F492081

General Info

Members Datasets Scaffolds Average Seq Length
1240 547 1236 91

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101275967|Ga0070707_1012759672
Length 109
Sequence MCLGIPGTIVEIDEDRPDLAKVDVSGVRRMINIGLLENEVIEPGDWILIHVGFALSKIDEEEAASAMAFLEGIGTAYEEELAALSSSQIEAGFIQAGRDIESRWAAEEV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
3 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
137 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
138 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
139 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
140 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
141 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
142 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
143 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
144 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
145 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
146 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
147 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
148 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
149 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
150 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
151 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
174 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
179 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
180 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
181 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
182 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
250 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
257 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
258 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
265 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
266 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
267 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
268 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
269 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
270 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
274 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
289 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
290 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
291 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
292 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
293 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
294 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
295 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
296 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
297 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
298 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
299 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
300 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
301 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
302 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
303 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
304 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
305 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
306 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
308 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
309 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
310 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
311 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
312 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
313 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
314 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
315 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
316 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
317 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
318 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
319 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
320 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
334 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
335 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
336 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
337 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
338 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
339 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
340 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
341 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
342 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
343 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
344 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
345 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
346 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
347 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
348 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
349 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
350 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
351 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
352 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
353 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
354 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
355 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
356 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
357 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
358 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
359 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
360 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
361 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
362 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
363 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
364 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
365 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
366 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
367 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
368 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
369 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
370 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
371 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
372 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
373 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
374 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
375 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
376 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
377 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
378 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
379 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
380 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
381 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
382 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
383 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
384 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
385 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
386 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
387 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
388 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
389 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
390 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
391 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
392 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
393 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
394 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
395 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
396 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
397 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
398 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
399 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
400 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
401 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
402 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
403 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
404 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
405 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
406 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
407 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
408 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
409 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
410 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
411 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
412 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
413 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
414 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
415 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
416 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
417 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
418 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
419 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
420 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
421 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
422 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
423 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
424 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
425 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
426 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
427 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
428 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
429 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
430 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
431 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
432 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
433 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
434 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
435 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
436 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
437 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
438 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
439 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
440 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
441 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
442 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
443 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
444 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
445 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
446 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
447 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
448 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
449 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
450 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
451 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
452 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
453 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
454 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
455 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
456 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
457 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
458 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
459 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
460 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
461 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
462 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
463 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
464 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
465 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
466 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
467 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
468 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
469 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
470 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
471 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
472 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
473 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
474 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
475 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
476 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
495 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
496 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
503 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
504 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
505 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
506 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
507 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
508 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
509 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
512 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
513 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
514 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
515 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
516 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
517 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
518 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
519 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
520 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
521 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
522 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
523 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
524 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
525 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
526 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
527 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
528 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
529 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
530 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
533 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
534 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
535 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
536 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
537 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
538 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
545 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
546 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
547 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 4.11
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 4.19
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3941096 2162886012 Unclassified 1067
2 MBSR1b_contig_907293 2162886012 Bacteria 940
3 JGI24747J21853_1035595 3300001978 Bacteria 579
4 JGI24740J21852_10106836 3300001979 Bacteria 708
5 JGI25406J46586_10005292 3300003203 Bacteria 5986
6 rootH1_10194767 3300003323 Bacteria 3584
7 JGI25407J50210_10000833 3300003373 Bacteria 6609
8 JGI25407J50210_10016676 3300003373 Bacteria 1903
9 JGI25407J50210_10056702 3300003373 Bacteria 987
10 JGI25407J50210_10088080 3300003373 Bacteria 769
11 JGI25404J52841_10009969 3300003659 Bacteria 2039
12 JGI25405J52794_10055288 3300003911 Bacteria 854
13 Ga0058859_11645648 3300004798 Bacteria 506
14 Ga0058863_10899516 3300004799 Bacteria 1022
15 Ga0058863_11599248 3300004799 Bacteria 544
16 Ga0058861_12077379 3300004800 Bacteria 730
17 Ga0058860_11560143 3300004801 Bacteria 529
18 Ga0058860_11738255 3300004801 Bacteria 671
19 Ga0058860_12151675 3300004801 Bacteria 569
20 Ga0058860_12178315 3300004801 Bacteria 1223
21 Ga0058862_12586157 3300004803 Bacteria 1140
22 Ga0065712_10274254 3300005290 Bacteria 909
23 Ga0065715_10289222 3300005293 Unclassified 1067
24 Ga0065715_10730475 3300005293 Bacteria 639
25 Ga0070658_10331868 3300005327 Bacteria 1300
26 Ga0070658_11303641 3300005327 Bacteria 631
27 Ga0070676_10160328 3300005328 Bacteria 1447
28 Ga0070676_10172052 3300005328 Bacteria 1402
29 Ga0070676_11106245 3300005328 Bacteria 599
30 Ga0070683_100078885 3300005329 Bacteria 3081
31 Ga0070683_101523177 3300005329 Bacteria 643
32 Ga0070690_100021786 3300005330 Bacteria 3916
33 Ga0070690_100158076 3300005330 Bacteria 1551
34 Ga0070670_100341741 3300005331 Bacteria 1314
35 Ga0070677_10633582 3300005333 Bacteria 596
36 Ga0068869_100200806 3300005334 Bacteria 1572
37 Ga0068869_101409204 3300005334 Bacteria 617
38 Ga0068869_101601707 3300005334 Bacteria 580
39 Ga0070666_10027739 3300005335 Bacteria 3711
40 Ga0070680_100029072 3300005336 Bacteria 4438
41 Ga0070680_101599057 3300005336 Bacteria 565
42 Ga0070680_101687462 3300005336 Bacteria 549
43 Ga0070682_101357266 3300005337 Bacteria 606
44 Ga0070682_101537110 3300005337 Unclassified 573
45 Ga0068868_100157214 3300005338 Bacteria 1875
46 Ga0068868_100795308 3300005338 Bacteria 853
47 Ga0068868_101582979 3300005338 Bacteria 615
48 Ga0068868_102259794 3300005338 Bacteria 518
49 Ga0070660_100094455 3300005339 Bacteria 2362
50 Ga0070689_100156161 3300005340 Bacteria 1842
51 Ga0070689_100301426 3300005340 Bacteria 1334
52 Ga0070691_10158041 3300005341 Bacteria 1167
53 Ga0070691_10159590 3300005341 Bacteria 1161
54 Ga0070687_100079062 3300005343 Bacteria 1789
55 Ga0070687_100116027 3300005343 Bacteria 1523
56 Ga0070661_100442954 3300005344 Bacteria 1033
57 Ga0070661_101401537 3300005344 Bacteria 588
58 Ga0070661_101702382 3300005344 Bacteria 534
59 Ga0070692_10129584 3300005345 Bacteria 1416
60 Ga0070692_10166930 3300005345 Bacteria 1266
61 Ga0070692_10511515 3300005345 Bacteria 780
62 Ga0070692_10964705 3300005345 Bacteria 594
63 Ga0070668_100033387 3300005347 Bacteria 3918
64 Ga0070668_100060524 3300005347 Bacteria 2932
65 Ga0070668_101119947 3300005347 Unclassified 711
66 Ga0070668_101656047 3300005347 Bacteria 587
67 Ga0070669_100728507 3300005353 Bacteria 839
68 Ga0070675_100008751 3300005354 Bacteria 7863
69 Ga0070671_100126208 3300005355 Bacteria 2154
70 Ga0070671_100195879 3300005355 Bacteria 1713
71 Ga0070671_101053297 3300005355 Bacteria 714
72 Ga0070674_100077219 3300005356 Bacteria 2370
73 Ga0070673_100223684 3300005364 Bacteria 1630
74 Ga0070673_101506029 3300005364 Bacteria 634
75 Ga0070688_100947161 3300005365 Bacteria 681
76 Ga0070659_100034617 3300005366 Bacteria 3929
77 Ga0070659_100516752 3300005366 Bacteria 1019
78 Ga0070667_100193332 3300005367 Bacteria 1803
79 Ga0070667_100516214 3300005367 Bacteria 1096
80 Ga0070709_10036426 3300005434 Bacteria 2997
81 Ga0070714_100006392 3300005435 Bacteria 9097
82 Ga0070714_100055323 3300005435 Bacteria 3391
83 Ga0070713_100054063 3300005436 Bacteria 3330
84 Ga0070713_100192759 3300005436 Bacteria 1837
85 Ga0070713_100948922 3300005436 Bacteria 828
86 Ga0070713_101863858 3300005436 Bacteria 583
87 Ga0070710_10026356 3300005437 Bacteria 3087
88 Ga0070710_10929638 3300005437 Bacteria 629
89 Ga0070701_10013994 3300005438 Bacteria 3666
90 Ga0070701_10019016 3300005438 Bacteria 3239
91 Ga0070711_100001426 3300005439 Bacteria 13128
92 Ga0070711_100357553 3300005439 Bacteria 1175
93 Ga0070711_100863563 3300005439 Bacteria 770
94 Ga0070711_101074934 3300005439 Bacteria 692
95 Ga0070711_101173638 3300005439 Unclassified 663
96 Ga0070711_101477800 3300005439 Bacteria 592
97 Ga0070705_100463586 3300005440 Bacteria 953
98 Ga0070705_100852967 3300005440 Bacteria 729
99 Ga0070705_101439097 3300005440 Unclassified 575
100 Ga0070700_100033958 3300005441 Bacteria 3076
101 Ga0070694_101238563 3300005444 Bacteria 626
102 Ga0070708_100072487 3300005445 Bacteria 3103
103 Ga0070708_100425108 3300005445 Bacteria 1253
104 Ga0070708_100450243 3300005445 Bacteria 1214
105 Ga0070708_102077276 3300005445 Bacteria 526
106 Ga0070663_100174784 3300005455 Bacteria 1662
107 Ga0070663_100611315 3300005455 Bacteria 918
108 Ga0070663_100618747 3300005455 Bacteria 913
109 Ga0070678_100092333 3300005456 Bacteria 2325
110 Ga0070678_100244244 3300005456 Bacteria 1502
111 Ga0070678_101477888 3300005456 Bacteria 636
112 Ga0070662_100204352 3300005457 Bacteria 1569
113 Ga0070662_100291802 3300005457 Bacteria 1322
114 Ga0070662_101867194 3300005457 Bacteria 519
115 Ga0070681_10068567 3300005458 Bacteria 3513
116 Ga0070681_10611244 3300005458 Bacteria 1004
117 Ga0070681_10639694 3300005458 Bacteria 978
118 Ga0070681_10694981 3300005458 Bacteria 933
119 Ga0070681_11745870 3300005458 Bacteria 549
120 Ga0068867_100318504 3300005459 Bacteria 1288
121 Ga0068867_100858644 3300005459 Bacteria 814
122 Ga0068867_101180951 3300005459 Bacteria 702
123 Ga0068867_102217962 3300005459 Unclassified 521
124 Ga0070685_10011703 3300005466 Bacteria 4598
125 Ga0070685_10346031 3300005466 Bacteria 1015
126 Ga0070685_10565146 3300005466 Bacteria 814
127 Ga0070685_11129105 3300005466 Bacteria 593
128 Ga0070706_100423089 3300005467 Bacteria 1240
129 Ga0070706_100426688 3300005467 Bacteria 1234
130 Ga0070706_100476267 3300005467 Bacteria 1161
131 Ga0070706_101738191 3300005467 Bacteria 568
132 Ga0070706_101747147 3300005467 Bacteria 566
133 Ga0070707_100078604 3300005468 Bacteria 3183
134 Ga0070707_100719183 3300005468 Bacteria 961
135 Ga0070707_101275967 3300005468 Bacteria 701
136 Ga0070698_100028747 3300005471 Bacteria 5771
137 Ga0070698_100102261 3300005471 Bacteria 2836
138 Ga0070698_100198840 3300005471 Bacteria 1940
139 Ga0070699_100136318 3300005518 Bacteria 2165
140 Ga0070699_100169295 3300005518 Bacteria 1935
141 Ga0070699_100221686 3300005518 Bacteria 1685
142 Ga0070699_101007202 3300005518 Bacteria 764
143 Ga0070699_101677945 3300005518 Unclassified 582
144 Ga0070699_101986071 3300005518 Bacteria 532
145 Ga0070679_100019756 3300005530 Bacteria 6558
146 Ga0070679_100063188 3300005530 Bacteria 3691
147 Ga0070679_100683549 3300005530 Bacteria 969
148 Ga0070679_100921245 3300005530 Bacteria 817
149 Ga0070684_100116279 3300005535 Bacteria 2402
150 Ga0070684_100726946 3300005535 Bacteria 926
151 Ga0070697_100455830 3300005536 Bacteria 1114
152 Ga0068853_100061482 3300005539 Bacteria 3248
153 Ga0068853_100315627 3300005539 Bacteria 1448
154 Ga0070672_100027866 3300005543 Bacteria 4218
155 Ga0070672_100739761 3300005543 Bacteria 863
156 Ga0070686_100015286 3300005544 Bacteria 4441
157 Ga0070686_100498965 3300005544 Bacteria 944
158 Ga0070695_100048509 3300005545 Bacteria 2715
159 Ga0070695_100123103 3300005545 Bacteria 1777
160 Ga0070696_100004836 3300005546 Bacteria 9004
161 Ga0070693_100019269 3300005547 Bacteria 3573
162 Ga0070693_101584368 3300005547 Bacteria 514
163 Ga0070665_100503215 3300005548 Bacteria 1223
164 Ga0070665_100996374 3300005548 Bacteria 850
165 Ga0070665_101004512 3300005548 Bacteria 846
166 Ga0070704_100296736 3300005549 Bacteria 1345
167 Ga0070704_101813862 3300005549 Bacteria 564
168 Ga0068855_100599164 3300005563 Bacteria 1188
169 Ga0068855_101802898 3300005563 Bacteria 622
170 Ga0068855_102495585 3300005563 Bacteria 514
171 Ga0070664_100026709 3300005564 Bacteria 4792
172 Ga0068857_100026603 3300005577 Bacteria 5099
173 Ga0068857_100039067 3300005577 Bacteria 4203
174 Ga0068854_100028549 3300005578 Bacteria 3856
175 Ga0068854_100152768 3300005578 Bacteria 1782
176 Ga0068856_100211973 3300005614 Bacteria 1952
177 Ga0070702_100051134 3300005615 Bacteria 2364
178 Ga0068852_100088656 3300005616 Bacteria 2763
179 Ga0068852_100181073 3300005616 Bacteria 1982
180 Ga0068852_100920473 3300005616 Bacteria 892
181 Ga0068859_100054371 3300005617 Bacteria 4026
182 Ga0068859_100447429 3300005617 Bacteria 1388
183 Ga0068864_100027927 3300005618 Bacteria 4769
184 Ga0068864_100401860 3300005618 Bacteria 1302
185 Ga0068864_100509781 3300005618 Bacteria 1158
186 Ga0068864_102200130 3300005618 Bacteria 558
187 Ga0068866_10125816 3300005718 Bacteria 1451
188 Ga0068861_100043723 3300005719 Bacteria 3364
189 Ga0068861_100272308 3300005719 Bacteria 1454
190 Ga0068861_100702140 3300005719 Bacteria 940
191 Ga0068861_101345442 3300005719 Bacteria 696
192 Ga0068851_10048255 3300005834 Bacteria 2158
193 Ga0068851_10872544 3300005834 Bacteria 562
194 Ga0068870_10024232 3300005840 Bacteria 3001
195 Ga0068870_10113483 3300005840 Bacteria 1551
196 Ga0068863_100026524 3300005841 Bacteria 5526
197 Ga0068863_100258157 3300005841 Bacteria 1684
198 Ga0068863_101662527 3300005841 Bacteria 648
199 Ga0068863_102228089 3300005841 Bacteria 558
200 Ga0068863_102721301 3300005841 Bacteria 503
201 Ga0068858_100167892 3300005842 Bacteria 2068
202 Ga0068860_100162837 3300005843 Bacteria 2151
203 Ga0068860_102178642 3300005843 Bacteria 575
204 Ga0068860_102380252 3300005843 Bacteria 550
205 Ga0068862_100756231 3300005844 Bacteria 946
206 Ga0081455_10005075 3300005937 Bacteria 14533
207 Ga0081538_10000212 3300005981 Bacteria 64889
208 Ga0081538_10000947 3300005981 Bacteria 31238
209 Ga0081538_10006746 3300005981 Bacteria 10036
210 Ga0081538_10015131 3300005981 Bacteria 5992
211 Ga0081538_10015846 3300005981 Bacteria 5813
212 Ga0081538_10021750 3300005981 Bacteria 4668
213 Ga0081538_10049026 3300005981 Bacteria 2567
214 Ga0081538_10113811 3300005981 Bacteria 1320
215 Ga0081540_1000125 3300005983 Bacteria 81285
216 Ga0081540_1030082 3300005983 Bacteria 3014
217 Ga0081540_1252644 3300005983 Bacteria 615
218 Ga0081540_1261816 3300005983 Bacteria 601
219 Ga0081539_10000179 3300005985 Bacteria 149126
220 Ga0081539_10005342 3300005985 Bacteria 13183
221 Ga0081539_10183721 3300005985 Bacteria 979
222 Ga0070717_10020829 3300006028 Bacteria 5162
223 Ga0070717_10144230 3300006028 Bacteria 2056
224 Ga0070717_10401489 3300006028 Bacteria 1231
225 Ga0070717_11049117 3300006028 Bacteria 742
226 Ga0070717_11049118 3300006028 Bacteria 742
227 Ga0070717_11565935 3300006028 Bacteria 597
228 Ga0070717_11981335 3300006028 Bacteria 525
229 Ga0075365_10336000 3300006038 Bacteria 1064
230 Ga0075363_100027439 3300006048 Bacteria 2920
231 Ga0075364_10364038 3300006051 Bacteria 986
232 Ga0075364_11159608 3300006051 Bacteria 524
233 Ga0075432_10003415 3300006058 Bacteria 5381
234 Ga0075432_10564123 3300006058 Bacteria 516
235 Ga0075432_10592169 3300006058 Bacteria 506
236 Ga0070715_10062596 3300006163 Bacteria 1638
237 Ga0070716_100010618 3300006173 Bacteria 4622
238 Ga0070716_100246465 3300006173 Bacteria 1214
239 Ga0070716_100637153 3300006173 Bacteria 806
240 Ga0070712_100497448 3300006175 Bacteria 1021
241 Ga0070712_100647742 3300006175 Bacteria 897
242 Ga0070712_101338183 3300006175 Bacteria 624
243 Ga0075367_10233781 3300006178 Bacteria 1151
244 Ga0075369_10655235 3300006186 Bacteria 504
245 Ga0097621_100138858 3300006237 Bacteria 2075
246 Ga0097621_101186722 3300006237 Bacteria 719
247 Ga0075370_10171354 3300006353 Bacteria 1276
248 Ga0075370_10592296 3300006353 Bacteria 671
249 Ga0068871_100829597 3300006358 Bacteria 854
250 Ga0068871_101273919 3300006358 Bacteria 691
251 Ga0075428_100012144 3300006844 Bacteria 9581
252 Ga0075428_100083713 3300006844 Bacteria 3480
253 Ga0075428_100914291 3300006844 Bacteria 930
254 Ga0075428_102677222 3300006844 Bacteria 509
255 Ga0075430_100008071 3300006846 Bacteria 8897
256 Ga0075430_100017068 3300006846 Bacteria 6183
257 Ga0075430_100038408 3300006846 Bacteria 4055
258 Ga0075431_100000246 3300006847 Bacteria 41024
259 Ga0075431_100017656 3300006847 Bacteria 7254
260 Ga0075431_100522370 3300006847 Bacteria 1176
261 Ga0075433_10099639 3300006852 Bacteria 2572
262 Ga0075433_10758212 3300006852 Bacteria 849
263 Ga0075433_11554971 3300006852 Bacteria 571
264 Ga0075434_101166867 3300006871 Bacteria 783
265 Ga0075434_102378702 3300006871 Bacteria 532
266 Ga0075429_100003454 3300006880 Bacteria 13490
267 Ga0075429_100049390 3300006880 Bacteria 3658
268 Ga0068865_100187050 3300006881 Bacteria 1599
269 Ga0068865_100426121 3300006881 Bacteria 1092
270 Ga0068865_100768273 3300006881 Bacteria 829
271 Ga0075436_100207579 3300006914 Bacteria 1388
272 Ga0075436_100844124 3300006914 Bacteria 683
273 Ga0097620_100054371 3300006931 Bacteria 4026
274 Ga0097620_100447376 3300006931 Bacteria 1388
275 Ga0075435_100303590 3300007076 Bacteria 1365
276 Ga0075435_100307606 3300007076 Bacteria 1356
277 Ga0075435_100330870 3300007076 Bacteria 1305
278 Ga0075435_100837093 3300007076 Bacteria 801
279 Ga0105251_10018255 3300009011 Bacteria 3734
280 Ga0105251_10085736 3300009011 Bacteria 1451
281 Ga0105244_10099659 3300009036 Bacteria 1422
282 Ga0105250_10240481 3300009092 Bacteria 772
283 Ga0105240_10393500 3300009093 Bacteria 1562
284 Ga0111539_10053806 3300009094 Bacteria 4792
285 Ga0111539_10157593 3300009094 Bacteria 2656
286 Ga0111539_10161724 3300009094 Bacteria 2618
287 Ga0111539_10394425 3300009094 Bacteria 1612
288 Ga0111539_10555773 3300009094 Bacteria 1337
289 Ga0111539_11579225 3300009094 Bacteria 761
290 Ga0111539_12066323 3300009094 Bacteria 661
291 Ga0105245_10064792 3300009098 Bacteria 3303
292 Ga0105245_10115988 3300009098 Bacteria 2497
293 Ga0105245_10429208 3300009098 Bacteria 1326
294 Ga0105245_10694743 3300009098 Bacteria 1050
295 Ga0105245_11284516 3300009098 Bacteria 781
296 Ga0105247_10105653 3300009101 Bacteria 1806
297 Ga0105247_10124036 3300009101 Bacteria 1677
298 Ga0114129_10146873 3300009147 Bacteria 3229
299 Ga0114129_10173387 3300009147 Bacteria 2939
300 Ga0114129_10304138 3300009147 Bacteria 2124
301 Ga0114129_10448341 3300009147 Bacteria 1693
302 Ga0114129_10916141 3300009147 Bacteria 1110
303 Ga0114129_10956757 3300009147 Bacteria 1081
304 Ga0114129_10982315 3300009147 Bacteria 1064
305 Ga0114129_11311959 3300009147 Bacteria 896
306 Ga0105243_10312695 3300009148 Bacteria 1428
307 Ga0105243_11296439 3300009148 Unclassified 745
308 Ga0105241_10047409 3300009174 Bacteria 3267
309 Ga0105241_10395807 3300009174 Unclassified 1210
310 Ga0105241_11927088 3300009174 Bacteria 580
311 Ga0105241_12320882 3300009174 Bacteria 534
312 Ga0105242_10131871 3300009176 Bacteria 2158
313 Ga0105248_10055968 3300009177 Bacteria 4424
314 Ga0105248_10305272 3300009177 Bacteria 1792
315 Ga0105248_10318407 3300009177 Bacteria 1752
316 Ga0105237_11010517 3300009545 Bacteria 838
317 Ga0105237_11079414 3300009545 Bacteria 810
318 Ga0105237_11300885 3300009545 Bacteria 733
319 Ga0105238_10024849 3300009551 Bacteria 6106
320 Ga0105238_10186972 3300009551 Bacteria 2048
321 Ga0105238_10479500 3300009551 Bacteria 1243
322 Ga0105238_11264875 3300009551 Bacteria 763
323 Ga0105238_11354494 3300009551 Bacteria 738
324 Ga0105249_10013769 3300009553 Bacteria 7144
325 Ga0105249_10188458 3300009553 Bacteria 2012
326 Ga0105249_10772584 3300009553 Bacteria 1024
327 Ga0105249_10859814 3300009553 Bacteria 973
328 Ga0105249_11096500 3300009553 Bacteria 866
329 Ga0105249_13526288 3300009553 Bacteria 504
330 Ga0105239_10797698 3300010375 Bacteria 1082
331 Ga0105239_10821910 3300010375 Bacteria 1065
332 Ga0105239_11112190 3300010375 Bacteria 910
333 Ga0105239_11381293 3300010375 Bacteria 813
334 Ga0105239_12968151 3300010375 Bacteria 553
335 Ga0105239_12980143 3300010375 Bacteria 552
336 Ga0105239_13620492 3300010375 Bacteria 502
337 Ga0105246_10073676 3300011119 Bacteria 2411
338 Ga0105246_10311226 3300011119 Bacteria 1276
339 Ga0105246_10319735 3300011119 Bacteria 1261
340 Ga0105246_11113452 3300011119 Bacteria 722
341 Ga0157344_1001452 3300012476 Bacteria 1131
342 Ga0157328_1006624 3300012478 Bacteria 710
343 Ga0157320_1004341 3300012481 Bacteria 901
344 Ga0157318_1002382 3300012482 Bacteria 1018
345 Ga0157337_1012173 3300012483 Bacteria 690
346 Ga0157321_1001536 3300012487 Bacteria 1190
347 Ga0157321_1001672 3300012487 Bacteria 1161
348 Ga0157329_1010619 3300012491 Bacteria 724
349 Ga0157335_1000732 3300012492 Bacteria 1601
350 Ga0157341_1001329 3300012494 Bacteria 1478
351 Ga0157319_1005116 3300012497 Bacteria 890
352 Ga0157345_1004555 3300012498 Bacteria 1044
353 Ga0157339_1029903 3300012505 Bacteria 631
354 Ga0157339_1042471 3300012505 Bacteria 575
355 Ga0157342_1034889 3300012507 Bacteria 650
356 Ga0157316_1054880 3300012510 Bacteria 561
357 Ga0157326_1007534 3300012513 Bacteria 1177
358 Ga0157326_1011009 3300012513 Bacteria 1015
359 Ga0154016_118101 3300013045 Bacteria 538
360 Ga0154012_168450 3300013059 Bacteria 2407
361 Ga0157373_10059673 3300013100 Bacteria 2703
362 Ga0157371_10040069 3300013102 Bacteria 3348
363 Ga0157371_10425723 3300013102 Bacteria 974
364 Ga0157370_10215352 3300013104 Bacteria 1780
365 Ga0157369_10676920 3300013105 Bacteria 1063
366 Ga0157374_11165652 3300013296 Bacteria 792
367 Ga0157374_12329021 3300013296 Bacteria 563
368 Ga0157374_12591812 3300013296 Bacteria 535
369 Ga0157378_10367541 3300013297 Bacteria 1409
370 Ga0157378_11645108 3300013297 Bacteria 688
371 Ga0163162_10081706 3300013306 Bacteria 3302
372 Ga0163162_10431206 3300013306 Bacteria 1450
373 Ga0163162_13309803 3300013306 Bacteria 516
374 Ga0157372_10150306 3300013307 Bacteria 2688
375 Ga0157372_11362142 3300013307 Bacteria 818
376 Ga0157372_11762408 3300013307 Bacteria 712
377 Ga0157375_10252686 3300013308 Bacteria 1924
378 Ga0157375_10353462 3300013308 Bacteria 1635
379 Ga0157375_10575080 3300013308 Bacteria 1287
380 Ga0157375_11026372 3300013308 Bacteria 963
381 Ga0163163_10080375 3300014325 Bacteria 3260
382 Ga0163163_10199818 3300014325 Bacteria 2047
383 Ga0163163_10544726 3300014325 Bacteria 1223
384 Ga0163163_11259353 3300014325 Bacteria 802
385 Ga0157380_10162222 3300014326 Bacteria 1944
386 Ga0157380_10299943 3300014326 Bacteria 1480
387 Ga0157380_10744554 3300014326 Bacteria 991
388 Ga0157380_11091886 3300014326 Bacteria 836
389 Ga0182008_10246229 3300014497 Bacteria 921
390 Ga0182008_10260871 3300014497 Bacteria 896
391 Ga0157377_10021726 3300014745 Bacteria 3380
392 Ga0157377_10954972 3300014745 Bacteria 645
393 Ga0157379_10955709 3300014968 Bacteria 815
394 Ga0157376_10328465 3300014969 Bacteria 1456
395 Ga0182005_1085550 3300015265 Bacteria 874
396 Ga0163161_10028629 3300017792 Bacteria 3957
397 Ga0163161_11140830 3300017792 Bacteria 672
398 Ga0197907_10062224 3300020069 Bacteria 522
399 Ga0197907_10589343 3300020069 Bacteria 7139
400 Ga0197907_10600103 3300020069 Bacteria 1054
401 Ga0197907_10771716 3300020069 Bacteria 1288
402 Ga0197907_10917418 3300020069 Bacteria 2203
403 Ga0206356_10151201 3300020070 Bacteria 3411
404 Ga0206356_10756000 3300020070 Bacteria 934
405 Ga0206356_11021398 3300020070 Bacteria 700
406 Ga0206356_11659164 3300020070 Bacteria 723
407 Ga0206349_1167587 3300020075 Bacteria 537
408 Ga0206355_1486302 3300020076 Bacteria 936
409 Ga0206355_1647528 3300020076 Bacteria 1326
410 Ga0206352_11247908 3300020078 Bacteria 794
411 Ga0206352_11337198 3300020078 Bacteria 2126
412 Ga0206350_10512250 3300020080 Bacteria 1547
413 Ga0206350_10550630 3300020080 Bacteria 1609
414 Ga0206350_10991633 3300020080 Bacteria 532
415 Ga0206350_11266182 3300020080 Bacteria 1131
416 Ga0206354_10260094 3300020081 Bacteria 1198
417 Ga0206353_10778556 3300020082 Bacteria 912
418 Ga0206353_10908020 3300020082 Bacteria 561
419 Ga0206353_11681707 3300020082 Bacteria 729
420 Ga0213873_10079077 3300021358 Bacteria 918
421 Ga0213873_10150173 3300021358 Bacteria 701
422 Ga0213876_10120256 3300021384 Bacteria 1394
423 Ga0213875_10000287 3300021388 Bacteria 48929
424 Ga0213875_10002379 3300021388 Bacteria 11316
425 Ga0213875_10143022 3300021388 Bacteria 1120
426 Ga0213875_10343934 3300021388 Bacteria 708
427 Ga0213871_10115050 3300021441 Bacteria 798
428 Ga0213871_10200801 3300021441 Unclassified 622
429 Ga0224712_10174171 3300022467 Bacteria 966
430 Ga0224712_10254322 3300022467 Bacteria 812
431 Ga0224712_10489968 3300022467 Bacteria 593
432 Ga0224712_10503000 3300022467 Bacteria 586
433 Ga0224712_10601044 3300022467 Bacteria 537
434 Ga0207656_10278524 3300025321 Bacteria 824
435 Ga0207713_1141770 3300025735 Bacteria 784
436 Ga0207653_10005525 3300025885 Bacteria 3947
437 Ga0207682_10419999 3300025893 Bacteria 632
438 Ga0207692_10051175 3300025898 Bacteria 2093
439 Ga0207692_10202706 3300025898 Bacteria 1167
440 Ga0207642_10043317 3300025899 Bacteria 1984
441 Ga0207710_10322946 3300025900 Bacteria 783
442 Ga0207710_10482988 3300025900 Bacteria 642
443 Ga0207688_10023261 3300025901 Bacteria 3392
444 Ga0207688_10172938 3300025901 Bacteria 1285
445 Ga0207688_10184011 3300025901 Bacteria 1247
446 Ga0207680_10257363 3300025903 Bacteria 1207
447 Ga0207647_10297266 3300025904 Bacteria 920
448 Ga0207647_10361474 3300025904 Bacteria 821
449 Ga0207685_10082938 3300025905 Bacteria 1331
450 Ga0207685_10518598 3300025905 Bacteria 630
451 Ga0207699_10021404 3300025906 Bacteria 3484
452 Ga0207699_10137991 3300025906 Bacteria 1599
453 Ga0207699_10190074 3300025906 Bacteria 1385
454 Ga0207699_11336195 3300025906 Bacteria 530
455 Ga0207645_10024982 3300025907 Bacteria 3870
456 Ga0207643_10022011 3300025908 Bacteria 3508
457 Ga0207643_10169114 3300025908 Bacteria 1318
458 Ga0207705_10052746 3300025909 Bacteria 2929
459 Ga0207684_10337153 3300025910 Bacteria 1299
460 Ga0207684_10374096 3300025910 Bacteria 1226
461 Ga0207684_10838960 3300025910 Bacteria 775
462 Ga0207684_11166818 3300025910 Bacteria 639
463 Ga0207654_10193483 3300025911 Bacteria 1335
464 Ga0207707_10019452 3300025912 Bacteria 5928
465 Ga0207707_10433096 3300025912 Bacteria 1126
466 Ga0207707_10568362 3300025912 Bacteria 962
467 Ga0207707_10859034 3300025912 Bacteria 752
468 Ga0207707_10913937 3300025912 Bacteria 725
469 Ga0207671_10837532 3300025914 Bacteria 729
470 Ga0207671_11476763 3300025914 Bacteria 525
471 Ga0207693_10083464 3300025915 Bacteria 2503
472 Ga0207693_11104438 3300025915 Bacteria 602
473 Ga0207693_11407296 3300025915 Bacteria 518
474 Ga0207663_10002343 3300025916 Bacteria 9098
475 Ga0207663_10055972 3300025916 Bacteria 2477
476 Ga0207663_10188479 3300025916 Bacteria 1479
477 Ga0207663_10285881 3300025916 Bacteria 1227
478 Ga0207663_11731693 3300025916 Bacteria 503
479 Ga0207660_10822083 3300025917 Bacteria 758
480 Ga0207660_11056137 3300025917 Bacteria 662
481 Ga0207662_10008902 3300025918 Bacteria 5506
482 Ga0207657_10010851 3300025919 Bacteria 9064
483 Ga0207649_10047085 3300025920 Bacteria 2652
484 Ga0207649_10757696 3300025920 Bacteria 756
485 Ga0207652_10059326 3300025921 Bacteria 3298
486 Ga0207652_10079514 3300025921 Bacteria 2864
487 Ga0207652_10429524 3300025921 Bacteria 1191
488 Ga0207646_10563090 3300025922 Bacteria 1024
489 Ga0207646_11117306 3300025922 Bacteria 693
490 Ga0207646_11307934 3300025922 Bacteria 633
491 Ga0207694_10206350 3300025924 Bacteria 1600
492 Ga0207694_10276150 3300025924 Bacteria 1379
493 Ga0207694_10577387 3300025924 Bacteria 945
494 Ga0207694_11236932 3300025924 Bacteria 632
495 Ga0207650_10028329 3300025925 Bacteria 4015
496 Ga0207659_10320733 3300025926 Bacteria 1278
497 Ga0207687_10037346 3300025927 Bacteria 3313
498 Ga0207687_10119070 3300025927 Bacteria 1972
499 Ga0207687_10617870 3300025927 Bacteria 915
500 Ga0207687_10701226 3300025927 Bacteria 859
501 Ga0207687_11198204 3300025927 Bacteria 653
502 Ga0207700_10003084 3300025928 Bacteria 9617
503 Ga0207700_10008397 3300025928 Bacteria 6396
504 Ga0207700_10103401 3300025928 Bacteria 2277
505 Ga0207700_10116091 3300025928 Bacteria 2162
506 Ga0207700_10176926 3300025928 Bacteria 1784
507 Ga0207664_10002753 3300025929 Bacteria 11671
508 Ga0207664_10026416 3300025929 Bacteria 4388
509 Ga0207664_10063610 3300025929 Bacteria 2949
510 Ga0207664_10090973 3300025929 Bacteria 2501
511 Ga0207664_10282636 3300025929 Bacteria 1456
512 Ga0207644_10043226 3300025931 Bacteria 3196
513 Ga0207644_11026482 3300025931 Bacteria 692
514 Ga0207690_10253540 3300025932 Bacteria 1360
515 Ga0207690_10511687 3300025932 Bacteria 972
516 Ga0207706_10012770 3300025933 Bacteria 7645
517 Ga0207706_10048071 3300025933 Bacteria 3774
518 Ga0207706_11219651 3300025933 Bacteria 624
519 Ga0207706_11303192 3300025933 Bacteria 600
520 Ga0207686_11372257 3300025934 Bacteria 581
521 Ga0207709_10024317 3300025935 Bacteria 3458
522 Ga0207709_11051138 3300025935 Bacteria 667
523 Ga0207670_10160518 3300025936 Bacteria 1677
524 Ga0207670_11249769 3300025936 Bacteria 629
525 Ga0207669_10124215 3300025937 Bacteria 1759
526 Ga0207669_10167788 3300025937 Bacteria 1559
527 Ga0207669_11089734 3300025937 Bacteria 674
528 Ga0207669_11359742 3300025937 Bacteria 604
529 Ga0207704_10302887 3300025938 Bacteria 1225
530 Ga0207704_10336036 3300025938 Bacteria 1171
531 Ga0207704_10710173 3300025938 Bacteria 833
532 Ga0207704_11625475 3300025938 Bacteria 555
533 Ga0207665_10025970 3300025939 Bacteria 3864
534 Ga0207665_10131467 3300025939 Bacteria 1777
535 Ga0207665_10508859 3300025939 Bacteria 931
536 Ga0207691_10033856 3300025940 Bacteria 4756
537 Ga0207691_10385097 3300025940 Bacteria 1197
538 Ga0207691_10758526 3300025940 Bacteria 817
539 Ga0207711_10190803 3300025941 Bacteria 1867
540 Ga0207711_10483241 3300025941 Bacteria 1154
541 Ga0207711_10556045 3300025941 Bacteria 1070
542 Ga0207711_10612788 3300025941 Bacteria 1016
543 Ga0207689_10035855 3300025942 Bacteria 4118
544 Ga0207689_10040929 3300025942 Bacteria 3834
545 Ga0207661_11836559 3300025944 Bacteria 552
546 Ga0207679_10751108 3300025945 Bacteria 887
547 Ga0207667_10946181 3300025949 Bacteria 851
548 Ga0207651_10193251 3300025960 Bacteria 1625
549 Ga0207651_10505767 3300025960 Bacteria 1045
550 Ga0207651_11297176 3300025960 Bacteria 655
551 Ga0207712_10055319 3300025961 Bacteria 2791
552 Ga0207712_10375322 3300025961 Bacteria 1189
553 Ga0207668_10056825 3300025972 Bacteria 2727
554 Ga0207668_10065230 3300025972 Bacteria 2577
555 Ga0207668_10094577 3300025972 Bacteria 2204
556 Ga0207668_10585122 3300025972 Unclassified 971
557 Ga0207668_10783903 3300025972 Bacteria 843
558 Ga0207640_10251188 3300025981 Bacteria 1373
559 Ga0207658_10018375 3300025986 Bacteria 4828
560 Ga0207658_10083168 3300025986 Bacteria 2460
561 Ga0207677_10194477 3300026023 Bacteria 1607
562 Ga0207677_10759838 3300026023 Bacteria 865
563 Ga0207703_10055288 3300026035 Bacteria 3229
564 Ga0207703_10812590 3300026035 Bacteria 893
565 Ga0207703_12079678 3300026035 Bacteria 544
566 Ga0207639_11353182 3300026041 Bacteria 668
567 Ga0207678_10004755 3300026067 Bacteria 12199
568 Ga0207678_10170136 3300026067 Bacteria 1860
569 Ga0207678_10457647 3300026067 Bacteria 1110
570 Ga0207708_10023470 3300026075 Bacteria 4663
571 Ga0207708_11020813 3300026075 Unclassified 719
572 Ga0207702_10062363 3300026078 Bacteria 3183
573 Ga0207702_11951081 3300026078 Bacteria 578
574 Ga0207702_12234160 3300026078 Bacteria 536
575 Ga0207641_10291425 3300026088 Bacteria 1538
576 Ga0207641_10574458 3300026088 Bacteria 1102
577 Ga0207648_10335248 3300026089 Bacteria 1361
578 Ga0207648_10368350 3300026089 Bacteria 1297
579 Ga0207648_10759156 3300026089 Bacteria 901
580 Ga0207676_10065958 3300026095 Bacteria 2884
581 Ga0207676_10141666 3300026095 Bacteria 2059
582 Ga0207676_10167283 3300026095 Bacteria 1912
583 Ga0207676_10249835 3300026095 Bacteria 1596
584 Ga0207676_10971899 3300026095 Bacteria 836
585 Ga0207674_10003916 3300026116 Bacteria 18112
586 Ga0207674_10014777 3300026116 Bacteria 8611
587 Ga0207674_11205013 3300026116 Bacteria 727
588 Ga0207675_100002273 3300026118 Bacteria 19097
589 Ga0207675_100014841 3300026118 Bacteria 7271
590 Ga0207675_100596371 3300026118 Bacteria 1107
591 Ga0207675_100667383 3300026118 Bacteria 1047
592 Ga0207683_10002629 3300026121 Bacteria 15702
593 Ga0207683_10286074 3300026121 Bacteria 1507
594 Ga0207698_10136783 3300026142 Bacteria 2103
595 Ga0207698_10228086 3300026142 Bacteria 1689
596 Ga0207698_10880820 3300026142 Bacteria 902
597 Ga0207698_11293937 3300026142 Bacteria 744
598 Ga0207428_10001336 3300027907 Bacteria 26222
599 Ga0207428_10581183 3300027907 Bacteria 808
600 Ga0207428_10927328 3300027907 Bacteria 614
601 Ga0265357_1013765 3300028023 Bacteria 843
602 Ga0268266_10215026 3300028379 Bacteria 1764
603 Ga0268266_10406341 3300028379 Bacteria 1288
604 Ga0268266_11248177 3300028379 Unclassified 718
605 Ga0268266_11677443 3300028379 Bacteria 611
606 Ga0268265_10704499 3300028380 Bacteria 976
607 Ga0268265_11084822 3300028380 Bacteria 794
608 Ga0268265_11147400 3300028380 Bacteria 773
609 Ga0268264_10359495 3300028381 Bacteria 1388
610 Ga0268264_10685510 3300028381 Bacteria 1017
611 Ga0268264_12284514 3300028381 Bacteria 548
612 Ga0265334_10024295 3300028573 Bacteria 2460
613 Ga0307515_10234593 3300028794 Bacteria 1619
614 Ga0265338_10010522 3300028800 Bacteria 10820
615 Ga0307511_10000212 3300030521 Bacteria 59189
616 Ga0307511_10088246 3300030521 Bacteria 2123
617 Ga0265762_1092595 3300030760 Bacteria 661
618 Ga0265762_1137384 3300030760 Bacteria 572
619 Ga0265763_1002351 3300030763 Bacteria 1446
620 Ga0265767_105926 3300030836 Bacteria 751
621 Ga0265766_1001087 3300030863 Bacteria 1311
622 Ga0265768_101295 3300030963 Bacteria 1149
623 Ga0265773_1000888 3300031018 Bacteria 1423
624 Ga0265320_10011837 3300031240 Bacteria 5112
625 Ga0265325_10011636 3300031241 Bacteria 5053
626 Ga0265329_10041183 3300031242 Bacteria 1482
627 Ga0265340_10015634 3300031247 Bacteria 3941
628 Ga0265339_10003699 3300031249 Bacteria 10671
629 Ga0265331_10484126 3300031250 Unclassified 556
630 Ga0265327_10000019 3300031251 Bacteria 427653
631 Ga0307513_10006720 3300031456 Bacteria 15013
632 Ga0307408_100008957 3300031548 Bacteria 6610
633 Ga0307408_100019064 3300031548 Bacteria 4616
634 Ga0307408_100217991 3300031548 Bacteria 1555
635 Ga0307408_101083270 3300031548 Bacteria 742
636 Ga0265313_10077855 3300031595 Bacteria 1513
637 Ga0316579_10101216 3300031691 Bacteria 1380
638 Ga0265314_10010164 3300031711 Bacteria 7885
639 Ga0265342_10071088 3300031712 Bacteria 2029
640 Ga0307405_10025197 3300031731 Bacteria 3410
641 Ga0307405_10090349 3300031731 Bacteria 2026
642 Ga0307405_10139218 3300031731 Bacteria 1689
643 Ga0307405_10763750 3300031731 Bacteria 806
644 Ga0307405_11174205 3300031731 Bacteria 663
645 Ga0316577_10175745 3300031733 Bacteria 1209
646 Ga0307413_10020604 3300031824 Bacteria 3511
647 Ga0307413_10057908 3300031824 Bacteria 2372
648 Ga0307413_11317294 3300031824 Bacteria 632
649 Ga0307410_10004986 3300031852 Bacteria 6963
650 Ga0307410_10069920 3300031852 Bacteria 2430
651 Ga0307410_10571537 3300031852 Bacteria 939
652 Ga0307410_11037091 3300031852 Bacteria 709
653 Ga0307410_11168073 3300031852 Bacteria 669
654 Ga0307406_10127083 3300031901 Bacteria 1783
655 Ga0307406_10229811 3300031901 Bacteria 1384
656 Ga0307406_10244303 3300031901 Bacteria 1348
657 Ga0307406_10252465 3300031901 Bacteria 1329
658 Ga0307406_10860565 3300031901 Bacteria 769
659 Ga0307406_10920514 3300031901 Bacteria 745
660 Ga0307406_11421424 3300031901 Bacteria 608
661 Ga0307407_10004283 3300031903 Bacteria 6024
662 Ga0307407_10137462 3300031903 Bacteria 1572
663 Ga0307407_10214977 3300031903 Bacteria 1296
664 Ga0307407_10350275 3300031903 Bacteria 1045
665 Ga0307407_11474433 3300031903 Bacteria 537
666 Ga0307412_10153876 3300031911 Bacteria 1700
667 Ga0307412_10432161 3300031911 Bacteria 1080
668 Ga0307412_10539889 3300031911 Bacteria 977
669 Ga0307412_11130256 3300031911 Bacteria 698
670 Ga0307409_100006641 3300031995 Bacteria 6826
671 Ga0307409_100022131 3300031995 Bacteria 4375
672 Ga0307409_100051560 3300031995 Bacteria 3149
673 Ga0307409_100108333 3300031995 Bacteria 2323
674 Ga0307409_100154335 3300031995 Bacteria 1998
675 Ga0307409_100609978 3300031995 Bacteria 1079
676 Ga0307416_100082530 3300032002 Bacteria 2723
677 Ga0307416_100167011 3300032002 Bacteria 2042
678 Ga0307416_100441418 3300032002 Bacteria 1351
679 Ga0307416_101163551 3300032002 Bacteria 877
680 Ga0307416_101554318 3300032002 Bacteria 767
681 Ga0307414_10107170 3300032004 Bacteria 2117
682 Ga0307414_10212664 3300032004 Bacteria 1582
683 Ga0307414_10821594 3300032004 Bacteria 848
684 Ga0307414_11132289 3300032004 Bacteria 723
685 Ga0307414_11934555 3300032004 Bacteria 550
686 Ga0307411_10025146 3300032005 Bacteria 3562
687 Ga0307411_10134400 3300032005 Bacteria 1813
688 Ga0307411_10188023 3300032005 Bacteria 1574
689 Ga0307411_10435782 3300032005 Bacteria 1092
690 Ga0307411_11661178 3300032005 Bacteria 590
691 Ga0307415_100011821 3300032126 Bacteria 5017
692 Ga0307415_100581803 3300032126 Bacteria 993
693 Ga0307415_100898092 3300032126 Bacteria 816
694 Ga0307415_101155936 3300032126 Bacteria 727
695 Ga0316583_10040852 3300032133 Bacteria 1642
696 Ga0307507_10000329 3300033179 Bacteria 96032
697 Ga0307507_10085237 3300033179 Bacteria 2749
698 Ga0316215_1017545 3300033544 Bacteria 723
699 Ga0316214_1002972 3300033545 Bacteria 2115
700 Ga0316214_1008567 3300033545 Bacteria 1377
701 Ga0316212_1006199 3300033547 Bacteria 1736
702 Ga0373930_0030062 3300034816 Bacteria 1113
703 Ga0373950_0062746 3300034818 Bacteria 749
704 Ga0373959_0014093 3300034820 Bacteria 1451
705 Ga0373938_0004895 3300034957 Bacteria 2255
706 Ga0373926_0001004 3300035083 Bacteria 8245
707 Ga0373926_0105762 3300035083 Bacteria 1055
708 Ga0373929_0027832 3300035085 Bacteria 1190
709 Ga0373934_0005441 3300035086 Bacteria 4718
710 Ga0373940_0207423 3300035088 Bacteria 646
711 Ga0373944_0006255 3300035089 Bacteria 3156
712 Ga0373944_0030808 3300035089 Bacteria 1610
713 Ga0373944_0288706 3300035089 Bacteria 613
714 Ga0373949_0019283 3300035090 Bacteria 1552
715 Ga0373951_0197736 3300035091 Bacteria 584
716 Ga0373952_0025270 3300035092 Bacteria 1281
717 Ga0373923_0008519 3300035111 Bacteria 3661
718 Ga0373923_0028820 3300035111 Bacteria 2222
719 Ga0373936_0000482 3300035113 Bacteria 13475
720 Ga0373936_0004605 3300035113 Bacteria 5218
721 Ga0373936_0462800 3300035113 Bacteria 587
722 Ga0373936_0631953 3300035113 Bacteria 504
723 Ga0373939_0115153 3300035114 Bacteria 941
724 Ga0373939_0185296 3300035114 Bacteria 779
725 Ga0373941_0007620 3300035115 Bacteria 2655
726 Ga0373941_0079923 3300035115 Bacteria 1102
727 Ga0373945_0000485 3300035116 Bacteria 11271
728 Ga0373945_0002240 3300035116 Bacteria 6049
729 Ga0373954_0012340 3300035118 Bacteria 3797
730 Ga0373954_0567360 3300035118 Bacteria 562
731 Ga0373956_0004367 3300035119 Bacteria 5665
732 Ga0373956_0013013 3300035119 Bacteria 3458
733 Ga0373956_0139935 3300035119 Bacteria 1136
734 Ga0373957_0118082 3300035120 Bacteria 1072
735 Ga0373943_0000368 3300035170 Bacteria 19143
736 Ga0373943_0014761 3300035170 Bacteria 3542
737 Ga0373943_0061321 3300035170 Bacteria 1880
738 Ga0373946_0002015 3300035171 Bacteria 7115
739 Ga0373946_0003630 3300035171 Bacteria 5465
740 Ga0373955_0007874 3300035172 Bacteria 4916
741 Ga0373955_0034979 3300035172 Bacteria 2657
742 Ga0373955_0081613 3300035172 Bacteria 1828
743 Ga0373942_0024119 3300035207 Bacteria 1558
744 Ga0316574_0003093 3300035398 Bacteria 8496
745 Ga0373924_0034235 3300035410 Bacteria 2055
746 Ga0373924_0299081 3300035410 Bacteria 714
747 Ga0373931_0071382 3300035691 Bacteria 1896
748 Ga0373931_0364852 3300035691 Bacteria 907
749 Ga0373935_0003807 3300035692 Bacteria 8809
750 Ga0373935_0015929 3300035692 Bacteria 4549
751 Ga0373935_0088136 3300035692 Bacteria 2027
752 Ga0373927_0002270 3300035695 Bacteria 14086
753 Ga0373927_0936832 3300035695 Bacteria 571
754 Ga0373933_0035134 3300035724 Bacteria 2925
755 Ga0373933_0389210 3300035724 Bacteria 908
756 Ga0373947_0009607 3300035725 Bacteria 5551
757 Ga0373947_0070086 3300035725 Bacteria 2147
758 Ga0373937_0064872 3300036401 Bacteria 3360
759 Ga0373937_0098972 3300036401 Bacteria 2705
760 Ga0373937_0374115 3300036401 Bacteria 1351
761 Ga0373937_0378462 3300036401 Bacteria 1342
762 Ga0373925_0045325 3300037068 Bacteria 3266
763 Ga0373925_0512065 3300037068 Bacteria 985
764 Ga0395899_0082700 3300037312 Bacteria 2335
765 Ga0395900_0283544 3300037418 Bacteria 1648
766 Ga0395900_0445110 3300037418 Bacteria 1252
767 Ga0395900_1678598 3300037418 Bacteria 546
768 Ga0395898_0012815 3300037466 Bacteria 8655
769 Ga0395898_0956201 3300037466 Bacteria 793
770 Ga0395898_1474465 3300037466 Unclassified 607
771 Ga0395905_0026295 3300037471 Bacteria 5488
772 Ga0395905_1839631 3300037471 Bacteria 511
773 Ga0436364_0154596 3300037853 Bacteria 62862
774 Ga0436364_0182444 3300037853 Bacteria 708
775 Ga0436364_0323152 3300037853 Bacteria 724
776 Ga0436364_1125035 3300037853 Bacteria 36092
777 Ga0395901_0013659 3300038443 Bacteria 8256
778 Ga0395901_2131658 3300038443 Bacteria 505
779 Ga0400483_004249 3300039062 Bacteria 2618
780 Ga0400483_175799 3300039062 Bacteria 7247
781 Ga0436365_0800928 3300039437 Bacteria 779
782 Ga0436365_0984038 3300039437 Bacteria 20730
783 Ga0436360_0027561 3300039438 Bacteria 1539
784 Ga0436360_0070157 3300039438 Bacteria 1125
785 Ga0436360_0914144 3300039438 Bacteria 946
786 Ga0436361_0883200 3300039447 Bacteria 699
787 Ga0436363_1306040 3300039450 Bacteria 510
788 Ga0436362_0513142 3300039453 Bacteria 4048
789 Ga0436362_0916296 3300039453 Bacteria 7523
790 Ga0439439_0017977 3300041406 Bacteria 1743
791 Ga0439453_0069259 3300041408 Bacteria 744
792 Ga0439461_0050733 3300041410 Bacteria 920
793 Ga0439466_0042362 3300041411 Bacteria 1516
794 Ga0451793_0948911 3300041452 Bacteria 4142
795 Ga0451797_0891010 3300041453 Bacteria 550
796 Ga0451795_0533444 3300041456 Bacteria 531
797 Ga0451795_0637961 3300041456 Bacteria 601
798 Ga0451800_0242290 3300041459 Bacteria 638
799 Ga0451833_0713203 3300041491 Bacteria 3171
800 Ga0451837_0535912 3300041494 Bacteria 4102
801 Ga0451839_0403005 3300041496 Bacteria 691
802 Ga0451839_0498698 3300041496 Bacteria 3406
803 Ga0451841_0874204 3300041498 Bacteria 1016
804 Ga0451843_0712501 3300041509 Bacteria 853
805 Ga0451843_1206816 3300041509 Bacteria 569
806 Ga0451853_3042104 3300041512 Bacteria 628
807 Ga0451853_3804823 3300041512 Bacteria 722
808 Ga0439443_007118 3300042003 Bacteria 1550
809 Ga0439443_016281 3300042003 Bacteria 1135
810 Ga0439448_0036946 3300042005 Bacteria 1567
811 Ga0439448_0038275 3300042005 Bacteria 1543
812 Ga0439448_0046624 3300042005 Bacteria 1412
813 Ga0439448_0061139 3300042005 Bacteria 1245
814 Ga0439448_0107677 3300042005 Bacteria 951
815 Ga0439450_000035 3300042008 Bacteria 11242
816 Ga0439450_011775 3300042008 Bacteria 1721
817 Ga0439450_018018 3300042008 Bacteria 1479
818 Ga0439450_120507 3300042008 Bacteria 675
819 Ga0439452_067965 3300042010 Bacteria 788
820 Ga0439454_001686 3300042011 Bacteria 2185
821 Ga0439454_003306 3300042011 Bacteria 1783
822 Ga0439454_033156 3300042011 Bacteria 818
823 Ga0439455_0018810 3300042012 Bacteria 1623
824 Ga0439455_0038123 3300042012 Bacteria 1222
825 Ga0439455_0136136 3300042012 Bacteria 694
826 Ga0439456_051974 3300042013 Bacteria 896
827 Ga0439457_192138 3300042014 Bacteria 501
828 Ga0439463_001477 3300042016 Bacteria 6215
829 Ga0439463_004777 3300042016 Bacteria 3385
830 Ga0439463_010669 3300042016 Bacteria 2258
831 Ga0439463_064242 3300042016 Bacteria 938
832 Ga0450913_002761 3300042117 Bacteria 1105
833 Ga0450914_008018 3300042118 Bacteria 967
834 Ga0450915_011382 3300042119 Bacteria 631
835 Ga0450917_026067 3300042120 Bacteria 541
836 Ga0450891_035994 3300042129 Bacteria 523
837 Ga0450898_094537 3300042134 Bacteria 620
838 Ga0450900_021541 3300042136 Bacteria 901
839 Ga0450900_037249 3300042136 Bacteria 720
840 Ga0450900_071804 3300042136 Bacteria 550
841 Ga0450902_026391 3300042137 Bacteria 971
842 Ga0450904_023465 3300042139 Bacteria 631
843 Ga0450905_002654 3300042142 Bacteria 2309
844 Ga0450905_092082 3300042142 Bacteria 536
845 Ga0439458_0139124 3300042157 Bacteria 646
846 Ga0439458_0189281 3300042157 Bacteria 560
847 Ga0439435_0009970 3300042436 Bacteria 2242
848 Ga0439444_0002183 3300042437 Bacteria 2646
849 Ga0439444_0060942 3300042437 Bacteria 788
850 Ga0439459_0042238 3300042438 Bacteria 973
851 Ga0439459_0048877 3300042438 Bacteria 922
852 Ga0439459_0053458 3300042438 Bacteria 893
853 Ga0439459_0102746 3300042438 Bacteria 701
854 Ga0439464_0010913 3300042439 Bacteria 2401
855 Ga0439464_0194462 3300042439 Bacteria 645
856 Ga0439460_0003195 3300042461 Bacteria 3958
857 Ga0439460_0010060 3300042461 Bacteria 2412
858 Ga0439460_0019662 3300042461 Bacteria 1831
859 Ga0439460_0284883 3300042461 Bacteria 576
860 Ga0450916_024509 3300042530 Bacteria 847
861 Ga0439440_0000128 3300042993 Bacteria 10663
862 Ga0439440_0000836 3300042993 Bacteria 5352
863 Ga0439440_0002296 3300042993 Bacteria 3594
864 Ga0466972_0209223 3300044658 Bacteria 913
865 Ga0453683_0285305 3300044673 Bacteria 1055
866 Ga0466966_0091496 3300044684 Bacteria 1888
867 Ga0466961_0070627 3300044693 Bacteria 2217
868 Ga0466961_0224672 3300044693 Bacteria 1157
869 Ga0466963_0098154 3300044694 Bacteria 2002
870 Ga0466963_0599349 3300044694 Unclassified 778
871 Ga0466964_0767142 3300044706 Bacteria 543
872 Ga0466964_0795879 3300044706 Bacteria 534
873 Ga0466971_0308557 3300044719 Bacteria 761
874 Ga0466970_0172981 3300044765 Bacteria 1197
875 Ga0466970_0450724 3300044765 Bacteria 738
876 Ga0466970_0834115 3300044765 Bacteria 541
877 Ga0466957_0253442 3300044842 Bacteria 1171
878 Ga0466957_0387446 3300044842 Bacteria 954
879 Ga0466960_0199184 3300044901 Bacteria 1093
880 Ga0466959_0072169 3300045049 Bacteria 2499
881 Ga0466959_1178682 3300045049 Unclassified 509
882 Ga0466958_0394228 3300045836 Bacteria 893
883 Ga0466958_0550939 3300045836 Bacteria 749
884 Ga0466967_0142653 3300045976 Bacteria 2232
885 Ga0466967_1312802 3300045976 Unclassified 721
886 Ga0466967_1586905 3300045976 Bacteria 652
887 Ga0495627_173053 3300046453 Bacteria 599
888 Ga0495592_0060290 3300046454 Bacteria 2791
889 Ga0495592_0227188 3300046454 Bacteria 1244
890 Ga0495592_0756328 3300046454 Bacteria 580
891 Ga0495592_0950261 3300046454 Bacteria 503
892 Ga0495603_0256857 3300046455 Bacteria 1006
893 Ga0495603_0318036 3300046455 Bacteria 893
894 Ga0495629_0016977 3300046459 Bacteria 5222
895 Ga0495629_0205101 3300046459 Bacteria 1362
896 Ga0495641_0015396 3300046461 Bacteria 4085
897 Ga0495641_0171219 3300046461 Bacteria 972
898 Ga0495651_0032413 3300046462 Bacteria 4075
899 Ga0495651_0151987 3300046462 Bacteria 1667
900 Ga0495653_0015253 3300046463 Bacteria 6261
901 Ga0495653_0102962 3300046463 Bacteria 2065
902 Ga0495653_0869221 3300046463 Bacteria 539
903 Ga0495580_0124984 3300046472 Bacteria 1785
904 Ga0495580_0938835 3300046472 Bacteria 554
905 Ga0495582_0010972 3300046473 Bacteria 4986
906 Ga0495639_0049730 3300046475 Bacteria 1903
907 Ga0495662_0027556 3300046476 Bacteria 2744
908 Ga0495662_0056693 3300046476 Bacteria 1892
909 Ga0495662_0079873 3300046476 Bacteria 1590
910 Ga0495662_0220375 3300046476 Bacteria 935
911 Ga0495664_0028425 3300046477 Bacteria 3265
912 Ga0495664_0039374 3300046477 Bacteria 2792
913 Ga0495664_0440607 3300046477 Bacteria 780
914 Ga0495584_0085481 3300046491 Bacteria 1589
915 Ga0495585_0571628 3300046492 Bacteria 533
916 Ga0495594_0015240 3300046499 Bacteria 4038
917 Ga0495594_0050670 3300046499 Bacteria 2284
918 Ga0495596_0052010 3300046500 Bacteria 1604
919 Ga0495608_0063052 3300046511 Bacteria 2433
920 Ga0495608_0076737 3300046511 Bacteria 2175
921 Ga0495618_0068945 3300046514 Bacteria 2248
922 Ga0495618_0348073 3300046514 Bacteria 913
923 Ga0495628_0025142 3300046516 Bacteria 4866
924 Ga0495628_0110770 3300046516 Bacteria 2111
925 Ga0495630_0009083 3300046517 Bacteria 7143
926 Ga0495630_0111063 3300046517 Bacteria 2076
927 Ga0495630_0180311 3300046517 Bacteria 1610
928 Ga0495632_0481617 3300046519 Bacteria 536
929 Ga0495666_0008049 3300046526 Bacteria 5284
930 Ga0495652_0035058 3300046529 Bacteria 4368
931 Ga0495652_0100099 3300046529 Bacteria 2352
932 Ga0495652_0249945 3300046529 Bacteria 1314
933 Ga0495652_0509199 3300046529 Bacteria 833
934 Ga0495654_0292749 3300046530 Bacteria 667
935 Ga0495665_0003251 3300046531 Bacteria 8794
936 Ga0495665_0003452 3300046531 Bacteria 8584
937 Ga0495665_0028246 3300046531 Bacteria 3008
938 Ga0495665_0068728 3300046531 Bacteria 1868
939 Ga0495665_0078996 3300046531 Bacteria 1731
940 Ga0495640_0016803 3300046533 Bacteria 5470
941 Ga0495640_0195666 3300046533 Bacteria 1283
942 Ga0495640_0350980 3300046533 Bacteria 910
943 Ga0495586_0017383 3300046535 Bacteria 3823
944 Ga0495586_0028005 3300046535 Bacteria 3015
945 Ga0495587_0048774 3300046536 Bacteria 2507
946 Ga0495587_0444498 3300046536 Bacteria 718
947 Ga0495587_0481664 3300046536 Bacteria 686
948 Ga0495609_0022560 3300046538 Bacteria 2899
949 Ga0495621_0036101 3300046539 Bacteria 1714
950 Ga0495621_0049098 3300046539 Bacteria 1505
951 Ga0495645_0158007 3300046543 Bacteria 1569
952 Ga0495645_0387711 3300046543 Bacteria 892
953 Ga0495622_0073197 3300046557 Bacteria 1581
954 Ga0495667_0030332 3300046559 Bacteria 3635
955 Ga0495667_0044382 3300046559 Bacteria 2944
956 Ga0495667_0953623 3300046559 Bacteria 524
957 Ga0495656_0009807 3300046615 Bacteria 3457
958 Ga0495634_0072421 3300046642 Bacteria 2266
959 Ga0495634_0139446 3300046642 Bacteria 1540
960 Ga0495634_0153533 3300046642 Bacteria 1454
961 Ga0495611_0121512 3300046648 Bacteria 1218
962 Ga0495635_0000658 3300046663 Bacteria 22137
963 Ga0495635_0056326 3300046663 Bacteria 2706
964 Ga0495635_0067430 3300046663 Bacteria 2454
965 Ga0495588_0626313 3300046674 Bacteria 563
966 Ga0495657_0070320 3300046675 Bacteria 2287
967 Ga0495657_0133453 3300046675 Bacteria 1553
968 Ga0495657_0491080 3300046675 Bacteria 716
969 Ga0495599_0036981 3300046678 Bacteria 3067
970 Ga0495599_0056549 3300046678 Bacteria 2456
971 Ga0495623_0113935 3300046679 Bacteria 1635
972 Ga0495623_0197230 3300046679 Bacteria 1159
973 Ga0495646_0070249 3300046680 Bacteria 2063
974 Ga0495646_0214735 3300046680 Bacteria 1042
975 Ga0495646_0445064 3300046680 Bacteria 669
976 Ga0495647_0135939 3300046681 Bacteria 1045
977 Ga0495647_0405850 3300046681 Bacteria 626
978 Ga0495658_0194985 3300046683 Bacteria 1261
979 Ga0495658_0226256 3300046683 Bacteria 1172
980 Ga0495669_0034011 3300046684 Bacteria 2246
981 Ga0495613_0006122 3300046689 Bacteria 9002
982 Ga0495613_0167325 3300046689 Bacteria 1561
983 Ga0495624_0035552 3300046690 Bacteria 3216
984 Ga0495624_0068963 3300046690 Bacteria 2204
985 Ga0495624_0304014 3300046690 Bacteria 961
986 Ga0495670_0250846 3300046691 Bacteria 943
987 Ga0495649_0430873 3300046694 Bacteria 660
988 Ga0495589_0087574 3300046794 Bacteria 1512
989 Ga0495600_0018569 3300046809 Bacteria 4432
990 Ga0495600_0091470 3300046809 Bacteria 1984
991 Ga0495600_0350001 3300046809 Bacteria 925
992 Ga0495581_0007400 3300047315 Bacteria 6350
993 Ga0495581_0015967 3300047315 Bacteria 4364
994 Ga0495581_0251668 3300047315 Bacteria 1033
995 Ga0495581_0569927 3300047315 Bacteria 657
996 Ga0495604_0121375 3300047317 Bacteria 1891
997 Ga0495604_0201907 3300047317 Bacteria 1378
998 Ga0495636_0032597 3300047318 Bacteria 2138
999 Ga0495674_0088142 3300047319 Bacteria 2654
1000 Ga0495676_0035969 3300047321 Bacteria 4139
1001 Ga0495676_0276273 3300047321 Bacteria 1138
1002 Ga0495680_0150464 3300047322 Bacteria 1697
1003 Ga0495680_0828427 3300047322 Bacteria 602
1004 Ga0495675_0084221 3300047444 Bacteria 2001
1005 Ga0495675_0324314 3300047444 Bacteria 910
1006 Ga0495684_0054691 3300047471 Bacteria 3044
1007 Ga0495684_0086267 3300047471 Bacteria 2379
1008 Ga0495684_0768151 3300047471 Bacteria 632
1009 Ga0495593_0045304 3300047673 Bacteria 2348
1010 Ga0495593_0400310 3300047673 Bacteria 686
1011 Ga0495602_0113980 3300048088 Bacteria 2190
1012 Ga0495602_0424457 3300048088 Bacteria 943
1013 Ga0495602_0797006 3300048088 Bacteria 635
1014 Ga0495614_0052179 3300048089 Bacteria 1753
1015 Ga0495615_0235681 3300048090 Bacteria 576
1016 Ga0496100_0019542 3300048903 Bacteria 4044
1017 Ga0496101_0052070 3300048904 Bacteria 2951
1018 Ga0496101_0606292 3300048904 Bacteria 865
1019 Ga0496102_0306075 3300048905 Bacteria 1498
1020 Ga0496102_0797744 3300048905 Bacteria 866
1021 Ga0496102_1852370 3300048905 Bacteria 520
1022 Ga0496102_1901948 3300048905 Bacteria 512
1023 Ga0496103_0024921 3300048906 Bacteria 3611
1024 Ga0496104_0169357 3300048907 Bacteria 2094
1025 Ga0496104_0178488 3300048907 Bacteria 2034
1026 Ga0496104_0192871 3300048907 Bacteria 1949
1027 Ga0496104_0909186 3300048907 Bacteria 785
1028 Ga0496105_0016547 3300048908 Bacteria 5888
1029 Ga0496105_0132875 3300048908 Bacteria 2051
1030 Ga0496105_1291832 3300048908 Bacteria 533
1031 Ga0496106_0862544 3300048909 Bacteria 716
1032 Ga0496107_0096143 3300048910 Bacteria 2167
1033 Ga0496108_0225681 3300048911 Bacteria 1628
1034 Ga0496108_0311649 3300048911 Bacteria 1371
1035 Ga0496108_0449639 3300048911 Bacteria 1125
1036 Ga0496108_0470252 3300048911 Bacteria 1098
1037 Ga0496109_0059001 3300048912 Bacteria 3506
1038 Ga0496109_1299259 3300048912 Bacteria 663
1039 Ga0496109_1344953 3300048912 Bacteria 650
1040 Ga0496109_1552522 3300048912 Bacteria 597
1041 Ga0496109_1858059 3300048912 Bacteria 535
1042 Ga0496110_0070071 3300048913 Bacteria 3106
1043 Ga0496110_0073263 3300048913 Bacteria 3039
1044 Ga0496110_0506179 3300048913 Bacteria 1099
1045 Ga0496110_0612221 3300048913 Bacteria 987
1046 Ga0496111_0222421 3300048914 Bacteria 1402
1047 Ga0496111_0443665 3300048914 Bacteria 958
1048 Ga0496111_1183767 3300048914 Bacteria 542
1049 Ga0496112_0128615 3300048915 Bacteria 2503
1050 Ga0496112_0467682 3300048915 Bacteria 1198
1051 Ga0496112_0694556 3300048915 Bacteria 945
1052 Ga0496113_0016306 3300048916 Bacteria 5130
1053 Ga0496113_0070923 3300048916 Bacteria 2649
1054 Ga0496113_0088993 3300048916 Bacteria 2376
1055 Ga0496113_0577319 3300048916 Bacteria 901
1056 Ga0496113_0870307 3300048916 Bacteria 714
1057 Ga0496114_0172345 3300048917 Bacteria 1886
1058 Ga0496114_0673297 3300048917 Bacteria 909
1059 Ga0496114_0898941 3300048917 Bacteria 767
1060 Ga0496114_1459927 3300048917 Bacteria 572
1061 Ga0496115_0267680 3300048918 Bacteria 1404
1062 Ga0496115_0393115 3300048918 Bacteria 1126
1063 Ga0496118_0331690 3300048921 Unclassified 820
1064 Ga0496119_0036955 3300048922 Bacteria 3180
1065 Ga0496120_0254820 3300048923 Bacteria 822
1066 Ga0496122_0011095 3300048925 Bacteria 9185
1067 Ga0496123_0001686 3300048926 Bacteria 29566
1068 Ga0496125_0277027 3300048928 Bacteria 1042
1069 Ga0496126_0000007 3300048929 Bacteria 787364
1070 Ga0496126_0001977 3300048929 Bacteria 29041
1071 Ga0496126_0162886 3300048929 Bacteria 1905
1072 Ga0496126_0936235 3300048929 Bacteria 654
1073 Ga0501031_0007036 3300049568 Bacteria 7343
1074 Ga0501031_0016176 3300049568 Bacteria 4845
1075 Ga0501032_0035526 3300049569 Bacteria 3407
1076 Ga0501032_0132383 3300049569 Bacteria 1644
1077 Ga0501032_0822093 3300049569 Unclassified 586
1078 Ga0501033_0024312 3300049570 Bacteria 4571
1079 Ga0501033_0044866 3300049570 Bacteria 3291
1080 Ga0501033_1174323 3300049570 Bacteria 509
1081 Ga0501034_0386300 3300049571 Bacteria 1324
1082 Ga0501036_0001139 3300049572 Bacteria 20210
1083 Ga0501036_0011323 3300049572 Bacteria 7381
1084 Ga0501037_0007729 3300049573 Bacteria 7869
1085 Ga0501037_0045918 3300049573 Bacteria 3205
1086 Ga0501037_0826243 3300049573 Bacteria 611
1087 Ga0501038_0027050 3300049574 Bacteria 5106
1088 Ga0501038_0186185 3300049574 Bacteria 1673
1089 Ga0501038_0214282 3300049574 Bacteria 1539
1090 Ga0501039_0003019 3300049575 Bacteria 12587
1091 Ga0501039_0015614 3300049575 Bacteria 5811
1092 Ga0501039_1132676 3300049575 Bacteria 606
1093 Ga0501040_0000293 3300049576 Bacteria 29155
1094 Ga0501040_0003652 3300049576 Bacteria 9963
1095 Ga0501040_0033161 3300049576 Bacteria 3497
1096 Ga0501040_0219142 3300049576 Bacteria 1354
1097 Ga0501040_0226478 3300049576 Bacteria 1331
1098 Ga0501041_0000165 3300049577 Bacteria 29328
1099 Ga0501041_0000404 3300049577 Bacteria 21758
1100 Ga0501041_0283498 3300049577 Bacteria 1043
1101 Ga0501041_0980098 3300049577 Bacteria 544
1102 Ga0501042_0000007 3300049578 Bacteria 63673
1103 Ga0501042_0002086 3300049578 Bacteria 12133
1104 Ga0501042_0085211 3300049578 Bacteria 2266
1105 Ga0501042_0176411 3300049578 Bacteria 1542
1106 Ga0501043_0003703 3300049579 Bacteria 12561
1107 Ga0501043_0017819 3300049579 Bacteria 5567
1108 Ga0501043_0234102 3300049579 Bacteria 1418
1109 Ga0501046_0002500 3300049580 Bacteria 17210
1110 Ga0501046_0003651 3300049580 Bacteria 14096
1111 Ga0501046_0787204 3300049580 Bacteria 667
1112 Ga0501047_0033679 3300049581 Bacteria 4944
1113 Ga0501047_0045921 3300049581 Bacteria 4223
1114 Ga0501048_0001431 3300049582 Bacteria 18080
1115 Ga0501048_0172156 3300049582 Bacteria 1534
1116 Ga0501067_0235194 3300049583 Bacteria 1020
1117 Ga0501067_0299764 3300049583 Bacteria 895
1118 Ga0501067_0644431 3300049583 Bacteria 595
1119 Ga0501067_0865505 3300049583 Bacteria 510
1120 Ga0501068_0010885 3300049584 Bacteria 5119
1121 Ga0501069_0280931 3300049585 Bacteria 974
1122 Ga0501069_0400763 3300049585 Bacteria 812
1123 Ga0501069_0422873 3300049585 Bacteria 790
1124 Ga0501070_0411927 3300049586 Bacteria 1092
1125 Ga0501070_1488881 3300049586 Bacteria 512
1126 Ga0501071_0021545 3300049587 Bacteria 4488
1127 Ga0501071_0041011 3300049587 Bacteria 3314
1128 Ga0501071_0371799 3300049587 Bacteria 1089
1129 Ga0501072_0221046 3300049588 Bacteria 1509
1130 Ga0501072_0246899 3300049588 Bacteria 1422
1131 Ga0501073_0214621 3300049589 Bacteria 1329
1132 Ga0501074_0000297 3300049590 Bacteria 28572
1133 Ga0501075_0000238 3300049591 Bacteria 29445
1134 Ga0501075_0000795 3300049591 Bacteria 19734
1135 Ga0501075_0107829 3300049591 Bacteria 2117
1136 Ga0501076_0000380 3300049592 Bacteria 27776
1137 Ga0501076_0017302 3300049592 Bacteria 5476
1138 Ga0501076_0185186 3300049592 Bacteria 1698
1139 Ga0501076_1185423 3300049592 Bacteria 629
1140 Ga0501077_0000459 3300049593 Bacteria 24732
1141 Ga0501077_0203344 3300049593 Bacteria 1258
1142 Ga0501077_0288684 3300049593 Bacteria 1044
1143 Ga0501077_0329672 3300049593 Bacteria 973
1144 Ga0501079_0000448 3300049741 Bacteria 26890
1145 Ga0501079_0003137 3300049741 Bacteria 12106
1146 Ga0501079_0153645 3300049741 Bacteria 1794
1147 Ga0501080_0013285 3300049742 Bacteria 7566
1148 Ga0501080_0166091 3300049742 Bacteria 2036
1149 Ga0501080_0468815 3300049742 Bacteria 1127
1150 Ga0501081_0000172 3300049743 Bacteria 30389
1151 Ga0501081_0001115 3300049743 Bacteria 16137
1152 Ga0501083_0262544 3300049744 Bacteria 1123
1153 Ga0501035_0026090 3300049822 Bacteria 5351
1154 Ga0501035_0026525 3300049822 Bacteria 5300
1155 Ga0501044_0002377 3300049823 Bacteria 21431
1156 Ga0501044_0009795 3300049823 Bacteria 10419
1157 Ga0501044_0081049 3300049823 Bacteria 3286
1158 Ga0501044_0241056 3300049823 Bacteria 1752
1159 Ga0501045_0000063 3300049824 Bacteria 48972
1160 Ga0501045_0011785 3300049824 Bacteria 6143
1161 Ga0501045_0017782 3300049824 Bacteria 5049
1162 nmdc:mga00v17_310187_c1 3300050491 Bacteria 1025
1163 nmdc:mga00v17_856535_c1 3300050491 Bacteria 577
1164 nmdc:mga0yw44_455915_c1 3300050492 Bacteria 867
1165 nmdc:mga06z11_93588_c2 3300050494 Bacteria 1162
1166 nmdc:mga07m45_763810_c1 3300050496 Bacteria 555
1167 nmdc:mga05p37_1110226_c1 3300050507 Bacteria 827
1168 nmdc:mga05p37_1191869_c1 3300050507 Bacteria 788
1169 nmdc:mga05p37_1273092_c1 3300050507 Bacteria 752
1170 nmdc:mga05p37_134314_c1 3300050507 Bacteria 2487
1171 nmdc:mga05p37_193279_c1 3300050507 Bacteria 2469
1172 nmdc:mga05p37_2197224_c1 3300050507 Bacteria 513
1173 nmdc:mga05p37_2792_c1 3300050507 Bacteria 20305
1174 nmdc:mga05p37_322292_c1 3300050507 Bacteria 1828
1175 nmdc:mga09592_1585_c1 3300050508 Bacteria 18320
1176 nmdc:mga09592_207142_c1 3300050508 Bacteria 1699
1177 nmdc:mga09592_919107_c1 3300050508 Bacteria 735
1178 nmdc:mga0qj67_1434_c1 3300050509 Bacteria 16697
1179 nmdc:mga0qj67_2253_c1 3300050509 Bacteria 13712
1180 nmdc:mga0qj67_748267_c1 3300050509 Bacteria 776
1181 nmdc:mga06r32_116842_c1 3300050510 Bacteria 2629
1182 nmdc:mga06r32_15984_c1 3300050510 Bacteria 6830
1183 nmdc:mga06r32_515_c1 3300050510 Bacteria 33313
1184 nmdc:mga08y16_1095853_c1 3300050511 Bacteria 772
1185 nmdc:mga08y16_1679234_c1 3300050511 Bacteria 591
1186 nmdc:mga08y16_1960028_c1 3300050511 Bacteria 536
1187 nmdc:mga08y16_21682_c1 3300050511 Bacteria 6781
1188 nmdc:mga08y16_754336_c1 3300050511 Bacteria 969
1189 nmdc:mga08y16_8919_c1 3300050511 Bacteria 10531
1190 nmdc:mga0n895_1240757_c1 3300050512 Bacteria 718
1191 nmdc:mga0n895_132835_c1 3300050512 Bacteria 2515
1192 nmdc:mga0n895_1679580_c1 3300050512 Bacteria 598
1193 nmdc:mga0n895_247609_c1 3300050512 Bacteria 1809
1194 nmdc:mga0n895_372676_c1 3300050512 Bacteria 1445
1195 nmdc:mga0rr50_106334_c1 3300050513 Bacteria 2214
1196 nmdc:mga0rr50_964687_c1 3300050513 Bacteria 727
1197 nmdc:mga08x19_1010546_c1 3300050514 Bacteria 591
1198 nmdc:mga08x19_1204744_c1 3300050514 Bacteria 537
1199 nmdc:mga08x19_749848_c1 3300050514 Bacteria 693
1200 nmdc:mga0a205_394795_c1 3300050515 Bacteria 1247
1201 nmdc:mga0a205_5116_c1 3300050515 Bacteria 11795
1202 Ga0495601_0040021 3300053077 Bacteria 2936
1203 Ga0495612_0050108 3300053078 Bacteria 1714
1204 Ga0495612_0171165 3300053078 Bacteria 951
1205 Ga0495595_0012380 3300053084 Bacteria 3586
1206 Ga0495595_0241559 3300053084 Bacteria 903
1207 Ga0495619_0004418 3300053085 Bacteria 8969
1208 Ga0495619_0299361 3300053085 Bacteria 1114
1209 Ga0500644_0056969 3300053088 Bacteria 1362
1210 Ga0500577_0089278 3300053142 Bacteria 1242
1211 Ga0500616_0018678 3300053153 Bacteria 3917
1212 Ga0500599_000374 3300053736 Bacteria 4499
1213 Ga0501084_0005801 3300054114 Bacteria 10160
1214 Ga0501084_0012141 3300054114 Bacteria 7130
1215 Ga0501084_0615357 3300054114 Bacteria 917
1216 Ga0590071_005793 3300059421 Bacteria 2962
1217 Ga0590071_100303 3300059421 Bacteria 729
1218 Ga0590071_163384 3300059421 Bacteria 580
1219 Ga0590074_005445 3300059423 Bacteria 2108
1220 Ga0590075_001535 3300059424 Bacteria 5743
1221 Ga0590077_002621 3300059426 Bacteria 3814
1222 Ga0590077_114768 3300059426 Bacteria 634
1223 Ga0587073_0276292 3300059492 Bacteria 537
1224 Ga0587083_0016055 3300059505 Bacteria 1318
1225 Ga0587086_006600 3300059507 Bacteria 1301
1226 Ga0587088_035167 3300059508 Unclassified 917
1227 Ga0587128_006456 3300059630 Bacteria 1443
1228 Ga0587071_198685 3300060344 Bacteria 523
1229 Ga0501082_0000373 3300060353 Bacteria 39570
1230 Ga0501082_0000696 3300060353 Bacteria 29645
1231 Ga0501082_0186428 3300060353 Bacteria 1805
1232 Ga0501082_1136514 3300060353 Bacteria 683
1233 Ga0501082_1277207 3300060353 Bacteria 641
1234 Ga0530510_0000454 3300061734 Bacteria 26524
1235 Ga0530510_0002560 3300061734 Bacteria 12499
1236 Ga0530510_0028241 3300061734 Bacteria 4022

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_11051138 Ga0207709_110511382 81
2 3300025937 Ga0207669_11089734 Ga0207669_110897342 81
3 3300005340 Ga0070689_100156161 Ga0070689_1001561613 84
4 3300005343 Ga0070687_100079062 Ga0070687_1000790623 84
5 3300005345 Ga0070692_10129584 Ga0070692_101295841 84
6 3300005438 Ga0070701_10019016 Ga0070701_100190162 84
7 3300005467 Ga0070706_101747147 Ga0070706_1017471471 84
8 3300005545 Ga0070695_100123103 Ga0070695_1001231033 84
9 3300005841 Ga0068863_101662527 Ga0068863_1016625272 84
10 3300025910 Ga0207684_11166818 Ga0207684_111668182 84
11 3300025936 Ga0207670_10160518 Ga0207670_101605183 84
12 3300025942 Ga0207689_10040929 Ga0207689_100409294 84
13 3300035114 Ga0373939_0185296 Ga0373939_0185296_452_718 84
14 3300035115 Ga0373941_0079923 Ga0373941_0079923_168_434 84
15 iso_pu_bacteria 2744054611 2744955251 86
16 iso_pu_bacteria 2863067949 2863068059 86
17 iso_pu_bacteria 8055066027 8055071739 86
18 iso_pu_bacteria 8055172936 8055179248 86
19 3300031731 Ga0307405_11174205 Ga0307405_111742051 87
20 3300032126 Ga0307415_101155936 Ga0307415_1011559363 87
21 3300005327 Ga0070658_11303641 Ga0070658_113036412 88
22 3300005329 Ga0070683_101523177 Ga0070683_1015231771 88
23 3300005347 Ga0070668_101119947 Ga0070668_1011199472 88
24 3300005444 Ga0070694_101238563 Ga0070694_1012385632 88
25 3300005459 Ga0068867_102217962 Ga0068867_1022179622 88
26 3300005543 Ga0070672_100739761 Ga0070672_1007397613 88
27 3300009098 Ga0105245_11284516 Ga0105245_112845162 88
28 3300009148 Ga0105243_11296439 Ga0105243_112964392 88
29 3300009174 Ga0105241_11927088 Ga0105241_119270881 88
30 3300014326 Ga0157380_10162222 Ga0157380_101622222 88
31 3300025940 Ga0207691_10385097 Ga0207691_103850973 88
32 3300025944 Ga0207661_11836559 Ga0207661_118365591 88
33 3300025972 Ga0207668_10585122 Ga0207668_105851223 88
34 3300028379 Ga0268266_11248177 Ga0268266_112481772 88
35 3300037418 Ga0395900_1678598 Ga0395900_1678598_194_460 88
36 3300048905 Ga0496102_1852370 Ga0496102_1852370_203_469 88
37 3300048907 Ga0496104_0178488 Ga0496104_0178488_644_910 88
38 3300048911 Ga0496108_0470252 Ga0496108_0470252_376_642 88
39 3300048912 Ga0496109_0059001 Ga0496109_0059001_1876_2142 88
40 3300048913 Ga0496110_0506179 Ga0496110_0506179_350_616 88
41 3300048914 Ga0496111_0443665 Ga0496111_0443665_52_318 88
42 3300048917 Ga0496114_0673297 Ga0496114_0673297_52_318 88
43 3300004799 Ga0058863_11599248 Ga0058863_115992481 89
44 3300004803 Ga0058862_12586157 Ga0058862_125861571 89
45 3300005328 Ga0070676_10160328 Ga0070676_101603282 89
46 3300005336 Ga0070680_101599057 Ga0070680_1015990572 89
47 3300005338 Ga0068868_101582979 Ga0068868_1015829791 89
48 3300005355 Ga0070671_100195879 Ga0070671_1001958794 89
49 3300005435 Ga0070714_100055323 Ga0070714_1000553236 89
50 3300005530 Ga0070679_100063188 Ga0070679_1000631884 89
51 3300005548 Ga0070665_100503215 Ga0070665_1005032152 89
52 3300005617 Ga0068859_100447429 Ga0068859_1004474292 89
53 3300005618 Ga0068864_100027927 Ga0068864_1000279275 89
54 3300005841 Ga0068863_100026524 Ga0068863_1000265241 89
55 3300005841 Ga0068863_102721301 Ga0068863_1027213012 89
56 3300006178 Ga0075367_10233781 Ga0075367_102337812 89
57 3300006931 Ga0097620_100447376 Ga0097620_1004473762 89
58 3300009011 Ga0105251_10085736 Ga0105251_100857362 89
59 3300009098 Ga0105245_10064792 Ga0105245_100647924 89
60 3300009101 Ga0105247_10105653 Ga0105247_101056532 89
61 3300009174 Ga0105241_10395807 Ga0105241_103958073 89
62 3300009177 Ga0105248_10055968 Ga0105248_100559683 89
63 3300009545 Ga0105237_11300885 Ga0105237_113008852 89
64 3300009551 Ga0105238_10479500 Ga0105238_104795002 89
65 3300009553 Ga0105249_13526288 Ga0105249_135262882 89
66 3300010375 Ga0105239_10821910 Ga0105239_108219102 89
67 3300013297 Ga0157378_11645108 Ga0157378_116451082 89
68 3300014968 Ga0157379_10955709 Ga0157379_109557092 89
69 3300020069 Ga0197907_10062224 Ga0197907_100622242 89
70 3300020070 Ga0206356_10756000 Ga0206356_107560002 89
71 3300021358 Ga0213873_10079077 Ga0213873_100790772 89
72 3300021441 Ga0213871_10200801 Ga0213871_102008012 89
73 3300025900 Ga0207710_10322946 Ga0207710_103229462 89
74 3300025912 Ga0207707_10859034 Ga0207707_108590341 89
75 3300025917 Ga0207660_11056137 Ga0207660_110561372 89
76 3300025921 Ga0207652_10079514 Ga0207652_100795143 89
77 3300025924 Ga0207694_10577387 Ga0207694_105773872 89
78 3300025925 Ga0207650_10028329 Ga0207650_100283292 89
79 3300025927 Ga0207687_10037346 Ga0207687_100373464 89
80 3300025929 Ga0207664_10063610 Ga0207664_100636107 89
81 3300025931 Ga0207644_11026482 Ga0207644_110264821 89
82 3300025941 Ga0207711_10483241 Ga0207711_104832412 89
83 3300025972 Ga0207668_10094577 Ga0207668_100945772 89
84 3300026035 Ga0207703_10812590 Ga0207703_108125902 89
85 3300026089 Ga0207648_10759156 Ga0207648_107591562 89
86 3300026095 Ga0207676_10141666 Ga0207676_101416664 89
87 3300026095 Ga0207676_10167283 Ga0207676_101672832 89
88 3300028379 Ga0268266_10406341 Ga0268266_104063412 89
89 3300031456 Ga0307513_10006720 Ga0307513_1000672019 89
90 3300031691 Ga0316579_10101216 Ga0316579_101012162 89
91 3300032002 Ga0307416_101163551 Ga0307416_1011635512 89
92 3300032133 Ga0316583_10040852 Ga0316583_100408522 89
93 3300033179 Ga0307507_10085237 Ga0307507_100852372 89
94 3300039062 Ga0400483_004249 Ga0400483_004249_1425_1718 89
95 3300039062 Ga0400483_175799 Ga0400483_175799_397_690 89
96 3300039438 Ga0436360_0070157 Ga0436360_0070157_289_582 89
97 3300039453 Ga0436362_0916296 Ga0436362_0916296_3360_3629 89
98 3300041456 Ga0451795_0637961 Ga0451795_0637961_171_440 89
99 3300042438 Ga0439459_0048877 Ga0439459_0048877_515_787 89
100 3300046461 Ga0495641_0171219 Ga0495641_0171219_375_644 89
101 3300046472 Ga0495580_0938835 Ga0495580_0938835_243_512 89
102 3300046476 Ga0495662_0220375 Ga0495662_0220375_282_551 89
103 3300046499 Ga0495594_0050670 Ga0495594_0050670_903_1172 89
104 3300047315 Ga0495581_0569927 Ga0495581_0569927_314_583 89
105 3300048907 Ga0496104_0192871 Ga0496104_0192871_833_1102 89
106 3300048908 Ga0496105_0132875 Ga0496105_0132875_477_746 89
107 3300048912 Ga0496109_1858059 Ga0496109_1858059_84_353 89
108 3300048914 Ga0496111_1183767 Ga0496111_1183767_43_324 89
109 3300048915 Ga0496112_0128615 Ga0496112_0128615_1611_1880 89
110 3300048915 Ga0496112_0467682 Ga0496112_0467682_66_347 89
111 3300048916 Ga0496113_0088993 Ga0496113_0088993_1048_1317 89
112 3300048916 Ga0496113_0870307 Ga0496113_0870307_288_581 89
113 3300049570 Ga0501033_1174323 Ga0501033_1174323_33_329 89
114 3300049575 Ga0501039_1132676 Ga0501039_1132676_23_319 89
115 3300049576 Ga0501040_0219142 Ga0501040_0219142_857_1153 89
116 3300050494 nmdc:mga06z11_93588_c2 nmdc:mga06z11_93588_c2_309_590 89
117 2162886012 MBSR1b_contig_3941096 MBSR1b_0118.00000630 90
118 2162886012 MBSR1b_contig_907293 MBSR1b_0527.00001330 90
119 3300001978 JGI24747J21853_1035595 JGI24747J21853_10355952 90
120 3300001979 JGI24740J21852_10106836 JGI24740J21852_101068362 90
121 3300003203 JGI25406J46586_10005292 JGI25406J46586_100052925 90
122 3300003323 rootH1_10194767 rootH1_101947674 90
123 3300003373 JGI25407J50210_10000833 JGI25407J50210_100008334 90
124 3300003373 JGI25407J50210_10016676 JGI25407J50210_100166763 90
125 3300003373 JGI25407J50210_10056702 JGI25407J50210_100567021 90
126 3300003373 JGI25407J50210_10088080 JGI25407J50210_100880801 90
127 3300003659 JGI25404J52841_10009969 JGI25404J52841_100099694 90
128 3300003911 JGI25405J52794_10055288 JGI25405J52794_100552883 90
129 3300004798 Ga0058859_11645648 Ga0058859_116456481 90
130 3300004799 Ga0058863_10899516 Ga0058863_108995162 90
131 3300004800 Ga0058861_12077379 Ga0058861_120773792 90
132 3300004801 Ga0058860_11560143 Ga0058860_115601431 90
133 3300004801 Ga0058860_11738255 Ga0058860_117382552 90
134 3300004801 Ga0058860_12151675 Ga0058860_121516752 90
135 3300004801 Ga0058860_12178315 Ga0058860_121783152 90
136 3300005290 Ga0065712_10274254 Ga0065712_102742542 90
137 3300005293 Ga0065715_10289222 Ga0065715_102892222 90
138 3300005293 Ga0065715_10730475 Ga0065715_107304752 90
139 3300005327 Ga0070658_10331868 Ga0070658_103318681 90
140 3300005328 Ga0070676_10172052 Ga0070676_101720522 90
141 3300005328 Ga0070676_11106245 Ga0070676_111062452 90
142 3300005329 Ga0070683_100078885 Ga0070683_1000788853 90
143 3300005330 Ga0070690_100021786 Ga0070690_1000217865 90
144 3300005330 Ga0070690_100158076 Ga0070690_1001580763 90
145 3300005331 Ga0070670_100341741 Ga0070670_1003417412 90
146 3300005333 Ga0070677_10633582 Ga0070677_106335822 90
147 3300005334 Ga0068869_100200806 Ga0068869_1002008063 90
148 3300005334 Ga0068869_101409204 Ga0068869_1014092042 90
149 3300005334 Ga0068869_101601707 Ga0068869_1016017072 90
150 3300005335 Ga0070666_10027739 Ga0070666_100277394 90
151 3300005336 Ga0070680_100029072 Ga0070680_1000290725 90
152 3300005336 Ga0070680_101687462 Ga0070680_1016874622 90
153 3300005337 Ga0070682_101357266 Ga0070682_1013572662 90
154 3300005337 Ga0070682_101537110 Ga0070682_1015371102 90
155 3300005338 Ga0068868_100157214 Ga0068868_1001572142 90
156 3300005338 Ga0068868_100795308 Ga0068868_1007953082 90
157 3300005338 Ga0068868_102259794 Ga0068868_1022597942 90
158 3300005339 Ga0070660_100094455 Ga0070660_1000944554 90
159 3300005340 Ga0070689_100301426 Ga0070689_1003014262 90
160 3300005341 Ga0070691_10158041 Ga0070691_101580411 90
161 3300005341 Ga0070691_10159590 Ga0070691_101595902 90
162 3300005343 Ga0070687_100116027 Ga0070687_1001160272 90
163 3300005344 Ga0070661_100442954 Ga0070661_1004429542 90
164 3300005344 Ga0070661_101401537 Ga0070661_1014015372 90
165 3300005344 Ga0070661_101702382 Ga0070661_1017023822 90
166 3300005345 Ga0070692_10166930 Ga0070692_101669302 90
167 3300005345 Ga0070692_10511515 Ga0070692_105115152 90
168 3300005345 Ga0070692_10964705 Ga0070692_109647052 90
169 3300005347 Ga0070668_100033387 Ga0070668_1000333874 90
170 3300005347 Ga0070668_100060524 Ga0070668_1000605242 90
171 3300005347 Ga0070668_101656047 Ga0070668_1016560472 90
172 3300005353 Ga0070669_100728507 Ga0070669_1007285072 90
173 3300005354 Ga0070675_100008751 Ga0070675_1000087515 90
174 3300005355 Ga0070671_100126208 Ga0070671_1001262082 90
175 3300005355 Ga0070671_101053297 Ga0070671_1010532972 90
176 3300005356 Ga0070674_100077219 Ga0070674_1000772192 90
177 3300005364 Ga0070673_100223684 Ga0070673_1002236842 90
178 3300005364 Ga0070673_101506029 Ga0070673_1015060292 90
179 3300005365 Ga0070688_100947161 Ga0070688_1009471612 90
180 3300005366 Ga0070659_100034617 Ga0070659_1000346173 90
181 3300005366 Ga0070659_100516752 Ga0070659_1005167522 90
182 3300005367 Ga0070667_100193332 Ga0070667_1001933323 90
183 3300005367 Ga0070667_100516214 Ga0070667_1005162142 90
184 3300005434 Ga0070709_10036426 Ga0070709_100364262 90
185 3300005435 Ga0070714_100006392 Ga0070714_10000639210 90
186 3300005436 Ga0070713_100054063 Ga0070713_1000540634 90
187 3300005436 Ga0070713_100192759 Ga0070713_1001927592 90
188 3300005436 Ga0070713_100948922 Ga0070713_1009489222 90
189 3300005436 Ga0070713_101863858 Ga0070713_1018638582 90
190 3300005437 Ga0070710_10026356 Ga0070710_100263563 90
191 3300005437 Ga0070710_10929638 Ga0070710_109296381 90
192 3300005438 Ga0070701_10013994 Ga0070701_100139942 90
193 3300005439 Ga0070711_100001426 Ga0070711_1000014269 90
194 3300005439 Ga0070711_100357553 Ga0070711_1003575532 90
195 3300005439 Ga0070711_100863563 Ga0070711_1008635632 90
196 3300005439 Ga0070711_101074934 Ga0070711_1010749341 90
197 3300005439 Ga0070711_101173638 Ga0070711_1011736382 90
198 3300005439 Ga0070711_101477800 Ga0070711_1014778002 90
199 3300005440 Ga0070705_100463586 Ga0070705_1004635862 90
200 3300005440 Ga0070705_100852967 Ga0070705_1008529672 90
201 3300005440 Ga0070705_101439097 Ga0070705_1014390971 90
202 3300005441 Ga0070700_100033958 Ga0070700_1000339583 90
203 3300005445 Ga0070708_100072487 Ga0070708_1000724872 90
204 3300005445 Ga0070708_100425108 Ga0070708_1004251082 90
205 3300005445 Ga0070708_100450243 Ga0070708_1004502432 90
206 3300005445 Ga0070708_102077276 Ga0070708_1020772762 90
207 3300005455 Ga0070663_100174784 Ga0070663_1001747844 90
208 3300005455 Ga0070663_100611315 Ga0070663_1006113152 90
209 3300005455 Ga0070663_100618747 Ga0070663_1006187471 90
210 3300005456 Ga0070678_100092333 Ga0070678_1000923332 90
211 3300005456 Ga0070678_100244244 Ga0070678_1002442443 90
212 3300005456 Ga0070678_101477888 Ga0070678_1014778882 90
213 3300005457 Ga0070662_100204352 Ga0070662_1002043522 90
214 3300005457 Ga0070662_100291802 Ga0070662_1002918022 90
215 3300005457 Ga0070662_101867194 Ga0070662_1018671942 90
216 3300005458 Ga0070681_10068567 Ga0070681_100685674 90
217 3300005458 Ga0070681_10611244 Ga0070681_106112441 90
218 3300005458 Ga0070681_10639694 Ga0070681_106396942 90
219 3300005458 Ga0070681_10694981 Ga0070681_106949812 90
220 3300005458 Ga0070681_11745870 Ga0070681_117458702 90
221 3300005459 Ga0068867_100318504 Ga0068867_1003185043 90
222 3300005459 Ga0068867_100858644 Ga0068867_1008586442 90
223 3300005459 Ga0068867_101180951 Ga0068867_1011809511 90
224 3300005466 Ga0070685_10011703 Ga0070685_100117034 90
225 3300005466 Ga0070685_10346031 Ga0070685_103460312 90
226 3300005466 Ga0070685_10565146 Ga0070685_105651462 90
227 3300005466 Ga0070685_11129105 Ga0070685_111291052 90
228 3300005467 Ga0070706_100423089 Ga0070706_1004230892 90
229 3300005467 Ga0070706_100426688 Ga0070706_1004266882 90
230 3300005467 Ga0070706_100476267 Ga0070706_1004762672 90
231 3300005467 Ga0070706_101738191 Ga0070706_1017381911 90
232 3300005468 Ga0070707_100078604 Ga0070707_1000786043 90
233 3300005468 Ga0070707_100719183 Ga0070707_1007191832 90
234 3300005468 Ga0070707_101275967 Ga0070707_1012759672 90
235 3300005471 Ga0070698_100028747 Ga0070698_1000287472 90
236 3300005471 Ga0070698_100102261 Ga0070698_1001022612 90
237 3300005471 Ga0070698_100198840 Ga0070698_1001988402 90
238 3300005518 Ga0070699_100136318 Ga0070699_1001363184 90
239 3300005518 Ga0070699_100169295 Ga0070699_1001692953 90
240 3300005518 Ga0070699_100221686 Ga0070699_1002216862 90
241 3300005518 Ga0070699_101007202 Ga0070699_1010072022 90
242 3300005518 Ga0070699_101677945 Ga0070699_1016779452 90
243 3300005518 Ga0070699_101986071 Ga0070699_1019860712 90
244 3300005530 Ga0070679_100019756 Ga0070679_1000197567 90
245 3300005530 Ga0070679_100683549 Ga0070679_1006835492 90
246 3300005530 Ga0070679_100921245 Ga0070679_1009212452 90
247 3300005535 Ga0070684_100116279 Ga0070684_1001162792 90
248 3300005535 Ga0070684_100726946 Ga0070684_1007269463 90
249 3300005536 Ga0070697_100455830 Ga0070697_1004558302 90
250 3300005539 Ga0068853_100061482 Ga0068853_1000614822 90
251 3300005539 Ga0068853_100315627 Ga0068853_1003156272 90
252 3300005543 Ga0070672_100027866 Ga0070672_1000278664 90
253 3300005544 Ga0070686_100015286 Ga0070686_1000152864 90
254 3300005544 Ga0070686_100498965 Ga0070686_1004989652 90
255 3300005545 Ga0070695_100048509 Ga0070695_1000485095 90
256 3300005546 Ga0070696_100004836 Ga0070696_1000048365 90
257 3300005547 Ga0070693_100019269 Ga0070693_1000192693 90
258 3300005547 Ga0070693_101584368 Ga0070693_1015843681 90
259 3300005548 Ga0070665_100996374 Ga0070665_1009963742 90
260 3300005548 Ga0070665_101004512 Ga0070665_1010045122 90
261 3300005549 Ga0070704_100296736 Ga0070704_1002967363 90
262 3300005549 Ga0070704_101813862 Ga0070704_1018138622 90
263 3300005563 Ga0068855_100599164 Ga0068855_1005991642 90
264 3300005563 Ga0068855_101802898 Ga0068855_1018028982 90
265 3300005563 Ga0068855_102495585 Ga0068855_1024955852 90
266 3300005564 Ga0070664_100026709 Ga0070664_1000267091 90
267 3300005577 Ga0068857_100026603 Ga0068857_1000266036 90
268 3300005577 Ga0068857_100039067 Ga0068857_1000390672 90
269 3300005578 Ga0068854_100028549 Ga0068854_1000285493 90
270 3300005578 Ga0068854_100152768 Ga0068854_1001527683 90
271 3300005614 Ga0068856_100211973 Ga0068856_1002119733 90
272 3300005615 Ga0070702_100051134 Ga0070702_1000511342 90
273 3300005616 Ga0068852_100088656 Ga0068852_1000886562 90
274 3300005616 Ga0068852_100181073 Ga0068852_1001810732 90
275 3300005616 Ga0068852_100920473 Ga0068852_1009204731 90
276 3300005617 Ga0068859_100054371 Ga0068859_1000543713 90
277 3300005618 Ga0068864_100401860 Ga0068864_1004018602 90
278 3300005618 Ga0068864_100509781 Ga0068864_1005097812 90
279 3300005618 Ga0068864_102200130 Ga0068864_1022001301 90
280 3300005718 Ga0068866_10125816 Ga0068866_101258162 90
281 3300005719 Ga0068861_100043723 Ga0068861_1000437235 90
282 3300005719 Ga0068861_100272308 Ga0068861_1002723082 90
283 3300005719 Ga0068861_100702140 Ga0068861_1007021403 90
284 3300005719 Ga0068861_101345442 Ga0068861_1013454423 90
285 3300005834 Ga0068851_10048255 Ga0068851_100482552 90
286 3300005834 Ga0068851_10872544 Ga0068851_108725442 90
287 3300005840 Ga0068870_10024232 Ga0068870_100242322 90
288 3300005840 Ga0068870_10113483 Ga0068870_101134833 90
289 3300005841 Ga0068863_100258157 Ga0068863_1002581572 90
290 3300005841 Ga0068863_102228089 Ga0068863_1022280893 90
291 3300005842 Ga0068858_100167892 Ga0068858_1001678924 90
292 3300005843 Ga0068860_100162837 Ga0068860_1001628372 90
293 3300005843 Ga0068860_102178642 Ga0068860_1021786422 90
294 3300005843 Ga0068860_102380252 Ga0068860_1023802522 90
295 3300005844 Ga0068862_100756231 Ga0068862_1007562312 90
296 3300005937 Ga0081455_10005075 Ga0081455_100050754 90
297 3300005981 Ga0081538_10000212 Ga0081538_1000021236 90
298 3300005981 Ga0081538_10000947 Ga0081538_1000094717 90
299 3300005981 Ga0081538_10006746 Ga0081538_100067465 90
300 3300005981 Ga0081538_10015131 Ga0081538_100151312 90
301 3300005981 Ga0081538_10015846 Ga0081538_100158465 90
302 3300005981 Ga0081538_10021750 Ga0081538_100217502 90
303 3300005981 Ga0081538_10049026 Ga0081538_100490262 90
304 3300005981 Ga0081538_10113811 Ga0081538_101138114 90
305 3300005983 Ga0081540_1000125 Ga0081540_100012576 90
306 3300005983 Ga0081540_1030082 Ga0081540_10300823 90
307 3300005983 Ga0081540_1252644 Ga0081540_12526442 90
308 3300005983 Ga0081540_1261816 Ga0081540_12618162 90
309 3300005985 Ga0081539_10000179 Ga0081539_1000017952 90
310 3300005985 Ga0081539_10005342 Ga0081539_1000534216 90
311 3300005985 Ga0081539_10183721 Ga0081539_101837214 90
312 3300006028 Ga0070717_10020829 Ga0070717_100208295 90
313 3300006028 Ga0070717_10144230 Ga0070717_101442302 90
314 3300006028 Ga0070717_10401489 Ga0070717_104014892 90
315 3300006028 Ga0070717_11049117 Ga0070717_110491172 90
316 3300006028 Ga0070717_11049118 Ga0070717_110491182 90
317 3300006028 Ga0070717_11565935 Ga0070717_115659352 90
318 3300006028 Ga0070717_11981335 Ga0070717_119813352 90
319 3300006038 Ga0075365_10336000 Ga0075365_103360002 90
320 3300006048 Ga0075363_100027439 Ga0075363_1000274393 90
321 3300006051 Ga0075364_10364038 Ga0075364_103640382 90
322 3300006051 Ga0075364_11159608 Ga0075364_111596082 90
323 3300006058 Ga0075432_10003415 Ga0075432_100034155 90
324 3300006058 Ga0075432_10564123 Ga0075432_105641232 90
325 3300006058 Ga0075432_10592169 Ga0075432_105921692 90
326 3300006163 Ga0070715_10062596 Ga0070715_100625962 90
327 3300006173 Ga0070716_100010618 Ga0070716_1000106188 90
328 3300006173 Ga0070716_100246465 Ga0070716_1002464652 90
329 3300006173 Ga0070716_100637153 Ga0070716_1006371532 90
330 3300006175 Ga0070712_100497448 Ga0070712_1004974482 90
331 3300006175 Ga0070712_100647742 Ga0070712_1006477422 90
332 3300006175 Ga0070712_101338183 Ga0070712_1013381832 90
333 3300006186 Ga0075369_10655235 Ga0075369_106552352 90
334 3300006237 Ga0097621_100138858 Ga0097621_1001388584 90
335 3300006237 Ga0097621_101186722 Ga0097621_1011867222 90
336 3300006353 Ga0075370_10171354 Ga0075370_101713542 90
337 3300006353 Ga0075370_10592296 Ga0075370_105922962 90
338 3300006358 Ga0068871_100829597 Ga0068871_1008295972 90
339 3300006358 Ga0068871_101273919 Ga0068871_1012739193 90
340 3300006844 Ga0075428_100012144 Ga0075428_1000121444 90
341 3300006844 Ga0075428_100083713 Ga0075428_1000837132 90
342 3300006844 Ga0075428_100914291 Ga0075428_1009142912 90
343 3300006844 Ga0075428_102677222 Ga0075428_1026772221 90
344 3300006846 Ga0075430_100008071 Ga0075430_10000807111 90
345 3300006846 Ga0075430_100017068 Ga0075430_1000170683 90
346 3300006846 Ga0075430_100038408 Ga0075430_1000384084 90
347 3300006847 Ga0075431_100000246 Ga0075431_10000024623 90
348 3300006847 Ga0075431_100017656 Ga0075431_1000176569 90
349 3300006847 Ga0075431_100522370 Ga0075431_1005223702 90
350 3300006852 Ga0075433_10099639 Ga0075433_100996392 90
351 3300006852 Ga0075433_10758212 Ga0075433_107582122 90
352 3300006852 Ga0075433_11554971 Ga0075433_115549712 90
353 3300006871 Ga0075434_101166867 Ga0075434_1011668672 90
354 3300006871 Ga0075434_102378702 Ga0075434_1023787021 90
355 3300006880 Ga0075429_100003454 Ga0075429_1000034543 90
356 3300006880 Ga0075429_100049390 Ga0075429_1000493904 90
357 3300006881 Ga0068865_100187050 Ga0068865_1001870502 90
358 3300006881 Ga0068865_100426121 Ga0068865_1004261212 90
359 3300006881 Ga0068865_100768273 Ga0068865_1007682732 90
360 3300006914 Ga0075436_100207579 Ga0075436_1002075791 90
361 3300006914 Ga0075436_100844124 Ga0075436_1008441241 90
362 3300006931 Ga0097620_100054371 Ga0097620_1000543713 90
363 3300007076 Ga0075435_100303590 Ga0075435_1003035902 90
364 3300007076 Ga0075435_100307606 Ga0075435_1003076062 90
365 3300007076 Ga0075435_100330870 Ga0075435_1003308703 90
366 3300007076 Ga0075435_100837093 Ga0075435_1008370932 90
367 3300009011 Ga0105251_10018255 Ga0105251_100182555 90
368 3300009036 Ga0105244_10099659 Ga0105244_100996592 90
369 3300009092 Ga0105250_10240481 Ga0105250_102404812 90
370 3300009093 Ga0105240_10393500 Ga0105240_103935002 90
371 3300009094 Ga0111539_10053806 Ga0111539_100538069 90
372 3300009094 Ga0111539_10157593 Ga0111539_101575932 90
373 3300009094 Ga0111539_10161724 Ga0111539_101617243 90
374 3300009094 Ga0111539_10394425 Ga0111539_103944255 90
375 3300009094 Ga0111539_10555773 Ga0111539_105557732 90
376 3300009094 Ga0111539_11579225 Ga0111539_115792253 90
377 3300009094 Ga0111539_12066323 Ga0111539_120663232 90
378 3300009098 Ga0105245_10115988 Ga0105245_101159885 90
379 3300009098 Ga0105245_10429208 Ga0105245_104292082 90
380 3300009098 Ga0105245_10694743 Ga0105245_106947432 90
381 3300009101 Ga0105247_10124036 Ga0105247_101240364 90
382 3300009147 Ga0114129_10146873 Ga0114129_101468735 90
383 3300009147 Ga0114129_10173387 Ga0114129_101733872 90
384 3300009147 Ga0114129_10304138 Ga0114129_103041382 90
385 3300009147 Ga0114129_10448341 Ga0114129_104483412 90
386 3300009147 Ga0114129_10916141 Ga0114129_109161412 90
387 3300009147 Ga0114129_10956757 Ga0114129_109567572 90
388 3300009147 Ga0114129_10982315 Ga0114129_109823153 90
389 3300009147 Ga0114129_11311959 Ga0114129_113119592 90
390 3300009148 Ga0105243_10312695 Ga0105243_103126954 90
391 3300009174 Ga0105241_10047409 Ga0105241_100474093 90
392 3300009174 Ga0105241_12320882 Ga0105241_123208821 90
393 3300009176 Ga0105242_10131871 Ga0105242_101318712 90
394 3300009177 Ga0105248_10305272 Ga0105248_103052723 90
395 3300009177 Ga0105248_10318407 Ga0105248_103184072 90
396 3300009545 Ga0105237_11010517 Ga0105237_110105172 90
397 3300009545 Ga0105237_11079414 Ga0105237_110794142 90
398 3300009551 Ga0105238_10024849 Ga0105238_100248492 90
399 3300009551 Ga0105238_10186972 Ga0105238_101869723 90
400 3300009551 Ga0105238_11264875 Ga0105238_112648753 90
401 3300009551 Ga0105238_11354494 Ga0105238_113544942 90
402 3300009553 Ga0105249_10013769 Ga0105249_100137699 90
403 3300009553 Ga0105249_10188458 Ga0105249_101884582 90
404 3300009553 Ga0105249_10772584 Ga0105249_107725842 90
405 3300009553 Ga0105249_10859814 Ga0105249_108598142 90
406 3300009553 Ga0105249_11096500 Ga0105249_110965001 90
407 3300010375 Ga0105239_10797698 Ga0105239_107976982 90
408 3300010375 Ga0105239_11112190 Ga0105239_111121902 90
409 3300010375 Ga0105239_11381293 Ga0105239_113812932 90
410 3300010375 Ga0105239_12968151 Ga0105239_129681512 90
411 3300010375 Ga0105239_12980143 Ga0105239_129801431 90
412 3300010375 Ga0105239_13620492 Ga0105239_136204921 90
413 3300011119 Ga0105246_10073676 Ga0105246_100736765 90
414 3300011119 Ga0105246_10311226 Ga0105246_103112262 90
415 3300011119 Ga0105246_10319735 Ga0105246_103197352 90
416 3300011119 Ga0105246_11113452 Ga0105246_111134522 90
417 3300012476 Ga0157344_1001452 Ga0157344_10014522 90
418 3300012478 Ga0157328_1006624 Ga0157328_10066242 90
419 3300012481 Ga0157320_1004341 Ga0157320_10043412 90
420 3300012482 Ga0157318_1002382 Ga0157318_10023822 90
421 3300012483 Ga0157337_1012173 Ga0157337_10121732 90
422 3300012487 Ga0157321_1001536 Ga0157321_10015363 90
423 3300012487 Ga0157321_1001672 Ga0157321_10016723 90
424 3300012491 Ga0157329_1010619 Ga0157329_10106192 90
425 3300012492 Ga0157335_1000732 Ga0157335_10007322 90
426 3300012494 Ga0157341_1001329 Ga0157341_10013294 90
427 3300012497 Ga0157319_1005116 Ga0157319_10051162 90
428 3300012498 Ga0157345_1004555 Ga0157345_10045552 90
429 3300012505 Ga0157339_1029903 Ga0157339_10299033 90
430 3300012505 Ga0157339_1042471 Ga0157339_10424711 90
431 3300012507 Ga0157342_1034889 Ga0157342_10348891 90
432 3300012510 Ga0157316_1054880 Ga0157316_10548802 90
433 3300012513 Ga0157326_1007534 Ga0157326_10075343 90
434 3300012513 Ga0157326_1011009 Ga0157326_10110092 90
435 3300013045 Ga0154016_118101 Ga0154016_1181012 90
436 3300013059 Ga0154012_168450 Ga0154012_1684504 90
437 3300013100 Ga0157373_10059673 Ga0157373_100596733 90
438 3300013102 Ga0157371_10040069 Ga0157371_100400694 90
439 3300013102 Ga0157371_10425723 Ga0157371_104257232 90
440 3300013104 Ga0157370_10215352 Ga0157370_102153523 90
441 3300013105 Ga0157369_10676920 Ga0157369_106769202 90
442 3300013296 Ga0157374_11165652 Ga0157374_111656522 90
443 3300013296 Ga0157374_12329021 Ga0157374_123290211 90
444 3300013296 Ga0157374_12591812 Ga0157374_125918122 90
445 3300013297 Ga0157378_10367541 Ga0157378_103675412 90
446 3300013306 Ga0163162_10081706 Ga0163162_100817065 90
447 3300013306 Ga0163162_10431206 Ga0163162_104312062 90
448 3300013306 Ga0163162_13309803 Ga0163162_133098031 90
449 3300013307 Ga0157372_10150306 Ga0157372_101503063 90
450 3300013307 Ga0157372_11362142 Ga0157372_113621422 90
451 3300013307 Ga0157372_11762408 Ga0157372_117624082 90
452 3300013308 Ga0157375_10252686 Ga0157375_102526862 90
453 3300013308 Ga0157375_10353462 Ga0157375_103534622 90
454 3300013308 Ga0157375_10575080 Ga0157375_105750802 90
455 3300013308 Ga0157375_11026372 Ga0157375_110263722 90
456 3300014325 Ga0163163_10080375 Ga0163163_100803756 90
457 3300014325 Ga0163163_10199818 Ga0163163_101998182 90
458 3300014325 Ga0163163_10544726 Ga0163163_105447262 90
459 3300014325 Ga0163163_11259353 Ga0163163_112593532 90
460 3300014326 Ga0157380_10299943 Ga0157380_102999432 90
461 3300014326 Ga0157380_10744554 Ga0157380_107445542 90
462 3300014326 Ga0157380_11091886 Ga0157380_110918862 90
463 3300014497 Ga0182008_10246229 Ga0182008_102462292 90
464 3300014497 Ga0182008_10260871 Ga0182008_102608712 90
465 3300014745 Ga0157377_10021726 Ga0157377_100217262 90
466 3300014745 Ga0157377_10954972 Ga0157377_109549723 90
467 3300014969 Ga0157376_10328465 Ga0157376_103284652 90
468 3300015265 Ga0182005_1085550 Ga0182005_10855502 90
469 3300017792 Ga0163161_10028629 Ga0163161_100286292 90
470 3300017792 Ga0163161_11140830 Ga0163161_111408302 90
471 3300020069 Ga0197907_10589343 Ga0197907_105893437 90
472 3300020069 Ga0197907_10600103 Ga0197907_106001033 90
473 3300020069 Ga0197907_10771716 Ga0197907_107717162 90
474 3300020069 Ga0197907_10917418 Ga0197907_109174185 90
475 3300020070 Ga0206356_10151201 Ga0206356_101512016 90
476 3300020070 Ga0206356_11021398 Ga0206356_110213982 90
477 3300020070 Ga0206356_11659164 Ga0206356_116591641 90
478 3300020075 Ga0206349_1167587 Ga0206349_11675872 90
479 3300020076 Ga0206355_1486302 Ga0206355_14863022 90
480 3300020076 Ga0206355_1647528 Ga0206355_16475283 90
481 3300020078 Ga0206352_11247908 Ga0206352_112479082 90
482 3300020078 Ga0206352_11337198 Ga0206352_113371982 90
483 3300020080 Ga0206350_10512250 Ga0206350_105122503 90
484 3300020080 Ga0206350_10550630 Ga0206350_105506303 90
485 3300020080 Ga0206350_10991633 Ga0206350_109916331 90
486 3300020080 Ga0206350_11266182 Ga0206350_112661822 90
487 3300020081 Ga0206354_10260094 Ga0206354_102600942 90
488 3300020082 Ga0206353_10778556 Ga0206353_107785562 90
489 3300020082 Ga0206353_10908020 Ga0206353_109080202 90
490 3300020082 Ga0206353_11681707 Ga0206353_116817072 90
491 3300021358 Ga0213873_10150173 Ga0213873_101501733 90
492 3300021384 Ga0213876_10120256 Ga0213876_101202561 90
493 3300021388 Ga0213875_10000287 Ga0213875_1000028712 90
494 3300021388 Ga0213875_10002379 Ga0213875_100023798 90
495 3300021388 Ga0213875_10143022 Ga0213875_101430222 90
496 3300021388 Ga0213875_10343934 Ga0213875_103439342 90
497 3300021441 Ga0213871_10115050 Ga0213871_101150502 90
498 3300022467 Ga0224712_10174171 Ga0224712_101741712 90
499 3300022467 Ga0224712_10254322 Ga0224712_102543222 90
500 3300022467 Ga0224712_10489968 Ga0224712_104899682 90
501 3300022467 Ga0224712_10503000 Ga0224712_105030001 90
502 3300022467 Ga0224712_10601044 Ga0224712_106010442 90
503 3300025321 Ga0207656_10278524 Ga0207656_102785242 90
504 3300025735 Ga0207713_1141770 Ga0207713_11417702 90
505 3300025885 Ga0207653_10005525 Ga0207653_100055254 90
506 3300025893 Ga0207682_10419999 Ga0207682_104199992 90
507 3300025898 Ga0207692_10051175 Ga0207692_100511752 90
508 3300025898 Ga0207692_10202706 Ga0207692_102027062 90
509 3300025899 Ga0207642_10043317 Ga0207642_100433173 90
510 3300025900 Ga0207710_10482988 Ga0207710_104829881 90
511 3300025901 Ga0207688_10023261 Ga0207688_100232615 90
512 3300025901 Ga0207688_10172938 Ga0207688_101729383 90
513 3300025901 Ga0207688_10184011 Ga0207688_101840113 90
514 3300025903 Ga0207680_10257363 Ga0207680_102573632 90
515 3300025904 Ga0207647_10297266 Ga0207647_102972662 90
516 3300025904 Ga0207647_10361474 Ga0207647_103614741 90
517 3300025905 Ga0207685_10082938 Ga0207685_100829382 90
518 3300025905 Ga0207685_10518598 Ga0207685_105185981 90
519 3300025906 Ga0207699_10021404 Ga0207699_100214042 90
520 3300025906 Ga0207699_10137991 Ga0207699_101379913 90
521 3300025906 Ga0207699_10190074 Ga0207699_101900742 90
522 3300025906 Ga0207699_11336195 Ga0207699_113361952 90
523 3300025907 Ga0207645_10024982 Ga0207645_100249824 90
524 3300025908 Ga0207643_10022011 Ga0207643_100220112 90
525 3300025908 Ga0207643_10169114 Ga0207643_101691142 90
526 3300025909 Ga0207705_10052746 Ga0207705_100527461 90
527 3300025910 Ga0207684_10337153 Ga0207684_103371532 90
528 3300025910 Ga0207684_10374096 Ga0207684_103740962 90
529 3300025910 Ga0207684_10838960 Ga0207684_108389602 90
530 3300025911 Ga0207654_10193483 Ga0207654_101934832 90
531 3300025912 Ga0207707_10019452 Ga0207707_100194522 90
532 3300025912 Ga0207707_10433096 Ga0207707_104330962 90
533 3300025912 Ga0207707_10568362 Ga0207707_105683622 90
534 3300025912 Ga0207707_10913937 Ga0207707_109139372 90
535 3300025914 Ga0207671_10837532 Ga0207671_108375321 90
536 3300025914 Ga0207671_11476763 Ga0207671_114767632 90
537 3300025915 Ga0207693_10083464 Ga0207693_100834644 90
538 3300025915 Ga0207693_11104438 Ga0207693_111044381 90
539 3300025915 Ga0207693_11407296 Ga0207693_114072961 90
540 3300025916 Ga0207663_10002343 Ga0207663_100023437 90
541 3300025916 Ga0207663_10055972 Ga0207663_100559722 90
542 3300025916 Ga0207663_10188479 Ga0207663_101884792 90
543 3300025916 Ga0207663_10285881 Ga0207663_102858812 90
544 3300025916 Ga0207663_11731693 Ga0207663_117316932 90
545 3300025917 Ga0207660_10822083 Ga0207660_108220832 90
546 3300025918 Ga0207662_10008902 Ga0207662_100089024 90
547 3300025919 Ga0207657_10010851 Ga0207657_100108516 90
548 3300025920 Ga0207649_10047085 Ga0207649_100470852 90
549 3300025920 Ga0207649_10757696 Ga0207649_107576961 90
550 3300025921 Ga0207652_10059326 Ga0207652_100593262 90
551 3300025921 Ga0207652_10429524 Ga0207652_104295242 90
552 3300025922 Ga0207646_10563090 Ga0207646_105630902 90
553 3300025922 Ga0207646_11117306 Ga0207646_111173062 90
554 3300025922 Ga0207646_11307934 Ga0207646_113079342 90
555 3300025924 Ga0207694_10206350 Ga0207694_102063502 90
556 3300025924 Ga0207694_10276150 Ga0207694_102761502 90
557 3300025924 Ga0207694_11236932 Ga0207694_112369322 90
558 3300025926 Ga0207659_10320733 Ga0207659_103207332 90
559 3300025927 Ga0207687_10119070 Ga0207687_101190703 90
560 3300025927 Ga0207687_10617870 Ga0207687_106178701 90
561 3300025927 Ga0207687_10701226 Ga0207687_107012262 90
562 3300025927 Ga0207687_11198204 Ga0207687_111982042 90
563 3300025928 Ga0207700_10003084 Ga0207700_100030848 90
564 3300025928 Ga0207700_10008397 Ga0207700_100083979 90
565 3300025928 Ga0207700_10103401 Ga0207700_101034014 90
566 3300025928 Ga0207700_10116091 Ga0207700_101160913 90
567 3300025928 Ga0207700_10176926 Ga0207700_101769262 90
568 3300025929 Ga0207664_10002753 Ga0207664_1000275310 90
569 3300025929 Ga0207664_10026416 Ga0207664_100264162 90
570 3300025929 Ga0207664_10090973 Ga0207664_100909733 90
571 3300025929 Ga0207664_10282636 Ga0207664_102826362 90
572 3300025931 Ga0207644_10043226 Ga0207644_100432262 90
573 3300025932 Ga0207690_10253540 Ga0207690_102535402 90
574 3300025932 Ga0207690_10511687 Ga0207690_105116872 90
575 3300025933 Ga0207706_10012770 Ga0207706_100127704 90
576 3300025933 Ga0207706_10048071 Ga0207706_100480712 90
577 3300025933 Ga0207706_11219651 Ga0207706_112196512 90
578 3300025933 Ga0207706_11303192 Ga0207706_113031922 90
579 3300025934 Ga0207686_11372257 Ga0207686_113722572 90
580 3300025935 Ga0207709_10024317 Ga0207709_100243173 90
581 3300025936 Ga0207670_11249769 Ga0207670_112497692 90
582 3300025937 Ga0207669_10124215 Ga0207669_101242151 90
583 3300025937 Ga0207669_10167788 Ga0207669_101677882 90
584 3300025937 Ga0207669_11359742 Ga0207669_113597422 90
585 3300025938 Ga0207704_10302887 Ga0207704_103028872 90
586 3300025938 Ga0207704_10336036 Ga0207704_103360362 90
587 3300025938 Ga0207704_10710173 Ga0207704_107101731 90
588 3300025938 Ga0207704_11625475 Ga0207704_116254752 90
589 3300025939 Ga0207665_10025970 Ga0207665_100259707 90
590 3300025939 Ga0207665_10131467 Ga0207665_101314673 90
591 3300025939 Ga0207665_10508859 Ga0207665_105088592 90
592 3300025940 Ga0207691_10033856 Ga0207691_100338563 90
593 3300025940 Ga0207691_10758526 Ga0207691_107585262 90
594 3300025941 Ga0207711_10190803 Ga0207711_101908032 90
595 3300025941 Ga0207711_10556045 Ga0207711_105560452 90
596 3300025941 Ga0207711_10612788 Ga0207711_106127883 90
597 3300025942 Ga0207689_10035855 Ga0207689_100358554 90
598 3300025945 Ga0207679_10751108 Ga0207679_107511081 90
599 3300025949 Ga0207667_10946181 Ga0207667_109461812 90
600 3300025960 Ga0207651_10193251 Ga0207651_101932514 90
601 3300025960 Ga0207651_10505767 Ga0207651_105057672 90
602 3300025960 Ga0207651_11297176 Ga0207651_112971762 90
603 3300025961 Ga0207712_10055319 Ga0207712_100553193 90
604 3300025961 Ga0207712_10375322 Ga0207712_103753222 90
605 3300025972 Ga0207668_10056825 Ga0207668_100568252 90
606 3300025972 Ga0207668_10065230 Ga0207668_100652305 90
607 3300025972 Ga0207668_10783903 Ga0207668_107839033 90
608 3300025981 Ga0207640_10251188 Ga0207640_102511883 90
609 3300025986 Ga0207658_10018375 Ga0207658_100183754 90
610 3300025986 Ga0207658_10083168 Ga0207658_100831682 90
611 3300026023 Ga0207677_10194477 Ga0207677_101944772 90
612 3300026023 Ga0207677_10759838 Ga0207677_107598383 90
613 3300026035 Ga0207703_10055288 Ga0207703_100552885 90
614 3300026035 Ga0207703_12079678 Ga0207703_120796781 90
615 3300026041 Ga0207639_11353182 Ga0207639_113531822 90
616 3300026067 Ga0207678_10004755 Ga0207678_100047554 90
617 3300026067 Ga0207678_10170136 Ga0207678_101701364 90
618 3300026067 Ga0207678_10457647 Ga0207678_104576472 90
619 3300026075 Ga0207708_10023470 Ga0207708_100234702 90
620 3300026075 Ga0207708_11020813 Ga0207708_110208132 90
621 3300026078 Ga0207702_10062363 Ga0207702_100623634 90
622 3300026078 Ga0207702_11951081 Ga0207702_119510812 90
623 3300026078 Ga0207702_12234160 Ga0207702_122341602 90
624 3300026088 Ga0207641_10291425 Ga0207641_102914252 90
625 3300026088 Ga0207641_10574458 Ga0207641_105744582 90
626 3300026089 Ga0207648_10335248 Ga0207648_103352482 90
627 3300026089 Ga0207648_10368350 Ga0207648_103683501 90
628 3300026095 Ga0207676_10065958 Ga0207676_100659583 90
629 3300026095 Ga0207676_10249835 Ga0207676_102498353 90
630 3300026095 Ga0207676_10971899 Ga0207676_109718992 90
631 3300026116 Ga0207674_10003916 Ga0207674_100039168 90
632 3300026116 Ga0207674_10014777 Ga0207674_100147775 90
633 3300026116 Ga0207674_11205013 Ga0207674_112050132 90
634 3300026118 Ga0207675_100002273 Ga0207675_10000227322 90
635 3300026118 Ga0207675_100014841 Ga0207675_1000148412 90
636 3300026118 Ga0207675_100596371 Ga0207675_1005963712 90
637 3300026118 Ga0207675_100667383 Ga0207675_1006673833 90
638 3300026121 Ga0207683_10002629 Ga0207683_100026298 90
639 3300026121 Ga0207683_10286074 Ga0207683_102860744 90
640 3300026142 Ga0207698_10136783 Ga0207698_101367831 90
641 3300026142 Ga0207698_10228086 Ga0207698_102280862 90
642 3300026142 Ga0207698_10880820 Ga0207698_108808201 90
643 3300026142 Ga0207698_11293937 Ga0207698_112939371 90
644 3300027907 Ga0207428_10001336 Ga0207428_1000133619 90
645 3300027907 Ga0207428_10581183 Ga0207428_105811832 90
646 3300027907 Ga0207428_10927328 Ga0207428_109273283 90
647 3300028023 Ga0265357_1013765 Ga0265357_10137652 90
648 3300028379 Ga0268266_10215026 Ga0268266_102150264 90
649 3300028379 Ga0268266_11677443 Ga0268266_116774432 90
650 3300028380 Ga0268265_10704499 Ga0268265_107044993 90
651 3300028380 Ga0268265_11084822 Ga0268265_110848222 90
652 3300028380 Ga0268265_11147400 Ga0268265_111474002 90
653 3300028381 Ga0268264_10359495 Ga0268264_103594952 90
654 3300028381 Ga0268264_10685510 Ga0268264_106855102 90
655 3300028381 Ga0268264_12284514 Ga0268264_122845142 90
656 3300028573 Ga0265334_10024295 Ga0265334_100242953 90
657 3300028794 Ga0307515_10234593 Ga0307515_102345933 90
658 3300028800 Ga0265338_10010522 Ga0265338_100105225 90
659 3300030521 Ga0307511_10000212 Ga0307511_1000021257 90
660 3300030521 Ga0307511_10088246 Ga0307511_100882462 90
661 3300030760 Ga0265762_1092595 Ga0265762_10925952 90
662 3300030760 Ga0265762_1137384 Ga0265762_11373842 90
663 3300030763 Ga0265763_1002351 Ga0265763_10023512 90
664 3300030836 Ga0265767_105926 Ga0265767_1059262 90
665 3300030863 Ga0265766_1001087 Ga0265766_10010872 90
666 3300030963 Ga0265768_101295 Ga0265768_1012952 90
667 3300031018 Ga0265773_1000888 Ga0265773_10008882 90
668 3300031240 Ga0265320_10011837 Ga0265320_100118375 90
669 3300031241 Ga0265325_10011636 Ga0265325_100116366 90
670 3300031242 Ga0265329_10041183 Ga0265329_100411832 90
671 3300031247 Ga0265340_10015634 Ga0265340_100156345 90
672 3300031249 Ga0265339_10003699 Ga0265339_1000369913 90
673 3300031250 Ga0265331_10484126 Ga0265331_104841261 90
674 3300031251 Ga0265327_10000019 Ga0265327_10000019307 90
675 3300031548 Ga0307408_100008957 Ga0307408_1000089574 90
676 3300031548 Ga0307408_100019064 Ga0307408_1000190642 90
677 3300031548 Ga0307408_100217991 Ga0307408_1002179911 90
678 3300031548 Ga0307408_101083270 Ga0307408_1010832702 90
679 3300031595 Ga0265313_10077855 Ga0265313_100778552 90
680 3300031711 Ga0265314_10010164 Ga0265314_100101647 90
681 3300031712 Ga0265342_10071088 Ga0265342_100710883 90
682 3300031731 Ga0307405_10025197 Ga0307405_100251972 90
683 3300031731 Ga0307405_10090349 Ga0307405_100903492 90
684 3300031731 Ga0307405_10139218 Ga0307405_101392185 90
685 3300031731 Ga0307405_10763750 Ga0307405_107637503 90
686 3300031733 Ga0316577_10175745 Ga0316577_101757452 90
687 3300031824 Ga0307413_10020604 Ga0307413_100206042 90
688 3300031824 Ga0307413_10057908 Ga0307413_100579082 90
689 3300031824 Ga0307413_11317294 Ga0307413_113172942 90
690 3300031852 Ga0307410_10004986 Ga0307410_100049866 90
691 3300031852 Ga0307410_10069920 Ga0307410_100699203 90
692 3300031852 Ga0307410_10571537 Ga0307410_105715372 90
693 3300031852 Ga0307410_11037091 Ga0307410_110370912 90
694 3300031852 Ga0307410_11168073 Ga0307410_111680732 90
695 3300031901 Ga0307406_10127083 Ga0307406_101270832 90
696 3300031901 Ga0307406_10229811 Ga0307406_102298112 90
697 3300031901 Ga0307406_10244303 Ga0307406_102443031 90
698 3300031901 Ga0307406_10252465 Ga0307406_102524651 90
699 3300031901 Ga0307406_10860565 Ga0307406_108605652 90
700 3300031901 Ga0307406_10920514 Ga0307406_109205142 90
701 3300031901 Ga0307406_11421424 Ga0307406_114214242 90
702 3300031903 Ga0307407_10004283 Ga0307407_100042837 90
703 3300031903 Ga0307407_10137462 Ga0307407_101374624 90
704 3300031903 Ga0307407_10214977 Ga0307407_102149771 90
705 3300031903 Ga0307407_10350275 Ga0307407_103502754 90
706 3300031903 Ga0307407_11474433 Ga0307407_114744332 90
707 3300031911 Ga0307412_10153876 Ga0307412_101538762 90
708 3300031911 Ga0307412_10432161 Ga0307412_104321611 90
709 3300031911 Ga0307412_10539889 Ga0307412_105398892 90
710 3300031911 Ga0307412_11130256 Ga0307412_111302561 90
711 3300031995 Ga0307409_100006641 Ga0307409_1000066412 90
712 3300031995 Ga0307409_100022131 Ga0307409_1000221317 90
713 3300031995 Ga0307409_100051560 Ga0307409_1000515603 90
714 3300031995 Ga0307409_100108333 Ga0307409_1001083333 90
715 3300031995 Ga0307409_100154335 Ga0307409_1001543355 90
716 3300031995 Ga0307409_100609978 Ga0307409_1006099782 90
717 3300032002 Ga0307416_100082530 Ga0307416_1000825302 90
718 3300032002 Ga0307416_100167011 Ga0307416_1001670113 90
719 3300032002 Ga0307416_100441418 Ga0307416_1004414184 90
720 3300032002 Ga0307416_101554318 Ga0307416_1015543182 90
721 3300032004 Ga0307414_10107170 Ga0307414_101071701 90
722 3300032004 Ga0307414_10212664 Ga0307414_102126643 90
723 3300032004 Ga0307414_10821594 Ga0307414_108215942 90
724 3300032004 Ga0307414_11132289 Ga0307414_111322892 90
725 3300032004 Ga0307414_11934555 Ga0307414_119345552 90
726 3300032005 Ga0307411_10025146 Ga0307411_100251462 90
727 3300032005 Ga0307411_10134400 Ga0307411_101344005 90
728 3300032005 Ga0307411_10188023 Ga0307411_101880232 90
729 3300032005 Ga0307411_10435782 Ga0307411_104357822 90
730 3300032005 Ga0307411_11661178 Ga0307411_116611781 90
731 3300032126 Ga0307415_100011821 Ga0307415_1000118212 90
732 3300032126 Ga0307415_100581803 Ga0307415_1005818034 90
733 3300032126 Ga0307415_100898092 Ga0307415_1008980922 90
734 3300033179 Ga0307507_10000329 Ga0307507_1000032926 90
735 3300033544 Ga0316215_1017545 Ga0316215_10175452 90
736 3300033545 Ga0316214_1002972 Ga0316214_10029722 90
737 3300033545 Ga0316214_1008567 Ga0316214_10085673 90
738 3300033547 Ga0316212_1006199 Ga0316212_10061992 90
739 3300034816 Ga0373930_0030062 Ga0373930_0030062_618_890 90
740 3300034818 Ga0373950_0062746 Ga0373950_0062746_77_349 90
741 3300034820 Ga0373959_0014093 Ga0373959_0014093_866_1138 90
742 3300034957 Ga0373938_0004895 Ga0373938_0004895_1731_2003 90
743 3300035083 Ga0373926_0001004 Ga0373926_0001004_2573_2845 90
744 3300035083 Ga0373926_0105762 Ga0373926_0105762_536_808 90
745 3300035085 Ga0373929_0027832 Ga0373929_0027832_406_678 90
746 3300035086 Ga0373934_0005441 Ga0373934_0005441_1615_1887 90
747 3300035088 Ga0373940_0207423 Ga0373940_0207423_52_324 90
748 3300035089 Ga0373944_0006255 Ga0373944_0006255_1233_1505 90
749 3300035089 Ga0373944_0030808 Ga0373944_0030808_27_299 90
750 3300035089 Ga0373944_0288706 Ga0373944_0288706_106_378 90
751 3300035090 Ga0373949_0019283 Ga0373949_0019283_912_1184 90
752 3300035091 Ga0373951_0197736 Ga0373951_0197736_205_477 90
753 3300035092 Ga0373952_0025270 Ga0373952_0025270_315_587 90
754 3300035111 Ga0373923_0008519 Ga0373923_0008519_1881_2153 90
755 3300035111 Ga0373923_0028820 Ga0373923_0028820_182_454 90
756 3300035113 Ga0373936_0000482 Ga0373936_0000482_12899_13171 90
757 3300035113 Ga0373936_0004605 Ga0373936_0004605_483_755 90
758 3300035113 Ga0373936_0462800 Ga0373936_0462800_30_302 90
759 3300035113 Ga0373936_0631953 Ga0373936_0631953_56_328 90
760 3300035114 Ga0373939_0115153 Ga0373939_0115153_329_601 90
761 3300035115 Ga0373941_0007620 Ga0373941_0007620_321_593 90
762 3300035116 Ga0373945_0000485 Ga0373945_0000485_2574_2846 90
763 3300035116 Ga0373945_0002240 Ga0373945_0002240_160_432 90
764 3300035118 Ga0373954_0012340 Ga0373954_0012340_2636_2908 90
765 3300035118 Ga0373954_0567360 Ga0373954_0567360_246_518 90
766 3300035119 Ga0373956_0004367 Ga0373956_0004367_396_668 90
767 3300035119 Ga0373956_0013013 Ga0373956_0013013_1115_1387 90
768 3300035119 Ga0373956_0139935 Ga0373956_0139935_526_798 90
769 3300035120 Ga0373957_0118082 Ga0373957_0118082_201_473 90
770 3300035170 Ga0373943_0000368 Ga0373943_0000368_10813_11085 90
771 3300035170 Ga0373943_0014761 Ga0373943_0014761_1491_1763 90
772 3300035170 Ga0373943_0061321 Ga0373943_0061321_1135_1407 90
773 3300035171 Ga0373946_0002015 Ga0373946_0002015_1619_1891 90
774 3300035171 Ga0373946_0003630 Ga0373946_0003630_148_420 90
775 3300035172 Ga0373955_0007874 Ga0373955_0007874_4576_4848 90
776 3300035172 Ga0373955_0034979 Ga0373955_0034979_971_1243 90
777 3300035172 Ga0373955_0081613 Ga0373955_0081613_223_495 90
778 3300035207 Ga0373942_0024119 Ga0373942_0024119_1174_1446 90
779 3300035398 Ga0316574_0003093 Ga0316574_0003093_511_816 90
780 3300035410 Ga0373924_0034235 Ga0373924_0034235_387_659 90
781 3300035410 Ga0373924_0299081 Ga0373924_0299081_170_442 90
782 3300035691 Ga0373931_0071382 Ga0373931_0071382_837_1109 90
783 3300035691 Ga0373931_0364852 Ga0373931_0364852_94_366 90
784 3300035692 Ga0373935_0003807 Ga0373935_0003807_1903_2175 90
785 3300035692 Ga0373935_0015929 Ga0373935_0015929_3769_4041 90
786 3300035692 Ga0373935_0088136 Ga0373935_0088136_636_908 90
787 3300035695 Ga0373927_0002270 Ga0373927_0002270_2377_2649 90
788 3300035695 Ga0373927_0936832 Ga0373927_0936832_255_527 90
789 3300035724 Ga0373933_0035134 Ga0373933_0035134_2453_2725 90
790 3300035724 Ga0373933_0389210 Ga0373933_0389210_106_378 90
791 3300035725 Ga0373947_0009607 Ga0373947_0009607_1617_1889 90
792 3300035725 Ga0373947_0070086 Ga0373947_0070086_565_837 90
793 3300036401 Ga0373937_0064872 Ga0373937_0064872_596_868 90
794 3300036401 Ga0373937_0098972 Ga0373937_0098972_979_1251 90
795 3300036401 Ga0373937_0374115 Ga0373937_0374115_664_945 90
796 3300036401 Ga0373937_0378462 Ga0373937_0378462_274_546 90
797 3300037068 Ga0373925_0045325 Ga0373925_0045325_1238_1510 90
798 3300037068 Ga0373925_0512065 Ga0373925_0512065_479_751 90
799 3300037312 Ga0395899_0082700 Ga0395899_0082700_780_1052 90
800 3300037418 Ga0395900_0283544 Ga0395900_0283544_480_758 90
801 3300037418 Ga0395900_0445110 Ga0395900_0445110_962_1234 90
802 3300037466 Ga0395898_0012815 Ga0395898_0012815_826_1104 90
803 3300037466 Ga0395898_0956201 Ga0395898_0956201_281_553 90
804 3300037466 Ga0395898_1474465 Ga0395898_1474465_136_414 90
805 3300037471 Ga0395905_0026295 Ga0395905_0026295_1168_1440 90
806 3300037471 Ga0395905_1839631 Ga0395905_1839631_79_351 90
807 3300037853 Ga0436364_0154596 Ga0436364_0154596_25018_25290 90
808 3300037853 Ga0436364_0182444 Ga0436364_0182444_397_669 90
809 3300037853 Ga0436364_0323152 Ga0436364_0323152_325_597 90
810 3300037853 Ga0436364_1125035 Ga0436364_1125035_7230_7502 90
811 3300038443 Ga0395901_0013659 Ga0395901_0013659_6971_7249 90
812 3300038443 Ga0395901_2131658 Ga0395901_2131658_121_393 90
813 3300039437 Ga0436365_0800928 Ga0436365_0800928_125_397 90
814 3300039437 Ga0436365_0984038 Ga0436365_0984038_5067_5345 90
815 3300039438 Ga0436360_0027561 Ga0436360_0027561_1010_1282 90
816 3300039438 Ga0436360_0914144 Ga0436360_0914144_366_638 90
817 3300039447 Ga0436361_0883200 Ga0436361_0883200_416_688 90
818 3300039450 Ga0436363_1306040 Ga0436363_1306040_86_358 90
819 3300039453 Ga0436362_0513142 Ga0436362_0513142_1808_2086 90
820 3300041406 Ga0439439_0017977 Ga0439439_0017977_1347_1676 90
821 3300041408 Ga0439453_0069259 Ga0439453_0069259_50_322 90
822 3300041410 Ga0439461_0050733 Ga0439461_0050733_476_748 90
823 3300041411 Ga0439466_0042362 Ga0439466_0042362_448_720 90
824 3300041452 Ga0451793_0948911 Ga0451793_0948911_2332_2604 90
825 3300041453 Ga0451797_0891010 Ga0451797_0891010_232_504 90
826 3300041456 Ga0451795_0533444 Ga0451795_0533444_34_306 90
827 3300041459 Ga0451800_0242290 Ga0451800_0242290_325_618 90
828 3300041491 Ga0451833_0713203 Ga0451833_0713203_1327_1599 90
829 3300041494 Ga0451837_0535912 Ga0451837_0535912_2169_2441 90
830 3300041496 Ga0451839_0403005 Ga0451839_0403005_377_649 90
831 3300041496 Ga0451839_0498698 Ga0451839_0498698_229_501 90
832 3300041498 Ga0451841_0874204 Ga0451841_0874204_477_749 90
833 3300041509 Ga0451843_0712501 Ga0451843_0712501_396_668 90
834 3300041509 Ga0451843_1206816 Ga0451843_1206816_274_552 90
835 3300041512 Ga0451853_3042104 Ga0451853_3042104_159_446 90
836 3300041512 Ga0451853_3804823 Ga0451853_3804823_317_589 90
837 3300042003 Ga0439443_007118 Ga0439443_007118_891_1163 90
838 3300042003 Ga0439443_016281 Ga0439443_016281_204_476 90
839 3300042005 Ga0439448_0036946 Ga0439448_0036946_1058_1330 90
840 3300042005 Ga0439448_0038275 Ga0439448_0038275_87_359 90
841 3300042005 Ga0439448_0046624 Ga0439448_0046624_574_846 90
842 3300042005 Ga0439448_0061139 Ga0439448_0061139_667_957 90
843 3300042005 Ga0439448_0107677 Ga0439448_0107677_605_877 90
844 3300042008 Ga0439450_000035 Ga0439450_000035_5834_6106 90
845 3300042008 Ga0439450_011775 Ga0439450_011775_26_298 90
846 3300042008 Ga0439450_018018 Ga0439450_018018_254_526 90
847 3300042008 Ga0439450_120507 Ga0439450_120507_130_402 90
848 3300042010 Ga0439452_067965 Ga0439452_067965_216_545 90
849 3300042011 Ga0439454_001686 Ga0439454_001686_1722_1994 90
850 3300042011 Ga0439454_003306 Ga0439454_003306_309_599 90
851 3300042011 Ga0439454_033156 Ga0439454_033156_261_533 90
852 3300042012 Ga0439455_0018810 Ga0439455_0018810_500_772 90
853 3300042012 Ga0439455_0038123 Ga0439455_0038123_144_416 90
854 3300042012 Ga0439455_0136136 Ga0439455_0136136_265_537 90
855 3300042013 Ga0439456_051974 Ga0439456_051974_222_494 90
856 3300042014 Ga0439457_192138 Ga0439457_192138_146_418 90
857 3300042016 Ga0439463_001477 Ga0439463_001477_1225_1497 90
858 3300042016 Ga0439463_004777 Ga0439463_004777_1366_1656 90
859 3300042016 Ga0439463_010669 Ga0439463_010669_637_909 90
860 3300042016 Ga0439463_064242 Ga0439463_064242_458_730 90
861 3300042117 Ga0450913_002761 Ga0450913_002761_756_1028 90
862 3300042118 Ga0450914_008018 Ga0450914_008018_537_809 90
863 3300042119 Ga0450915_011382 Ga0450915_011382_144_416 90
864 3300042120 Ga0450917_026067 Ga0450917_026067_143_415 90
865 3300042129 Ga0450891_035994 Ga0450891_035994_45_317 90
866 3300042134 Ga0450898_094537 Ga0450898_094537_112_441 90
867 3300042136 Ga0450900_021541 Ga0450900_021541_517_789 90
868 3300042136 Ga0450900_037249 Ga0450900_037249_39_311 90
869 3300042136 Ga0450900_071804 Ga0450900_071804_204_476 90
870 3300042137 Ga0450902_026391 Ga0450902_026391_11_283 90
871 3300042139 Ga0450904_023465 Ga0450904_023465_270_542 90
872 3300042142 Ga0450905_002654 Ga0450905_002654_1011_1283 90
873 3300042142 Ga0450905_092082 Ga0450905_092082_104_376 90
874 3300042157 Ga0439458_0139124 Ga0439458_0139124_158_430 90
875 3300042157 Ga0439458_0189281 Ga0439458_0189281_84_356 90
876 3300042436 Ga0439435_0009970 Ga0439435_0009970_1098_1370 90
877 3300042437 Ga0439444_0002183 Ga0439444_0002183_432_704 90
878 3300042437 Ga0439444_0060942 Ga0439444_0060942_473_745 90
879 3300042438 Ga0439459_0042238 Ga0439459_0042238_20_292 90
880 3300042438 Ga0439459_0053458 Ga0439459_0053458_477_749 90
881 3300042438 Ga0439459_0102746 Ga0439459_0102746_197_469 90
882 3300042439 Ga0439464_0010913 Ga0439464_0010913_1080_1352 90
883 3300042439 Ga0439464_0194462 Ga0439464_0194462_310_582 90
884 3300042461 Ga0439460_0003195 Ga0439460_0003195_3570_3860 90
885 3300042461 Ga0439460_0010060 Ga0439460_0010060_1748_2020 90
886 3300042461 Ga0439460_0019662 Ga0439460_0019662_1546_1818 90
887 3300042461 Ga0439460_0284883 Ga0439460_0284883_239_511 90
888 3300042530 Ga0450916_024509 Ga0450916_024509_495_767 90
889 3300042993 Ga0439440_0000128 Ga0439440_0000128_3633_3905 90
890 3300042993 Ga0439440_0000836 Ga0439440_0000836_4155_4427 90
891 3300042993 Ga0439440_0002296 Ga0439440_0002296_3106_3378 90
892 3300044658 Ga0466972_0209223 Ga0466972_0209223_421_699 90
893 3300044673 Ga0453683_0285305 Ga0453683_0285305_16_288 90
894 3300044684 Ga0466966_0091496 Ga0466966_0091496_1461_1739 90
895 3300044693 Ga0466961_0070627 Ga0466961_0070627_1869_2144 90
896 3300044693 Ga0466961_0224672 Ga0466961_0224672_536_808 90
897 3300044694 Ga0466963_0098154 Ga0466963_0098154_277_549 90
898 3300044694 Ga0466963_0599349 Ga0466963_0599349_328_600 90
899 3300044706 Ga0466964_0767142 Ga0466964_0767142_223_495 90
900 3300044706 Ga0466964_0795879 Ga0466964_0795879_98_370 90
901 3300044719 Ga0466971_0308557 Ga0466971_0308557_160_432 90
902 3300044765 Ga0466970_0172981 Ga0466970_0172981_822_1097 90
903 3300044765 Ga0466970_0450724 Ga0466970_0450724_198_470 90
904 3300044765 Ga0466970_0834115 Ga0466970_0834115_179_457 90
905 3300044842 Ga0466957_0253442 Ga0466957_0253442_252_524 90
906 3300044842 Ga0466957_0387446 Ga0466957_0387446_380_655 90
907 3300044901 Ga0466960_0199184 Ga0466960_0199184_319_591 90
908 3300045049 Ga0466959_0072169 Ga0466959_0072169_1256_1528 90
909 3300045049 Ga0466959_1178682 Ga0466959_1178682_189_467 90
910 3300045836 Ga0466958_0394228 Ga0466958_0394228_580_855 90
911 3300045836 Ga0466958_0550939 Ga0466958_0550939_34_306 90
912 3300045976 Ga0466967_0142653 Ga0466967_0142653_570_842 90
913 3300045976 Ga0466967_1312802 Ga0466967_1312802_439_711 90
914 3300045976 Ga0466967_1586905 Ga0466967_1586905_286_564 90
915 3300046453 Ga0495627_173053 Ga0495627_173053_212_484 90
916 3300046454 Ga0495592_0060290 Ga0495592_0060290_1010_1282 90
917 3300046454 Ga0495592_0227188 Ga0495592_0227188_160_432 90
918 3300046454 Ga0495592_0756328 Ga0495592_0756328_12_284 90
919 3300046454 Ga0495592_0950261 Ga0495592_0950261_116_394 90
920 3300046455 Ga0495603_0256857 Ga0495603_0256857_650_922 90
921 3300046455 Ga0495603_0318036 Ga0495603_0318036_271_543 90
922 3300046459 Ga0495629_0016977 Ga0495629_0016977_2342_2614 90
923 3300046459 Ga0495629_0205101 Ga0495629_0205101_688_960 90
924 3300046461 Ga0495641_0015396 Ga0495641_0015396_2818_3090 90
925 3300046462 Ga0495651_0032413 Ga0495651_0032413_2829_3101 90
926 3300046462 Ga0495651_0151987 Ga0495651_0151987_127_399 90
927 3300046463 Ga0495653_0015253 Ga0495653_0015253_4813_5085 90
928 3300046463 Ga0495653_0102962 Ga0495653_0102962_202_474 90
929 3300046463 Ga0495653_0869221 Ga0495653_0869221_233_505 90
930 3300046472 Ga0495580_0124984 Ga0495580_0124984_1496_1768 90
931 3300046473 Ga0495582_0010972 Ga0495582_0010972_4509_4781 90
932 3300046475 Ga0495639_0049730 Ga0495639_0049730_610_882 90
933 3300046476 Ga0495662_0027556 Ga0495662_0027556_1598_1870 90
934 3300046476 Ga0495662_0056693 Ga0495662_0056693_835_1107 90
935 3300046476 Ga0495662_0079873 Ga0495662_0079873_1032_1304 90
936 3300046477 Ga0495664_0028425 Ga0495664_0028425_1619_1891 90
937 3300046477 Ga0495664_0039374 Ga0495664_0039374_1006_1278 90
938 3300046477 Ga0495664_0440607 Ga0495664_0440607_387_659 90
939 3300046491 Ga0495584_0085481 Ga0495584_0085481_506_778 90
940 3300046492 Ga0495585_0571628 Ga0495585_0571628_20_292 90
941 3300046499 Ga0495594_0015240 Ga0495594_0015240_3666_3938 90
942 3300046500 Ga0495596_0052010 Ga0495596_0052010_735_1007 90
943 3300046511 Ga0495608_0063052 Ga0495608_0063052_966_1238 90
944 3300046511 Ga0495608_0076737 Ga0495608_0076737_1517_1789 90
945 3300046514 Ga0495618_0068945 Ga0495618_0068945_1953_2225 90
946 3300046514 Ga0495618_0348073 Ga0495618_0348073_255_527 90
947 3300046516 Ga0495628_0025142 Ga0495628_0025142_4464_4736 90
948 3300046516 Ga0495628_0110770 Ga0495628_0110770_1106_1378 90
949 3300046517 Ga0495630_0009083 Ga0495630_0009083_5225_5497 90
950 3300046517 Ga0495630_0111063 Ga0495630_0111063_1554_1826 90
951 3300046517 Ga0495630_0180311 Ga0495630_0180311_736_1008 90
952 3300046519 Ga0495632_0481617 Ga0495632_0481617_98_370 90
953 3300046526 Ga0495666_0008049 Ga0495666_0008049_4671_4943 90
954 3300046529 Ga0495652_0035058 Ga0495652_0035058_3055_3327 90
955 3300046529 Ga0495652_0100099 Ga0495652_0100099_936_1208 90
956 3300046529 Ga0495652_0249945 Ga0495652_0249945_255_527 90
957 3300046529 Ga0495652_0509199 Ga0495652_0509199_512_784 90
958 3300046530 Ga0495654_0292749 Ga0495654_0292749_46_318 90
959 3300046531 Ga0495665_0003251 Ga0495665_0003251_6181_6453 90
960 3300046531 Ga0495665_0003452 Ga0495665_0003452_5251_5523 90
961 3300046531 Ga0495665_0028246 Ga0495665_0028246_1372_1644 90
962 3300046531 Ga0495665_0068728 Ga0495665_0068728_1102_1374 90
963 3300046531 Ga0495665_0078996 Ga0495665_0078996_479_751 90
964 3300046533 Ga0495640_0016803 Ga0495640_0016803_202_474 90
965 3300046533 Ga0495640_0195666 Ga0495640_0195666_199_471 90
966 3300046533 Ga0495640_0350980 Ga0495640_0350980_70_342 90
967 3300046535 Ga0495586_0017383 Ga0495586_0017383_3066_3338 90
968 3300046535 Ga0495586_0028005 Ga0495586_0028005_2397_2669 90
969 3300046536 Ga0495587_0048774 Ga0495587_0048774_727_999 90
970 3300046536 Ga0495587_0444498 Ga0495587_0444498_49_321 90
971 3300046536 Ga0495587_0481664 Ga0495587_0481664_255_527 90
972 3300046538 Ga0495609_0022560 Ga0495609_0022560_1805_2077 90
973 3300046539 Ga0495621_0036101 Ga0495621_0036101_568_840 90
974 3300046539 Ga0495621_0049098 Ga0495621_0049098_312_584 90
975 3300046543 Ga0495645_0158007 Ga0495645_0158007_572_844 90
976 3300046543 Ga0495645_0387711 Ga0495645_0387711_366_638 90
977 3300046557 Ga0495622_0073197 Ga0495622_0073197_1221_1493 90
978 3300046559 Ga0495667_0030332 Ga0495667_0030332_1352_1624 90
979 3300046559 Ga0495667_0044382 Ga0495667_0044382_1338_1610 90
980 3300046559 Ga0495667_0953623 Ga0495667_0953623_44_316 90
981 3300046615 Ga0495656_0009807 Ga0495656_0009807_2402_2674 90
982 3300046642 Ga0495634_0072421 Ga0495634_0072421_1421_1693 90
983 3300046642 Ga0495634_0139446 Ga0495634_0139446_779_1051 90
984 3300046642 Ga0495634_0153533 Ga0495634_0153533_370_642 90
985 3300046648 Ga0495611_0121512 Ga0495611_0121512_681_953 90
986 3300046663 Ga0495635_0000658 Ga0495635_0000658_20277_20549 90
987 3300046663 Ga0495635_0056326 Ga0495635_0056326_1538_1810 90
988 3300046663 Ga0495635_0067430 Ga0495635_0067430_14_286 90
989 3300046674 Ga0495588_0626313 Ga0495588_0626313_21_293 90
990 3300046675 Ga0495657_0070320 Ga0495657_0070320_616_888 90
991 3300046675 Ga0495657_0133453 Ga0495657_0133453_1222_1494 90
992 3300046675 Ga0495657_0491080 Ga0495657_0491080_268_540 90
993 3300046678 Ga0495599_0036981 Ga0495599_0036981_582_854 90
994 3300046678 Ga0495599_0056549 Ga0495599_0056549_722_994 90
995 3300046679 Ga0495623_0113935 Ga0495623_0113935_822_1094 90
996 3300046679 Ga0495623_0197230 Ga0495623_0197230_671_943 90
997 3300046680 Ga0495646_0070249 Ga0495646_0070249_723_995 90
998 3300046680 Ga0495646_0214735 Ga0495646_0214735_444_716 90
999 3300046680 Ga0495646_0445064 Ga0495646_0445064_255_527 90
1000 3300046681 Ga0495647_0135939 Ga0495647_0135939_315_587 90
1001 3300046681 Ga0495647_0405850 Ga0495647_0405850_237_509 90
1002 3300046683 Ga0495658_0194985 Ga0495658_0194985_348_620 90
1003 3300046683 Ga0495658_0226256 Ga0495658_0226256_421_693 90
1004 3300046684 Ga0495669_0034011 Ga0495669_0034011_100_372 90
1005 3300046689 Ga0495613_0006122 Ga0495613_0006122_3759_4031 90
1006 3300046689 Ga0495613_0167325 Ga0495613_0167325_650_922 90
1007 3300046690 Ga0495624_0035552 Ga0495624_0035552_1720_1992 90
1008 3300046690 Ga0495624_0068963 Ga0495624_0068963_303_575 90
1009 3300046690 Ga0495624_0304014 Ga0495624_0304014_291_563 90
1010 3300046691 Ga0495670_0250846 Ga0495670_0250846_578_850 90
1011 3300046694 Ga0495649_0430873 Ga0495649_0430873_98_370 90
1012 3300046794 Ga0495589_0087574 Ga0495589_0087574_202_474 90
1013 3300046809 Ga0495600_0018569 Ga0495600_0018569_1766_2038 90
1014 3300046809 Ga0495600_0091470 Ga0495600_0091470_1396_1668 90
1015 3300046809 Ga0495600_0350001 Ga0495600_0350001_406_678 90
1016 3300047315 Ga0495581_0007400 Ga0495581_0007400_5985_6257 90
1017 3300047315 Ga0495581_0015967 Ga0495581_0015967_2500_2772 90
1018 3300047315 Ga0495581_0251668 Ga0495581_0251668_433_705 90
1019 3300047317 Ga0495604_0121375 Ga0495604_0121375_1350_1622 90
1020 3300047317 Ga0495604_0201907 Ga0495604_0201907_1094_1366 90
1021 3300047318 Ga0495636_0032597 Ga0495636_0032597_143_415 90
1022 3300047319 Ga0495674_0088142 Ga0495674_0088142_1401_1673 90
1023 3300047321 Ga0495676_0035969 Ga0495676_0035969_2259_2531 90
1024 3300047321 Ga0495676_0276273 Ga0495676_0276273_473_745 90
1025 3300047322 Ga0495680_0150464 Ga0495680_0150464_1242_1514 90
1026 3300047322 Ga0495680_0828427 Ga0495680_0828427_316_588 90
1027 3300047444 Ga0495675_0084221 Ga0495675_0084221_1222_1494 90
1028 3300047444 Ga0495675_0324314 Ga0495675_0324314_252_524 90
1029 3300047471 Ga0495684_0054691 Ga0495684_0054691_349_621 90
1030 3300047471 Ga0495684_0086267 Ga0495684_0086267_1379_1651 90
1031 3300047471 Ga0495684_0768151 Ga0495684_0768151_143_415 90
1032 3300047673 Ga0495593_0045304 Ga0495593_0045304_808_1080 90
1033 3300047673 Ga0495593_0400310 Ga0495593_0400310_160_432 90
1034 3300048088 Ga0495602_0113980 Ga0495602_0113980_1360_1632 90
1035 3300048088 Ga0495602_0424457 Ga0495602_0424457_370_642 90
1036 3300048088 Ga0495602_0797006 Ga0495602_0797006_295_573 90
1037 3300048089 Ga0495614_0052179 Ga0495614_0052179_1212_1484 90
1038 3300048090 Ga0495615_0235681 Ga0495615_0235681_85_357 90
1039 3300048903 Ga0496100_0019542 Ga0496100_0019542_1051_1323 90
1040 3300048904 Ga0496101_0052070 Ga0496101_0052070_1113_1385 90
1041 3300048904 Ga0496101_0606292 Ga0496101_0606292_88_360 90
1042 3300048905 Ga0496102_0306075 Ga0496102_0306075_494_766 90
1043 3300048905 Ga0496102_0797744 Ga0496102_0797744_397_669 90
1044 3300048905 Ga0496102_1901948 Ga0496102_1901948_20_292 90
1045 3300048906 Ga0496103_0024921 Ga0496103_0024921_2097_2369 90
1046 3300048907 Ga0496104_0169357 Ga0496104_0169357_53_325 90
1047 3300048907 Ga0496104_0909186 Ga0496104_0909186_225_497 90
1048 3300048908 Ga0496105_0016547 Ga0496105_0016547_2932_3204 90
1049 3300048908 Ga0496105_1291832 Ga0496105_1291832_206_478 90
1050 3300048909 Ga0496106_0862544 Ga0496106_0862544_47_322 90
1051 3300048910 Ga0496107_0096143 Ga0496107_0096143_1627_1899 90
1052 3300048911 Ga0496108_0225681 Ga0496108_0225681_746_1021 90
1053 3300048911 Ga0496108_0311649 Ga0496108_0311649_422_694 90
1054 3300048911 Ga0496108_0449639 Ga0496108_0449639_684_956 90
1055 3300048912 Ga0496109_1299259 Ga0496109_1299259_170_442 90
1056 3300048912 Ga0496109_1344953 Ga0496109_1344953_309_608 90
1057 3300048912 Ga0496109_1552522 Ga0496109_1552522_155_427 90
1058 3300048913 Ga0496110_0070071 Ga0496110_0070071_1535_1807 90
1059 3300048913 Ga0496110_0073263 Ga0496110_0073263_1070_1342 90
1060 3300048913 Ga0496110_0612221 Ga0496110_0612221_17_289 90
1061 3300048914 Ga0496111_0222421 Ga0496111_0222421_755_1027 90
1062 3300048915 Ga0496112_0694556 Ga0496112_0694556_504_776 90
1063 3300048916 Ga0496113_0016306 Ga0496113_0016306_1275_1547 90
1064 3300048916 Ga0496113_0070923 Ga0496113_0070923_680_952 90
1065 3300048916 Ga0496113_0577319 Ga0496113_0577319_33_305 90
1066 3300048917 Ga0496114_0172345 Ga0496114_0172345_12_284 90
1067 3300048917 Ga0496114_0898941 Ga0496114_0898941_287_559 90
1068 3300048917 Ga0496114_1459927 Ga0496114_1459927_131_421 90
1069 3300048918 Ga0496115_0267680 Ga0496115_0267680_637_909 90
1070 3300048918 Ga0496115_0393115 Ga0496115_0393115_770_1042 90
1071 3300048921 Ga0496118_0331690 Ga0496118_0331690_191_466 90
1072 3300048922 Ga0496119_0036955 Ga0496119_0036955_498_770 90
1073 3300048923 Ga0496120_0254820 Ga0496120_0254820_331_603 90
1074 3300048925 Ga0496122_0011095 Ga0496122_0011095_8496_8768 90
1075 3300048926 Ga0496123_0001686 Ga0496123_0001686_26107_26379 90
1076 3300048928 Ga0496125_0277027 Ga0496125_0277027_294_566 90
1077 3300048929 Ga0496126_0000007 Ga0496126_0000007_615622_615897 90
1078 3300048929 Ga0496126_0001977 Ga0496126_0001977_6438_6710 90
1079 3300048929 Ga0496126_0162886 Ga0496126_0162886_42_314 90
1080 3300048929 Ga0496126_0936235 Ga0496126_0936235_297_569 90
1081 3300049568 Ga0501031_0007036 Ga0501031_0007036_2073_2345 90
1082 3300049568 Ga0501031_0016176 Ga0501031_0016176_642_914 90
1083 3300049569 Ga0501032_0035526 Ga0501032_0035526_756_1028 90
1084 3300049569 Ga0501032_0132383 Ga0501032_0132383_898_1170 90
1085 3300049569 Ga0501032_0822093 Ga0501032_0822093_281_553 90
1086 3300049570 Ga0501033_0024312 Ga0501033_0024312_430_702 90
1087 3300049570 Ga0501033_0044866 Ga0501033_0044866_2398_2670 90
1088 3300049571 Ga0501034_0386300 Ga0501034_0386300_71_349 90
1089 3300049572 Ga0501036_0001139 Ga0501036_0001139_5139_5411 90
1090 3300049572 Ga0501036_0011323 Ga0501036_0011323_5359_5631 90
1091 3300049573 Ga0501037_0007729 Ga0501037_0007729_1495_1773 90
1092 3300049573 Ga0501037_0045918 Ga0501037_0045918_2818_3090 90
1093 3300049573 Ga0501037_0826243 Ga0501037_0826243_262_552 90
1094 3300049574 Ga0501038_0027050 Ga0501038_0027050_564_836 90
1095 3300049574 Ga0501038_0186185 Ga0501038_0186185_1074_1364 90
1096 3300049574 Ga0501038_0214282 Ga0501038_0214282_991_1269 90
1097 3300049575 Ga0501039_0003019 Ga0501039_0003019_2767_3039 90
1098 3300049575 Ga0501039_0015614 Ga0501039_0015614_4802_5074 90
1099 3300049576 Ga0501040_0000293 Ga0501040_0000293_22907_23179 90
1100 3300049576 Ga0501040_0003652 Ga0501040_0003652_4503_4775 90
1101 3300049576 Ga0501040_0033161 Ga0501040_0033161_1334_1624 90
1102 3300049576 Ga0501040_0226478 Ga0501040_0226478_529_801 90
1103 3300049577 Ga0501041_0000165 Ga0501041_0000165_5416_5688 90
1104 3300049577 Ga0501041_0000404 Ga0501041_0000404_7120_7392 90
1105 3300049577 Ga0501041_0283498 Ga0501041_0283498_254_526 90
1106 3300049577 Ga0501041_0980098 Ga0501041_0980098_194_466 90
1107 3300049578 Ga0501042_0000007 Ga0501042_0000007_4138_4410 90
1108 3300049578 Ga0501042_0002086 Ga0501042_0002086_6672_6944 90
1109 3300049578 Ga0501042_0085211 Ga0501042_0085211_581_871 90
1110 3300049578 Ga0501042_0176411 Ga0501042_0176411_350_622 90
1111 3300049579 Ga0501043_0003703 Ga0501043_0003703_3147_3419 90
1112 3300049579 Ga0501043_0017819 Ga0501043_0017819_442_714 90
1113 3300049579 Ga0501043_0234102 Ga0501043_0234102_216_506 90
1114 3300049580 Ga0501046_0002500 Ga0501046_0002500_9805_10077 90
1115 3300049580 Ga0501046_0003651 Ga0501046_0003651_8487_8759 90
1116 3300049580 Ga0501046_0787204 Ga0501046_0787204_43_333 90
1117 3300049581 Ga0501047_0033679 Ga0501047_0033679_819_1091 90
1118 3300049581 Ga0501047_0045921 Ga0501047_0045921_2224_2502 90
1119 3300049582 Ga0501048_0001431 Ga0501048_0001431_12741_13013 90
1120 3300049582 Ga0501048_0172156 Ga0501048_0172156_360_632 90
1121 3300049583 Ga0501067_0235194 Ga0501067_0235194_30_359 90
1122 3300049583 Ga0501067_0299764 Ga0501067_0299764_188_460 90
1123 3300049583 Ga0501067_0644431 Ga0501067_0644431_207_536 90
1124 3300049583 Ga0501067_0865505 Ga0501067_0865505_37_309 90
1125 3300049584 Ga0501068_0010885 Ga0501068_0010885_747_1019 90
1126 3300049585 Ga0501069_0280931 Ga0501069_0280931_684_956 90
1127 3300049585 Ga0501069_0400763 Ga0501069_0400763_394_672 90
1128 3300049585 Ga0501069_0422873 Ga0501069_0422873_111_401 90
1129 3300049586 Ga0501070_0411927 Ga0501070_0411927_613_885 90
1130 3300049586 Ga0501070_1488881 Ga0501070_1488881_123_395 90
1131 3300049587 Ga0501071_0021545 Ga0501071_0021545_300_572 90
1132 3300049587 Ga0501071_0041011 Ga0501071_0041011_1384_1656 90
1133 3300049587 Ga0501071_0371799 Ga0501071_0371799_583_855 90
1134 3300049588 Ga0501072_0221046 Ga0501072_0221046_50_340 90
1135 3300049588 Ga0501072_0246899 Ga0501072_0246899_443_715 90
1136 3300049589 Ga0501073_0214621 Ga0501073_0214621_502_774 90
1137 3300049590 Ga0501074_0000297 Ga0501074_0000297_23205_23477 90
1138 3300049591 Ga0501075_0000238 Ga0501075_0000238_22786_23058 90
1139 3300049591 Ga0501075_0000795 Ga0501075_0000795_5300_5572 90
1140 3300049591 Ga0501075_0107829 Ga0501075_0107829_1418_1708 90
1141 3300049592 Ga0501076_0000380 Ga0501076_0000380_11535_11807 90
1142 3300049592 Ga0501076_0017302 Ga0501076_0017302_4693_4965 90
1143 3300049592 Ga0501076_0185186 Ga0501076_0185186_792_1082 90
1144 3300049592 Ga0501076_1185423 Ga0501076_1185423_317_598 90
1145 3300049593 Ga0501077_0000459 Ga0501077_0000459_22902_23174 90
1146 3300049593 Ga0501077_0203344 Ga0501077_0203344_303_593 90
1147 3300049593 Ga0501077_0288684 Ga0501077_0288684_246_518 90
1148 3300049593 Ga0501077_0329672 Ga0501077_0329672_198_470 90
1149 3300049741 Ga0501079_0000448 Ga0501079_0000448_14141_14413 90
1150 3300049741 Ga0501079_0003137 Ga0501079_0003137_5144_5434 90
1151 3300049741 Ga0501079_0153645 Ga0501079_0153645_394_666 90
1152 3300049742 Ga0501080_0013285 Ga0501080_0013285_1864_2136 90
1153 3300049742 Ga0501080_0166091 Ga0501080_0166091_767_1045 90
1154 3300049742 Ga0501080_0468815 Ga0501080_0468815_730_1002 90
1155 3300049743 Ga0501081_0000172 Ga0501081_0000172_25325_25597 90
1156 3300049743 Ga0501081_0001115 Ga0501081_0001115_11803_12075 90
1157 3300049744 Ga0501083_0262544 Ga0501083_0262544_632_904 90
1158 3300049822 Ga0501035_0026090 Ga0501035_0026090_2629_2901 90
1159 3300049822 Ga0501035_0026525 Ga0501035_0026525_1040_1312 90
1160 3300049823 Ga0501044_0002377 Ga0501044_0002377_18848_19120 90
1161 3300049823 Ga0501044_0009795 Ga0501044_0009795_7176_7454 90
1162 3300049823 Ga0501044_0081049 Ga0501044_0081049_2171_2443 90
1163 3300049823 Ga0501044_0241056 Ga0501044_0241056_95_367 90
1164 3300049824 Ga0501045_0000063 Ga0501045_0000063_43147_43419 90
1165 3300049824 Ga0501045_0011785 Ga0501045_0011785_5134_5406 90
1166 3300049824 Ga0501045_0017782 Ga0501045_0017782_1362_1652 90
1167 3300050491 nmdc:mga00v17_310187_c1 nmdc:mga00v17_310187_c1_141_413 90
1168 3300050491 nmdc:mga00v17_856535_c1 nmdc:mga00v17_856535_c1_13_285 90
1169 3300050492 nmdc:mga0yw44_455915_c1 nmdc:mga0yw44_455915_c1_406_678 90
1170 3300050496 nmdc:mga07m45_763810_c1 nmdc:mga07m45_763810_c1_177_449 90
1171 3300050507 nmdc:mga05p37_1110226_c1 nmdc:mga05p37_1110226_c1_529_801 90
1172 3300050507 nmdc:mga05p37_1191869_c1 nmdc:mga05p37_1191869_c1_96_413 90
1173 3300050507 nmdc:mga05p37_1273092_c1 nmdc:mga05p37_1273092_c1_52_324 90
1174 3300050507 nmdc:mga05p37_134314_c1 nmdc:mga05p37_134314_c1_1309_1581 90
1175 3300050507 nmdc:mga05p37_193279_c1 nmdc:mga05p37_193279_c1_2024_2314 90
1176 3300050507 nmdc:mga05p37_2197224_c1 nmdc:mga05p37_2197224_c1_176_448 90
1177 3300050507 nmdc:mga05p37_2792_c1 nmdc:mga05p37_2792_c1_6691_6963 90
1178 3300050507 nmdc:mga05p37_322292_c1 nmdc:mga05p37_322292_c1_48_320 90
1179 3300050508 nmdc:mga09592_1585_c1 nmdc:mga09592_1585_c1_663_980 90
1180 3300050508 nmdc:mga09592_207142_c1 nmdc:mga09592_207142_c1_1089_1361 90
1181 3300050508 nmdc:mga09592_919107_c1 nmdc:mga09592_919107_c1_427_717 90
1182 3300050509 nmdc:mga0qj67_1434_c1 nmdc:mga0qj67_1434_c1_16179_16496 90
1183 3300050509 nmdc:mga0qj67_2253_c1 nmdc:mga0qj67_2253_c1_1351_1623 90
1184 3300050509 nmdc:mga0qj67_748267_c1 nmdc:mga0qj67_748267_c1_250_540 90
1185 3300050510 nmdc:mga06r32_116842_c1 nmdc:mga06r32_116842_c1_1843_2133 90
1186 3300050510 nmdc:mga06r32_15984_c1 nmdc:mga06r32_15984_c1_956_1228 90
1187 3300050510 nmdc:mga06r32_515_c1 nmdc:mga06r32_515_c1_8532_8849 90
1188 3300050511 nmdc:mga08y16_1095853_c1 nmdc:mga08y16_1095853_c1_316_588 90
1189 3300050511 nmdc:mga08y16_1679234_c1 nmdc:mga08y16_1679234_c1_70_342 90
1190 3300050511 nmdc:mga08y16_1960028_c1 nmdc:mga08y16_1960028_c1_68_340 90
1191 3300050511 nmdc:mga08y16_21682_c1 nmdc:mga08y16_21682_c1_2835_3107 90
1192 3300050511 nmdc:mga08y16_754336_c1 nmdc:mga08y16_754336_c1_374_646 90
1193 3300050511 nmdc:mga08y16_8919_c1 nmdc:mga08y16_8919_c1_9274_9546 90
1194 3300050512 nmdc:mga0n895_1240757_c1 nmdc:mga0n895_1240757_c1_168_440 90
1195 3300050512 nmdc:mga0n895_132835_c1 nmdc:mga0n895_132835_c1_1705_1977 90
1196 3300050512 nmdc:mga0n895_1679580_c1 nmdc:mga0n895_1679580_c1_294_575 90
1197 3300050512 nmdc:mga0n895_247609_c1 nmdc:mga0n895_247609_c1_212_484 90
1198 3300050512 nmdc:mga0n895_372676_c1 nmdc:mga0n895_372676_c1_249_527 90
1199 3300050513 nmdc:mga0rr50_106334_c1 nmdc:mga0rr50_106334_c1_153_425 90
1200 3300050513 nmdc:mga0rr50_964687_c1 nmdc:mga0rr50_964687_c1_173_445 90
1201 3300050514 nmdc:mga08x19_1010546_c1 nmdc:mga08x19_1010546_c1_141_413 90
1202 3300050514 nmdc:mga08x19_1204744_c1 nmdc:mga08x19_1204744_c1_88_360 90
1203 3300050514 nmdc:mga08x19_749848_c1 nmdc:mga08x19_749848_c1_46_324 90
1204 3300050515 nmdc:mga0a205_394795_c1 nmdc:mga0a205_394795_c1_530_802 90
1205 3300050515 nmdc:mga0a205_5116_c1 nmdc:mga0a205_5116_c1_574_846 90
1206 3300053077 Ga0495601_0040021 Ga0495601_0040021_285_557 90
1207 3300053078 Ga0495612_0050108 Ga0495612_0050108_1013_1285 90
1208 3300053078 Ga0495612_0171165 Ga0495612_0171165_456_728 90
1209 3300053084 Ga0495595_0012380 Ga0495595_0012380_1380_1652 90
1210 3300053084 Ga0495595_0241559 Ga0495595_0241559_379_651 90
1211 3300053085 Ga0495619_0004418 Ga0495619_0004418_8444_8716 90
1212 3300053085 Ga0495619_0299361 Ga0495619_0299361_628_900 90
1213 3300053088 Ga0500644_0056969 Ga0500644_0056969_637_909 90
1214 3300053142 Ga0500577_0089278 Ga0500577_0089278_447_719 90
1215 3300053153 Ga0500616_0018678 Ga0500616_0018678_2487_2759 90
1216 3300053736 Ga0500599_000374 Ga0500599_000374_1932_2210 90
1217 3300054114 Ga0501084_0005801 Ga0501084_0005801_4811_5083 90
1218 3300054114 Ga0501084_0012141 Ga0501084_0012141_2756_3028 90
1219 3300054114 Ga0501084_0615357 Ga0501084_0615357_604_894 90
1220 3300059421 Ga0590071_005793 Ga0590071_005793_1159_1431 90
1221 3300059421 Ga0590071_100303 Ga0590071_100303_99_371 90
1222 3300059421 Ga0590071_163384 Ga0590071_163384_181_453 90
1223 3300059423 Ga0590074_005445 Ga0590074_005445_1024_1296 90
1224 3300059424 Ga0590075_001535 Ga0590075_001535_4631_4903 90
1225 3300059426 Ga0590077_002621 Ga0590077_002621_868_1140 90
1226 3300059426 Ga0590077_114768 Ga0590077_114768_41_313 90
1227 3300059492 Ga0587073_0276292 Ga0587073_0276292_243_515 90
1228 3300059505 Ga0587083_0016055 Ga0587083_0016055_819_1091 90
1229 3300059507 Ga0587086_006600 Ga0587086_006600_814_1086 90
1230 3300059508 Ga0587088_035167 Ga0587088_035167_83_358 90
1231 3300059630 Ga0587128_006456 Ga0587128_006456_714_986 90
1232 3300060344 Ga0587071_198685 Ga0587071_198685_14_286 90
1233 3300060353 Ga0501082_0000373 Ga0501082_0000373_34045_34317 90
1234 3300060353 Ga0501082_0000696 Ga0501082_0000696_23543_23815 90
1235 3300060353 Ga0501082_0186428 Ga0501082_0186428_626_916 90
1236 3300060353 Ga0501082_1136514 Ga0501082_1136514_271_543 90
1237 3300060353 Ga0501082_1277207 Ga0501082_1277207_34_306 90
1238 3300061734 Ga0530510_0000454 Ga0530510_0000454_20663_20935 90
1239 3300061734 Ga0530510_0002560 Ga0530510_0002560_6171_6443 90
1240 3300061734 Ga0530510_0028241 Ga0530510_0028241_1515_1805 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01455

HupF_HypC

HupF/HypC family

1

70

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h43-assembly1.cif.gz_A n-terminal domain of the proteasome-activating nucleotidase of methanocaldococcus jannaschii 0.7943 1 49
7w3j-assembly1.cif.gz_D structure of usp14-bound human 26s proteasome in substrate-inhibited state sc_usp14 0.7852 3 50
4glm-assembly4.cif.gz_D crystal structure of the sh3 domain of dnmbp protein [homo sapiens] 0.7842 3 32
1w6x-assembly2.cif.gz_B sh3 domain of p40phox, component of the nadph oxidase 0.7821 7 34
6he9-assembly1.cif.gz_K pan-proteasome in state 2 0.7818 4 50
ID Description Score Start End Superfamily
af_Q68LP1_328_392_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8426 7 33 2.30.30.40
af_A0A6M3QH40_2314_2376_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8382 7 34 2.30.30.40
af_O74749_210_275_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8362 7 34 2.30.30.40
af_A0A2R8QPI9_635_697_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8293 7 34 2.30.30.40
af_A7E3N2_456_514_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8254 7 34 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A838PX29-F1-model_v4 HypC/HybG/HupF family hydrogenase formation chaperone 0.8707 1 52 GO:0005506
GO:0051604
GO:1902670
AF-A0A7C7PPC6-F1-model_v4 Hydrogenase assembly protein HupF 0.8663 1 52 GO:0005506
GO:0051604
GO:1902670
AF-T1C4F6-F1-model_v4 Protein belonging to Hydrogenase expression/formation protein, HupF/HypC 0.8605 1 57 GO:0005506
GO:0051604
GO:1902670
AF-A0A838PX29-F1-model_v4 HypC/HybG/HupF family hydrogenase formation chaperone 0.8559 1 52 GO:0005506
GO:0051604
GO:1902670
AF-T1C4F6-F1-model_v4 Protein belonging to Hydrogenase expression/formation protein, HupF/HypC 0.8464 1 57 GO:0005506
GO:0051604
GO:1902670

Feature Viewer

pLDDT pTM Quality
86.74 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map