F491965
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1228 | 870 | 672 | 288 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2862705112|2862708551 |
| Length | 307 |
| Sequence | ATAPVRGPRQVGGPRRPGRPRRPLFGNRPTRSPLLRALVKHSVMIITLTLMLYPLLWMFGASLRPDNQVFTTLGLWGSDLTLDNYAAGWSGGDQLNFSRFFLNSLTITVLSIVGNLLACALTAYAFARLEFRFKKTLFALVIGTLLLPYHVTLVPQYILFNQLGWVNTILPLVVPKFLATDAFFIFLMVQFIRALPSSLDDAARIDGCGHWGIFWRVVMPLSIPALGTSALFTFINTWNDFLGPMLYLTEPDSWTVSQGLASFLDATGQSAYGSLFAMSTLSLVPVLGFFVAAQKLLVEGIATSGLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 23 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 24 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 25 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 26 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 27 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 28 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 29 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 30 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 31 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 32 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 35 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 36 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 37 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 38 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 39 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 40 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 41 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 42 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 43 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 44 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 45 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 46 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 47 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 48 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 49 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 50 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 51 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 52 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 53 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 54 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 55 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 56 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 57 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 58 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 59 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 60 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 61 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 62 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 63 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 64 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 65 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 66 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 67 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 68 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 69 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 70 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 71 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 72 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 73 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 74 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 75 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 76 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 77 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 78 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 79 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 80 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 81 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 82 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 83 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 84 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 85 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 86 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 87 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 88 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 89 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 90 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 91 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 92 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 93 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 94 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 95 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 96 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 97 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 98 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 99 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 100 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 101 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 102 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 103 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 104 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 105 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 106 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 107 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 108 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 109 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 110 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 111 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 112 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 113 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 114 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 115 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 116 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 117 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 118 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 119 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 120 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 121 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 122 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 123 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 124 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 125 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 126 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 127 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 128 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 129 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 130 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 131 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 132 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 133 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 134 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 135 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 136 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 137 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 138 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 139 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 140 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 141 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 142 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 143 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 144 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 145 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 146 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 147 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 148 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 149 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 150 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 151 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 152 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 153 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 154 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 155 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 156 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 157 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 158 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 159 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 160 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 161 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 162 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 163 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 164 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 165 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 166 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 167 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 168 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 169 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 170 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 171 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 172 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 173 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 174 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 175 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 176 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 177 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 178 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 179 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 180 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 181 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 182 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 183 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 184 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 185 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 186 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 187 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 188 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 189 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 190 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 191 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 192 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 193 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 194 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 195 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 196 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 197 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 198 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 199 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 200 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 201 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 202 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 203 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 204 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 205 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 206 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 207 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 208 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 209 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 210 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 211 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 212 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 213 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 214 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 215 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 216 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 217 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 218 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 219 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 220 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 221 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 222 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 223 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 224 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 225 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 226 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 227 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 228 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 229 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 230 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 231 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 232 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 233 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 234 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 235 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 236 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 237 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 238 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 239 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 240 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 241 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 242 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 243 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 244 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 245 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 246 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 247 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 248 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 249 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 250 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 251 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 252 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 253 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 254 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 255 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 256 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 257 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 258 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 259 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 260 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 261 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 262 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 263 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 264 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 265 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 266 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 267 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 268 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 269 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 270 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 271 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 272 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 273 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 274 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 275 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 276 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 277 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 278 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 279 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 280 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 281 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 282 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 283 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 284 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 285 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 286 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 287 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 288 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 289 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 290 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 291 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 292 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 293 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 294 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 295 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 296 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 297 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 298 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 299 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 300 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 301 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 302 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 303 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 304 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 305 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 306 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 307 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 308 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 309 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 310 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 311 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 312 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 313 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 314 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 315 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 316 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 317 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 318 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 319 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 320 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 321 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 322 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 323 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 324 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 325 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 326 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 327 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 328 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 329 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 330 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 331 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 332 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 333 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 334 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 335 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 336 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 337 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 338 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 339 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 340 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 341 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 342 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 343 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 344 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 345 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 346 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 347 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 348 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 349 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 350 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 351 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 352 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 353 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 354 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 355 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 356 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 357 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 358 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 359 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 360 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 361 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 362 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 363 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 364 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 365 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 366 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 367 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 368 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 369 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 370 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 371 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 372 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 373 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 374 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 375 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 376 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 377 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 378 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 379 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 380 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 381 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 382 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 383 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 384 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 385 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 386 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 387 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 388 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 389 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 390 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 391 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 392 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 393 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 394 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 395 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 396 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 397 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 398 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 399 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 400 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 401 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 402 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 403 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 404 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 405 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 406 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 407 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 408 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 409 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 410 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 411 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 412 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 413 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 414 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 415 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 416 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 417 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 418 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 419 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 420 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 421 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 422 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 423 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 424 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 425 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 426 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 427 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 428 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 429 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 430 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 431 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 432 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 433 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 434 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 435 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 436 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 437 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 438 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 439 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 440 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 441 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 442 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 443 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 444 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 445 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 446 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 447 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 448 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 449 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 450 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 451 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 452 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 453 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 454 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 455 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 456 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 457 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 458 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 459 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 460 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 461 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 462 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 463 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 464 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 465 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 466 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 467 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 468 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 469 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 470 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 471 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 472 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 473 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 474 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 475 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 476 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 477 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 478 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 479 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 480 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 481 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 482 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 483 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 484 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 485 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 486 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 487 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 488 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 489 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 490 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 491 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 492 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 493 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 494 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 495 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 496 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 497 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 498 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 499 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 500 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 501 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 502 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 503 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 504 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 505 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 506 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 507 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 508 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 509 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 510 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 511 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 512 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 513 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 514 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 515 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 516 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 517 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 518 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 519 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 520 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 521 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 522 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 523 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 524 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 525 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 526 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 527 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 528 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 530 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 532 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 533 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 534 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 535 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 536 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 537 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 538 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 539 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 540 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 541 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 542 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 543 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 544 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 545 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 546 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 547 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 548 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 549 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 550 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 551 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 552 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 553 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 554 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 555 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 556 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 557 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 558 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 559 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 560 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 561 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 562 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 563 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 564 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 565 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 566 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 568 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 569 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 570 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 571 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 572 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 573 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 574 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 575 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 576 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 577 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 578 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 579 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 580 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 581 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 582 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 583 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 584 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 585 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 586 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 587 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 588 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 589 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 590 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 591 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 592 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 593 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 594 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 595 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 596 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 597 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 598 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 599 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 601 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 602 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 603 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 604 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 605 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 606 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 607 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 608 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 609 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 610 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 611 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 612 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 613 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 614 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 615 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 616 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 617 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 618 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 619 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 620 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 621 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 622 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 623 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 654 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 656 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 660 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 661 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 662 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 663 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 664 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 665 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 666 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 667 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 668 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 669 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 670 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 671 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 672 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 673 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 674 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 675 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 676 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 677 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 678 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 679 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 680 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 681 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 682 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 683 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 684 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 685 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 686 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 687 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 688 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 689 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 690 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 691 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 692 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 693 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 694 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 695 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 696 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 697 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 698 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 699 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 700 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 701 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 702 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 703 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 704 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 705 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 706 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 707 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 708 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 709 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 743 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 744 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 745 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 746 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 747 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 748 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 749 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 750 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 751 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 752 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 753 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 754 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 755 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 756 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 757 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 758 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 759 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 760 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 761 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 764 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 765 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 766 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 767 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 768 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 769 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 770 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 771 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 772 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 773 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 774 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 775 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 776 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 777 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 778 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 779 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 780 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 781 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 782 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 783 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 784 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 785 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 786 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 787 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 788 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 789 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 790 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 791 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 792 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 793 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 794 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 795 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 796 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 797 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 798 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 799 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 800 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 801 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 802 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 803 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 804 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 805 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 806 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 807 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 808 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 809 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 810 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 811 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 812 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 813 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 814 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 815 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 816 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 817 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 818 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 819 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 820 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 821 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 822 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 823 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 824 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 825 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 826 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 827 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 828 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 829 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 830 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 831 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 832 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 833 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 834 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 835 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 836 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 837 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 838 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 839 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 840 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 841 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 842 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 843 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 844 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 845 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 846 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 847 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 848 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 849 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 850 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 851 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 852 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 853 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 854 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 855 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 856 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 857 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 858 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 859 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 860 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 861 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 862 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 863 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 864 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 865 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 866 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 867 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 868 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 869 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 870 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.64 |
| Metatranscriptomes | 0.16 |
| Isolates | 45.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 17.59 |
| Nodule | 35.42 |
| Rhizoplane | 1.38 |
| Rhizosphere | 32.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10026791 | 3300001979 | Bacteria | 1926 |
| 2 | JGI25155J39150_1000004 | 3300002704 | Bacteria | 269098 |
| 3 | JGI25156J39149_1000014 | 3300002705 | Bacteria | 189257 |
| 4 | JGI25156J39149_1000015 | 3300002705 | Bacteria | 181949 |
| 5 | JGI25162J39368_1001203 | 3300002737 | Bacteria | 15095 |
| 6 | JGI25162J39368_1002942 | 3300002737 | Bacteria | 5755 |
| 7 | JGI25154J39366_1000026 | 3300002738 | Bacteria | 200613 |
| 8 | JGI25158J39367_1000160 | 3300002739 | Bacteria | 16034 |
| 9 | JGI25157J39369_1000005 | 3300002741 | Bacteria | 269089 |
| 10 | JGI25152J39213_1000493 | 3300002773 | Bacteria | 22302 |
| 11 | JGI25152J39213_1000861 | 3300002773 | Bacteria | 14974 |
| 12 | JGI25152J39213_1001207 | 3300002773 | Bacteria | 11855 |
| 13 | JGI25152J39213_1001531 | 3300002773 | Bacteria | 9827 |
| 14 | JGI25152J39213_1002263 | 3300002773 | Bacteria | 7434 |
| 15 | JGI25150J39212_1000355 | 3300002774 | Bacteria | 22476 |
| 16 | JGI25150J39212_1009798 | 3300002774 | Bacteria | 1808 |
| 17 | JGI25150J39212_1013415 | 3300002774 | Bacteria | 1421 |
| 18 | JGI25159J45721_1000242 | 3300002987 | Bacteria | 25793 |
| 19 | JGI25159J45721_1000711 | 3300002987 | Bacteria | 14533 |
| 20 | JGI25151J46595_10000409 | 3300003187 | Bacteria | 44077 |
| 21 | JGI25151J46595_10000946 | 3300003187 | Bacteria | 22420 |
| 22 | JGI25151J46595_10001865 | 3300003187 | Bacteria | 13494 |
| 23 | JGI25151J46595_10004033 | 3300003187 | Bacteria | 7876 |
| 24 | JGI25151J46595_10014430 | 3300003187 | Bacteria | 3520 |
| 25 | JGI25165J46597_1001246 | 3300003214 | Bacteria | 15061 |
| 26 | JGI25165J46597_1002528 | 3300003214 | Bacteria | 5747 |
| 27 | JGI25165J46597_1004993 | 3300003214 | Bacteria | 2662 |
| 28 | JGI25153J46596_10001894 | 3300003215 | Bacteria | 12408 |
| 29 | JGI25153J46596_10007757 | 3300003215 | Bacteria | 5221 |
| 30 | JGI25153J46596_10008884 | 3300003215 | Bacteria | 4743 |
| 31 | JGI25153J46596_10065292 | 3300003215 | Bacteria | 968 |
| 32 | rootL2_10007443 | 3300003322 | Bacteria | 3105 |
| 33 | rootL2_10112950 | 3300003322 | Bacteria | 7748 |
| 34 | rootH1_10078778 | 3300003323 | Bacteria | 1325 |
| 35 | rootH1_10129646 | 3300003323 | Bacteria | 1181 |
| 36 | JGI25160J50197_1000022 | 3300003354 | Bacteria | 201071 |
| 37 | JGI25160J50197_1002301 | 3300003354 | Bacteria | 8957 |
| 38 | JGI25160J50197_1002712 | 3300003354 | Bacteria | 8141 |
| 39 | JGI25161J50226_1000024 | 3300003374 | Bacteria | 152176 |
| 40 | JGI25161J50226_1000206 | 3300003374 | Bacteria | 38371 |
| 41 | JGI25161J50226_1006719 | 3300003374 | Bacteria | 2038 |
| 42 | Ga0055526_1000489 | 3300003771 | Bacteria | 31492 |
| 43 | Ga0055526_1000926 | 3300003771 | Bacteria | 21784 |
| 44 | Ga0055526_1004307 | 3300003771 | Bacteria | 8599 |
| 45 | Ga0055526_1013134 | 3300003771 | Bacteria | 3534 |
| 46 | Ga0055526_1018821 | 3300003771 | Bacteria | 2553 |
| 47 | Ga0055524_1003779 | 3300003775 | Bacteria | 7202 |
| 48 | Ga0055524_1005189 | 3300003775 | Bacteria | 5867 |
| 49 | Ga0055524_1005277 | 3300003775 | Bacteria | 5803 |
| 50 | Ga0055524_1014466 | 3300003775 | Bacteria | 2922 |
| 51 | Ga0055536_1009179 | 3300003781 | Bacteria | 4132 |
| 52 | Ga0055528_1000464 | 3300003790 | Bacteria | 32427 |
| 53 | Ga0055528_1000478 | 3300003790 | Bacteria | 31939 |
| 54 | Ga0055528_1001760 | 3300003790 | Bacteria | 12455 |
| 55 | Ga0055528_1002389 | 3300003790 | Bacteria | 10126 |
| 56 | Ga0055528_1011321 | 3300003790 | Bacteria | 3553 |
| 57 | Ga0055528_1021586 | 3300003790 | Bacteria | 2037 |
| 58 | Ga0055540_1000320 | 3300003792 | Bacteria | 42457 |
| 59 | Ga0055540_1003981 | 3300003792 | Bacteria | 6880 |
| 60 | Ga0058692_1002641 | 3300003856 | Bacteria | 5903 |
| 61 | Ga0058692_1007147 | 3300003856 | Bacteria | 2991 |
| 62 | Ga0055543_1000025 | 3300004625 | Bacteria | 137886 |
| 63 | Ga0055543_1000248 | 3300004625 | Bacteria | 41302 |
| 64 | Ga0055543_1002104 | 3300004625 | Bacteria | 6913 |
| 65 | Ga0065165_1000200 | 3300005262 | Bacteria | 103564 |
| 66 | Ga0065165_1001128 | 3300005262 | Bacteria | 31425 |
| 67 | Ga0065165_1001369 | 3300005262 | Bacteria | 26829 |
| 68 | Ga0065165_1006963 | 3300005262 | Bacteria | 5725 |
| 69 | Ga0065165_1035870 | 3300005262 | Bacteria | 1518 |
| 70 | Ga0065704_10166279 | 3300005289 | Bacteria | 1320 |
| 71 | Ga0070658_10086291 | 3300005327 | Bacteria | 2582 |
| 72 | Ga0070658_10297277 | 3300005327 | Bacteria | 1376 |
| 73 | Ga0070658_10495653 | 3300005327 | Bacteria | 1055 |
| 74 | Ga0070658_10669075 | 3300005327 | Bacteria | 901 |
| 75 | Ga0070666_10137792 | 3300005335 | Bacteria | 1699 |
| 76 | Ga0070682_100111494 | 3300005337 | Bacteria | 1824 |
| 77 | Ga0068868_100461933 | 3300005338 | Bacteria | 1106 |
| 78 | Ga0070660_100001762 | 3300005339 | Bacteria | 14850 |
| 79 | Ga0070668_100007262 | 3300005347 | Bacteria | 8215 |
| 80 | Ga0070668_100031244 | 3300005347 | Bacteria | 4051 |
| 81 | Ga0070668_100046535 | 3300005347 | Bacteria | 3332 |
| 82 | Ga0070669_100036316 | 3300005353 | Bacteria | 3570 |
| 83 | Ga0070669_100451166 | 3300005353 | Bacteria | 1060 |
| 84 | Ga0070671_100017417 | 3300005355 | Bacteria | 5819 |
| 85 | Ga0070671_100057348 | 3300005355 | Bacteria | 3240 |
| 86 | Ga0070673_100436412 | 3300005364 | Bacteria | 1176 |
| 87 | Ga0070659_100256225 | 3300005366 | Bacteria | 1451 |
| 88 | Ga0070667_100300329 | 3300005367 | Bacteria | 1446 |
| 89 | Ga0070714_100356364 | 3300005435 | Bacteria | 1375 |
| 90 | Ga0070710_10000347 | 3300005437 | Bacteria | 22041 |
| 91 | Ga0070663_100076567 | 3300005455 | Bacteria | 2447 |
| 92 | Ga0070678_100282533 | 3300005456 | Bacteria | 1404 |
| 93 | Ga0070679_100174329 | 3300005530 | Bacteria | 2123 |
| 94 | Ga0070679_100314869 | 3300005530 | Bacteria | 1515 |
| 95 | Ga0068853_100000565 | 3300005539 | Bacteria | 25355 |
| 96 | Ga0068853_100133742 | 3300005539 | Bacteria | 2222 |
| 97 | Ga0070672_100340495 | 3300005543 | Bacteria | 1277 |
| 98 | Ga0070665_100002585 | 3300005548 | Bacteria | 19803 |
| 99 | Ga0070665_100250452 | 3300005548 | Bacteria | 1772 |
| 100 | Ga0070665_100264906 | 3300005548 | Bacteria | 1720 |
| 101 | Ga0068855_100174023 | 3300005563 | Bacteria | 2437 |
| 102 | Ga0068855_100174184 | 3300005563 | Bacteria | 2435 |
| 103 | Ga0068855_100412760 | 3300005563 | Bacteria | 1478 |
| 104 | Ga0068857_100523358 | 3300005577 | Bacteria | 1115 |
| 105 | Ga0068854_100064409 | 3300005578 | Bacteria | 2663 |
| 106 | Ga0068856_100008285 | 3300005614 | Bacteria | 10132 |
| 107 | Ga0068852_100002107 | 3300005616 | Bacteria | 13607 |
| 108 | Ga0068852_100693968 | 3300005616 | Bacteria | 1028 |
| 109 | Ga0068864_100629438 | 3300005618 | Bacteria | 1043 |
| 110 | Ga0068858_100113296 | 3300005842 | Bacteria | 2533 |
| 111 | Ga0068862_100436295 | 3300005844 | Bacteria | 1232 |
| 112 | Ga0068862_100459150 | 3300005844 | Bacteria | 1202 |
| 113 | Ga0081455_10331566 | 3300005937 | Bacteria | 1080 |
| 114 | Ga0081540_1024832 | 3300005983 | Bacteria | 3467 |
| 115 | Ga0075365_10001348 | 3300006038 | Bacteria | 11002 |
| 116 | Ga0075365_10002567 | 3300006038 | Bacteria | 8967 |
| 117 | Ga0075365_10004465 | 3300006038 | Bacteria | 7415 |
| 118 | Ga0075365_10019507 | 3300006038 | Bacteria | 4187 |
| 119 | Ga0075363_100017783 | 3300006048 | Bacteria | 3531 |
| 120 | Ga0075363_100085685 | 3300006048 | Bacteria | 1729 |
| 121 | Ga0075364_10019248 | 3300006051 | Bacteria | 4283 |
| 122 | Ga0075364_10023714 | 3300006051 | Bacteria | 3887 |
| 123 | Ga0075364_10030856 | 3300006051 | Bacteria | 3442 |
| 124 | Ga0075364_10075249 | 3300006051 | Bacteria | 2228 |
| 125 | Ga0075362_10010334 | 3300006177 | Bacteria | 3642 |
| 126 | Ga0075362_10024045 | 3300006177 | Bacteria | 2582 |
| 127 | Ga0075362_10024504 | 3300006177 | Bacteria | 2560 |
| 128 | Ga0075362_10064807 | 3300006177 | Bacteria | 1658 |
| 129 | Ga0075367_10001293 | 3300006178 | Bacteria | 10595 |
| 130 | Ga0075367_10005583 | 3300006178 | Bacteria | 6265 |
| 131 | Ga0075367_10031396 | 3300006178 | Bacteria | 3050 |
| 132 | Ga0075367_10052945 | 3300006178 | Bacteria | 2404 |
| 133 | Ga0075369_10005102 | 3300006186 | Bacteria | 4890 |
| 134 | Ga0075369_10008926 | 3300006186 | Bacteria | 3878 |
| 135 | Ga0075369_10016107 | 3300006186 | Bacteria | 3010 |
| 136 | Ga0075369_10021032 | 3300006186 | Bacteria | 2677 |
| 137 | Ga0075369_10047809 | 3300006186 | Bacteria | 1845 |
| 138 | Ga0075369_10130850 | 3300006186 | Bacteria | 1140 |
| 139 | Ga0075366_10121241 | 3300006195 | Bacteria | 1576 |
| 140 | Ga0075370_10003397 | 3300006353 | Bacteria | 7569 |
| 141 | Ga0075370_10010473 | 3300006353 | Bacteria | 4848 |
| 142 | Ga0075370_10230185 | 3300006353 | Bacteria | 1097 |
| 143 | Ga0075428_100007760 | 3300006844 | Bacteria | 11891 |
| 144 | Ga0075428_100008766 | 3300006844 | Bacteria | 11220 |
| 145 | Ga0075428_100015954 | 3300006844 | Bacteria | 8312 |
| 146 | Ga0075430_100004866 | 3300006846 | Bacteria | 11302 |
| 147 | Ga0075430_100013807 | 3300006846 | Bacteria | 6882 |
| 148 | Ga0075430_100149217 | 3300006846 | Bacteria | 1947 |
| 149 | Ga0075431_100013114 | 3300006847 | Bacteria | 8375 |
| 150 | Ga0075431_100187367 | 3300006847 | Bacteria | 2121 |
| 151 | Ga0075429_100014301 | 3300006880 | Bacteria | 6882 |
| 152 | Ga0075429_100120586 | 3300006880 | Bacteria | 2292 |
| 153 | Ga0099826_10000040 | 3300006948 | Bacteria | 98176 |
| 154 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 155 | Ga0105240_10007818 | 3300009093 | Bacteria | 15442 |
| 156 | Ga0105240_10139857 | 3300009093 | Bacteria | 2895 |
| 157 | Ga0105247_10009605 | 3300009101 | Bacteria | 5871 |
| 158 | Ga0114129_10004136 | 3300009147 | Bacteria | 20497 |
| 159 | Ga0114129_10006996 | 3300009147 | Bacteria | 16060 |
| 160 | Ga0114129_10069404 | 3300009147 | Bacteria | 4912 |
| 161 | Ga0114129_10172676 | 3300009147 | Bacteria | 2946 |
| 162 | Ga0105243_10028578 | 3300009148 | Bacteria | 4281 |
| 163 | Ga0105243_10072373 | 3300009148 | Bacteria | 2790 |
| 164 | Ga0105243_10133392 | 3300009148 | Bacteria | 2110 |
| 165 | Ga0105243_10400584 | 3300009148 | Bacteria | 1275 |
| 166 | Ga0105241_10049194 | 3300009174 | Bacteria | 3210 |
| 167 | Ga0105241_10062149 | 3300009174 | Bacteria | 2878 |
| 168 | Ga0105248_10009144 | 3300009177 | Bacteria | 10897 |
| 169 | Ga0105248_10081859 | 3300009177 | Bacteria | 3629 |
| 170 | Ga0105237_10000071 | 3300009545 | Bacteria | 135695 |
| 171 | Ga0105237_10002420 | 3300009545 | Bacteria | 23173 |
| 172 | Ga0105237_10010647 | 3300009545 | Bacteria | 9772 |
| 173 | Ga0105237_10016814 | 3300009545 | Bacteria | 7593 |
| 174 | Ga0105237_10376657 | 3300009545 | Bacteria | 1424 |
| 175 | Ga0105238_10051937 | 3300009551 | Bacteria | 4122 |
| 176 | Ga0105249_10082542 | 3300009553 | Bacteria | 2991 |
| 177 | Ga0123341_1000097 | 3300009765 | Bacteria | 37335 |
| 178 | Ga0123342_1020788 | 3300009766 | Bacteria | 4728 |
| 179 | Ga0105035_100701 | 3300009988 | Bacteria | 2095 |
| 180 | Ga0105028_109017 | 3300009993 | Bacteria | 1044 |
| 181 | Ga0105239_10001189 | 3300010375 | Bacteria | 35605 |
| 182 | Ga0105239_10388041 | 3300010375 | Bacteria | 1579 |
| 183 | Ga0105239_10430728 | 3300010375 | Bacteria | 1495 |
| 184 | Ga0105246_10080022 | 3300011119 | Bacteria | 2325 |
| 185 | Ga0105246_10248696 | 3300011119 | Bacteria | 1410 |
| 186 | Ga0157326_1006039 | 3300012513 | Bacteria | 1289 |
| 187 | Ga0157373_10111877 | 3300013100 | Bacteria | 1920 |
| 188 | Ga0157371_10000042 | 3300013102 | Bacteria | 198938 |
| 189 | Ga0157370_10000035 | 3300013104 | Bacteria | 137103 |
| 190 | Ga0157370_10003431 | 3300013104 | Bacteria | 18611 |
| 191 | Ga0157369_10064646 | 3300013105 | Bacteria | 3939 |
| 192 | Ga0157369_10098498 | 3300013105 | Bacteria | 3118 |
| 193 | Ga0157369_10234860 | 3300013105 | Bacteria | 1916 |
| 194 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 195 | Ga0171462_1067 | 3300013250 | Bacteria | 13661 |
| 196 | Ga0157374_10040993 | 3300013296 | Bacteria | 4264 |
| 197 | Ga0157374_10118195 | 3300013296 | Bacteria | 2556 |
| 198 | Ga0163163_10028230 | 3300014325 | Bacteria | 5386 |
| 199 | Ga0157380_10185827 | 3300014326 | Bacteria | 1830 |
| 200 | Ga0157376_10293960 | 3300014969 | Bacteria | 1535 |
| 201 | Ga0182007_10006551 | 3300015262 | Bacteria | 4991 |
| 202 | Ga0182005_1001647 | 3300015265 | Bacteria | 8685 |
| 203 | Ga0183363_1046 | 3300015690 | Bacteria | 40582 |
| 204 | Ga0214544_1000771 | 3300021320 | Bacteria | 61917 |
| 205 | Ga0214542_1000032 | 3300021321 | Bacteria | 171690 |
| 206 | Ga0214542_1021618 | 3300021321 | Bacteria | 4352 |
| 207 | Ga0214543_1000016 | 3300021327 | Bacteria | 295257 |
| 208 | Ga0214543_1009269 | 3300021327 | Bacteria | 15462 |
| 209 | Ga0228711_1000006 | 3300022739 | Bacteria | 202437 |
| 210 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 211 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 212 | Ga0209436_100127 | 3300025208 | Bacteria | 37528 |
| 213 | Ga0209672_102531 | 3300025228 | Bacteria | 4406 |
| 214 | Ga0207427_103104 | 3300025231 | Bacteria | 3742 |
| 215 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 216 | Ga0209437_100772 | 3300025233 | Bacteria | 15151 |
| 217 | Ga0207425_1000052 | 3300025245 | Bacteria | 162123 |
| 218 | Ga0207425_1012086 | 3300025245 | Bacteria | 2036 |
| 219 | Ga0207425_1017797 | 3300025245 | Bacteria | 1553 |
| 220 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 221 | Ga0209646_1010000 | 3300025246 | Bacteria | 1494 |
| 222 | Ga0209026_1000043 | 3300025250 | Bacteria | 269142 |
| 223 | Ga0209677_100426 | 3300025253 | Bacteria | 25046 |
| 224 | Ga0209148_1000305 | 3300025254 | Bacteria | 70375 |
| 225 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 226 | Ga0209759_1020957 | 3300025256 | Bacteria | 1503 |
| 227 | Ga0209129_1000141 | 3300025258 | Bacteria | 119150 |
| 228 | Ga0209129_1000312 | 3300025258 | Bacteria | 43311 |
| 229 | Ga0209129_1000357 | 3300025258 | Bacteria | 38204 |
| 230 | Ga0209129_1001779 | 3300025258 | Bacteria | 11495 |
| 231 | Ga0209129_1004734 | 3300025258 | Bacteria | 5161 |
| 232 | Ga0209129_1011981 | 3300025258 | Bacteria | 2029 |
| 233 | Ga0209129_1011984 | 3300025258 | Bacteria | 2028 |
| 234 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 235 | Ga0209233_1000255 | 3300025261 | Bacteria | 82230 |
| 236 | Ga0209233_1000290 | 3300025261 | Bacteria | 64394 |
| 237 | Ga0209233_1000332 | 3300025261 | Bacteria | 48225 |
| 238 | Ga0209233_1004820 | 3300025261 | Bacteria | 4543 |
| 239 | Ga0209455_1006533 | 3300025272 | Bacteria | 3427 |
| 240 | Ga0209673_1000584 | 3300025273 | Bacteria | 57616 |
| 241 | Ga0209673_1000616 | 3300025273 | Bacteria | 54474 |
| 242 | Ga0209673_1000890 | 3300025273 | Bacteria | 38476 |
| 243 | Ga0209673_1001948 | 3300025273 | Bacteria | 16219 |
| 244 | Ga0209673_1002261 | 3300025273 | Bacteria | 13869 |
| 245 | Ga0209673_1002508 | 3300025273 | Bacteria | 12618 |
| 246 | Ga0209673_1002576 | 3300025273 | Bacteria | 12296 |
| 247 | Ga0209673_1004618 | 3300025273 | Bacteria | 7295 |
| 248 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 249 | Ga0209130_1000164 | 3300025284 | Bacteria | 97595 |
| 250 | Ga0209130_1000830 | 3300025284 | Bacteria | 25965 |
| 251 | Ga0209130_1006186 | 3300025284 | Bacteria | 3939 |
| 252 | Ga0209676_1000097 | 3300025292 | Bacteria | 237203 |
| 253 | Ga0209676_1000256 | 3300025292 | Bacteria | 112819 |
| 254 | Ga0209025_1000144 | 3300025294 | Bacteria | 181446 |
| 255 | Ga0209025_1000374 | 3300025294 | Bacteria | 93607 |
| 256 | Ga0209025_1000857 | 3300025294 | Bacteria | 48082 |
| 257 | Ga0209025_1001024 | 3300025294 | Bacteria | 41149 |
| 258 | Ga0209025_1001822 | 3300025294 | Bacteria | 25091 |
| 259 | Ga0209025_1006010 | 3300025294 | Bacteria | 9634 |
| 260 | Ga0209025_1021041 | 3300025294 | Bacteria | 3534 |
| 261 | Ga0209025_1047953 | 3300025294 | Bacteria | 1738 |
| 262 | Ga0209025_1053412 | 3300025294 | Bacteria | 1585 |
| 263 | Ga0209025_1066981 | 3300025294 | Bacteria | 1300 |
| 264 | Ga0209564_1000900 | 3300025295 | Bacteria | 39003 |
| 265 | Ga0209564_1000914 | 3300025295 | Bacteria | 38607 |
| 266 | Ga0209564_1001996 | 3300025295 | Bacteria | 17840 |
| 267 | Ga0209564_1008825 | 3300025295 | Bacteria | 4906 |
| 268 | Ga0209564_1011645 | 3300025295 | Bacteria | 3917 |
| 269 | Ga0209564_1018123 | 3300025295 | Bacteria | 2703 |
| 270 | Ga0209564_1030026 | 3300025295 | Bacteria | 1694 |
| 271 | Ga0209758_1000229 | 3300025297 | Bacteria | 119657 |
| 272 | Ga0209758_1000744 | 3300025297 | Bacteria | 47380 |
| 273 | Ga0209758_1001147 | 3300025297 | Bacteria | 33967 |
| 274 | Ga0209758_1001197 | 3300025297 | Bacteria | 32795 |
| 275 | Ga0209758_1001885 | 3300025297 | Bacteria | 22881 |
| 276 | Ga0209758_1002066 | 3300025297 | Bacteria | 21435 |
| 277 | Ga0209758_1002485 | 3300025297 | Bacteria | 18743 |
| 278 | Ga0209758_1003392 | 3300025297 | Bacteria | 14554 |
| 279 | Ga0209050_1005209 | 3300025298 | Bacteria | 8312 |
| 280 | Ga0209050_1019700 | 3300025298 | Bacteria | 2548 |
| 281 | Ga0209256_1000260 | 3300025299 | Bacteria | 93956 |
| 282 | Ga0209256_1000739 | 3300025299 | Bacteria | 42871 |
| 283 | Ga0209256_1001392 | 3300025299 | Bacteria | 25218 |
| 284 | Ga0209256_1001817 | 3300025299 | Bacteria | 20042 |
| 285 | Ga0209256_1005354 | 3300025299 | Bacteria | 7432 |
| 286 | Ga0209256_1007001 | 3300025299 | Bacteria | 5731 |
| 287 | Ga0209256_1014775 | 3300025299 | Bacteria | 2779 |
| 288 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 289 | Ga0207426_1000082 | 3300025302 | Bacteria | 298939 |
| 290 | Ga0207426_1000287 | 3300025302 | Bacteria | 100566 |
| 291 | Ga0207426_1000812 | 3300025302 | Bacteria | 33529 |
| 292 | Ga0207426_1001778 | 3300025302 | Bacteria | 16206 |
| 293 | Ga0209051_1000195 | 3300025303 | Bacteria | 107201 |
| 294 | Ga0209051_1002486 | 3300025303 | Bacteria | 13148 |
| 295 | Ga0209051_1003965 | 3300025303 | Bacteria | 9419 |
| 296 | Ga0209051_1007413 | 3300025303 | Bacteria | 5998 |
| 297 | Ga0209051_1061436 | 3300025303 | Bacteria | 1180 |
| 298 | Ga0209257_1004297 | 3300025304 | Bacteria | 11202 |
| 299 | Ga0209257_1007822 | 3300025304 | Bacteria | 6326 |
| 300 | Ga0209257_1011479 | 3300025304 | Bacteria | 4260 |
| 301 | Ga0209257_1014939 | 3300025304 | Bacteria | 3282 |
| 302 | Ga0207697_10035302 | 3300025315 | Bacteria | 2046 |
| 303 | Ga0207692_10001908 | 3300025898 | Bacteria | 7931 |
| 304 | Ga0207688_10010706 | 3300025901 | Bacteria | 4991 |
| 305 | Ga0207680_10194829 | 3300025903 | Bacteria | 1378 |
| 306 | Ga0207647_10019341 | 3300025904 | Bacteria | 4582 |
| 307 | Ga0207647_10143634 | 3300025904 | Bacteria | 1398 |
| 308 | Ga0207705_10002602 | 3300025909 | Bacteria | 13868 |
| 309 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 310 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 311 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 312 | Ga0207671_10000099 | 3300025914 | Bacteria | 132378 |
| 313 | Ga0207671_10005950 | 3300025914 | Bacteria | 11056 |
| 314 | Ga0207671_10392991 | 3300025914 | Bacteria | 1103 |
| 315 | Ga0207657_10003030 | 3300025919 | Bacteria | 17989 |
| 316 | Ga0207681_10423472 | 3300025923 | Bacteria | 1079 |
| 317 | Ga0207681_10445926 | 3300025923 | Bacteria | 1052 |
| 318 | Ga0207664_10112941 | 3300025929 | Bacteria | 2262 |
| 319 | Ga0207644_10028013 | 3300025931 | Bacteria | 3896 |
| 320 | Ga0207644_10194257 | 3300025931 | Bacteria | 1597 |
| 321 | Ga0207706_10236571 | 3300025933 | Bacteria | 1597 |
| 322 | Ga0207709_10118553 | 3300025935 | Bacteria | 1783 |
| 323 | Ga0207691_10313136 | 3300025940 | Bacteria | 1347 |
| 324 | Ga0207711_10037909 | 3300025941 | Bacteria | 4097 |
| 325 | Ga0207667_10032885 | 3300025949 | Bacteria | 5582 |
| 326 | Ga0207651_10381920 | 3300025960 | Bacteria | 1194 |
| 327 | Ga0207668_10007860 | 3300025972 | Bacteria | 6340 |
| 328 | Ga0207668_10035197 | 3300025972 | Bacteria | 3332 |
| 329 | Ga0207668_10224012 | 3300025972 | Bacteria | 1512 |
| 330 | Ga0207640_10050225 | 3300025981 | Bacteria | 2704 |
| 331 | Ga0207658_10162608 | 3300025986 | Bacteria | 1831 |
| 332 | Ga0207677_10298518 | 3300026023 | Bacteria | 1330 |
| 333 | Ga0207703_10048242 | 3300026035 | Bacteria | 3437 |
| 334 | Ga0207678_10000459 | 3300026067 | Bacteria | 36973 |
| 335 | Ga0207678_10040377 | 3300026067 | Bacteria | 4048 |
| 336 | Ga0207678_10046776 | 3300026067 | Bacteria | 3742 |
| 337 | Ga0207678_10105168 | 3300026067 | Bacteria | 2408 |
| 338 | Ga0207708_10125570 | 3300026075 | Bacteria | 2002 |
| 339 | Ga0207702_10006190 | 3300026078 | Bacteria | 10352 |
| 340 | Ga0207641_10284022 | 3300026088 | Bacteria | 1558 |
| 341 | Ga0207676_10360053 | 3300026095 | Bacteria | 1348 |
| 342 | Ga0207674_10052495 | 3300026116 | Bacteria | 4158 |
| 343 | Ga0207698_10332056 | 3300026142 | Bacteria | 1428 |
| 344 | Ga0209281_1000102 | 3300027111 | Bacteria | 221665 |
| 345 | Ga0209281_1000563 | 3300027111 | Bacteria | 44757 |
| 346 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 347 | Ga0209371_1000998 | 3300027312 | Bacteria | 21742 |
| 348 | Ga0209371_1001347 | 3300027312 | Bacteria | 17020 |
| 349 | Ga0209282_1000013 | 3300027666 | Bacteria | 215053 |
| 350 | Ga0209282_1000150 | 3300027666 | Bacteria | 41053 |
| 351 | Ga0209974_10036341 | 3300027876 | Bacteria | 1636 |
| 352 | Ga0268266_10000391 | 3300028379 | Bacteria | 66400 |
| 353 | Ga0268266_10002425 | 3300028379 | Bacteria | 20076 |
| 354 | Ga0268265_10374449 | 3300028380 | Bacteria | 1308 |
| 355 | Ga0307517_10013188 | 3300028786 | Bacteria | 11254 |
| 356 | Ga0307515_10004240 | 3300028794 | Bacteria | 29769 |
| 357 | Ga0307515_10025103 | 3300028794 | Bacteria | 10334 |
| 358 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 359 | Ga0268256_1001200 | 3300030500 | Bacteria | 16565 |
| 360 | Ga0268256_1002297 | 3300030500 | Bacteria | 9909 |
| 361 | Ga0268256_1029509 | 3300030500 | Bacteria | 1341 |
| 362 | Ga0307512_10092747 | 3300030522 | Bacteria | 2093 |
| 363 | Ga0316177_1124381 | 3300030731 | Bacteria | 5146 |
| 364 | Ga0314311_1040023 | 3300030733 | Bacteria | 7981 |
| 365 | Ga0316182_1202552 | 3300030745 | Bacteria | 1586 |
| 366 | Ga0307513_10081852 | 3300031456 | Bacteria | 3325 |
| 367 | Ga0307509_10105576 | 3300031507 | Bacteria | 2838 |
| 368 | Ga0307408_100291335 | 3300031548 | Bacteria | 1363 |
| 369 | Ga0307408_100361291 | 3300031548 | Bacteria | 1235 |
| 370 | Ga0307408_100411623 | 3300031548 | Bacteria | 1164 |
| 371 | Ga0307508_10017913 | 3300031616 | Bacteria | 6436 |
| 372 | Ga0307514_10023355 | 3300031649 | Bacteria | 5018 |
| 373 | Ga0307516_10028576 | 3300031730 | Bacteria | 5642 |
| 374 | Ga0307405_10000651 | 3300031731 | Bacteria | 13391 |
| 375 | Ga0307405_10001743 | 3300031731 | Bacteria | 9291 |
| 376 | Ga0307405_10331739 | 3300031731 | Bacteria | 1166 |
| 377 | Ga0307413_10030735 | 3300031824 | Bacteria | 3020 |
| 378 | Ga0307410_10145161 | 3300031852 | Bacteria | 1760 |
| 379 | Ga0307406_10010585 | 3300031901 | Bacteria | 5206 |
| 380 | Ga0307406_10050209 | 3300031901 | Bacteria | 2643 |
| 381 | Ga0307406_10191622 | 3300031901 | Bacteria | 1497 |
| 382 | Ga0307407_10063534 | 3300031903 | Bacteria | 2166 |
| 383 | Ga0307412_10001987 | 3300031911 | Bacteria | 11320 |
| 384 | Ga0307412_10031012 | 3300031911 | Bacteria | 3372 |
| 385 | Ga0307412_10324270 | 3300031911 | Bacteria | 1227 |
| 386 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 387 | Ga0307409_100000181 | 3300031995 | Bacteria | 24481 |
| 388 | Ga0307409_100064948 | 3300031995 | Bacteria | 2869 |
| 389 | Ga0307409_100220145 | 3300031995 | Bacteria | 1713 |
| 390 | Ga0307416_100011847 | 3300032002 | Bacteria | 5844 |
| 391 | Ga0307414_10127305 | 3300032004 | Bacteria | 1970 |
| 392 | Ga0307414_10619725 | 3300032004 | Bacteria | 972 |
| 393 | Ga0307411_10008197 | 3300032005 | Bacteria | 5393 |
| 394 | Ga0307411_10267341 | 3300032005 | Bacteria | 1354 |
| 395 | Ga0307411_10300107 | 3300032005 | Bacteria | 1288 |
| 396 | Ga0307415_100000148 | 3300032126 | Bacteria | 31023 |
| 397 | Ga0307415_100034769 | 3300032126 | Bacteria | 3285 |
| 398 | Ga0307507_10027619 | 3300033179 | Bacteria | 6077 |
| 399 | Ga0307510_10081429 | 3300033180 | Bacteria | 3139 |
| 400 | Ga0307510_10100597 | 3300033180 | Bacteria | 2683 |
| 401 | Ga0315913_1000055 | 3300033430 | Bacteria | 58182 |
| 402 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 403 | Ga0316212_1007769 | 3300033547 | Bacteria | 1548 |
| 404 | Ga0395899_0048208 | 3300037312 | Bacteria | 3171 |
| 405 | Ga0395898_0095647 | 3300037466 | Bacteria | 2854 |
| 406 | Ga0395901_0101100 | 3300038443 | Bacteria | 3025 |
| 407 | Ga0436360_0070791 | 3300039438 | Bacteria | 2255 |
| 408 | Ga0436360_1011386 | 3300039438 | Bacteria | 1752 |
| 409 | Ga0439436_0030841 | 3300041404 | Bacteria | 1557 |
| 410 | Ga0439465_0008671 | 3300041413 | Bacteria | 3206 |
| 411 | Ga0439465_0023002 | 3300041413 | Bacteria | 1960 |
| 412 | Ga0439465_0117235 | 3300041413 | Bacteria | 931 |
| 413 | Ga0451802_1411238 | 3300041460 | Bacteria | 1556 |
| 414 | Ga0451845_0333885 | 3300041501 | Bacteria | 4304 |
| 415 | Ga0451851_0470152 | 3300041507 | Bacteria | 1513 |
| 416 | Ga0451843_0046155 | 3300041509 | Bacteria | 2275 |
| 417 | Ga0451853_3055762 | 3300041512 | Bacteria | 3202 |
| 418 | Ga0439445_0027998 | 3300042004 | Bacteria | 1451 |
| 419 | Ga0439449_0001583 | 3300042007 | Bacteria | 8928 |
| 420 | Ga0439449_0031779 | 3300042007 | Bacteria | 1968 |
| 421 | Ga0439449_0035952 | 3300042007 | Bacteria | 1843 |
| 422 | Ga0466972_0001921 | 3300044658 | Bacteria | 10193 |
| 423 | Ga0466972_0002978 | 3300044658 | Bacteria | 8382 |
| 424 | Ga0466972_0052262 | 3300044658 | Bacteria | 1970 |
| 425 | Ga0466965_0002969 | 3300044683 | Bacteria | 7348 |
| 426 | Ga0466965_0028214 | 3300044683 | Bacteria | 2726 |
| 427 | Ga0466965_0104737 | 3300044683 | Bacteria | 1449 |
| 428 | Ga0466968_0051109 | 3300044735 | Bacteria | 1765 |
| 429 | Ga0466970_0064151 | 3300044765 | Bacteria | 1969 |
| 430 | Ga0466957_0074802 | 3300044842 | Bacteria | 2101 |
| 431 | Ga0466957_0320856 | 3300044842 | Bacteria | 1045 |
| 432 | Ga0466960_0018879 | 3300044901 | Bacteria | 3028 |
| 433 | Ga0466960_0020911 | 3300044901 | Bacteria | 2906 |
| 434 | Ga0451576_0146143 | 3300045051 | Bacteria | 2465 |
| 435 | Ga0495617_031549 | 3300046452 | Bacteria | 1779 |
| 436 | Ga0495638_0000393 | 3300046460 | Bacteria | 53859 |
| 437 | Ga0495605_0000832 | 3300046474 | Bacteria | 21775 |
| 438 | Ga0495605_0128552 | 3300046474 | Bacteria | 1144 |
| 439 | Ga0495662_0015516 | 3300046476 | Bacteria | 3697 |
| 440 | Ga0495585_0018147 | 3300046492 | Bacteria | 4061 |
| 441 | Ga0495607_0210175 | 3300046501 | Bacteria | 958 |
| 442 | Ga0495583_0007210 | 3300046506 | Bacteria | 7050 |
| 443 | Ga0495583_0091327 | 3300046506 | Bacteria | 1310 |
| 444 | Ga0495606_0001613 | 3300046507 | Bacteria | 29410 |
| 445 | Ga0495606_0017853 | 3300046507 | Bacteria | 5343 |
| 446 | Ga0495606_0018190 | 3300046507 | Bacteria | 5280 |
| 447 | Ga0495606_0094411 | 3300046507 | Bacteria | 1833 |
| 448 | Ga0495610_0004797 | 3300046512 | Bacteria | 9868 |
| 449 | Ga0495610_0006514 | 3300046512 | Bacteria | 8009 |
| 450 | Ga0495610_0017073 | 3300046512 | Bacteria | 4150 |
| 451 | Ga0495610_0033794 | 3300046512 | Bacteria | 2640 |
| 452 | Ga0495616_0007526 | 3300046513 | Bacteria | 6519 |
| 453 | Ga0495620_0000419 | 3300046515 | Bacteria | 28341 |
| 454 | Ga0495620_0035733 | 3300046515 | Bacteria | 2230 |
| 455 | Ga0495631_0002319 | 3300046518 | Bacteria | 10844 |
| 456 | Ga0495643_0008514 | 3300046522 | Bacteria | 6483 |
| 457 | Ga0495643_0035802 | 3300046522 | Bacteria | 2731 |
| 458 | Ga0495643_0049454 | 3300046522 | Bacteria | 2267 |
| 459 | Ga0495643_0166468 | 3300046522 | Bacteria | 1081 |
| 460 | Ga0495648_0043505 | 3300046524 | Bacteria | 2814 |
| 461 | Ga0495652_0146768 | 3300046529 | Bacteria | 1848 |
| 462 | Ga0495609_0207207 | 3300046538 | Bacteria | 818 |
| 463 | Ga0495597_0009339 | 3300046542 | Bacteria | 4850 |
| 464 | Ga0495597_0019632 | 3300046542 | Bacteria | 3159 |
| 465 | Ga0495597_0039884 | 3300046542 | Bacteria | 2100 |
| 466 | Ga0495645_0018535 | 3300046543 | Bacteria | 5001 |
| 467 | Ga0495625_0001497 | 3300046660 | Bacteria | 28081 |
| 468 | Ga0495625_0065711 | 3300046660 | Bacteria | 2556 |
| 469 | Ga0495625_0068313 | 3300046660 | Bacteria | 2499 |
| 470 | Ga0495625_0110100 | 3300046660 | Bacteria | 1883 |
| 471 | Ga0495588_0181501 | 3300046674 | Bacteria | 1112 |
| 472 | Ga0495624_0151270 | 3300046690 | Bacteria | 1420 |
| 473 | Ga0495670_0014187 | 3300046691 | Bacteria | 3921 |
| 474 | Ga0495670_0027101 | 3300046691 | Bacteria | 2837 |
| 475 | Ga0495670_0247397 | 3300046691 | Bacteria | 950 |
| 476 | Ga0495649_0004007 | 3300046694 | Bacteria | 9708 |
| 477 | Ga0495589_0078012 | 3300046794 | Bacteria | 1613 |
| 478 | Ga0495660_0042753 | 3300046810 | Bacteria | 2502 |
| 479 | Ga0495604_0025521 | 3300047317 | Bacteria | 4709 |
| 480 | Ga0495604_0054994 | 3300047317 | Bacteria | 3069 |
| 481 | Ga0495636_0001079 | 3300047318 | Bacteria | 10250 |
| 482 | Ga0495672_0028222 | 3300047320 | Bacteria | 3553 |
| 483 | Ga0495683_0002213 | 3300047323 | Bacteria | 11897 |
| 484 | Ga0495687_004605 | 3300047443 | Bacteria | 9213 |
| 485 | Ga0495687_009007 | 3300047443 | Bacteria | 5637 |
| 486 | Ga0495687_015362 | 3300047443 | Bacteria | 3897 |
| 487 | Ga0495687_105285 | 3300047443 | Bacteria | 1049 |
| 488 | Ga0495685_018992 | 3300047447 | Bacteria | 2360 |
| 489 | Ga0495681_0004413 | 3300047470 | Bacteria | 9606 |
| 490 | Ga0495686_0013754 | 3300047472 | Bacteria | 5606 |
| 491 | Ga0495686_0017404 | 3300047472 | Bacteria | 4845 |
| 492 | Ga0496102_0033995 | 3300048905 | Bacteria | 4585 |
| 493 | Ga0496102_0041920 | 3300048905 | Bacteria | 4147 |
| 494 | Ga0496103_0025893 | 3300048906 | Bacteria | 3548 |
| 495 | Ga0496104_0041056 | 3300048907 | Bacteria | 4337 |
| 496 | Ga0496104_0167520 | 3300048907 | Bacteria | 2107 |
| 497 | Ga0496105_0006351 | 3300048908 | Bacteria | 9079 |
| 498 | Ga0496105_0117903 | 3300048908 | Bacteria | 2189 |
| 499 | Ga0496106_0000490 | 3300048909 | Bacteria | 28105 |
| 500 | Ga0496109_0243689 | 3300048912 | Bacteria | 1692 |
| 501 | Ga0496111_0533464 | 3300048914 | Bacteria | 862 |
| 502 | Ga0496113_0572367 | 3300048916 | Bacteria | 905 |
| 503 | Ga0496116_0001183 | 3300048919 | Bacteria | 30639 |
| 504 | Ga0496116_0042278 | 3300048919 | Bacteria | 3117 |
| 505 | Ga0496116_0068890 | 3300048919 | Bacteria | 2252 |
| 506 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 507 | Ga0496117_0012929 | 3300048920 | Bacteria | 7315 |
| 508 | Ga0496118_0002329 | 3300048921 | Bacteria | 25761 |
| 509 | Ga0496118_0027736 | 3300048921 | Bacteria | 4784 |
| 510 | Ga0496118_0028305 | 3300048921 | Bacteria | 4723 |
| 511 | Ga0496118_0043304 | 3300048921 | Bacteria | 3541 |
| 512 | Ga0496118_0049355 | 3300048921 | Bacteria | 3242 |
| 513 | Ga0496118_0067101 | 3300048921 | Bacteria | 2615 |
| 514 | Ga0496118_0083178 | 3300048921 | Bacteria | 2239 |
| 515 | Ga0496119_0016153 | 3300048922 | Bacteria | 5701 |
| 516 | Ga0496119_0036900 | 3300048922 | Bacteria | 3183 |
| 517 | Ga0496119_0087555 | 3300048922 | Bacteria | 1777 |
| 518 | Ga0496119_0108615 | 3300048922 | Bacteria | 1544 |
| 519 | Ga0496120_0000036 | 3300048923 | Bacteria | 206505 |
| 520 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 521 | Ga0496121_0002070 | 3300048924 | Bacteria | 31759 |
| 522 | Ga0496121_0024651 | 3300048924 | Bacteria | 5743 |
| 523 | Ga0496121_0041492 | 3300048924 | Bacteria | 4020 |
| 524 | Ga0496121_0331008 | 3300048924 | Bacteria | 1021 |
| 525 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 526 | Ga0496122_0008486 | 3300048925 | Bacteria | 11065 |
| 527 | Ga0496122_0257689 | 3300048925 | Bacteria | 970 |
| 528 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 529 | Ga0496123_0010831 | 3300048926 | Bacteria | 7995 |
| 530 | Ga0496123_0011879 | 3300048926 | Bacteria | 7485 |
| 531 | Ga0496123_0109713 | 3300048926 | Bacteria | 1580 |
| 532 | Ga0496124_0000080 | 3300048927 | Bacteria | 210439 |
| 533 | Ga0496124_0004382 | 3300048927 | Bacteria | 16507 |
| 534 | Ga0496124_0044542 | 3300048927 | Bacteria | 3806 |
| 535 | Ga0496124_0061233 | 3300048927 | Bacteria | 3155 |
| 536 | Ga0496124_0061251 | 3300048927 | Bacteria | 3154 |
| 537 | Ga0496124_0069587 | 3300048927 | Bacteria | 2921 |
| 538 | Ga0496124_0105128 | 3300048927 | Bacteria | 2282 |
| 539 | Ga0496124_0369927 | 3300048927 | Bacteria | 1006 |
| 540 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 541 | Ga0496125_0000381 | 3300048928 | Bacteria | 82386 |
| 542 | Ga0496125_0011518 | 3300048928 | Bacteria | 8836 |
| 543 | Ga0496125_0038894 | 3300048928 | Bacteria | 4107 |
| 544 | Ga0496126_0272377 | 3300048929 | Bacteria | 1405 |
| 545 | Ga0496126_0488740 | 3300048929 | Bacteria | 985 |
| 546 | Ga0495678_013297 | 3300049459 | Bacteria | 3871 |
| 547 | Ga0495678_054477 | 3300049459 | Unclassified | 1531 |
| 548 | Ga0495682_0079709 | 3300049460 | Bacteria | 1178 |
| 549 | Ga0501031_0000460 | 3300049568 | Bacteria | 23596 |
| 550 | Ga0501031_0000517 | 3300049568 | Bacteria | 22611 |
| 551 | Ga0501031_0315348 | 3300049568 | Bacteria | 1013 |
| 552 | Ga0501032_0000232 | 3300049569 | Bacteria | 46458 |
| 553 | Ga0501032_0003497 | 3300049569 | Bacteria | 12010 |
| 554 | Ga0501033_0000450 | 3300049570 | Bacteria | 39159 |
| 555 | Ga0501033_0015663 | 3300049570 | Bacteria | 5748 |
| 556 | Ga0501033_0017798 | 3300049570 | Bacteria | 5366 |
| 557 | Ga0501034_0001627 | 3300049571 | Bacteria | 29108 |
| 558 | Ga0501034_0003974 | 3300049571 | Bacteria | 16614 |
| 559 | Ga0501034_0035747 | 3300049571 | Bacteria | 5036 |
| 560 | Ga0501034_0049658 | 3300049571 | Bacteria | 4233 |
| 561 | Ga0501034_0051191 | 3300049571 | Bacteria | 4164 |
| 562 | Ga0501034_0279207 | 3300049571 | Bacteria | 1610 |
| 563 | Ga0501036_0016815 | 3300049572 | Bacteria | 6110 |
| 564 | Ga0501036_0022260 | 3300049572 | Bacteria | 5330 |
| 565 | Ga0501036_0089301 | 3300049572 | Bacteria | 2604 |
| 566 | Ga0501036_0264158 | 3300049572 | Bacteria | 1442 |
| 567 | Ga0501036_0360876 | 3300049572 | Bacteria | 1213 |
| 568 | Ga0501037_0000226 | 3300049573 | Bacteria | 49205 |
| 569 | Ga0501037_0000231 | 3300049573 | Bacteria | 48188 |
| 570 | Ga0501038_0000130 | 3300049574 | Bacteria | 63940 |
| 571 | Ga0501038_0000264 | 3300049574 | Bacteria | 44267 |
| 572 | Ga0501038_0018372 | 3300049574 | Bacteria | 6312 |
| 573 | Ga0501039_0000456 | 3300049575 | Bacteria | 29710 |
| 574 | Ga0501039_0005986 | 3300049575 | Bacteria | 9218 |
| 575 | Ga0501040_0096357 | 3300049576 | Bacteria | 2060 |
| 576 | Ga0501040_0211721 | 3300049576 | Unclassified | 1378 |
| 577 | Ga0501042_0000963 | 3300049578 | Bacteria | 16249 |
| 578 | Ga0501043_0000147 | 3300049579 | Bacteria | 65326 |
| 579 | Ga0501043_0009199 | 3300049579 | Bacteria | 7764 |
| 580 | Ga0501046_0000067 | 3300049580 | Bacteria | 114617 |
| 581 | Ga0501046_0002136 | 3300049580 | Bacteria | 18679 |
| 582 | Ga0501047_0001781 | 3300049581 | Bacteria | 20821 |
| 583 | Ga0501047_0031506 | 3300049581 | Bacteria | 5113 |
| 584 | Ga0501047_0085094 | 3300049581 | Bacteria | 3038 |
| 585 | Ga0501047_0173948 | 3300049581 | Bacteria | 2022 |
| 586 | Ga0501048_0000007 | 3300049582 | Bacteria | 86855 |
| 587 | Ga0501048_0003947 | 3300049582 | Bacteria | 11277 |
| 588 | Ga0501069_0000220 | 3300049585 | Bacteria | 25553 |
| 589 | Ga0501069_0001018 | 3300049585 | Bacteria | 13361 |
| 590 | Ga0501069_0163626 | 3300049585 | Bacteria | 1282 |
| 591 | Ga0501070_0001078 | 3300049586 | Bacteria | 24457 |
| 592 | Ga0501070_0005189 | 3300049586 | Bacteria | 11094 |
| 593 | Ga0501070_0030405 | 3300049586 | Bacteria | 4525 |
| 594 | Ga0501070_0050474 | 3300049586 | Bacteria | 3454 |
| 595 | Ga0501073_0007934 | 3300049589 | Bacteria | 7876 |
| 596 | Ga0501074_0003820 | 3300049590 | Bacteria | 10718 |
| 597 | Ga0501261_017946 | 3300049690 | Bacteria | 994 |
| 598 | Ga0501080_0000330 | 3300049742 | Bacteria | 36255 |
| 599 | Ga0501080_0002004 | 3300049742 | Bacteria | 17585 |
| 600 | Ga0501083_0000004 | 3300049744 | Bacteria | 207886 |
| 601 | Ga0501083_0016248 | 3300049744 | Bacteria | 5212 |
| 602 | Ga0501083_0114036 | 3300049744 | Bacteria | 1775 |
| 603 | Ga0501035_0001684 | 3300049822 | Bacteria | 22359 |
| 604 | Ga0501035_0006672 | 3300049822 | Bacteria | 10789 |
| 605 | Ga0501035_0020784 | 3300049822 | Bacteria | 6032 |
| 606 | Ga0501035_0020842 | 3300049822 | Bacteria | 6023 |
| 607 | Ga0501035_0494149 | 3300049822 | Bacteria | 1008 |
| 608 | Ga0501035_0519569 | 3300049822 | Bacteria | 978 |
| 609 | Ga0501044_0000755 | 3300049823 | Bacteria | 39069 |
| 610 | Ga0501044_0026318 | 3300049823 | Bacteria | 6160 |
| 611 | Ga0501044_0089190 | 3300049823 | Bacteria | 3113 |
| 612 | Ga0501044_0369290 | 3300049823 | Bacteria | 1351 |
| 613 | Ga0501045_0575280 | 3300049824 | Bacteria | 835 |
| 614 | nmdc:mga03683_1781_c1 | 3300050489 | Bacteria | 6517 |
| 615 | nmdc:mga03683_5499_c1 | 3300050489 | Bacteria | 4281 |
| 616 | nmdc:mga03683_9967_c1 | 3300050489 | Bacteria | 3396 |
| 617 | nmdc:mga03n38_103286_c1 | 3300050490 | Bacteria | 1378 |
| 618 | nmdc:mga03n38_85912_c1 | 3300050490 | Bacteria | 1488 |
| 619 | nmdc:mga00v17_19_c1 | 3300050491 | Bacteria | 115002 |
| 620 | nmdc:mga00v17_27140_c1 | 3300050491 | Bacteria | 3341 |
| 621 | nmdc:mga0yw44_1027_c1 | 3300050492 | Bacteria | 10708 |
| 622 | nmdc:mga0yw44_2126_c1 | 3300050492 | Bacteria | 8307 |
| 623 | nmdc:mga0yw44_972_c1 | 3300050492 | Bacteria | 10912 |
| 624 | nmdc:mga0k408_149911_c1 | 3300050493 | Bacteria | 1389 |
| 625 | nmdc:mga0k408_58554_c1 | 3300050493 | Bacteria | 2238 |
| 626 | nmdc:mga06z11_2714_c1 | 3300050494 | Bacteria | 6779 |
| 627 | nmdc:mga07m45_232952_c1 | 3300050496 | Bacteria | 1072 |
| 628 | nmdc:mga07m45_48111_c1 | 3300050496 | Bacteria | 2398 |
| 629 | nmdc:mga05p37_1219_c1 | 3300050507 | Bacteria | 29772 |
| 630 | nmdc:mga05p37_13693_c1 | 3300050507 | Bacteria | 9721 |
| 631 | nmdc:mga05p37_285524_c1 | 3300050507 | Bacteria | 1966 |
| 632 | nmdc:mga05p37_69035_c1 | 3300050507 | Bacteria | 4347 |
| 633 | nmdc:mga09592_553_c1 | 3300050508 | Bacteria | 28439 |
| 634 | nmdc:mga0qj67_1587_c1 | 3300050509 | Bacteria | 15991 |
| 635 | nmdc:mga0qj67_162049_c1 | 3300050509 | Bacteria | 1815 |
| 636 | nmdc:mga06r32_24266_c1 | 3300050510 | Bacteria | 5625 |
| 637 | nmdc:mga06r32_415_c1 | 3300050510 | Bacteria | 35846 |
| 638 | nmdc:mga0sz30_1633_c1 | 3300050516 | Bacteria | 7984 |
| 639 | Ga0500635_0000073 | 3300053080 | Bacteria | 65023 |
| 640 | Ga0500578_0043021 | 3300053086 | Bacteria | 2899 |
| 641 | Ga0500660_097463 | 3300053100 | Bacteria | 1293 |
| 642 | Ga0500556_0115066 | 3300053104 | Bacteria | 1046 |
| 643 | Ga0500569_015471 | 3300053109 | Bacteria | 1911 |
| 644 | Ga0500569_018073 | 3300053109 | Bacteria | 1815 |
| 645 | Ga0500580_065834 | 3300053113 | Bacteria | 1501 |
| 646 | Ga0500594_0005833 | 3300053118 | Bacteria | 2741 |
| 647 | Ga0500595_000538 | 3300053119 | Bacteria | 22785 |
| 648 | Ga0500595_037146 | 3300053119 | Bacteria | 1591 |
| 649 | Ga0500595_051387 | 3300053119 | Bacteria | 1276 |
| 650 | Ga0500642_0028242 | 3300053130 | Bacteria | 2312 |
| 651 | Ga0500658_0000083 | 3300053134 | Bacteria | 43599 |
| 652 | Ga0500561_0000036 | 3300053137 | Bacteria | 27979 |
| 653 | Ga0500568_0051304 | 3300053139 | Bacteria | 1623 |
| 654 | Ga0500573_0010576 | 3300053140 | Bacteria | 5151 |
| 655 | Ga0500588_0008325 | 3300053146 | Bacteria | 2419 |
| 656 | Ga0500616_0000187 | 3300053153 | Bacteria | 101361 |
| 657 | Ga0500616_0003602 | 3300053153 | Bacteria | 11670 |
| 658 | Ga0500616_0033163 | 3300053153 | Bacteria | 2818 |
| 659 | Ga0500616_0085813 | 3300053153 | Bacteria | 1571 |
| 660 | Ga0500616_0118906 | 3300053153 | Bacteria | 1265 |
| 661 | Ga0500622_0000308 | 3300053156 | Bacteria | 50027 |
| 662 | Ga0500622_0070275 | 3300053156 | Bacteria | 1771 |
| 663 | Ga0500627_0035582 | 3300053158 | Bacteria | 2116 |
| 664 | Ga0500627_0100243 | 3300053158 | Bacteria | 1300 |
| 665 | Ga0500634_0052914 | 3300053161 | Bacteria | 2179 |
| 666 | Ga0500636_0000011 | 3300053177 | Bacteria | 140769 |
| 667 | Ga0500636_0000283 | 3300053177 | Bacteria | 28087 |
| 668 | Ga0500636_0023544 | 3300053177 | Bacteria | 3640 |
| 669 | Ga0501084_0000908 | 3300054114 | Bacteria | 22886 |
| 670 | Ga0501084_0002439 | 3300054114 | Bacteria | 14960 |
| 671 | Ga0587106_000487 | 3300059605 | Bacteria | 2796 |
| 672 | Ga0587072_005462 | 3300059643 | Bacteria | 1898 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032004 | Ga0307414_10619725 | Ga0307414_106197251 | 238 |
| 2 | 3300046501 | Ga0495607_0210175 | Ga0495607_0210175_19_771 | 244 |
| 3 | 3300025923 | Ga0207681_10423472 | Ga0207681_104234722 | 245 |
| 4 | 3300046538 | Ga0495609_0207207 | Ga0495609_0207207_34_807 | 245 |
| 5 | 3300048922 | Ga0496119_0016153 | Ga0496119_0016153_21_773 | 245 |
| 6 | 3300006038 | Ga0075365_10019507 | Ga0075365_100195074 | 246 |
| 7 | 3300026088 | Ga0207641_10284022 | Ga0207641_102840223 | 249 |
| 8 | 3300049824 | Ga0501045_0575280 | Ga0501045_0575280_15_770 | 249 |
| 9 | 3300046660 | Ga0495625_0068313 | Ga0495625_0068313_1713_2486 | 252 |
| 10 | 3300048916 | Ga0496113_0572367 | Ga0496113_0572367_14_787 | 252 |
| 11 | 3300005327 | Ga0070658_10086291 | Ga0070658_100862913 | 255 |
| 12 | 3300049568 | Ga0501031_0315348 | Ga0501031_0315348_190_981 | 256 |
| 13 | 3300049585 | Ga0501069_0163626 | Ga0501069_0163626_10_894 | 256 |
| 14 | 3300049586 | Ga0501070_0050474 | Ga0501070_0050474_1657_2541 | 256 |
| 15 | 3300049822 | Ga0501035_0020842 | Ga0501035_0020842_3683_4567 | 256 |
| 16 | 3300049823 | Ga0501044_0026318 | Ga0501044_0026318_5114_5998 | 256 |
| 17 | 3300031731 | Ga0307405_10331739 | Ga0307405_103317391 | 257 |
| 18 | 3300032005 | Ga0307411_10300107 | Ga0307411_103001072 | 257 |
| 19 | 3300044735 | Ga0466968_0051109 | Ga0466968_0051109_980_1753 | 257 |
| 20 | 3300048914 | Ga0496111_0533464 | Ga0496111_0533464_78_851 | 257 |
| 21 | 3300005338 | Ga0068868_100461933 | Ga0068868_1004619332 | 262 |
| 22 | 3300005530 | Ga0070679_100314869 | Ga0070679_1003148692 | 262 |
| 23 | 3300026023 | Ga0207677_10298518 | Ga0207677_102985182 | 262 |
| 24 | 3300046691 | Ga0495670_0247397 | Ga0495670_0247397_126_932 | 262 |
| 25 | 3300003322 | rootL2_10007443 | rootL2_100074433 | 263 |
| 26 | 3300003323 | rootH1_10129646 | rootH1_101296462 | 263 |
| 27 | 3300013296 | Ga0157374_10118195 | Ga0157374_101181952 | 263 |
| 28 | 3300049571 | Ga0501034_0049658 | Ga0501034_0049658_958_1848 | 263 |
| 29 | 3300041413 | Ga0439465_0117235 | Ga0439465_0117235_13_906 | 264 |
| 30 | 3300044842 | Ga0466957_0320856 | Ga0466957_0320856_131_958 | 264 |
| 31 | 3300033180 | Ga0307510_10100597 | Ga0307510_101005972 | 266 |
| 32 | 3300028794 | Ga0307515_10025103 | Ga0307515_100251036 | 267 |
| 33 | 3300032005 | Ga0307411_10008197 | Ga0307411_100081973 | 267 |
| 34 | 3300049571 | Ga0501034_0279207 | Ga0501034_0279207_375_1265 | 268 |
| 35 | iso_pu_bacteria | 2554235003 | 2554245857 | 268 |
| 36 | iso_pu_bacteria | 2558860242 | 2559296377 | 268 |
| 37 | iso_pu_bacteria | 2643221693 | 2644522821 | 268 |
| 38 | iso_pu_bacteria | 2808606387 | 2808988595 | 268 |
| 39 | 3300053161 | Ga0500634_0052914 | Ga0500634_0052914_392_1204 | 270 |
| 40 | 3300009545 | Ga0105237_10000071 | Ga0105237_10000071133 | 271 |
| 41 | 3300010375 | Ga0105239_10001189 | Ga0105239_100011896 | 271 |
| 42 | 3300025914 | Ga0207671_10000099 | Ga0207671_1000009947 | 271 |
| 43 | 3300028379 | Ga0268266_10000391 | Ga0268266_1000039154 | 271 |
| 44 | 3300049576 | Ga0501040_0211721 | Ga0501040_0211721_496_1326 | 271 |
| 45 | 3300005327 | Ga0070658_10669075 | Ga0070658_106690751 | 272 |
| 46 | 3300005456 | Ga0070678_100282533 | Ga0070678_1002825332 | 272 |
| 47 | 3300005548 | Ga0070665_100002585 | Ga0070665_10000258524 | 272 |
| 48 | 3300006177 | Ga0075362_10064807 | Ga0075362_100648072 | 272 |
| 49 | 3300006178 | Ga0075367_10052945 | Ga0075367_100529452 | 272 |
| 50 | 3300006186 | Ga0075369_10047809 | Ga0075369_100478092 | 272 |
| 51 | 3300009148 | Ga0105243_10133392 | Ga0105243_101333922 | 272 |
| 52 | 3300013100 | Ga0157373_10111877 | Ga0157373_101118772 | 272 |
| 53 | 3300013102 | Ga0157371_10000042 | Ga0157371_10000042120 | 272 |
| 54 | 3300013104 | Ga0157370_10000035 | Ga0157370_1000003570 | 272 |
| 55 | 3300025935 | Ga0207709_10118553 | Ga0207709_101185532 | 272 |
| 56 | 3300028379 | Ga0268266_10002425 | Ga0268266_100024254 | 272 |
| 57 | 3300046674 | Ga0495588_0181501 | Ga0495588_0181501_274_1092 | 272 |
| 58 | 3300047470 | Ga0495681_0004413 | Ga0495681_0004413_8252_9070 | 272 |
| 59 | 3300048920 | Ga0496117_0000036 | Ga0496117_0000036_236928_237746 | 272 |
| 60 | 3300048922 | Ga0496119_0087555 | Ga0496119_0087555_339_1157 | 272 |
| 61 | 3300048923 | Ga0496120_0000036 | Ga0496120_0000036_142667_143485 | 272 |
| 62 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_643620_644438 | 272 |
| 63 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1167245_1168063 | 272 |
| 64 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_643620_644438 | 272 |
| 65 | 3300048927 | Ga0496124_0069587 | Ga0496124_0069587_1427_2245 | 272 |
| 66 | 3300049823 | Ga0501044_0369290 | Ga0501044_0369290_26_844 | 272 |
| 67 | 3300050489 | nmdc:mga03683_5499_c1 | nmdc:mga03683_5499_c1_2788_3606 | 272 |
| 68 | 3300050490 | nmdc:mga03n38_103286_c1 | nmdc:mga03n38_103286_c1_131_949 | 272 |
| 69 | 3300050491 | nmdc:mga00v17_19_c1 | nmdc:mga00v17_19_c1_82507_83325 | 272 |
| 70 | 3300050492 | nmdc:mga0yw44_1027_c1 | nmdc:mga0yw44_1027_c1_4342_5160 | 272 |
| 71 | 3300050493 | nmdc:mga0k408_58554_c1 | nmdc:mga0k408_58554_c1_339_1157 | 272 |
| 72 | 3300050516 | nmdc:mga0sz30_1633_c1 | nmdc:mga0sz30_1633_c1_6110_6928 | 272 |
| 73 | 3300053137 | Ga0500561_0000036 | Ga0500561_0000036_8354_9172 | 272 |
| 74 | 3300005983 | Ga0081540_1024832 | Ga0081540_10248322 | 273 |
| 75 | 3300006844 | Ga0075428_100008766 | Ga0075428_1000087667 | 273 |
| 76 | 3300006846 | Ga0075430_100004866 | Ga0075430_1000048664 | 273 |
| 77 | 3300006846 | Ga0075430_100149217 | Ga0075430_1001492172 | 273 |
| 78 | 3300006847 | Ga0075431_100187367 | Ga0075431_1001873672 | 273 |
| 79 | 3300006880 | Ga0075429_100120586 | Ga0075429_1001205863 | 273 |
| 80 | 3300009147 | Ga0114129_10004136 | Ga0114129_1000413615 | 273 |
| 81 | 3300009147 | Ga0114129_10069404 | Ga0114129_100694044 | 273 |
| 82 | 3300050492 | nmdc:mga0yw44_972_c1 | nmdc:mga0yw44_972_c1_6003_6875 | 273 |
| 83 | 3300050507 | nmdc:mga05p37_13693_c1 | nmdc:mga05p37_13693_c1_1017_1841 | 273 |
| 84 | 3300050507 | nmdc:mga05p37_69035_c1 | nmdc:mga05p37_69035_c1_1461_2285 | 273 |
| 85 | 3300050509 | nmdc:mga0qj67_162049_c1 | nmdc:mga0qj67_162049_c1_699_1523 | 273 |
| 86 | 3300050510 | nmdc:mga06r32_24266_c1 | nmdc:mga06r32_24266_c1_330_1154 | 273 |
| 87 | 3300006844 | Ga0075428_100015954 | Ga0075428_1000159547 | 274 |
| 88 | 3300006846 | Ga0075430_100013807 | Ga0075430_1000138076 | 274 |
| 89 | 3300006847 | Ga0075431_100013114 | Ga0075431_1000131147 | 274 |
| 90 | 3300006880 | Ga0075429_100014301 | Ga0075429_1000143016 | 274 |
| 91 | 3300009147 | Ga0114129_10006996 | Ga0114129_100069962 | 274 |
| 92 | 3300009147 | Ga0114129_10172676 | Ga0114129_101726762 | 274 |
| 93 | 3300009988 | Ga0105035_100701 | Ga0105035_1007012 | 274 |
| 94 | 3300009993 | Ga0105028_109017 | Ga0105028_1090172 | 274 |
| 95 | 3300030731 | Ga0316177_1124381 | Ga0316177_11243813 | 274 |
| 96 | 3300030733 | Ga0314311_1040023 | Ga0314311_10400234 | 274 |
| 97 | 3300050507 | nmdc:mga05p37_1219_c1 | nmdc:mga05p37_1219_c1_14912_15739 | 274 |
| 98 | 3300050507 | nmdc:mga05p37_285524_c1 | nmdc:mga05p37_285524_c1_152_979 | 274 |
| 99 | 3300050508 | nmdc:mga09592_553_c1 | nmdc:mga09592_553_c1_21396_22223 | 274 |
| 100 | 3300050509 | nmdc:mga0qj67_1587_c1 | nmdc:mga0qj67_1587_c1_14497_15324 | 274 |
| 101 | 3300050510 | nmdc:mga06r32_415_c1 | nmdc:mga06r32_415_c1_21313_22140 | 274 |
| 102 | iso_pu_bacteria | 2558860280 | 2559425394 | 274 |
| 103 | iso_pu_bacteria | 2585428059 | 2587743766 | 274 |
| 104 | 3300005327 | Ga0070658_10495653 | Ga0070658_104956531 | 275 |
| 105 | 3300005437 | Ga0070710_10000347 | Ga0070710_100003472 | 275 |
| 106 | 3300005563 | Ga0068855_100412760 | Ga0068855_1004127602 | 275 |
| 107 | 3300006844 | Ga0075428_100007760 | Ga0075428_1000077608 | 275 |
| 108 | 3300025898 | Ga0207692_10001908 | Ga0207692_100019085 | 275 |
| 109 | 3300025904 | Ga0207647_10143634 | Ga0207647_101436342 | 275 |
| 110 | 3300031548 | Ga0307408_100361291 | Ga0307408_1003612912 | 275 |
| 111 | 3300031731 | Ga0307405_10001743 | Ga0307405_100017432 | 275 |
| 112 | 3300031852 | Ga0307410_10145161 | Ga0307410_101451612 | 275 |
| 113 | 3300031901 | Ga0307406_10050209 | Ga0307406_100502093 | 275 |
| 114 | 3300031911 | Ga0307412_10031012 | Ga0307412_100310124 | 275 |
| 115 | 3300031995 | Ga0307409_100000181 | Ga0307409_1000001816 | 275 |
| 116 | 3300032002 | Ga0307416_100011847 | Ga0307416_1000118473 | 275 |
| 117 | 3300032005 | Ga0307411_10267341 | Ga0307411_102673412 | 275 |
| 118 | 3300032126 | Ga0307415_100000148 | Ga0307415_1000001489 | 275 |
| 119 | 3300044658 | Ga0466972_0001921 | Ga0466972_0001921_781_1617 | 275 |
| 120 | 3300044683 | Ga0466965_0002969 | Ga0466965_0002969_4319_5155 | 275 |
| 121 | 3300044901 | Ga0466960_0020911 | Ga0466960_0020911_601_1437 | 275 |
| 122 | 3300053080 | Ga0500635_0000073 | Ga0500635_0000073_10692_11552 | 275 |
| 123 | iso_pu_bacteria | 2816332139 | 2816503937 | 275 |
| 124 | 3300025254 | Ga0209148_1000305 | Ga0209148_100030534 | 276 |
| 125 | 3300025272 | Ga0209455_1006533 | Ga0209455_10065334 | 276 |
| 126 | iso_pu_bacteria | 2643221618 | 2644105946 | 276 |
| 127 | iso_pu_bacteria | 2643221626 | 2644147089 | 276 |
| 128 | iso_pu_bacteria | 2643221655 | 2644310558 | 276 |
| 129 | iso_pu_bacteria | 2643221659 | 2644334657 | 276 |
| 130 | iso_pu_bacteria | 2643221698 | 2644545148 | 276 |
| 131 | iso_pu_bacteria | 2643221712 | 2644612660 | 276 |
| 132 | iso_pu_bacteria | 8003314358 | 8003321353 | 276 |
| 133 | 3300005347 | Ga0070668_100046535 | Ga0070668_1000465352 | 277 |
| 134 | 3300005353 | Ga0070669_100036316 | Ga0070669_1000363163 | 277 |
| 135 | 3300005355 | Ga0070671_100057348 | Ga0070671_1000573482 | 277 |
| 136 | 3300005364 | Ga0070673_100436412 | Ga0070673_1004364122 | 277 |
| 137 | 3300005366 | Ga0070659_100256225 | Ga0070659_1002562251 | 277 |
| 138 | 3300005367 | Ga0070667_100300329 | Ga0070667_1003003291 | 277 |
| 139 | 3300005539 | Ga0068853_100133742 | Ga0068853_1001337422 | 277 |
| 140 | 3300005563 | Ga0068855_100174023 | Ga0068855_1001740233 | 277 |
| 141 | 3300005616 | Ga0068852_100693968 | Ga0068852_1006939681 | 277 |
| 142 | 3300005618 | Ga0068864_100629438 | Ga0068864_1006294381 | 277 |
| 143 | 3300005842 | Ga0068858_100113296 | Ga0068858_1001132963 | 277 |
| 144 | 3300006051 | Ga0075364_10075249 | Ga0075364_100752492 | 277 |
| 145 | 3300006177 | Ga0075362_10024045 | Ga0075362_100240453 | 277 |
| 146 | 3300006178 | Ga0075367_10031396 | Ga0075367_100313962 | 277 |
| 147 | 3300009093 | Ga0105240_10139857 | Ga0105240_101398572 | 277 |
| 148 | 3300009101 | Ga0105247_10009605 | Ga0105247_100096054 | 277 |
| 149 | 3300009148 | Ga0105243_10028578 | Ga0105243_100285782 | 277 |
| 150 | 3300009174 | Ga0105241_10049194 | Ga0105241_100491943 | 277 |
| 151 | 3300009177 | Ga0105248_10081859 | Ga0105248_100818593 | 277 |
| 152 | 3300009545 | Ga0105237_10016814 | Ga0105237_100168144 | 277 |
| 153 | 3300011119 | Ga0105246_10080022 | Ga0105246_100800223 | 277 |
| 154 | 3300013296 | Ga0157374_10040993 | Ga0157374_100409933 | 277 |
| 155 | 3300014325 | Ga0163163_10028230 | Ga0163163_100282305 | 277 |
| 156 | 3300025304 | Ga0209257_1014939 | Ga0209257_10149393 | 277 |
| 157 | 3300025315 | Ga0207697_10035302 | Ga0207697_100353022 | 277 |
| 158 | 3300025903 | Ga0207680_10194829 | Ga0207680_101948291 | 277 |
| 159 | 3300025904 | Ga0207647_10019341 | Ga0207647_100193414 | 277 |
| 160 | 3300025914 | Ga0207671_10392991 | Ga0207671_103929911 | 277 |
| 161 | 3300025931 | Ga0207644_10194257 | Ga0207644_101942572 | 277 |
| 162 | 3300025960 | Ga0207651_10381920 | Ga0207651_103819202 | 277 |
| 163 | 3300025972 | Ga0207668_10035197 | Ga0207668_100351972 | 277 |
| 164 | 3300026035 | Ga0207703_10048242 | Ga0207703_100482423 | 277 |
| 165 | 3300026067 | Ga0207678_10040377 | Ga0207678_100403772 | 277 |
| 166 | 3300026095 | Ga0207676_10360053 | Ga0207676_103600531 | 277 |
| 167 | 3300026116 | Ga0207674_10052495 | Ga0207674_100524953 | 277 |
| 168 | 3300046474 | Ga0495605_0128552 | Ga0495605_0128552_234_1106 | 277 |
| 169 | 3300046542 | Ga0495597_0019632 | Ga0495597_0019632_1706_2578 | 277 |
| 170 | 3300048905 | Ga0496102_0033995 | Ga0496102_0033995_866_1738 | 277 |
| 171 | 3300048906 | Ga0496103_0025893 | Ga0496103_0025893_1811_2683 | 277 |
| 172 | 3300048907 | Ga0496104_0041056 | Ga0496104_0041056_959_1831 | 277 |
| 173 | 3300048908 | Ga0496105_0006351 | Ga0496105_0006351_134_1006 | 277 |
| 174 | 3300048912 | Ga0496109_0243689 | Ga0496109_0243689_578_1450 | 277 |
| 175 | 3300048921 | Ga0496118_0083178 | Ga0496118_0083178_50_922 | 277 |
| 176 | 3300049459 | Ga0495678_054477 | Ga0495678_054477_27_890 | 277 |
| 177 | 3300050493 | nmdc:mga0k408_149911_c1 | nmdc:mga0k408_149911_c1_470_1342 | 277 |
| 178 | 3300050496 | nmdc:mga07m45_232952_c1 | nmdc:mga07m45_232952_c1_38_910 | 277 |
| 179 | 3300005543 | Ga0070672_100340495 | Ga0070672_1003404952 | 278 |
| 180 | 3300006038 | Ga0075365_10002567 | Ga0075365_100025675 | 278 |
| 181 | 3300009148 | Ga0105243_10400584 | Ga0105243_104005842 | 278 |
| 182 | 3300025940 | Ga0207691_10313136 | Ga0207691_103131362 | 278 |
| 183 | 3300027876 | Ga0209974_10036341 | Ga0209974_100363412 | 278 |
| 184 | 3300005435 | Ga0070714_100356364 | Ga0070714_1003563642 | 279 |
| 185 | 3300005577 | Ga0068857_100523358 | Ga0068857_1005233581 | 279 |
| 186 | 3300013105 | Ga0157369_10234860 | Ga0157369_102348602 | 279 |
| 187 | 3300013249 | Ga0171463_1002 | Ga0171463_1002382 | 279 |
| 188 | 3300015690 | Ga0183363_1046 | Ga0183363_104613 | 279 |
| 189 | 3300025261 | Ga0209233_1004820 | Ga0209233_10048204 | 279 |
| 190 | 3300025929 | Ga0207664_10112941 | Ga0207664_101129412 | 279 |
| 191 | 3300026067 | Ga0207678_10000459 | Ga0207678_100004597 | 279 |
| 192 | 3300026075 | Ga0207708_10125570 | Ga0207708_101255702 | 279 |
| 193 | 3300028794 | Ga0307515_10004240 | Ga0307515_100042403 | 279 |
| 194 | 3300031507 | Ga0307509_10105576 | Ga0307509_101055762 | 279 |
| 195 | 3300031616 | Ga0307508_10017913 | Ga0307508_100179132 | 279 |
| 196 | 3300031649 | Ga0307514_10023355 | Ga0307514_100233552 | 279 |
| 197 | 3300033179 | Ga0307507_10027619 | Ga0307507_100276196 | 279 |
| 198 | 3300044658 | Ga0466972_0002978 | Ga0466972_0002978_4335_5180 | 279 |
| 199 | 3300044683 | Ga0466965_0104737 | Ga0466965_0104737_318_1163 | 279 |
| 200 | iso_pu_bacteria | 2917554339 | 2917555077 | 279 |
| 201 | 3300003781 | Ga0055536_1009179 | Ga0055536_10091794 | 280 |
| 202 | 3300005347 | Ga0070668_100031244 | Ga0070668_1000312444 | 280 |
| 203 | 3300025292 | Ga0209676_1000097 | Ga0209676_1000097234 | 280 |
| 204 | 3300025298 | Ga0209050_1019700 | Ga0209050_10197002 | 280 |
| 205 | 3300025972 | Ga0207668_10007860 | Ga0207668_100078605 | 280 |
| 206 | 3300046660 | Ga0495625_0110100 | Ga0495625_0110100_598_1497 | 280 |
| 207 | 3300049572 | Ga0501036_0360876 | Ga0501036_0360876_52_933 | 280 |
| 208 | iso_pu_bacteria | 2844533157 | 2844533831 | 280 |
| 209 | iso_pu_bacteria | 3005445848 | 3005450605 | 280 |
| 210 | 3300005539 | Ga0068853_100000565 | Ga0068853_1000005656 | 281 |
| 211 | 3300009545 | Ga0105237_10376657 | Ga0105237_103766572 | 281 |
| 212 | 3300013105 | Ga0157369_10064646 | Ga0157369_100646463 | 281 |
| 213 | 3300025304 | Ga0209257_1004297 | Ga0209257_10042976 | 281 |
| 214 | 3300037312 | Ga0395899_0048208 | Ga0395899_0048208_554_1438 | 281 |
| 215 | 3300038443 | Ga0395901_0101100 | Ga0395901_0101100_149_1033 | 281 |
| 216 | 3300049568 | Ga0501031_0000517 | Ga0501031_0000517_7579_8475 | 281 |
| 217 | 3300049569 | Ga0501032_0000232 | Ga0501032_0000232_37162_38058 | 281 |
| 218 | 3300049570 | Ga0501033_0000450 | Ga0501033_0000450_21662_22558 | 281 |
| 219 | 3300049571 | Ga0501034_0001627 | Ga0501034_0001627_21019_21915 | 281 |
| 220 | 3300049572 | Ga0501036_0016815 | Ga0501036_0016815_589_1485 | 281 |
| 221 | 3300049573 | Ga0501037_0000226 | Ga0501037_0000226_11051_11947 | 281 |
| 222 | 3300049574 | Ga0501038_0000130 | Ga0501038_0000130_33122_34018 | 281 |
| 223 | 3300049575 | Ga0501039_0000456 | Ga0501039_0000456_22044_22940 | 281 |
| 224 | 3300049579 | Ga0501043_0000147 | Ga0501043_0000147_20342_21238 | 281 |
| 225 | 3300049580 | Ga0501046_0000067 | Ga0501046_0000067_57837_58733 | 281 |
| 226 | 3300049581 | Ga0501047_0001781 | Ga0501047_0001781_7615_8511 | 281 |
| 227 | 3300049582 | Ga0501048_0000007 | Ga0501048_0000007_48722_49618 | 281 |
| 228 | 3300049585 | Ga0501069_0001018 | Ga0501069_0001018_1295_2191 | 281 |
| 229 | 3300049586 | Ga0501070_0001078 | Ga0501070_0001078_7194_8090 | 281 |
| 230 | 3300049742 | Ga0501080_0000330 | Ga0501080_0000330_32297_33193 | 281 |
| 231 | 3300049744 | Ga0501083_0114036 | Ga0501083_0114036_476_1372 | 281 |
| 232 | 3300049822 | Ga0501035_0001684 | Ga0501035_0001684_7327_8223 | 281 |
| 233 | 3300049823 | Ga0501044_0000755 | Ga0501044_0000755_7608_8504 | 281 |
| 234 | 3300054114 | Ga0501084_0002439 | Ga0501084_0002439_9097_9993 | 281 |
| 235 | iso_pu_bacteria | 2508501114 | 2509074855 | 281 |
| 236 | iso_pu_bacteria | 2643221629 | 2644168391 | 281 |
| 237 | iso_pu_bacteria | 2643221662 | 2644349925 | 281 |
| 238 | iso_pu_bacteria | 2821443989 | 2821445656 | 281 |
| 239 | iso_pu_bacteria | 2835312727 | 2835318609 | 281 |
| 240 | iso_pu_bacteria | 8005301065 | 8005301679 | 281 |
| 241 | iso_pu_bacteria | 8018127388 | 8018128486 | 281 |
| 242 | 3300005347 | Ga0070668_100007262 | Ga0070668_1000072624 | 282 |
| 243 | 3300005844 | Ga0068862_100459150 | Ga0068862_1004591502 | 282 |
| 244 | 3300046507 | Ga0495606_0094411 | Ga0495606_0094411_739_1611 | 282 |
| 245 | 3300048921 | Ga0496118_0002329 | Ga0496118_0002329_21209_22081 | 282 |
| 246 | 3300045051 | Ga0451576_0146143 | Ga0451576_0146143_346_1206 | 283 |
| 247 | 3300053153 | Ga0500616_0118906 | Ga0500616_0118906_123_977 | 283 |
| 248 | 3300053177 | Ga0500636_0023544 | Ga0500636_0023544_663_1529 | 283 |
| 249 | iso_pu_bacteria | 2508501050 | 2508727108 | 283 |
| 250 | iso_pu_bacteria | 2537561587 | 2537873468 | 283 |
| 251 | iso_pu_bacteria | 2599185210 | 2599605574 | 283 |
| 252 | iso_pu_bacteria | 2600255279 | 2601611769 | 283 |
| 253 | iso_pu_bacteria | 2600255308 | 2601749500 | 283 |
| 254 | iso_pu_bacteria | 2643221582 | 2643917656 | 283 |
| 255 | iso_pu_bacteria | 2757320392 | 2757572240 | 283 |
| 256 | iso_pu_bacteria | 2775506901 | 2776262737 | 283 |
| 257 | iso_pu_bacteria | 2818991439 | 2819557827 | 283 |
| 258 | iso_pu_bacteria | 2838675328 | 2838679775 | 283 |
| 259 | iso_pu_bacteria | 2838714209 | 2838717455 | 283 |
| 260 | iso_pu_bacteria | 2838719591 | 2838724344 | 283 |
| 261 | iso_pu_bacteria | 2838724970 | 2838729339 | 283 |
| 262 | iso_pu_bacteria | 2841846520 | 2841850766 | 283 |
| 263 | iso_pu_bacteria | 2841859092 | 2841864055 | 283 |
| 264 | iso_pu_bacteria | 2842124991 | 2842129571 | 283 |
| 265 | iso_pu_bacteria | 2842130223 | 2842134716 | 283 |
| 266 | iso_pu_bacteria | 2842152218 | 2842156766 | 283 |
| 267 | iso_pu_bacteria | 2842170452 | 2842173024 | 283 |
| 268 | iso_pu_bacteria | 2842175837 | 2842180384 | 283 |
| 269 | iso_pu_bacteria | 2842187318 | 2842191957 | 283 |
| 270 | iso_pu_bacteria | 2842211629 | 2842216273 | 283 |
| 271 | iso_pu_bacteria | 2842224351 | 2842228993 | 283 |
| 272 | iso_pu_bacteria | 2842515876 | 2842520837 | 283 |
| 273 | iso_pu_bacteria | 2899792073 | 2899793629 | 283 |
| 274 | iso_pu_bacteria | 2899845264 | 2899848722 | 283 |
| 275 | iso_pu_bacteria | 2919114240 | 2919119209 | 283 |
| 276 | iso_pu_bacteria | 2926754445 | 2926759240 | 283 |
| 277 | iso_pu_bacteria | 2926760298 | 2926763323 | 283 |
| 278 | iso_pu_bacteria | 2929138655 | 2929142966 | 283 |
| 279 | iso_pu_bacteria | 2933006813 | 2933011371 | 283 |
| 280 | iso_pu_bacteria | 2933011516 | 2933016550 | 283 |
| 281 | iso_pu_bacteria | 2933594066 | 2933596057 | 283 |
| 282 | iso_pu_bacteria | 2979089926 | 2979091644 | 283 |
| 283 | iso_pu_bacteria | 2979095461 | 2979097165 | 283 |
| 284 | iso_pu_bacteria | 2979100975 | 2979102868 | 283 |
| 285 | iso_pu_bacteria | 2984509177 | 2984509243 | 283 |
| 286 | iso_pu_bacteria | 2984518228 | 2984520058 | 283 |
| 287 | iso_pu_bacteria | 2984601300 | 2984604320 | 283 |
| 288 | iso_pu_bacteria | 650716007 | 650842770 | 283 |
| 289 | iso_pu_bacteria | 8003570095 | 8003574805 | 283 |
| 290 | iso_pu_bacteria | 8054460903 | 8054464674 | 283 |
| 291 | 3300005262 | Ga0065165_1001128 | Ga0065165_100112816 | 284 |
| 292 | 3300021320 | Ga0214544_1000771 | Ga0214544_100077137 | 284 |
| 293 | 3300021321 | Ga0214542_1000032 | Ga0214542_100003255 | 284 |
| 294 | 3300021327 | Ga0214543_1000016 | Ga0214543_1000016223 | 284 |
| 295 | 3300025297 | Ga0209758_1003392 | Ga0209758_100339210 | 284 |
| 296 | 3300031901 | Ga0307406_10010585 | Ga0307406_100105854 | 284 |
| 297 | 3300039438 | Ga0436360_1011386 | Ga0436360_1011386_528_1403 | 284 |
| 298 | 3300041413 | Ga0439465_0023002 | Ga0439465_0023002_642_1538 | 284 |
| 299 | 3300046522 | Ga0495643_0035802 | Ga0495643_0035802_106_984 | 284 |
| 300 | 3300046522 | Ga0495643_0049454 | Ga0495643_0049454_1253_2131 | 284 |
| 301 | 3300046542 | Ga0495597_0039884 | Ga0495597_0039884_747_1625 | 284 |
| 302 | 3300048921 | Ga0496118_0049355 | Ga0496118_0049355_2227_3105 | 284 |
| 303 | 3300048921 | Ga0496118_0067101 | Ga0496118_0067101_719_1603 | 284 |
| 304 | 3300048925 | Ga0496122_0008486 | Ga0496122_0008486_6554_7432 | 284 |
| 305 | 3300048926 | Ga0496123_0011879 | Ga0496123_0011879_4658_5536 | 284 |
| 306 | 3300048928 | Ga0496125_0000381 | Ga0496125_0000381_43255_44124 | 284 |
| 307 | 3300049568 | Ga0501031_0000460 | Ga0501031_0000460_19047_19946 | 284 |
| 308 | 3300049569 | Ga0501032_0003497 | Ga0501032_0003497_7491_8390 | 284 |
| 309 | 3300049570 | Ga0501033_0015663 | Ga0501033_0015663_4488_5387 | 284 |
| 310 | 3300049571 | Ga0501034_0003974 | Ga0501034_0003974_12349_13248 | 284 |
| 311 | 3300049572 | Ga0501036_0022260 | Ga0501036_0022260_3534_4433 | 284 |
| 312 | 3300049573 | Ga0501037_0000231 | Ga0501037_0000231_41691_42590 | 284 |
| 313 | 3300049574 | Ga0501038_0000264 | Ga0501038_0000264_39153_40052 | 284 |
| 314 | 3300049575 | Ga0501039_0005986 | Ga0501039_0005986_4431_5330 | 284 |
| 315 | 3300049576 | Ga0501040_0096357 | Ga0501040_0096357_841_1740 | 284 |
| 316 | 3300049579 | Ga0501043_0009199 | Ga0501043_0009199_119_1018 | 284 |
| 317 | 3300049580 | Ga0501046_0002136 | Ga0501046_0002136_13802_14701 | 284 |
| 318 | 3300049581 | Ga0501047_0031506 | Ga0501047_0031506_4096_4995 | 284 |
| 319 | 3300049582 | Ga0501048_0003947 | Ga0501048_0003947_4511_5410 | 284 |
| 320 | 3300049585 | Ga0501069_0000220 | Ga0501069_0000220_1892_2791 | 284 |
| 321 | 3300049586 | Ga0501070_0005189 | Ga0501070_0005189_5983_6882 | 284 |
| 322 | 3300049589 | Ga0501073_0007934 | Ga0501073_0007934_6309_7208 | 284 |
| 323 | 3300049590 | Ga0501074_0003820 | Ga0501074_0003820_3296_4195 | 284 |
| 324 | 3300049742 | Ga0501080_0002004 | Ga0501080_0002004_12090_12989 | 284 |
| 325 | 3300049744 | Ga0501083_0016248 | Ga0501083_0016248_654_1553 | 284 |
| 326 | 3300049822 | Ga0501035_0006672 | Ga0501035_0006672_3367_4266 | 284 |
| 327 | 3300050489 | nmdc:mga03683_9967_c1 | nmdc:mga03683_9967_c1_2243_3121 | 284 |
| 328 | 3300053086 | Ga0500578_0043021 | Ga0500578_0043021_1112_1990 | 284 |
| 329 | 3300053153 | Ga0500616_0033163 | Ga0500616_0033163_1031_1909 | 284 |
| 330 | 3300054114 | Ga0501084_0000908 | Ga0501084_0000908_369_1268 | 284 |
| 331 | iso_pu_bacteria | 2867346516 | 2867348024 | 284 |
| 332 | iso_pu_bacteria | 2867346516 | 2867350203 | 284 |
| 333 | iso_pu_bacteria | 2894232714 | 2894241243 | 284 |
| 334 | 3300002773 | JGI25152J39213_1000493 | JGI25152J39213_100049312 | 285 |
| 335 | 3300002774 | JGI25150J39212_1000355 | JGI25150J39212_100035512 | 285 |
| 336 | 3300003187 | JGI25151J46595_10000946 | JGI25151J46595_1000094611 | 285 |
| 337 | 3300003215 | JGI25153J46596_10001894 | JGI25153J46596_100018946 | 285 |
| 338 | 3300006177 | Ga0075362_10024504 | Ga0075362_100245042 | 285 |
| 339 | 3300006195 | Ga0075366_10121241 | Ga0075366_101212412 | 285 |
| 340 | 3300006353 | Ga0075370_10230185 | Ga0075370_102301852 | 285 |
| 341 | 3300025245 | Ga0207425_1000052 | Ga0207425_100005282 | 285 |
| 342 | 3300025258 | Ga0209129_1000141 | Ga0209129_100014112 | 285 |
| 343 | 3300025273 | Ga0209673_1004618 | Ga0209673_10046186 | 285 |
| 344 | 3300025284 | Ga0209130_1000830 | Ga0209130_10008306 | 285 |
| 345 | 3300025294 | Ga0209025_1000144 | Ga0209025_1000144114 | 285 |
| 346 | 3300025297 | Ga0209758_1000229 | Ga0209758_1000229114 | 285 |
| 347 | 3300025302 | Ga0207426_1000287 | Ga0207426_100028789 | 285 |
| 348 | 3300031731 | Ga0307405_10000651 | Ga0307405_100006515 | 285 |
| 349 | 3300031901 | Ga0307406_10191622 | Ga0307406_101916222 | 285 |
| 350 | 3300031911 | Ga0307412_10001987 | Ga0307412_1000198713 | 285 |
| 351 | 3300037466 | Ga0395898_0095647 | Ga0395898_0095647_1838_2740 | 285 |
| 352 | 3300039438 | Ga0436360_0070791 | Ga0436360_0070791_996_1856 | 285 |
| 353 | 3300046512 | Ga0495610_0033794 | Ga0495610_0033794_57_920 | 285 |
| 354 | 3300046691 | Ga0495670_0014187 | Ga0495670_0014187_70_957 | 285 |
| 355 | 3300048919 | Ga0496116_0001183 | Ga0496116_0001183_6413_7297 | 285 |
| 356 | 3300048919 | Ga0496116_0042278 | Ga0496116_0042278_2186_3070 | 285 |
| 357 | 3300048924 | Ga0496121_0024651 | Ga0496121_0024651_4813_5697 | 285 |
| 358 | 3300048926 | Ga0496123_0010831 | Ga0496123_0010831_1033_1917 | 285 |
| 359 | 3300048927 | Ga0496124_0004382 | Ga0496124_0004382_3363_4247 | 285 |
| 360 | 3300048927 | Ga0496124_0044542 | Ga0496124_0044542_2677_3561 | 285 |
| 361 | 3300048928 | Ga0496125_0011518 | Ga0496125_0011518_7476_8360 | 285 |
| 362 | 3300050489 | nmdc:mga03683_1781_c1 | nmdc:mga03683_1781_c1_4618_5511 | 285 |
| 363 | iso_pu_bacteria | 2513237094 | 2513641467 | 285 |
| 364 | iso_pu_bacteria | 2519899620 | 2520378318 | 285 |
| 365 | iso_pu_bacteria | 2529292951 | 2530648456 | 285 |
| 366 | iso_pu_bacteria | 2643221580 | 2643910908 | 285 |
| 367 | iso_pu_bacteria | 2643221591 | 2643965928 | 285 |
| 368 | iso_pu_bacteria | 2838668709 | 2838672657 | 285 |
| 369 | iso_pu_bacteria | 2838701080 | 2838705020 | 285 |
| 370 | iso_pu_bacteria | 2842146304 | 2842150014 | 285 |
| 371 | iso_pu_bacteria | 2842250916 | 2842254701 | 285 |
| 372 | iso_pu_bacteria | 2842489311 | 2842493983 | 285 |
| 373 | iso_pu_bacteria | 2844315083 | 2844320827 | 285 |
| 374 | iso_pu_bacteria | 2894817345 | 2894818903 | 285 |
| 375 | iso_pu_bacteria | 2903727486 | 2903728103 | 285 |
| 376 | iso_pu_bacteria | 2906602504 | 2906608110 | 285 |
| 377 | iso_pu_bacteria | 639633055 | 639645957 | 285 |
| 378 | iso_pu_bacteria | 8055431914 | 8055435338 | 285 |
| 379 | iso_pu_bacteria | 8056967851 | 8056969206 | 285 |
| 380 | 3300002773 | JGI25152J39213_1002263 | JGI25152J39213_10022635 | 286 |
| 381 | 3300003187 | JGI25151J46595_10001865 | JGI25151J46595_1000186512 | 286 |
| 382 | 3300003215 | JGI25153J46596_10065292 | JGI25153J46596_100652921 | 286 |
| 383 | 3300003771 | Ga0055526_1000926 | Ga0055526_10009267 | 286 |
| 384 | 3300003771 | Ga0055526_1013134 | Ga0055526_10131343 | 286 |
| 385 | 3300003775 | Ga0055524_1003779 | Ga0055524_10037793 | 286 |
| 386 | 3300003790 | Ga0055528_1000464 | Ga0055528_10004649 | 286 |
| 387 | 3300003790 | Ga0055528_1011321 | Ga0055528_10113212 | 286 |
| 388 | 3300005335 | Ga0070666_10137792 | Ga0070666_101377921 | 286 |
| 389 | 3300005353 | Ga0070669_100451166 | Ga0070669_1004511661 | 286 |
| 390 | 3300005355 | Ga0070671_100017417 | Ga0070671_1000174175 | 286 |
| 391 | 3300005844 | Ga0068862_100436295 | Ga0068862_1004362951 | 286 |
| 392 | 3300006038 | Ga0075365_10004465 | Ga0075365_100044654 | 286 |
| 393 | 3300006178 | Ga0075367_10001293 | Ga0075367_100012939 | 286 |
| 394 | 3300006186 | Ga0075369_10005102 | Ga0075369_100051023 | 286 |
| 395 | 3300009177 | Ga0105248_10009144 | Ga0105248_100091445 | 286 |
| 396 | 3300009766 | Ga0123342_1020788 | Ga0123342_10207882 | 286 |
| 397 | 3300011119 | Ga0105246_10248696 | Ga0105246_102486962 | 286 |
| 398 | 3300014326 | Ga0157380_10185827 | Ga0157380_101858272 | 286 |
| 399 | 3300025258 | Ga0209129_1001779 | Ga0209129_10017797 | 286 |
| 400 | 3300025273 | Ga0209673_1000616 | Ga0209673_100061620 | 286 |
| 401 | 3300025273 | Ga0209673_1002508 | Ga0209673_10025087 | 286 |
| 402 | 3300025284 | Ga0209130_1006186 | Ga0209130_10061863 | 286 |
| 403 | 3300025294 | Ga0209025_1001024 | Ga0209025_100102428 | 286 |
| 404 | 3300025294 | Ga0209025_1053412 | Ga0209025_10534122 | 286 |
| 405 | 3300025295 | Ga0209564_1000900 | Ga0209564_100090020 | 286 |
| 406 | 3300025295 | Ga0209564_1008825 | Ga0209564_10088255 | 286 |
| 407 | 3300025295 | Ga0209564_1011645 | Ga0209564_10116453 | 286 |
| 408 | 3300025297 | Ga0209758_1002485 | Ga0209758_10024851 | 286 |
| 409 | 3300025299 | Ga0209256_1001392 | Ga0209256_10013923 | 286 |
| 410 | 3300025299 | Ga0209256_1005354 | Ga0209256_10053543 | 286 |
| 411 | 3300025302 | Ga0207426_1001778 | Ga0207426_10017786 | 286 |
| 412 | 3300025303 | Ga0209051_1003965 | Ga0209051_10039652 | 286 |
| 413 | 3300025923 | Ga0207681_10445926 | Ga0207681_104459261 | 286 |
| 414 | 3300025931 | Ga0207644_10028013 | Ga0207644_100280132 | 286 |
| 415 | 3300025941 | Ga0207711_10037909 | Ga0207711_100379092 | 286 |
| 416 | 3300025986 | Ga0207658_10162608 | Ga0207658_101626082 | 286 |
| 417 | 3300026067 | Ga0207678_10046776 | Ga0207678_100467763 | 286 |
| 418 | 3300028380 | Ga0268265_10374449 | Ga0268265_103744492 | 286 |
| 419 | 3300031730 | Ga0307516_10028576 | Ga0307516_100285765 | 286 |
| 420 | 3300046474 | Ga0495605_0000832 | Ga0495605_0000832_3911_4783 | 286 |
| 421 | 3300048905 | Ga0496102_0041920 | Ga0496102_0041920_49_933 | 286 |
| 422 | 3300048908 | Ga0496105_0117903 | Ga0496105_0117903_24_908 | 286 |
| 423 | 3300048919 | Ga0496116_0068890 | Ga0496116_0068890_18_902 | 286 |
| 424 | 3300048920 | Ga0496117_0012929 | Ga0496117_0012929_228_1091 | 286 |
| 425 | 3300048921 | Ga0496118_0027736 | Ga0496118_0027736_1370_2233 | 286 |
| 426 | 3300048922 | Ga0496119_0108615 | Ga0496119_0108615_39_902 | 286 |
| 427 | 3300048924 | Ga0496121_0002070 | Ga0496121_0002070_13971_14834 | 286 |
| 428 | 3300048927 | Ga0496124_0061251 | Ga0496124_0061251_205_1089 | 286 |
| 429 | 3300048929 | Ga0496126_0272377 | Ga0496126_0272377_89_952 | 286 |
| 430 | 3300048929 | Ga0496126_0488740 | Ga0496126_0488740_98_961 | 286 |
| 431 | 3300049459 | Ga0495678_013297 | Ga0495678_013297_2649_3521 | 286 |
| 432 | 3300049578 | Ga0501042_0000963 | Ga0501042_0000963_968_1873 | 286 |
| 433 | 3300049744 | Ga0501083_0000004 | Ga0501083_0000004_165287_166192 | 286 |
| 434 | 3300053109 | Ga0500569_015471 | Ga0500569_015471_622_1494 | 286 |
| 435 | 3300053119 | Ga0500595_000538 | Ga0500595_000538_7119_7982 | 286 |
| 436 | 3300053119 | Ga0500595_037146 | Ga0500595_037146_576_1439 | 286 |
| 437 | 3300053130 | Ga0500642_0028242 | Ga0500642_0028242_1037_1900 | 286 |
| 438 | 3300053146 | Ga0500588_0008325 | Ga0500588_0008325_1413_2276 | 286 |
| 439 | 3300053158 | Ga0500627_0100243 | Ga0500627_0100243_320_1183 | 286 |
| 440 | iso_pu_bacteria | 2582581867 | 2585399562 | 286 |
| 441 | iso_pu_bacteria | 2585427528 | 2585542849 | 286 |
| 442 | iso_pu_bacteria | 2585427593 | 2585841209 | 286 |
| 443 | iso_pu_bacteria | 2643221674 | 2644412156 | 286 |
| 444 | iso_pu_bacteria | 2889790730 | 2889795101 | 286 |
| 445 | iso_pu_bacteria | 2889914905 | 2889914914 | 286 |
| 446 | iso_pu_bacteria | 2899803654 | 2899804634 | 286 |
| 447 | iso_pu_bacteria | 8008485437 | 8008491366 | 286 |
| 448 | iso_pu_bacteria | 8025524527 | 8025530696 | 286 |
| 449 | 3300002739 | JGI25158J39367_1000160 | JGI25158J39367_100016013 | 287 |
| 450 | 3300002773 | JGI25152J39213_1000861 | JGI25152J39213_10008616 | 287 |
| 451 | 3300002773 | JGI25152J39213_1001207 | JGI25152J39213_10012077 | 287 |
| 452 | 3300002773 | JGI25152J39213_1001531 | JGI25152J39213_10015317 | 287 |
| 453 | 3300002774 | JGI25150J39212_1009798 | JGI25150J39212_10097981 | 287 |
| 454 | 3300002774 | JGI25150J39212_1013415 | JGI25150J39212_10134151 | 287 |
| 455 | 3300002987 | JGI25159J45721_1000711 | JGI25159J45721_10007117 | 287 |
| 456 | 3300003187 | JGI25151J46595_10000409 | JGI25151J46595_1000040914 | 287 |
| 457 | 3300003187 | JGI25151J46595_10004033 | JGI25151J46595_100040332 | 287 |
| 458 | 3300003187 | JGI25151J46595_10014430 | JGI25151J46595_100144302 | 287 |
| 459 | 3300003214 | JGI25165J46597_1004993 | JGI25165J46597_10049933 | 287 |
| 460 | 3300003215 | JGI25153J46596_10007757 | JGI25153J46596_100077574 | 287 |
| 461 | 3300003215 | JGI25153J46596_10008884 | JGI25153J46596_100088844 | 287 |
| 462 | 3300003354 | JGI25160J50197_1002301 | JGI25160J50197_10023017 | 287 |
| 463 | 3300003354 | JGI25160J50197_1002712 | JGI25160J50197_10027125 | 287 |
| 464 | 3300003374 | JGI25161J50226_1000206 | JGI25161J50226_100020632 | 287 |
| 465 | 3300003374 | JGI25161J50226_1006719 | JGI25161J50226_10067192 | 287 |
| 466 | 3300003771 | Ga0055526_1000489 | Ga0055526_100048919 | 287 |
| 467 | 3300003771 | Ga0055526_1004307 | Ga0055526_10043077 | 287 |
| 468 | 3300003771 | Ga0055526_1018821 | Ga0055526_10188212 | 287 |
| 469 | 3300003775 | Ga0055524_1005189 | Ga0055524_10051894 | 287 |
| 470 | 3300003775 | Ga0055524_1005277 | Ga0055524_10052772 | 287 |
| 471 | 3300003790 | Ga0055528_1000478 | Ga0055528_100047813 | 287 |
| 472 | 3300003790 | Ga0055528_1001760 | Ga0055528_10017608 | 287 |
| 473 | 3300003790 | Ga0055528_1002389 | Ga0055528_10023897 | 287 |
| 474 | 3300003790 | Ga0055528_1021586 | Ga0055528_10215862 | 287 |
| 475 | 3300003792 | Ga0055540_1000320 | Ga0055540_100032027 | 287 |
| 476 | 3300003792 | Ga0055540_1003981 | Ga0055540_10039815 | 287 |
| 477 | 3300003856 | Ga0058692_1002641 | Ga0058692_10026412 | 287 |
| 478 | 3300003856 | Ga0058692_1007147 | Ga0058692_10071472 | 287 |
| 479 | 3300004625 | Ga0055543_1000248 | Ga0055543_100024824 | 287 |
| 480 | 3300004625 | Ga0055543_1002104 | Ga0055543_10021044 | 287 |
| 481 | 3300005262 | Ga0065165_1001369 | Ga0065165_100136925 | 287 |
| 482 | 3300005262 | Ga0065165_1006963 | Ga0065165_10069633 | 287 |
| 483 | 3300005262 | Ga0065165_1035870 | Ga0065165_10358702 | 287 |
| 484 | 3300005289 | Ga0065704_10166279 | Ga0065704_101662791 | 287 |
| 485 | 3300005327 | Ga0070658_10297277 | Ga0070658_102972772 | 287 |
| 486 | 3300005337 | Ga0070682_100111494 | Ga0070682_1001114942 | 287 |
| 487 | 3300005339 | Ga0070660_100001762 | Ga0070660_1000017626 | 287 |
| 488 | 3300005455 | Ga0070663_100076567 | Ga0070663_1000765672 | 287 |
| 489 | 3300005530 | Ga0070679_100174329 | Ga0070679_1001743292 | 287 |
| 490 | 3300005548 | Ga0070665_100264906 | Ga0070665_1002649062 | 287 |
| 491 | 3300005563 | Ga0068855_100174184 | Ga0068855_1001741843 | 287 |
| 492 | 3300006038 | Ga0075365_10001348 | Ga0075365_100013489 | 287 |
| 493 | 3300006048 | Ga0075363_100085685 | Ga0075363_1000856852 | 287 |
| 494 | 3300006051 | Ga0075364_10023714 | Ga0075364_100237142 | 287 |
| 495 | 3300006051 | Ga0075364_10030856 | Ga0075364_100308563 | 287 |
| 496 | 3300006177 | Ga0075362_10010334 | Ga0075362_100103343 | 287 |
| 497 | 3300006178 | Ga0075367_10005583 | Ga0075367_100055835 | 287 |
| 498 | 3300006186 | Ga0075369_10008926 | Ga0075369_100089264 | 287 |
| 499 | 3300006186 | Ga0075369_10016107 | Ga0075369_100161073 | 287 |
| 500 | 3300006186 | Ga0075369_10021032 | Ga0075369_100210322 | 287 |
| 501 | 3300006353 | Ga0075370_10003397 | Ga0075370_100033972 | 287 |
| 502 | 3300006948 | Ga0099826_10000040 | Ga0099826_1000004053 | 287 |
| 503 | 3300009148 | Ga0105243_10072373 | Ga0105243_100723732 | 287 |
| 504 | 3300009551 | Ga0105238_10051937 | Ga0105238_100519372 | 287 |
| 505 | 3300009553 | Ga0105249_10082542 | Ga0105249_100825422 | 287 |
| 506 | 3300009765 | Ga0123341_1000097 | Ga0123341_10000977 | 287 |
| 507 | 3300012513 | Ga0157326_1006039 | Ga0157326_10060392 | 287 |
| 508 | 3300013105 | Ga0157369_10098498 | Ga0157369_100984983 | 287 |
| 509 | 3300025208 | Ga0209436_100127 | Ga0209436_10012733 | 287 |
| 510 | 3300025231 | Ga0207427_103104 | Ga0207427_1031043 | 287 |
| 511 | 3300025245 | Ga0207425_1012086 | Ga0207425_10120862 | 287 |
| 512 | 3300025245 | Ga0207425_1017797 | Ga0207425_10177972 | 287 |
| 513 | 3300025258 | Ga0209129_1000312 | Ga0209129_100031223 | 287 |
| 514 | 3300025258 | Ga0209129_1000357 | Ga0209129_100035719 | 287 |
| 515 | 3300025258 | Ga0209129_1004734 | Ga0209129_10047342 | 287 |
| 516 | 3300025258 | Ga0209129_1011981 | Ga0209129_10119812 | 287 |
| 517 | 3300025258 | Ga0209129_1011984 | Ga0209129_10119842 | 287 |
| 518 | 3300025261 | Ga0209233_1000290 | Ga0209233_100029041 | 287 |
| 519 | 3300025273 | Ga0209673_1000584 | Ga0209673_100058428 | 287 |
| 520 | 3300025273 | Ga0209673_1000890 | Ga0209673_100089017 | 287 |
| 521 | 3300025273 | Ga0209673_1001948 | Ga0209673_100194812 | 287 |
| 522 | 3300025273 | Ga0209673_1002261 | Ga0209673_10022617 | 287 |
| 523 | 3300025273 | Ga0209673_1002576 | Ga0209673_10025769 | 287 |
| 524 | 3300025284 | Ga0209130_1000002 | Ga0209130_1000002697 | 287 |
| 525 | 3300025294 | Ga0209025_1000374 | Ga0209025_100037454 | 287 |
| 526 | 3300025294 | Ga0209025_1000857 | Ga0209025_100085725 | 287 |
| 527 | 3300025294 | Ga0209025_1001822 | Ga0209025_100182221 | 287 |
| 528 | 3300025294 | Ga0209025_1047953 | Ga0209025_10479532 | 287 |
| 529 | 3300025294 | Ga0209025_1066981 | Ga0209025_10669811 | 287 |
| 530 | 3300025295 | Ga0209564_1000914 | Ga0209564_100091426 | 287 |
| 531 | 3300025295 | Ga0209564_1001996 | Ga0209564_100199614 | 287 |
| 532 | 3300025295 | Ga0209564_1018123 | Ga0209564_10181232 | 287 |
| 533 | 3300025295 | Ga0209564_1030026 | Ga0209564_10300262 | 287 |
| 534 | 3300025297 | Ga0209758_1000744 | Ga0209758_10007442 | 287 |
| 535 | 3300025297 | Ga0209758_1001147 | Ga0209758_100114732 | 287 |
| 536 | 3300025297 | Ga0209758_1001197 | Ga0209758_100119722 | 287 |
| 537 | 3300025297 | Ga0209758_1001885 | Ga0209758_100188513 | 287 |
| 538 | 3300025297 | Ga0209758_1002066 | Ga0209758_100206619 | 287 |
| 539 | 3300025298 | Ga0209050_1005209 | Ga0209050_10052092 | 287 |
| 540 | 3300025299 | Ga0209256_1000260 | Ga0209256_100026032 | 287 |
| 541 | 3300025299 | Ga0209256_1000739 | Ga0209256_100073926 | 287 |
| 542 | 3300025299 | Ga0209256_1001817 | Ga0209256_100181714 | 287 |
| 543 | 3300025299 | Ga0209256_1007001 | Ga0209256_10070013 | 287 |
| 544 | 3300025299 | Ga0209256_1014775 | Ga0209256_10147752 | 287 |
| 545 | 3300025302 | Ga0207426_1000013 | Ga0207426_1000013697 | 287 |
| 546 | 3300025302 | Ga0207426_1000812 | Ga0207426_100081222 | 287 |
| 547 | 3300025303 | Ga0209051_1000195 | Ga0209051_100019529 | 287 |
| 548 | 3300025303 | Ga0209051_1002486 | Ga0209051_10024862 | 287 |
| 549 | 3300025303 | Ga0209051_1007413 | Ga0209051_10074133 | 287 |
| 550 | 3300025303 | Ga0209051_1061436 | Ga0209051_10614362 | 287 |
| 551 | 3300025304 | Ga0209257_1007822 | Ga0209257_10078223 | 287 |
| 552 | 3300025304 | Ga0209257_1011479 | Ga0209257_10114792 | 287 |
| 553 | 3300025901 | Ga0207688_10010706 | Ga0207688_100107063 | 287 |
| 554 | 3300025909 | Ga0207705_10002602 | Ga0207705_100026027 | 287 |
| 555 | 3300025919 | Ga0207657_10003030 | Ga0207657_100030309 | 287 |
| 556 | 3300025949 | Ga0207667_10032885 | Ga0207667_100328854 | 287 |
| 557 | 3300025972 | Ga0207668_10224012 | Ga0207668_102240121 | 287 |
| 558 | 3300026067 | Ga0207678_10105168 | Ga0207678_101051682 | 287 |
| 559 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003145 | 287 |
| 560 | 3300027312 | Ga0209371_1000998 | Ga0209371_10009988 | 287 |
| 561 | 3300027666 | Ga0209282_1000150 | Ga0209282_100015038 | 287 |
| 562 | 3300028786 | Ga0307517_10013188 | Ga0307517_100131886 | 287 |
| 563 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004906 | 287 |
| 564 | 3300030500 | Ga0268256_1002297 | Ga0268256_10022975 | 287 |
| 565 | 3300030500 | Ga0268256_1029509 | Ga0268256_10295092 | 287 |
| 566 | 3300030745 | Ga0316182_1202552 | Ga0316182_12025522 | 287 |
| 567 | 3300041460 | Ga0451802_1411238 | Ga0451802_1411238_350_1237 | 287 |
| 568 | 3300041501 | Ga0451845_0333885 | Ga0451845_0333885_1222_2109 | 287 |
| 569 | 3300041507 | Ga0451851_0470152 | Ga0451851_0470152_515_1402 | 287 |
| 570 | 3300041509 | Ga0451843_0046155 | Ga0451843_0046155_722_1609 | 287 |
| 571 | 3300041512 | Ga0451853_3055762 | Ga0451853_3055762_845_1732 | 287 |
| 572 | 3300042007 | Ga0439449_0001583 | Ga0439449_0001583_3016_3894 | 287 |
| 573 | 3300044683 | Ga0466965_0028214 | Ga0466965_0028214_1777_2694 | 287 |
| 574 | 3300044842 | Ga0466957_0074802 | Ga0466957_0074802_630_1547 | 287 |
| 575 | 3300046507 | Ga0495606_0017853 | Ga0495606_0017853_4306_5193 | 287 |
| 576 | 3300046512 | Ga0495610_0006514 | Ga0495610_0006514_4019_4906 | 287 |
| 577 | 3300046515 | Ga0495620_0035733 | Ga0495620_0035733_87_974 | 287 |
| 578 | 3300046522 | Ga0495643_0166468 | Ga0495643_0166468_195_1070 | 287 |
| 579 | 3300046691 | Ga0495670_0027101 | Ga0495670_0027101_730_1617 | 287 |
| 580 | 3300046794 | Ga0495589_0078012 | Ga0495589_0078012_285_1163 | 287 |
| 581 | 3300046810 | Ga0495660_0042753 | Ga0495660_0042753_372_1259 | 287 |
| 582 | 3300047443 | Ga0495687_015362 | Ga0495687_015362_591_1469 | 287 |
| 583 | 3300047447 | Ga0495685_018992 | Ga0495685_018992_1021_1899 | 287 |
| 584 | 3300047472 | Ga0495686_0013754 | Ga0495686_0013754_642_1529 | 287 |
| 585 | 3300048907 | Ga0496104_0167520 | Ga0496104_0167520_229_1104 | 287 |
| 586 | 3300048909 | Ga0496106_0000490 | Ga0496106_0000490_521_1408 | 287 |
| 587 | 3300048921 | Ga0496118_0028305 | Ga0496118_0028305_234_1109 | 287 |
| 588 | 3300048921 | Ga0496118_0043304 | Ga0496118_0043304_387_1262 | 287 |
| 589 | 3300048922 | Ga0496119_0036900 | Ga0496119_0036900_1778_2653 | 287 |
| 590 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_909714_910589 | 287 |
| 591 | 3300048924 | Ga0496121_0331008 | Ga0496121_0331008_40_927 | 287 |
| 592 | 3300048925 | Ga0496122_0257689 | Ga0496122_0257689_30_917 | 287 |
| 593 | 3300048926 | Ga0496123_0109713 | Ga0496123_0109713_185_1060 | 287 |
| 594 | 3300048927 | Ga0496124_0000080 | Ga0496124_0000080_106249_107124 | 287 |
| 595 | 3300048927 | Ga0496124_0061233 | Ga0496124_0061233_249_1136 | 287 |
| 596 | 3300048927 | Ga0496124_0369927 | Ga0496124_0369927_52_927 | 287 |
| 597 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_33811_34686 | 287 |
| 598 | 3300048928 | Ga0496125_0038894 | Ga0496125_0038894_2967_3854 | 287 |
| 599 | 3300049570 | Ga0501033_0017798 | Ga0501033_0017798_1178_2059 | 287 |
| 600 | 3300049571 | Ga0501034_0035747 | Ga0501034_0035747_1760_2641 | 287 |
| 601 | 3300049572 | Ga0501036_0089301 | Ga0501036_0089301_1564_2451 | 287 |
| 602 | 3300049574 | Ga0501038_0018372 | Ga0501038_0018372_2058_2945 | 287 |
| 603 | 3300049581 | Ga0501047_0085094 | Ga0501047_0085094_429_1310 | 287 |
| 604 | 3300049586 | Ga0501070_0030405 | Ga0501070_0030405_2240_3121 | 287 |
| 605 | 3300049822 | Ga0501035_0020784 | Ga0501035_0020784_1603_2484 | 287 |
| 606 | 3300049822 | Ga0501035_0494149 | Ga0501035_0494149_80_967 | 287 |
| 607 | 3300050491 | nmdc:mga00v17_27140_c1 | nmdc:mga00v17_27140_c1_1785_2660 | 287 |
| 608 | 3300050492 | nmdc:mga0yw44_2126_c1 | nmdc:mga0yw44_2126_c1_7193_8080 | 287 |
| 609 | 3300050494 | nmdc:mga06z11_2714_c1 | nmdc:mga06z11_2714_c1_3206_4093 | 287 |
| 610 | 3300053100 | Ga0500660_097463 | Ga0500660_097463_241_1119 | 287 |
| 611 | 3300053109 | Ga0500569_018073 | Ga0500569_018073_116_1003 | 287 |
| 612 | 3300053113 | Ga0500580_065834 | Ga0500580_065834_219_1097 | 287 |
| 613 | 3300053134 | Ga0500658_0000083 | Ga0500658_0000083_30853_31740 | 287 |
| 614 | 3300053139 | Ga0500568_0051304 | Ga0500568_0051304_669_1556 | 287 |
| 615 | 3300053140 | Ga0500573_0010576 | Ga0500573_0010576_2241_3119 | 287 |
| 616 | 3300053156 | Ga0500622_0000308 | Ga0500622_0000308_11850_12737 | 287 |
| 617 | 3300053177 | Ga0500636_0000011 | Ga0500636_0000011_128801_129676 | 287 |
| 618 | 3300053177 | Ga0500636_0000283 | Ga0500636_0000283_21281_22156 | 287 |
| 619 | 3300059643 | Ga0587072_005462 | Ga0587072_005462_699_1574 | 287 |
| 620 | iso_pu_bacteria | 2508501122 | 2509112219 | 287 |
| 621 | iso_pu_bacteria | 2509276019 | 2509379500 | 287 |
| 622 | iso_pu_bacteria | 2510065057 | 2510307139 | 287 |
| 623 | iso_pu_bacteria | 2510917028 | 2511185268 | 287 |
| 624 | iso_pu_bacteria | 2511231052 | 2511498714 | 287 |
| 625 | iso_pu_bacteria | 2512047086 | 2512534851 | 287 |
| 626 | iso_pu_bacteria | 2512875026 | 2512973321 | 287 |
| 627 | iso_pu_bacteria | 2513237086 | 2513587034 | 287 |
| 628 | iso_pu_bacteria | 2513237088 | 2513595668 | 287 |
| 629 | iso_pu_bacteria | 2513237089 | 2513603676 | 287 |
| 630 | iso_pu_bacteria | 2513237091 | 2513619444 | 287 |
| 631 | iso_pu_bacteria | 2513237138 | 2513865303 | 287 |
| 632 | iso_pu_bacteria | 2513237140 | 2513886042 | 287 |
| 633 | iso_pu_bacteria | 2513237143 | 2513904380 | 287 |
| 634 | iso_pu_bacteria | 2513237156 | 2513983384 | 287 |
| 635 | iso_pu_bacteria | 2513237160 | 2514005916 | 287 |
| 636 | iso_pu_bacteria | 2515154107 | 2515607154 | 287 |
| 637 | iso_pu_bacteria | 2516143018 | 2516208010 | 287 |
| 638 | iso_pu_bacteria | 2516653046 | 2516894991 | 287 |
| 639 | iso_pu_bacteria | 2517487022 | 2517571676 | 287 |
| 640 | iso_pu_bacteria | 2524023207 | 2524452595 | 287 |
| 641 | iso_pu_bacteria | 2534681796 | 2535514517 | 287 |
| 642 | iso_pu_bacteria | 2551306084 | 2551675564 | 287 |
| 643 | iso_pu_bacteria | 2551306085 | 2551685321 | 287 |
| 644 | iso_pu_bacteria | 2551306086 | 2551693960 | 287 |
| 645 | iso_pu_bacteria | 2551306087 | 2551698093 | 287 |
| 646 | iso_pu_bacteria | 2551306089 | 2551713109 | 287 |
| 647 | iso_pu_bacteria | 2551306090 | 2551716947 | 287 |
| 648 | iso_pu_bacteria | 2551306091 | 2551728264 | 287 |
| 649 | iso_pu_bacteria | 2551306091 | 2551728571 | 287 |
| 650 | iso_pu_bacteria | 2551306092 | 2551733167 | 287 |
| 651 | iso_pu_bacteria | 2551306093 | 2551744595 | 287 |
| 652 | iso_pu_bacteria | 2558860100 | 2558867609 | 287 |
| 653 | iso_pu_bacteria | 2582581283 | 2585167302 | 287 |
| 654 | iso_pu_bacteria | 2582581294 | 2585201347 | 287 |
| 655 | iso_pu_bacteria | 2582581299 | 2585231004 | 287 |
| 656 | iso_pu_bacteria | 2582581304 | 2585256480 | 287 |
| 657 | iso_pu_bacteria | 2582581867 | 2585399154 | 287 |
| 658 | iso_pu_bacteria | 2585427590 | 2585818697 | 287 |
| 659 | iso_pu_bacteria | 2585427594 | 2585843639 | 287 |
| 660 | iso_pu_bacteria | 2643221599 | 2644004280 | 287 |
| 661 | iso_pu_bacteria | 2643221634 | 2644191161 | 287 |
| 662 | iso_pu_bacteria | 2643221643 | 2644237718 | 287 |
| 663 | iso_pu_bacteria | 2657244999 | 2657684931 | 287 |
| 664 | iso_pu_bacteria | 2690316117 | 2692319028 | 287 |
| 665 | iso_pu_bacteria | 2738541293 | 2738800718 | 287 |
| 666 | iso_pu_bacteria | 2751185821 | 2753463607 | 287 |
| 667 | iso_pu_bacteria | 2791355091 | 2792621650 | 287 |
| 668 | iso_pu_bacteria | 2791355092 | 2792627665 | 287 |
| 669 | iso_pu_bacteria | 2791355094 | 2792640380 | 287 |
| 670 | iso_pu_bacteria | 2802428858 | 2802721250 | 287 |
| 671 | iso_pu_bacteria | 2802428859 | 2802724563 | 287 |
| 672 | iso_pu_bacteria | 2802428860 | 2802729770 | 287 |
| 673 | iso_pu_bacteria | 2802428861 | 2802737116 | 287 |
| 674 | iso_pu_bacteria | 2802428862 | 2802746871 | 287 |
| 675 | iso_pu_bacteria | 2802428863 | 2802751733 | 287 |
| 676 | iso_pu_bacteria | 2802429268 | 2804755716 | 287 |
| 677 | iso_pu_bacteria | 2838074704 | 2838075794 | 287 |
| 678 | iso_pu_bacteria | 2840764183 | 2840768350 | 287 |
| 679 | iso_pu_bacteria | 2844163670 | 2844165646 | 287 |
| 680 | iso_pu_bacteria | 2847417321 | 2847422472 | 287 |
| 681 | iso_pu_bacteria | 2848992105 | 2848998119 | 287 |
| 682 | iso_pu_bacteria | 2850079185 | 2850079282 | 287 |
| 683 | iso_pu_bacteria | 2855825444 | 2855827626 | 287 |
| 684 | iso_pu_bacteria | 2855839649 | 2855843002 | 287 |
| 685 | iso_pu_bacteria | 2855872281 | 2855875809 | 287 |
| 686 | iso_pu_bacteria | 2858800743 | 2858801957 | 287 |
| 687 | iso_pu_bacteria | 2862705112 | 2862708551 | 287 |
| 688 | iso_pu_bacteria | 2896384573 | 2896388243 | 287 |
| 689 | iso_pu_bacteria | 2913295892 | 2913296236 | 287 |
| 690 | iso_pu_bacteria | 2915980308 | 2915983213 | 287 |
| 691 | iso_pu_bacteria | 2915986958 | 2915991694 | 287 |
| 692 | iso_pu_bacteria | 2915993759 | 2915998940 | 287 |
| 693 | iso_pu_bacteria | 2916000859 | 2916002891 | 287 |
| 694 | iso_pu_bacteria | 2916007675 | 2916011231 | 287 |
| 695 | iso_pu_bacteria | 2916014648 | 2916018749 | 287 |
| 696 | iso_pu_bacteria | 2916021584 | 2916025409 | 287 |
| 697 | iso_pu_bacteria | 2916028427 | 2916032219 | 287 |
| 698 | iso_pu_bacteria | 2916035215 | 2916038116 | 287 |
| 699 | iso_pu_bacteria | 2916041962 | 2916042358 | 287 |
| 700 | iso_pu_bacteria | 2916048683 | 2916050083 | 287 |
| 701 | iso_pu_bacteria | 2916055098 | 2916059013 | 287 |
| 702 | iso_pu_bacteria | 2916061851 | 2916063524 | 287 |
| 703 | iso_pu_bacteria | 2916068649 | 2916075085 | 287 |
| 704 | iso_pu_bacteria | 2916076590 | 2916078506 | 287 |
| 705 | iso_pu_bacteria | 2920760137 | 2920764352 | 287 |
| 706 | iso_pu_bacteria | 2921201388 | 2921206388 | 287 |
| 707 | iso_pu_bacteria | 2921208531 | 2921211242 | 287 |
| 708 | iso_pu_bacteria | 2921237296 | 2921241210 | 287 |
| 709 | iso_pu_bacteria | 2921244191 | 2921249360 | 287 |
| 710 | iso_pu_bacteria | 2921250672 | 2921256209 | 287 |
| 711 | iso_pu_bacteria | 2921257292 | 2921258746 | 287 |
| 712 | iso_pu_bacteria | 2921263974 | 2921268225 | 287 |
| 713 | iso_pu_bacteria | 2921282425 | 2921285262 | 287 |
| 714 | iso_pu_bacteria | 2921289301 | 2921293420 | 287 |
| 715 | iso_pu_bacteria | 2923556063 | 2923556125 | 287 |
| 716 | iso_pu_bacteria | 2924144063 | 2924147844 | 287 |
| 717 | iso_pu_bacteria | 2924150972 | 2924151907 | 287 |
| 718 | iso_pu_bacteria | 2924158325 | 2924163295 | 287 |
| 719 | iso_pu_bacteria | 2924165586 | 2924171100 | 287 |
| 720 | iso_pu_bacteria | 2924172951 | 2924178487 | 287 |
| 721 | iso_pu_bacteria | 2924179722 | 2924185002 | 287 |
| 722 | iso_pu_bacteria | 2924186466 | 2924192107 | 287 |
| 723 | iso_pu_bacteria | 2924193448 | 2924196286 | 287 |
| 724 | iso_pu_bacteria | 2924200457 | 2924203998 | 287 |
| 725 | iso_pu_bacteria | 2924207177 | 2924210664 | 287 |
| 726 | iso_pu_bacteria | 2924214083 | 2924219966 | 287 |
| 727 | iso_pu_bacteria | 2924221636 | 2924225548 | 287 |
| 728 | iso_pu_bacteria | 2924228884 | 2924232394 | 287 |
| 729 | iso_pu_bacteria | 2936996657 | 2936998859 | 287 |
| 730 | iso_pu_bacteria | 2937002841 | 2937007132 | 287 |
| 731 | iso_pu_bacteria | 2937009748 | 2937013264 | 287 |
| 732 | iso_pu_bacteria | 2937016420 | 2937019954 | 287 |
| 733 | iso_pu_bacteria | 2937023124 | 2937025550 | 287 |
| 734 | iso_pu_bacteria | 2937029754 | 2937032508 | 287 |
| 735 | iso_pu_bacteria | 2937036028 | 2937039171 | 287 |
| 736 | iso_pu_bacteria | 2937042894 | 2937043221 | 287 |
| 737 | iso_pu_bacteria | 2937049772 | 2937053158 | 287 |
| 738 | iso_pu_bacteria | 2937056579 | 2937061974 | 287 |
| 739 | iso_pu_bacteria | 2937063883 | 2937065708 | 287 |
| 740 | iso_pu_bacteria | 2937071275 | 2937075755 | 287 |
| 741 | iso_pu_bacteria | 2937078374 | 2937084042 | 287 |
| 742 | iso_pu_bacteria | 2937084907 | 2937087345 | 287 |
| 743 | iso_pu_bacteria | 2937091812 | 2937097658 | 287 |
| 744 | iso_pu_bacteria | 2937098957 | 2937100246 | 287 |
| 745 | iso_pu_bacteria | 2937106411 | 2937111198 | 287 |
| 746 | iso_pu_bacteria | 2937113482 | 2937115945 | 287 |
| 747 | iso_pu_bacteria | 2937119839 | 2937123511 | 287 |
| 748 | iso_pu_bacteria | 2937126314 | 2937129166 | 287 |
| 749 | iso_pu_bacteria | 2957375807 | 2957378136 | 287 |
| 750 | iso_pu_bacteria | 2957382221 | 2957386328 | 287 |
| 751 | iso_pu_bacteria | 2957388812 | 2957392679 | 287 |
| 752 | iso_pu_bacteria | 2957395598 | 2957401630 | 287 |
| 753 | iso_pu_bacteria | 2957402308 | 2957404963 | 287 |
| 754 | iso_pu_bacteria | 2957408893 | 2957411936 | 287 |
| 755 | iso_pu_bacteria | 2957415311 | 2957417142 | 287 |
| 756 | iso_pu_bacteria | 2957422303 | 2957427988 | 287 |
| 757 | iso_pu_bacteria | 2957430029 | 2957433002 | 287 |
| 758 | iso_pu_bacteria | 2957437181 | 2957439245 | 287 |
| 759 | iso_pu_bacteria | 2957443900 | 2957446579 | 287 |
| 760 | iso_pu_bacteria | 2957450854 | 2957455828 | 287 |
| 761 | iso_pu_bacteria | 2957457609 | 2957461204 | 287 |
| 762 | iso_pu_bacteria | 2957464669 | 2957467688 | 287 |
| 763 | iso_pu_bacteria | 2957471148 | 2957471793 | 287 |
| 764 | iso_pu_bacteria | 2957478035 | 2957483180 | 287 |
| 765 | iso_pu_bacteria | 2957484790 | 2957486981 | 287 |
| 766 | iso_pu_bacteria | 2957491536 | 2957493851 | 287 |
| 767 | iso_pu_bacteria | 2957498199 | 2957502331 | 287 |
| 768 | iso_pu_bacteria | 2957505466 | 2957506288 | 287 |
| 769 | iso_pu_bacteria | 2960584000 | 2960587202 | 287 |
| 770 | iso_pu_bacteria | 2960591022 | 2960593049 | 287 |
| 771 | iso_pu_bacteria | 2960597568 | 2960601180 | 287 |
| 772 | iso_pu_bacteria | 2960603979 | 2960608169 | 287 |
| 773 | iso_pu_bacteria | 2960610863 | 2960612271 | 287 |
| 774 | iso_pu_bacteria | 2960617483 | 2960620260 | 287 |
| 775 | iso_pu_bacteria | 2960624210 | 2960626011 | 287 |
| 776 | iso_pu_bacteria | 2960631154 | 2960635492 | 287 |
| 777 | iso_pu_bacteria | 2960637947 | 2960643896 | 287 |
| 778 | iso_pu_bacteria | 2960645483 | 2960651957 | 287 |
| 779 | iso_pu_bacteria | 2960652885 | 2960655943 | 287 |
| 780 | iso_pu_bacteria | 2960660292 | 2960663090 | 287 |
| 781 | iso_pu_bacteria | 2960667422 | 2960671323 | 287 |
| 782 | iso_pu_bacteria | 2960674078 | 2960678032 | 287 |
| 783 | iso_pu_bacteria | 2960680706 | 2960683819 | 287 |
| 784 | iso_pu_bacteria | 2960687367 | 2960689234 | 287 |
| 785 | iso_pu_bacteria | 2960693952 | 2960697053 | 287 |
| 786 | iso_pu_bacteria | 2964607997 | 2964613680 | 287 |
| 787 | iso_pu_bacteria | 2964615318 | 2964616376 | 287 |
| 788 | iso_pu_bacteria | 2964621998 | 2964625348 | 287 |
| 789 | iso_pu_bacteria | 2964628898 | 2964632050 | 287 |
| 790 | iso_pu_bacteria | 2964636051 | 2964640465 | 287 |
| 791 | iso_pu_bacteria | 2964643177 | 2964647371 | 287 |
| 792 | iso_pu_bacteria | 2964649959 | 2964653745 | 287 |
| 793 | iso_pu_bacteria | 2964656573 | 2964662410 | 287 |
| 794 | iso_pu_bacteria | 2964663802 | 2964667431 | 287 |
| 795 | iso_pu_bacteria | 2964670856 | 2964676282 | 287 |
| 796 | iso_pu_bacteria | 2964678106 | 2964684971 | 287 |
| 797 | iso_pu_bacteria | 2964685014 | 2964687822 | 287 |
| 798 | iso_pu_bacteria | 2964691889 | 2964695719 | 287 |
| 799 | iso_pu_bacteria | 2964698721 | 2964702355 | 287 |
| 800 | iso_pu_bacteria | 2964705432 | 2964708147 | 287 |
| 801 | iso_pu_bacteria | 2964712639 | 2964717427 | 287 |
| 802 | iso_pu_bacteria | 2964719344 | 2964722583 | 287 |
| 803 | iso_pu_bacteria | 2967664464 | 2967669727 | 287 |
| 804 | iso_pu_bacteria | 2967671571 | 2967675225 | 287 |
| 805 | iso_pu_bacteria | 2967678726 | 2967684290 | 287 |
| 806 | iso_pu_bacteria | 2967686174 | 2967688334 | 287 |
| 807 | iso_pu_bacteria | 2967693043 | 2967695755 | 287 |
| 808 | iso_pu_bacteria | 2967699805 | 2967700216 | 287 |
| 809 | iso_pu_bacteria | 2967706974 | 2967711265 | 287 |
| 810 | iso_pu_bacteria | 2967714385 | 2967719508 | 287 |
| 811 | iso_pu_bacteria | 2967721400 | 2967727577 | 287 |
| 812 | iso_pu_bacteria | 2967728569 | 2967733933 | 287 |
| 813 | iso_pu_bacteria | 2967735183 | 2967738584 | 287 |
| 814 | iso_pu_bacteria | 2967742019 | 2967747576 | 287 |
| 815 | iso_pu_bacteria | 2967748971 | 2967752887 | 287 |
| 816 | iso_pu_bacteria | 2967755722 | 2967756436 | 287 |
| 817 | iso_pu_bacteria | 2967762386 | 2967765332 | 287 |
| 818 | iso_pu_bacteria | 2967769361 | 2967773032 | 287 |
| 819 | iso_pu_bacteria | 2967775926 | 2967781436 | 287 |
| 820 | iso_pu_bacteria | 2970019648 | 2970025354 | 287 |
| 821 | iso_pu_bacteria | 2970026789 | 2970028825 | 287 |
| 822 | iso_pu_bacteria | 2970033650 | 2970038099 | 287 |
| 823 | iso_pu_bacteria | 2970040964 | 2970044378 | 287 |
| 824 | iso_pu_bacteria | 2970047711 | 2970054285 | 287 |
| 825 | iso_pu_bacteria | 2970054988 | 2970059132 | 287 |
| 826 | iso_pu_bacteria | 2970061556 | 2970067967 | 287 |
| 827 | iso_pu_bacteria | 2970068827 | 2970074327 | 287 |
| 828 | iso_pu_bacteria | 2970076120 | 2970080244 | 287 |
| 829 | iso_pu_bacteria | 2970082768 | 2970087641 | 287 |
| 830 | iso_pu_bacteria | 2970088815 | 2970092134 | 287 |
| 831 | iso_pu_bacteria | 2970095765 | 2970097856 | 287 |
| 832 | iso_pu_bacteria | 2970102677 | 2970104377 | 287 |
| 833 | iso_pu_bacteria | 2970109326 | 2970111794 | 287 |
| 834 | iso_pu_bacteria | 2970116247 | 2970120829 | 287 |
| 835 | iso_pu_bacteria | 2970122695 | 2970122896 | 287 |
| 836 | iso_pu_bacteria | 2970129317 | 2970132269 | 287 |
| 837 | iso_pu_bacteria | 2970136068 | 2970137744 | 287 |
| 838 | iso_pu_bacteria | 2970143518 | 2970145421 | 287 |
| 839 | iso_pu_bacteria | 2970149975 | 2970153764 | 287 |
| 840 | iso_pu_bacteria | 2970156795 | 2970163866 | 287 |
| 841 | iso_pu_bacteria | 2970164137 | 2970168522 | 287 |
| 842 | iso_pu_bacteria | 2970170962 | 2970174556 | 287 |
| 843 | iso_pu_bacteria | 2970177841 | 2970184374 | 287 |
| 844 | iso_pu_bacteria | 2970184632 | 2970190352 | 287 |
| 845 | iso_pu_bacteria | 2970191845 | 2970195876 | 287 |
| 846 | iso_pu_bacteria | 2977516862 | 2977522224 | 287 |
| 847 | iso_pu_bacteria | 2977523885 | 2977525683 | 287 |
| 848 | iso_pu_bacteria | 2977530762 | 2977530782 | 287 |
| 849 | iso_pu_bacteria | 2977544691 | 2977546809 | 287 |
| 850 | iso_pu_bacteria | 2977551784 | 2977557133 | 287 |
| 851 | iso_pu_bacteria | 2977558990 | 2977562077 | 287 |
| 852 | iso_pu_bacteria | 2977565890 | 2977568754 | 287 |
| 853 | iso_pu_bacteria | 2977572785 | 2977576784 | 287 |
| 854 | iso_pu_bacteria | 2977579622 | 2977582560 | 287 |
| 855 | iso_pu_bacteria | 2996887358 | 2996889687 | 287 |
| 856 | iso_pu_bacteria | 3005452660 | 3005456280 | 287 |
| 857 | iso_pu_bacteria | 643692032 | 643823656 | 287 |
| 858 | iso_pu_bacteria | 648276728 | 648740449 | 287 |
| 859 | iso_pu_bacteria | 8003992118 | 8003995581 | 287 |
| 860 | iso_pu_bacteria | 8003999396 | 8004003348 | 287 |
| 861 | iso_pu_bacteria | 8005258706 | 8005261535 | 287 |
| 862 | iso_pu_bacteria | 8005321885 | 8005324214 | 287 |
| 863 | iso_pu_bacteria | 8005542996 | 8005543170 | 287 |
| 864 | 3300005937 | Ga0081455_10331566 | Ga0081455_103315662 | 288 |
| 865 | 3300025292 | Ga0209676_1000256 | Ga0209676_100025617 | 288 |
| 866 | 3300030522 | Ga0307512_10092747 | Ga0307512_100927472 | 288 |
| 867 | 3300031824 | Ga0307413_10030735 | Ga0307413_100307353 | 288 |
| 868 | 3300031903 | Ga0307407_10063534 | Ga0307407_100635342 | 288 |
| 869 | 3300031995 | Ga0307409_100064948 | Ga0307409_1000649483 | 288 |
| 870 | 3300032004 | Ga0307414_10127305 | Ga0307414_101273052 | 288 |
| 871 | 3300032126 | Ga0307415_100034769 | Ga0307415_1000347693 | 288 |
| 872 | 3300041404 | Ga0439436_0030841 | Ga0439436_0030841_312_1199 | 288 |
| 873 | 3300044658 | Ga0466972_0052262 | Ga0466972_0052262_437_1357 | 288 |
| 874 | 3300044765 | Ga0466970_0064151 | Ga0466970_0064151_30_950 | 288 |
| 875 | 3300044901 | Ga0466960_0018879 | Ga0466960_0018879_1743_2663 | 288 |
| 876 | 3300046506 | Ga0495583_0091327 | Ga0495583_0091327_164_1051 | 288 |
| 877 | 3300047318 | Ga0495636_0001079 | Ga0495636_0001079_8877_9764 | 288 |
| 878 | 3300047443 | Ga0495687_009007 | Ga0495687_009007_3290_4177 | 288 |
| 879 | 3300049690 | Ga0501261_017946 | Ga0501261_017946_31_900 | 288 |
| 880 | 3300049823 | Ga0501044_0089190 | Ga0501044_0089190_37_918 | 288 |
| 881 | iso_pu_bacteria | 2509276021 | 2509389142 | 288 |
| 882 | iso_pu_bacteria | 2509276033 | 2509444696 | 288 |
| 883 | iso_pu_bacteria | 2510065019 | 2510135519 | 288 |
| 884 | iso_pu_bacteria | 2510461076 | 2510896981 | 288 |
| 885 | iso_pu_bacteria | 2510917030 | 2511194386 | 288 |
| 886 | iso_pu_bacteria | 2513237084 | 2513570713 | 288 |
| 887 | iso_pu_bacteria | 2513237085 | 2513575068 | 288 |
| 888 | iso_pu_bacteria | 2513237093 | 2513633855 | 288 |
| 889 | iso_pu_bacteria | 2513237103 | 2513712996 | 288 |
| 890 | iso_pu_bacteria | 2513237144 | 2513912565 | 288 |
| 891 | iso_pu_bacteria | 2513237146 | 2513924190 | 288 |
| 892 | iso_pu_bacteria | 2513237162 | 2514023507 | 288 |
| 893 | iso_pu_bacteria | 2515075009 | 2515114709 | 288 |
| 894 | iso_pu_bacteria | 2515154113 | 2515636708 | 288 |
| 895 | iso_pu_bacteria | 2515154114 | 2515644879 | 288 |
| 896 | iso_pu_bacteria | 2515154116 | 2515661185 | 288 |
| 897 | iso_pu_bacteria | 2515154134 | 2515741294 | 288 |
| 898 | iso_pu_bacteria | 2516653077 | 2517038336 | 288 |
| 899 | iso_pu_bacteria | 2516653085 | 2517078614 | 288 |
| 900 | iso_pu_bacteria | 2517093000 | 2517097351 | 288 |
| 901 | iso_pu_bacteria | 2517287029 | 2517408804 | 288 |
| 902 | iso_pu_bacteria | 2582581298 | 2585223140 | 288 |
| 903 | iso_pu_bacteria | 2585427526 | 2585524071 | 288 |
| 904 | iso_pu_bacteria | 2585427528 | 2585543571 | 288 |
| 905 | iso_pu_bacteria | 2585427529 | 2585546264 | 288 |
| 906 | iso_pu_bacteria | 2585427593 | 2585841999 | 288 |
| 907 | iso_pu_bacteria | 2599185170 | 2599419857 | 288 |
| 908 | iso_pu_bacteria | 2615840624 | 2616294065 | 288 |
| 909 | iso_pu_bacteria | 2643221629 | 2644167350 | 288 |
| 910 | iso_pu_bacteria | 2643221662 | 2644349866 | 288 |
| 911 | iso_pu_bacteria | 2718217882 | 2719183223 | 288 |
| 912 | iso_pu_bacteria | 2718217927 | 2719387948 | 288 |
| 913 | iso_pu_bacteria | 2718217997 | 2719667565 | 288 |
| 914 | iso_pu_bacteria | 2718218009 | 2719733940 | 288 |
| 915 | iso_pu_bacteria | 2718218199 | 2720493985 | 288 |
| 916 | iso_pu_bacteria | 2718218232 | 2720615448 | 288 |
| 917 | iso_pu_bacteria | 2718218233 | 2720622232 | 288 |
| 918 | iso_pu_bacteria | 2718218235 | 2720633586 | 288 |
| 919 | iso_pu_bacteria | 2718218269 | 2720777286 | 288 |
| 920 | iso_pu_bacteria | 2718218363 | 2721149335 | 288 |
| 921 | iso_pu_bacteria | 2718218365 | 2721160737 | 288 |
| 922 | iso_pu_bacteria | 2718218366 | 2721166148 | 288 |
| 923 | iso_pu_bacteria | 2718218423 | 2721401581 | 288 |
| 924 | iso_pu_bacteria | 2721755514 | 2722842318 | 288 |
| 925 | iso_pu_bacteria | 2721755556 | 2723028884 | 288 |
| 926 | iso_pu_bacteria | 2721755684 | 2723562500 | 288 |
| 927 | iso_pu_bacteria | 2721755685 | 2723569193 | 288 |
| 928 | iso_pu_bacteria | 2721755809 | 2724040395 | 288 |
| 929 | iso_pu_bacteria | 2721755810 | 2724046696 | 288 |
| 930 | iso_pu_bacteria | 2721755819 | 2724091893 | 288 |
| 931 | iso_pu_bacteria | 2721755822 | 2724106458 | 288 |
| 932 | iso_pu_bacteria | 2721755823 | 2724112263 | 288 |
| 933 | iso_pu_bacteria | 2724679232 | 2725947219 | 288 |
| 934 | iso_pu_bacteria | 2728369352 | 2730109820 | 288 |
| 935 | iso_pu_bacteria | 2728369365 | 2730166458 | 288 |
| 936 | iso_pu_bacteria | 2728369397 | 2730300369 | 288 |
| 937 | iso_pu_bacteria | 2738541333 | 2739038818 | 288 |
| 938 | iso_pu_bacteria | 2765235942 | 2766067321 | 288 |
| 939 | iso_pu_bacteria | 2791355256 | 2793298346 | 288 |
| 940 | iso_pu_bacteria | 2791355259 | 2793315809 | 288 |
| 941 | iso_pu_bacteria | 2791355260 | 2793323594 | 288 |
| 942 | iso_pu_bacteria | 2791355261 | 2793330365 | 288 |
| 943 | iso_pu_bacteria | 2791355262 | 2793335530 | 288 |
| 944 | iso_pu_bacteria | 2791355263 | 2793340917 | 288 |
| 945 | iso_pu_bacteria | 2791355264 | 2793350900 | 288 |
| 946 | iso_pu_bacteria | 2791355265 | 2793354656 | 288 |
| 947 | iso_pu_bacteria | 2791355266 | 2793358648 | 288 |
| 948 | iso_pu_bacteria | 2791355267 | 2793369132 | 288 |
| 949 | iso_pu_bacteria | 2802429605 | 2805929027 | 288 |
| 950 | iso_pu_bacteria | 2802429606 | 2805934649 | 288 |
| 951 | iso_pu_bacteria | 2802429633 | 2806049228 | 288 |
| 952 | iso_pu_bacteria | 2802429634 | 2806056145 | 288 |
| 953 | iso_pu_bacteria | 2802429635 | 2806063153 | 288 |
| 954 | iso_pu_bacteria | 2802429636 | 2806070751 | 288 |
| 955 | iso_pu_bacteria | 2802429637 | 2806077612 | 288 |
| 956 | iso_pu_bacteria | 2838016132 | 2838020793 | 288 |
| 957 | iso_pu_bacteria | 2838022645 | 2838028210 | 288 |
| 958 | iso_pu_bacteria | 2838035591 | 2838039614 | 288 |
| 959 | iso_pu_bacteria | 2838042994 | 2838044971 | 288 |
| 960 | iso_pu_bacteria | 2838048938 | 2838053064 | 288 |
| 961 | iso_pu_bacteria | 2838061910 | 2838064855 | 288 |
| 962 | iso_pu_bacteria | 2838068647 | 2838070370 | 288 |
| 963 | iso_pu_bacteria | 2838661181 | 2838663886 | 288 |
| 964 | iso_pu_bacteria | 2838680041 | 2838685465 | 288 |
| 965 | iso_pu_bacteria | 2838686498 | 2838689956 | 288 |
| 966 | iso_pu_bacteria | 2838694306 | 2838696079 | 288 |
| 967 | iso_pu_bacteria | 2838707686 | 2838713478 | 288 |
| 968 | iso_pu_bacteria | 2841760612 | 2841765112 | 288 |
| 969 | iso_pu_bacteria | 2841851746 | 2841852829 | 288 |
| 970 | iso_pu_bacteria | 2841864319 | 2841870343 | 288 |
| 971 | iso_pu_bacteria | 2842077413 | 2842082712 | 288 |
| 972 | iso_pu_bacteria | 2842110456 | 2842112870 | 288 |
| 973 | iso_pu_bacteria | 2842118031 | 2842123729 | 288 |
| 974 | iso_pu_bacteria | 2842156927 | 2842160156 | 288 |
| 975 | iso_pu_bacteria | 2842163707 | 2842165865 | 288 |
| 976 | iso_pu_bacteria | 2842180545 | 2842184178 | 288 |
| 977 | iso_pu_bacteria | 2842192696 | 2842196490 | 288 |
| 978 | iso_pu_bacteria | 2842198810 | 2842204364 | 288 |
| 979 | iso_pu_bacteria | 2842205361 | 2842208781 | 288 |
| 980 | iso_pu_bacteria | 2842217011 | 2842219540 | 288 |
| 981 | iso_pu_bacteria | 2842229732 | 2842231760 | 288 |
| 982 | iso_pu_bacteria | 2842237096 | 2842242784 | 288 |
| 983 | iso_pu_bacteria | 2842243621 | 2842245738 | 288 |
| 984 | iso_pu_bacteria | 2842257432 | 2842260116 | 288 |
| 985 | iso_pu_bacteria | 2842264693 | 2842266997 | 288 |
| 986 | iso_pu_bacteria | 2842271015 | 2842273560 | 288 |
| 987 | iso_pu_bacteria | 2842278818 | 2842282529 | 288 |
| 988 | iso_pu_bacteria | 2842285085 | 2842289925 | 288 |
| 989 | iso_pu_bacteria | 2842291075 | 2842296857 | 288 |
| 990 | iso_pu_bacteria | 2842304105 | 2842308588 | 288 |
| 991 | iso_pu_bacteria | 2842311132 | 2842312102 | 288 |
| 992 | iso_pu_bacteria | 2842317721 | 2842321660 | 288 |
| 993 | iso_pu_bacteria | 2842341865 | 2842348227 | 288 |
| 994 | iso_pu_bacteria | 2842363717 | 2842367632 | 288 |
| 995 | iso_pu_bacteria | 2842370503 | 2842376150 | 288 |
| 996 | iso_pu_bacteria | 2842377471 | 2842383359 | 288 |
| 997 | iso_pu_bacteria | 2842384541 | 2842390492 | 288 |
| 998 | iso_pu_bacteria | 2842395702 | 2842397993 | 288 |
| 999 | iso_pu_bacteria | 2842402390 | 2842407534 | 288 |
| 1000 | iso_pu_bacteria | 2842409023 | 2842414165 | 288 |
| 1001 | iso_pu_bacteria | 2842415677 | 2842420975 | 288 |
| 1002 | iso_pu_bacteria | 2842422224 | 2842423984 | 288 |
| 1003 | iso_pu_bacteria | 2842428310 | 2842431307 | 288 |
| 1004 | iso_pu_bacteria | 2842434925 | 2842437642 | 288 |
| 1005 | iso_pu_bacteria | 2842441272 | 2842444457 | 288 |
| 1006 | iso_pu_bacteria | 2842447887 | 2842451119 | 288 |
| 1007 | iso_pu_bacteria | 2842462802 | 2842465450 | 288 |
| 1008 | iso_pu_bacteria | 2842469257 | 2842472081 | 288 |
| 1009 | iso_pu_bacteria | 2842495871 | 2842502110 | 288 |
| 1010 | iso_pu_bacteria | 2844104063 | 2844106722 | 288 |
| 1011 | iso_pu_bacteria | 2844454524 | 2844456704 | 288 |
| 1012 | iso_pu_bacteria | 2851182111 | 2851187718 | 288 |
| 1013 | iso_pu_bacteria | 2851246043 | 2851248762 | 288 |
| 1014 | iso_pu_bacteria | 2857516855 | 2857521005 | 288 |
| 1015 | iso_pu_bacteria | 2919100787 | 2919101983 | 288 |
| 1016 | iso_pu_bacteria | 2933016740 | 2933020585 | 288 |
| 1017 | iso_pu_bacteria | 2933570622 | 2933575036 | 288 |
| 1018 | iso_pu_bacteria | 2933586486 | 2933588240 | 288 |
| 1019 | iso_pu_bacteria | 2933599457 | 2933601174 | 288 |
| 1020 | iso_pu_bacteria | 2935894831 | 2935900096 | 288 |
| 1021 | iso_pu_bacteria | 2935901341 | 2935902209 | 288 |
| 1022 | iso_pu_bacteria | 2936367885 | 2936369656 | 288 |
| 1023 | iso_pu_bacteria | 2936375103 | 2936380394 | 288 |
| 1024 | iso_pu_bacteria | 2936381700 | 2936385139 | 288 |
| 1025 | iso_pu_bacteria | 2937822353 | 2937827152 | 288 |
| 1026 | iso_pu_bacteria | 2996893221 | 2996896243 | 288 |
| 1027 | iso_pu_bacteria | 3005409236 | 3005410515 | 288 |
| 1028 | iso_pu_bacteria | 3005445848 | 3005449949 | 288 |
| 1029 | iso_pu_bacteria | 8005275841 | 8005278148 | 288 |
| 1030 | iso_pu_bacteria | 8005282627 | 8005282824 | 288 |
| 1031 | iso_pu_bacteria | 8005289223 | 8005291766 | 288 |
| 1032 | iso_pu_bacteria | 8005301065 | 8005305367 | 288 |
| 1033 | iso_pu_bacteria | 8005307578 | 8005310139 | 288 |
| 1034 | iso_pu_bacteria | 8005376324 | 8005378213 | 288 |
| 1035 | iso_pu_bacteria | 8005382845 | 8005384239 | 288 |
| 1036 | iso_pu_bacteria | 8005395548 | 8005399485 | 288 |
| 1037 | iso_pu_bacteria | 8005430974 | 8005432404 | 288 |
| 1038 | iso_pu_bacteria | 8005460587 | 8005465404 | 288 |
| 1039 | iso_pu_bacteria | 8005497431 | 8005497956 | 288 |
| 1040 | iso_pu_bacteria | 8005556819 | 8005559853 | 288 |
| 1041 | iso_pu_bacteria | 8005563573 | 8005564649 | 288 |
| 1042 | iso_pu_bacteria | 8005570704 | 8005570983 | 288 |
| 1043 | iso_pu_bacteria | 8005619151 | 8005619172 | 288 |
| 1044 | iso_pu_bacteria | 8005626139 | 8005627735 | 288 |
| 1045 | iso_pu_bacteria | 8005668836 | 8005669363 | 288 |
| 1046 | iso_pu_bacteria | 8005688590 | 8005692880 | 288 |
| 1047 | iso_pu_bacteria | 8005695170 | 8005701619 | 288 |
| 1048 | iso_pu_bacteria | 8018127388 | 8018132429 | 288 |
| 1049 | iso_pu_bacteria | 8018163183 | 8018167111 | 288 |
| 1050 | iso_pu_bacteria | 8018176218 | 8018176763 | 288 |
| 1051 | iso_pu_bacteria | 8023680758 | 8023681385 | 288 |
| 1052 | iso_pu_bacteria | 8024479707 | 8024481782 | 288 |
| 1053 | iso_pu_bacteria | 8024501048 | 8024506215 | 288 |
| 1054 | iso_pu_bacteria | 8056375014 | 8056381336 | 288 |
| 1055 | iso_pu_bacteria | 8056382006 | 8056382793 | 288 |
| 1056 | iso_pu_bacteria | 8057874678 | 8057877237 | 288 |
| 1057 | 3300005578 | Ga0068854_100064409 | Ga0068854_1000644092 | 289 |
| 1058 | 3300005616 | Ga0068852_100002107 | Ga0068852_1000021077 | 289 |
| 1059 | 3300009093 | Ga0105240_10007818 | Ga0105240_100078188 | 289 |
| 1060 | 3300009174 | Ga0105241_10062149 | Ga0105241_100621492 | 289 |
| 1061 | 3300009545 | Ga0105237_10002420 | Ga0105237_1000242010 | 289 |
| 1062 | 3300010375 | Ga0105239_10388041 | Ga0105239_103880412 | 289 |
| 1063 | 3300010375 | Ga0105239_10430728 | Ga0105239_104307281 | 289 |
| 1064 | 3300014969 | Ga0157376_10293960 | Ga0157376_102939601 | 289 |
| 1065 | 3300025913 | Ga0207695_10000136 | Ga0207695_10000136111 | 289 |
| 1066 | 3300025914 | Ga0207671_10005950 | Ga0207671_100059502 | 289 |
| 1067 | 3300025981 | Ga0207640_10050225 | Ga0207640_100502253 | 289 |
| 1068 | 3300026142 | Ga0207698_10332056 | Ga0207698_103320562 | 289 |
| 1069 | 3300031548 | Ga0307408_100411623 | Ga0307408_1004116231 | 289 |
| 1070 | 3300031911 | Ga0307412_10324270 | Ga0307412_103242702 | 289 |
| 1071 | 3300033180 | Ga0307510_10081429 | Ga0307510_100814292 | 289 |
| 1072 | 3300033547 | Ga0316212_1007769 | Ga0316212_10077692 | 289 |
| 1073 | 3300046507 | Ga0495606_0018190 | Ga0495606_0018190_584_1456 | 289 |
| 1074 | 3300046524 | Ga0495648_0043505 | Ga0495648_0043505_432_1304 | 289 |
| 1075 | 3300046529 | Ga0495652_0146768 | Ga0495652_0146768_169_1041 | 289 |
| 1076 | 3300046690 | Ga0495624_0151270 | Ga0495624_0151270_250_1122 | 289 |
| 1077 | 3300047317 | Ga0495604_0025521 | Ga0495604_0025521_679_1551 | 289 |
| 1078 | 3300047472 | Ga0495686_0017404 | Ga0495686_0017404_2339_3211 | 289 |
| 1079 | 3300048927 | Ga0496124_0105128 | Ga0496124_0105128_885_1757 | 289 |
| 1080 | 3300049460 | Ga0495682_0079709 | Ga0495682_0079709_175_1047 | 289 |
| 1081 | 3300049571 | Ga0501034_0051191 | Ga0501034_0051191_1449_2333 | 289 |
| 1082 | 3300053119 | Ga0500595_051387 | Ga0500595_051387_389_1261 | 289 |
| 1083 | iso_pu_bacteria | 2643221557 | 2643809549 | 289 |
| 1084 | iso_pu_bacteria | 2643221668 | 2644375889 | 289 |
| 1085 | iso_pu_bacteria | 2920822456 | 2920827530 | 289 |
| 1086 | 3300006051 | Ga0075364_10019248 | Ga0075364_100192483 | 290 |
| 1087 | 3300006186 | Ga0075369_10130850 | Ga0075369_101308502 | 290 |
| 1088 | 3300046506 | Ga0495583_0007210 | Ga0495583_0007210_4214_5122 | 290 |
| 1089 | 3300046512 | Ga0495610_0017073 | Ga0495610_0017073_2770_3678 | 290 |
| 1090 | 3300046513 | Ga0495616_0007526 | Ga0495616_0007526_1856_2764 | 290 |
| 1091 | 3300046515 | Ga0495620_0000419 | Ga0495620_0000419_18635_19543 | 290 |
| 1092 | 3300046522 | Ga0495643_0008514 | Ga0495643_0008514_2243_3151 | 290 |
| 1093 | 3300046542 | Ga0495597_0009339 | Ga0495597_0009339_136_1044 | 290 |
| 1094 | 3300046660 | Ga0495625_0065711 | Ga0495625_0065711_511_1419 | 290 |
| 1095 | 3300046694 | Ga0495649_0004007 | Ga0495649_0004007_6040_6948 | 290 |
| 1096 | 3300047323 | Ga0495683_0002213 | Ga0495683_0002213_6432_7340 | 290 |
| 1097 | 3300047443 | Ga0495687_004605 | Ga0495687_004605_5039_5947 | 290 |
| 1098 | 3300048924 | Ga0496121_0041492 | Ga0496121_0041492_1573_2463 | 290 |
| 1099 | 3300050490 | nmdc:mga03n38_85912_c1 | nmdc:mga03n38_85912_c1_399_1274 | 290 |
| 1100 | 3300050496 | nmdc:mga07m45_48111_c1 | nmdc:mga07m45_48111_c1_1181_2056 | 290 |
| 1101 | 3300053153 | Ga0500616_0000187 | Ga0500616_0000187_56739_57647 | 290 |
| 1102 | 3300053156 | Ga0500622_0070275 | Ga0500622_0070275_806_1714 | 290 |
| 1103 | iso_pu_bacteria | 2510917022 | 2511133099 | 290 |
| 1104 | iso_pu_bacteria | 2524023209 | 2524458621 | 290 |
| 1105 | iso_pu_bacteria | 2582581307 | 2585271836 | 290 |
| 1106 | iso_pu_bacteria | 2582581308 | 2585279798 | 290 |
| 1107 | iso_pu_bacteria | 2582581315 | 2585326662 | 290 |
| 1108 | iso_pu_bacteria | 2582581316 | 2585333828 | 290 |
| 1109 | iso_pu_bacteria | 2585427527 | 2585531798 | 290 |
| 1110 | iso_pu_bacteria | 2585427530 | 2585551254 | 290 |
| 1111 | iso_pu_bacteria | 2585427531 | 2585563798 | 290 |
| 1112 | iso_pu_bacteria | 2585427608 | 2585897004 | 290 |
| 1113 | iso_pu_bacteria | 2585427609 | 2585907137 | 290 |
| 1114 | iso_pu_bacteria | 2585428125 | 2587982869 | 290 |
| 1115 | iso_pu_bacteria | 2615840626 | 2616306589 | 290 |
| 1116 | iso_pu_bacteria | 2615840698 | 2616551226 | 290 |
| 1117 | iso_pu_bacteria | 2617270742 | 2617382977 | 290 |
| 1118 | iso_pu_bacteria | 2667528174 | 2671113350 | 290 |
| 1119 | iso_pu_bacteria | 2775507266 | 2778179043 | 290 |
| 1120 | iso_pu_bacteria | 2818991448 | 2819611637 | 290 |
| 1121 | iso_pu_bacteria | 2818991453 | 2819638685 | 290 |
| 1122 | iso_pu_bacteria | 2838029111 | 2838031064 | 290 |
| 1123 | iso_pu_bacteria | 2842298080 | 2842300118 | 290 |
| 1124 | iso_pu_bacteria | 2842357229 | 2842359029 | 290 |
| 1125 | iso_pu_bacteria | 2842475841 | 2842477796 | 290 |
| 1126 | iso_pu_bacteria | 2842482326 | 2842485093 | 290 |
| 1127 | iso_pu_bacteria | 2842502639 | 2842504332 | 290 |
| 1128 | iso_pu_bacteria | 2842509118 | 2842511551 | 290 |
| 1129 | iso_pu_bacteria | 2852387548 | 2852391908 | 290 |
| 1130 | iso_pu_bacteria | 2874123672 | 2874128762 | 290 |
| 1131 | iso_pu_bacteria | 2919408235 | 2919411195 | 290 |
| 1132 | iso_pu_bacteria | 3005416602 | 3005421489 | 290 |
| 1133 | iso_pu_bacteria | 8005314921 | 8005319808 | 290 |
| 1134 | iso_pu_bacteria | 8005484373 | 8005490433 | 290 |
| 1135 | iso_pu_bacteria | 8005645114 | 8005647076 | 290 |
| 1136 | iso_pu_bacteria | 8005682033 | 8005687006 | 290 |
| 1137 | iso_pu_bacteria | 8046767195 | 8046767403 | 290 |
| 1138 | iso_pu_bacteria | 8057575449 | 8057578461 | 290 |
| 1139 | 3300021321 | Ga0214542_1021618 | Ga0214542_10216184 | 291 |
| 1140 | 3300021327 | Ga0214543_1009269 | Ga0214543_100926911 | 291 |
| 1141 | 3300022739 | Ga0228711_1000006 | Ga0228711_1000006175 | 291 |
| 1142 | 3300022740 | Ga0228710_1000004 | Ga0228710_1000004226 | 291 |
| 1143 | 3300025294 | Ga0209025_1021041 | Ga0209025_10210412 | 291 |
| 1144 | 3300025933 | Ga0207706_10236571 | Ga0207706_102365712 | 291 |
| 1145 | 3300027111 | Ga0209281_1000102 | Ga0209281_1000102158 | 291 |
| 1146 | 3300027111 | Ga0209281_1000563 | Ga0209281_100056317 | 291 |
| 1147 | 3300027666 | Ga0209282_1000013 | Ga0209282_1000013193 | 291 |
| 1148 | 3300031456 | Ga0307513_10081852 | Ga0307513_100818523 | 291 |
| 1149 | 3300031548 | Ga0307408_100291335 | Ga0307408_1002913352 | 291 |
| 1150 | 3300031967 | Ga0315914_1000004 | Ga0315914_1000004228 | 291 |
| 1151 | 3300031995 | Ga0307409_100220145 | Ga0307409_1002201452 | 291 |
| 1152 | 3300033430 | Ga0315913_1000055 | Ga0315913_100005521 | 291 |
| 1153 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003335 | 291 |
| 1154 | 3300042007 | Ga0439449_0035952 | Ga0439449_0035952_847_1734 | 291 |
| 1155 | 3300046452 | Ga0495617_031549 | Ga0495617_031549_315_1202 | 291 |
| 1156 | 3300046460 | Ga0495638_0000393 | Ga0495638_0000393_30808_31695 | 291 |
| 1157 | 3300046492 | Ga0495585_0018147 | Ga0495585_0018147_567_1454 | 291 |
| 1158 | 3300046512 | Ga0495610_0004797 | Ga0495610_0004797_1695_2579 | 291 |
| 1159 | 3300046518 | Ga0495631_0002319 | Ga0495631_0002319_4969_5856 | 291 |
| 1160 | 3300046543 | Ga0495645_0018535 | Ga0495645_0018535_3210_4097 | 291 |
| 1161 | 3300046660 | Ga0495625_0001497 | Ga0495625_0001497_15254_16141 | 291 |
| 1162 | 3300047320 | Ga0495672_0028222 | Ga0495672_0028222_2385_3272 | 291 |
| 1163 | 3300047443 | Ga0495687_105285 | Ga0495687_105285_118_1002 | 291 |
| 1164 | 3300049572 | Ga0501036_0264158 | Ga0501036_0264158_480_1373 | 291 |
| 1165 | 3300049581 | Ga0501047_0173948 | Ga0501047_0173948_213_1106 | 291 |
| 1166 | 3300049822 | Ga0501035_0519569 | Ga0501035_0519569_72_965 | 291 |
| 1167 | 3300053104 | Ga0500556_0115066 | Ga0500556_0115066_149_1036 | 291 |
| 1168 | 3300053118 | Ga0500594_0005833 | Ga0500594_0005833_863_1750 | 291 |
| 1169 | 3300053153 | Ga0500616_0003602 | Ga0500616_0003602_10503_11390 | 291 |
| 1170 | 3300053153 | Ga0500616_0085813 | Ga0500616_0085813_567_1460 | 291 |
| 1171 | 3300053158 | Ga0500627_0035582 | Ga0500627_0035582_1086_1973 | 291 |
| 1172 | 3300003775 | Ga0055524_1014466 | Ga0055524_10144662 | 292 |
| 1173 | 3300013250 | Ga0171462_1067 | Ga0171462_10678 | 292 |
| 1174 | 3300025294 | Ga0209025_1006010 | Ga0209025_10060105 | 292 |
| 1175 | 3300041413 | Ga0439465_0008671 | Ga0439465_0008671_2023_2910 | 292 |
| 1176 | 3300042004 | Ga0439445_0027998 | Ga0439445_0027998_306_1193 | 292 |
| 1177 | 3300042007 | Ga0439449_0031779 | Ga0439449_0031779_1006_1893 | 292 |
| 1178 | 3300046476 | Ga0495662_0015516 | Ga0495662_0015516_1245_2123 | 292 |
| 1179 | 3300047317 | Ga0495604_0054994 | Ga0495604_0054994_636_1514 | 292 |
| 1180 | iso_pu_bacteria | 2558860983 | 2561467604 | 293 |
| 1181 | 3300001979 | JGI24740J21852_10026791 | JGI24740J21852_100267912 | 294 |
| 1182 | 3300002704 | JGI25155J39150_1000004 | JGI25155J39150_1000004128 | 294 |
| 1183 | 3300002705 | JGI25156J39149_1000014 | JGI25156J39149_100001452 | 294 |
| 1184 | 3300002705 | JGI25156J39149_1000015 | JGI25156J39149_100001544 | 294 |
| 1185 | 3300002737 | JGI25162J39368_1001203 | JGI25162J39368_100120311 | 294 |
| 1186 | 3300002737 | JGI25162J39368_1002942 | JGI25162J39368_10029423 | 294 |
| 1187 | 3300002738 | JGI25154J39366_1000026 | JGI25154J39366_100002656 | 294 |
| 1188 | 3300002741 | JGI25157J39369_1000005 | JGI25157J39369_1000005135 | 294 |
| 1189 | 3300002987 | JGI25159J45721_1000242 | JGI25159J45721_100024213 | 294 |
| 1190 | 3300003214 | JGI25165J46597_1001246 | JGI25165J46597_10012463 | 294 |
| 1191 | 3300003214 | JGI25165J46597_1002528 | JGI25165J46597_10025283 | 294 |
| 1192 | 3300003322 | rootL2_10112950 | rootL2_101129505 | 294 |
| 1193 | 3300003323 | rootH1_10078778 | rootH1_100787782 | 294 |
| 1194 | 3300003354 | JGI25160J50197_1000022 | JGI25160J50197_100002239 | 294 |
| 1195 | 3300003374 | JGI25161J50226_1000024 | JGI25161J50226_100002493 | 294 |
| 1196 | 3300004625 | Ga0055543_1000025 | Ga0055543_100002539 | 294 |
| 1197 | 3300005262 | Ga0065165_1000200 | Ga0065165_100020039 | 294 |
| 1198 | 3300005548 | Ga0070665_100250452 | Ga0070665_1002504522 | 294 |
| 1199 | 3300005614 | Ga0068856_100008285 | Ga0068856_1000082854 | 294 |
| 1200 | 3300006048 | Ga0075363_100017783 | Ga0075363_1000177832 | 294 |
| 1201 | 3300006353 | Ga0075370_10010473 | Ga0075370_100104733 | 294 |
| 1202 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013361 | 294 |
| 1203 | 3300009545 | Ga0105237_10010647 | Ga0105237_100106471 | 294 |
| 1204 | 3300013104 | Ga0157370_10003431 | Ga0157370_1000343115 | 294 |
| 1205 | 3300015262 | Ga0182007_10006551 | Ga0182007_100065512 | 294 |
| 1206 | 3300015265 | Ga0182005_1001647 | Ga0182005_10016474 | 294 |
| 1207 | 3300025206 | Ga0209435_100009 | Ga0209435_100009132 | 294 |
| 1208 | 3300025228 | Ga0209672_102531 | Ga0209672_1025313 | 294 |
| 1209 | 3300025233 | Ga0209437_100057 | Ga0209437_100057341 | 294 |
| 1210 | 3300025233 | Ga0209437_100772 | Ga0209437_1007723 | 294 |
| 1211 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018132 | 294 |
| 1212 | 3300025246 | Ga0209646_1010000 | Ga0209646_10100002 | 294 |
| 1213 | 3300025250 | Ga0209026_1000043 | Ga0209026_1000043132 | 294 |
| 1214 | 3300025253 | Ga0209677_100426 | Ga0209677_1004268 | 294 |
| 1215 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007132 | 294 |
| 1216 | 3300025256 | Ga0209759_1020957 | Ga0209759_10209572 | 294 |
| 1217 | 3300025261 | Ga0209233_1000130 | Ga0209233_1000130143 | 294 |
| 1218 | 3300025261 | Ga0209233_1000255 | Ga0209233_100025524 | 294 |
| 1219 | 3300025261 | Ga0209233_1000332 | Ga0209233_100033238 | 294 |
| 1220 | 3300025284 | Ga0209130_1000164 | Ga0209130_100016452 | 294 |
| 1221 | 3300025302 | Ga0207426_1000082 | Ga0207426_100008252 | 294 |
| 1222 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044318 | 294 |
| 1223 | 3300025914 | Ga0207671_10000043 | Ga0207671_10000043170 | 294 |
| 1224 | 3300026078 | Ga0207702_10006190 | Ga0207702_100061906 | 294 |
| 1225 | 3300027312 | Ga0209371_1001347 | Ga0209371_10013475 | 294 |
| 1226 | 3300030500 | Ga0268256_1001200 | Ga0268256_100120011 | 294 |
| 1227 | 3300046507 | Ga0495606_0001613 | Ga0495606_0001613_14482_15366 | 294 |
| 1228 | 3300059605 | Ga0587106_000487 | Ga0587106_000487_560_1444 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
116
302
0.85
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tqu-assembly1.cif.gz_N | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8672 | 18 | 281 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8592 | 14 | 282 |
| 3fh6-assembly2.cif.gz_I | crystal structure of the resting state maltose transporter from e. coli | 0.8539 | 13 | 284 |
| 3fh6-assembly2.cif.gz_I | crystal structure of the resting state maltose transporter from e. coli | 0.8477 | 13 | 284 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.8304 | 20 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9482 | 21 | 284 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9361 | 21 | 278 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9281 | 21 | 284 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9207 | 21 | 284 | 1.10.3720.10 |
| af_Q2G1E7_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9173 | 21 | 280 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0HFA4-F1-model_v4 | deleted | 0.9823 | 24 | 294 |
|
| AF-A0A4Q3HBY0-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9822 | 72 | 294 |
GO:0005886
GO:0055085 |
| AF-A0A402AR11-F1-model_v4 | ABC transporter permease | 0.981 | 46 | 294 |
GO:0005886
GO:0055085 |
| AF-A0A7Y2M325-F1-model_v4 | deleted | 0.9798 | 46 | 294 |
|
| AF-H0HFA4-F1-model_v4 | deleted | 0.9752 | 24 | 294 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar