |
| 1174 | 3300050507 | nmdc:mga05p37_134314_c1 | nmdc:mga05p37_134314_c1_1309_1581 | 90 |
| 1175 | 3300050507 | nmdc:mga05p37_193279_c1 | nmdc:mga05p37_193279_c1_2024_2314 | 90 |
| 1176 | 3300050507 | nmdc:mga05p37_2197224_c1 | nmdc:mga05p37_2197224_c1_176_448 | 90 |
| 1177 | 3300050507 | nmdc:mga05p37_2792_c1 | nmdc:mga05p37_2792_c1_6691_6963 | 90 |
| 1178 | 3300050507 | nmdc:mga05p37_322292_c1 | nmdc:mga05p37_322292_c1_48_320 | 90 |
| 1179 | 3300050508 | nmdc:mga09592_1585_c1 | nmdc:mga09592_1585_c1_663_980 | 90 |
| 1180 | 3300050508 | nmdc:mga09592_207142_c1 | nmdc:mga09592_207142_c1_1089_1361 | 90 |
| 1181 | 3300050508 | nmdc:mga09592_919107_c1 | nmdc:mga09592_919107_c1_427_717 | 90 |
| 1182 | 3300050509 | nmdc:mga0qj67_1434_c1 | nmdc:mga0qj67_1434_c1_16179_16496 | 90 |
| 1183 | 3300050509 | nmdc:mga0qj67_2253_c1 | nmdc:mga0qj67_2253_c1_1351_1623 | 90 |
| 1184 | 3300050509 | nmdc:mga0qj67_748267_c1 | nmdc:mga0qj67_748267_c1_250_540 | 90 |
| 1185 | 3300050510 | nmdc:mga06r32_116842_c1 | nmdc:mga06r32_116842_c1_1843_2133 | 90 |
| 1186 | 3300050510 | nmdc:mga06r32_15984_c1 | nmdc:mga06r32_15984_c1_956_1228 | 90 |
| 1187 | 3300050510 | nmdc:mga06r32_515_c1 | nmdc:mga06r32_515_c1_8532_8849 | 90 |
| 1188 | 3300050511 | nmdc:mga08y16_1095853_c1 | nmdc:mga08y16_1095853_c1_316_588 | 90 |
| 1189 | 3300050511 | nmdc:mga08y16_1679234_c1 | nmdc:mga08y16_1679234_c1_70_342 | 90 |
| 1190 | 3300050511 | nmdc:mga08y16_1960028_c1 | nmdc:mga08y16_1960028_c1_68_340 | 90 |
| 1191 | 3300050511 | nmdc:mga08y16_21682_c1 | nmdc:mga08y16_21682_c1_2835_3107 | 90 |
| 1192 | 3300050511 | nmdc:mga08y16_754336_c1 | nmdc:mga08y16_754336_c1_374_646 | 90 |
| 1193 | 3300050511 | nmdc:mga08y16_8919_c1 | nmdc:mga08y16_8919_c1_9274_9546 | 90 |
| 1194 | 3300050512 | nmdc:mga0n895_1240757_c1 | nmdc:mga0n895_1240757_c1_168_440 | 90 |
| 1195 | 3300050512 | nmdc:mga0n895_132835_c1 | nmdc:mga0n895_132835_c1_1705_1977 | 90 |
| 1196 | 3300050512 | nmdc:mga0n895_1679580_c1 | nmdc:mga0n895_1679580_c1_294_575 | 90 |
| 1197 | 3300050512 | nmdc:mga0n895_247609_c1 | nmdc:mga0n895_247609_c1_212_484 | 90 |
| 1198 | 3300050512 | nmdc:mga0n895_372676_c1 | nmdc:mga0n895_372676_c1_249_527 | 90 |
| 1199 | 3300050513 | nmdc:mga0rr50_106334_c1 | nmdc:mga0rr50_106334_c1_153_425 | 90 |
| 1200 | 3300050513 | nmdc:mga0rr50_964687_c1 | nmdc:mga0rr50_964687_c1_173_445 | 90 |
| 1201 | 3300050514 | nmdc:mga08x19_1010546_c1 | nmdc:mga08x19_1010546_c1_141_413 | 90 |
| 1202 | 3300050514 | nmdc:mga08x19_1204744_c1 | nmdc:mga08x19_1204744_c1_88_360 | 90 |
| 1203 | 3300050514 | nmdc:mga08x19_749848_c1 | nmdc:mga08x19_749848_c1_46_324 | 90 |
| 1204 | 3300050515 | nmdc:mga0a205_394795_c1 | nmdc:mga0a205_394795_c1_530_802 | 90 |
| 1205 | 3300050515 | nmdc:mga0a205_5116_c1 | nmdc:mga0a205_5116_c1_574_846 | 90 |
| 1206 | 3300053077 | Ga0495601_0040021 | Ga0495601_0040021_285_557 | 90 |
| 1207 | 3300053078 | Ga0495612_0050108 | Ga0495612_0050108_1013_1285 | 90 |
| 1208 | 3300053078 | Ga0495612_0171165 | Ga0495612_0171165_456_728 | 90 |
| 1209 | 3300053084 | Ga0495595_0012380 | Ga0495595_0012380_1380_1652 | 90 |
| 1210 | 3300053084 | Ga0495595_0241559 | Ga0495595_0241559_379_651 | 90 |
| 1211 | 3300053085 | Ga0495619_0004418 | Ga0495619_0004418_8444_8716 | 90 |
| 1212 | 3300053085 | Ga0495619_0299361 | Ga0495619_0299361_628_900 | 90 |
| 1213 | 3300053088 | Ga0500644_0056969 | Ga0500644_0056969_637_909 | 90 |
| 1214 | 3300053142 | Ga0500577_0089278 | Ga0500577_0089278_447_719 | 90 |
| 1215 | 3300053153 | Ga0500616_0018678 | Ga0500616_0018678_2487_2759 | 90 |
| 1216 | 3300053736 | Ga0500599_000374 | Ga0500599_000374_1932_2210 | 90 |
| 1217 | 3300054114 | Ga0501084_0005801 | Ga0501084_0005801_4811_5083 | 90 |
| 1218 | 3300054114 | Ga0501084_0012141 | Ga0501084_0012141_2756_3028 | 90 |
| 1219 | 3300054114 | Ga0501084_0615357 | Ga0501084_0615357_604_894 | 90 |
| 1220 | 3300059421 | Ga0590071_005793 | Ga0590071_005793_1159_1431 | 90 |
| 1221 | 3300059421 | Ga0590071_100303 | Ga0590071_100303_99_371 | 90 |
| 1222 | 3300059421 | Ga0590071_163384 | Ga0590071_163384_181_453 | 90 |
| 1223 | 3300059423 | Ga0590074_005445 | Ga0590074_005445_1024_1296 | 90 |
| 1224 | 3300059424 | Ga0590075_001535 | Ga0590075_001535_4631_4903 | 90 |
| 1225 | 3300059426 | Ga0590077_002621 | Ga0590077_002621_868_1140 | 90 |
| 1226 | 3300059426 | Ga0590077_114768 | Ga0590077_114768_41_313 | 90 |
| 1227 | 3300059492 | Ga0587073_0276292 | Ga0587073_0276292_243_515 | 90 |
| 1228 | 3300059505 | Ga0587083_0016055 | Ga0587083_0016055_819_1091 | 90 |
| 1229 | 3300059507 | Ga0587086_006600 | Ga0587086_006600_814_1086 | 90 |
| 1230 | 3300059508 | Ga0587088_035167 | Ga0587088_035167_83_358 | 90 |
| 1231 | 3300059630 | Ga0587128_006456 | Ga0587128_006456_714_986 | 90 |
| 1232 | 3300060344 | Ga0587071_198685 | Ga0587071_198685_14_286 | 90 |
| 1233 | 3300060353 | Ga0501082_0000373 | Ga0501082_0000373_34045_34317 | 90 |
| 1234 | 3300060353 | Ga0501082_0000696 | Ga0501082_0000696_23543_23815 | 90 |
| 1235 | 3300060353 | Ga0501082_0186428 | Ga0501082_0186428_626_916 | 90 |
| 1236 | 3300060353 | Ga0501082_1136514 | Ga0501082_1136514_271_543 | 90 |
| 1237 | 3300060353 | Ga0501082_1277207 | Ga0501082_1277207_34_306 | 90 |
| 1238 | 3300061734 | Ga0530510_0000454 | Ga0530510_0000454_20663_20935 | 90 |
| 1239 | 3300061734 | Ga0530510_0002560 | Ga0530510_0002560_6171_6443 | 90 |
| 1240 | 3300061734 | Ga0530510_0028241 | Ga0530510_0028241_1515_1805 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h43-assembly1.cif.gz_A | n-terminal domain of the proteasome-activating nucleotidase of methanocaldococcus jannaschii | 0.7943 | 1 | 49 |
| 7w3j-assembly1.cif.gz_D | structure of usp14-bound human 26s proteasome in substrate-inhibited state sc_usp14 | 0.7852 | 3 | 50 |
| 4glm-assembly4.cif.gz_D | crystal structure of the sh3 domain of dnmbp protein [homo sapiens] | 0.7842 | 3 | 32 |
| 1w6x-assembly2.cif.gz_B | sh3 domain of p40phox, component of the nadph oxidase | 0.7821 | 7 | 34 |
| 6he9-assembly1.cif.gz_K | pan-proteasome in state 2 | 0.7818 | 4 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q68LP1_328_392_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8426 | 7 | 33 | 2.30.30.40 |
| af_A0A6M3QH40_2314_2376_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8382 | 7 | 34 | 2.30.30.40 |
| af_O74749_210_275_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8362 | 7 | 34 | 2.30.30.40 |
| af_A0A2R8QPI9_635_697_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8293 | 7 | 34 | 2.30.30.40 |
| af_A7E3N2_456_514_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8254 | 7 | 34 | 2.30.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838PX29-F1-model_v4 | HypC/HybG/HupF family hydrogenase formation chaperone | 0.8707 | 1 | 52 |
GO:0005506
GO:0051604 GO:1902670 |
| AF-A0A7C7PPC6-F1-model_v4 | Hydrogenase assembly protein HupF | 0.8663 | 1 | 52 |
GO:0005506
GO:0051604 GO:1902670 |
| AF-T1C4F6-F1-model_v4 | Protein belonging to Hydrogenase expression/formation protein, HupF/HypC | 0.8605 | 1 | 57 |
GO:0005506
GO:0051604 GO:1902670 |
| AF-A0A838PX29-F1-model_v4 | HypC/HybG/HupF family hydrogenase formation chaperone | 0.8559 | 1 | 52 |
GO:0005506
GO:0051604 GO:1902670 |
| AF-T1C4F6-F1-model_v4 | Protein belonging to Hydrogenase expression/formation protein, HupF/HypC | 0.8464 | 1 | 57 |
GO:0005506
GO:0051604 GO:1902670 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar