F491965

General Info

Members Datasets Scaffolds Average Seq Length
1228 870 672 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862705112|2862708551
Length 307
Sequence ATAPVRGPRQVGGPRRPGRPRRPLFGNRPTRSPLLRALVKHSVMIITLTLMLYPLLWMFGASLRPDNQVFTTLGLWGSDLTLDNYAAGWSGGDQLNFSRFFLNSLTITVLSIVGNLLACALTAYAFARLEFRFKKTLFALVIGTLLLPYHVTLVPQYILFNQLGWVNTILPLVVPKFLATDAFFIFLMVQFIRALPSSLDDAARIDGCGHWGIFWRVVMPLSIPALGTSALFTFINTWNDFLGPMLYLTEPDSWTVSQGLASFLDATGQSAYGSLFAMSTLSLVPVLGFFVAAQKLLVEGIATSGLK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860280 Kutzneria sp. 744 Isolate Unclassified
65 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
66 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
67 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
68 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
69 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
70 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
76 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
77 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
78 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
79 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
80 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
81 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
82 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
83 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
84 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
85 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
86 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
87 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
88 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
89 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
90 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
91 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
92 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
93 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
94 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
95 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
96 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
97 2643221557 Ensifer sp. Root558 Isolate Unclassified
98 2643221580 Devosia sp. Root635 Isolate Unclassified
99 2643221582 Rhizobium sp. Root651 Isolate Unclassified
100 2643221591 Devosia sp. Root685 Isolate Unclassified
101 2643221599 Rhizobium sp. Root708 Isolate Unclassified
102 2643221618 Ensifer sp. Root231 Isolate Unclassified
103 2643221626 Ensifer sp. Root31 Isolate Unclassified
104 2643221629 Devosia sp. Root105 Isolate Unclassified
105 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
106 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
107 2643221655 Ensifer sp. Root1252 Isolate Unclassified
108 2643221659 Ensifer sp. Root127 Isolate Unclassified
109 2643221662 Devosia sp. Root413D1 Isolate Unclassified
110 2643221668 Ensifer sp. Root423 Isolate Unclassified
111 2643221674 Devosia sp. Root436 Isolate Unclassified
112 2643221693 Rhizobium sp. Root491 Isolate Unclassified
113 2643221698 Ensifer sp. Root142 Isolate Unclassified
114 2643221712 Ensifer sp. Root258 Isolate Unclassified
115 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
116 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
117 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
118 2718217882 Rhizobium sp. N741 Isolate Nodule
119 2718217927 Rhizobium sp. N324 Isolate Nodule
120 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
121 2718218009 Rhizobium sp. N561 Isolate Nodule
122 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
123 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
124 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
125 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
126 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
127 2718218363 Rhizobium sp. N113 Isolate Nodule
128 2718218365 Rhizobium sp. N731 Isolate Nodule
129 2718218366 Rhizobium sp. N621 Isolate Nodule
130 2718218423 Rhizobium sp. N941 Isolate Nodule
131 2721755514 Rhizobium sp. N6212 Isolate Nodule
132 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
133 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
134 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
135 2721755809 Rhizobium sp. N541 Isolate Nodule
136 2721755810 Rhizobium sp. N871 Isolate Nodule
137 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
138 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
139 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
140 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
141 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
142 2728369365 Rhizobium sp. N1341 Isolate Nodule
143 2728369397 Rhizobium sp. N1314 Isolate Nodule
144 2738541293 Rhizobium sp. GV031 Isolate Unclassified
145 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
146 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
147 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
148 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
149 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
150 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
151 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
152 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
153 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
154 2791355256 Rhizobium sp. M10 Isolate Nodule
155 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
156 2791355260 Rhizobium sp. L9 Isolate Nodule
157 2791355261 Rhizobium sp. J15 Isolate Nodule
158 2791355262 Rhizobium sp. M1 Isolate Nodule
159 2791355263 Rhizobium chutanense C5 Isolate Nodule
160 2791355264 Rhizobium sp. S9 Isolate Nodule
161 2791355265 Rhizobium sp. H4 Isolate Nodule
162 2791355266 Rhizobium sp. L43 Isolate Nodule
163 2791355267 Rhizobium sp. L18 Isolate Nodule
164 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
165 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
166 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
167 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
168 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
169 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
170 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
171 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
172 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
173 2802429633 Rhizobium anhuiense J3 Isolate Nodule
174 2802429634 Rhizobium anhuiense S10 Isolate Nodule
175 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
176 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
177 2802429637 Rhizobium anhuiense C15 Isolate Nodule
178 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
179 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
180 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
181 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
182 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
183 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
184 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
185 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
186 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
187 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
188 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
189 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
190 2838048938 Rhizobium pisi 27/80 Isolate Nodule
191 2838061910 Rhizobium phaseoli L15 Isolate Nodule
192 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
193 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
194 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
195 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
196 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
197 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
198 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
199 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
200 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
201 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
202 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
203 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
204 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
205 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
206 2841760612 Bosea sp. Tri-49 Isolate Nodule
207 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
208 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
209 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
210 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
211 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
212 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
213 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
214 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
215 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
216 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
217 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
218 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
219 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
220 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
221 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
222 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
223 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
224 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
225 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
226 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
227 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
228 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
229 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
230 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
231 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
232 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
233 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
234 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
235 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
236 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
237 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
238 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
239 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
240 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
241 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
242 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
243 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
244 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
245 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
246 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
247 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
248 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
249 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
250 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
251 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
252 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
253 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
254 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
255 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
256 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
257 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
258 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
259 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
260 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
261 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
262 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
263 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
264 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
265 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
266 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
267 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
268 2844104063 Bosea sp. Tri-39 Isolate Nodule
269 2844163670 Ensifer sp. 1H6 Isolate Unclassified
270 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
271 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
272 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
273 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
274 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
275 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
276 2851182111 Bosea sp. Tri-44 Isolate Nodule
277 2851246043 Bosea sp. Tri-54 Isolate Nodule
278 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
279 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
280 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
281 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
282 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
283 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
284 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
285 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
286 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
287 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
288 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
289 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
290 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
291 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
292 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
293 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
294 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
295 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
296 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
297 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
298 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
299 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
300 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
301 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
302 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
303 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
304 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
305 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
306 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
307 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
308 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
309 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
310 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
311 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
312 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
313 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
314 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
315 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
316 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
317 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
318 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
319 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
320 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
321 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
322 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
323 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
324 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
325 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
326 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
327 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
328 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
329 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
330 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
331 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
332 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
333 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
334 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
335 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
336 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
337 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
338 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
339 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
340 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
341 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
342 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
343 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
344 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
345 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
346 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
347 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
348 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
349 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
350 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
351 2933599457 Rhizobium phaseoli M3 Isolate Nodule
352 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
353 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
354 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
355 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
356 2936381700 Rhizobium chutanense C16 Isolate Unclassified
357 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
358 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
359 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
360 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
361 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
362 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
363 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
364 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
365 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
366 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
367 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
368 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
369 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
370 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
371 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
372 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
373 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
374 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
375 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
376 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
377 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
378 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
379 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
380 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
381 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
382 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
383 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
384 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
385 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
386 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
387 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
388 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
389 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
390 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
391 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
392 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
393 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
394 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
395 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
396 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
397 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
398 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
399 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
400 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
401 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
402 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
403 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
404 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
405 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
406 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
407 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
408 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
409 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
410 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
411 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
412 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
413 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
414 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
415 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
416 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
417 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
418 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
419 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
420 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
421 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
422 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
423 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
424 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
425 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
426 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
427 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
428 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
429 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
430 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
431 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
432 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
433 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
434 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
435 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
436 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
437 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
438 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
439 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
440 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
441 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
442 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
443 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
444 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
445 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
446 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
447 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
448 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
449 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
450 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
451 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
452 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
453 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
454 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
455 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
456 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
457 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
458 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
459 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
460 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
461 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
462 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
463 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
464 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
465 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
466 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
467 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
468 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
469 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
470 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
471 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
472 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
473 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
474 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
475 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
476 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
477 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
478 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
479 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
480 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
481 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
482 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
483 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
484 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
485 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
486 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
487 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
488 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
489 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
490 2996887358 Rhizobium sp. R711 Isolate Nodule
491 2996893221 Rhizobium sp. R635 Isolate Nodule
492 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
493 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
494 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
495 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
496 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
497 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
498 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
499 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
500 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
501 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
502 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
503 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
504 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
505 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
506 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
507 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
508 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
509 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
510 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
511 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
512 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
513 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
514 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
515 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
516 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
517 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
518 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
519 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
520 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
521 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
522 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
523 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
524 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
525 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
526 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
527 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
528 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
529 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
530 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
531 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
532 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
533 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
534 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
535 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
536 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
537 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
538 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
539 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
540 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
541 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
542 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
543 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
544 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
545 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
546 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
547 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
548 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
549 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
550 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
551 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
552 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
553 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
554 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
555 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
556 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
557 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
558 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
559 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
560 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
561 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
562 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
563 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
564 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
565 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
566 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
567 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
568 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
569 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
570 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
571 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
572 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
573 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
574 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
575 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
576 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
577 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
578 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
579 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
580 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
581 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
582 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
583 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
584 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
585 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
586 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
587 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
588 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
589 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
590 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
591 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
592 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
593 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
594 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
595 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
596 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
597 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
598 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
599 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
600 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
602 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
603 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
604 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
605 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
606 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
607 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
608 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
609 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
610 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
611 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
612 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
613 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
614 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
615 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
616 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
617 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
618 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
620 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
621 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
622 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
645 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
646 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
649 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
650 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
651 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
654 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
655 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
656 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
657 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
660 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
661 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
662 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
663 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
664 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
665 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
666 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
667 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
668 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
669 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
670 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
671 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
672 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
673 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
674 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
675 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
676 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
677 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
678 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
679 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
680 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
681 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
682 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
683 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
684 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
685 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
686 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
687 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
688 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
689 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
690 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
691 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
692 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
693 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
694 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
695 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
696 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
697 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
698 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
699 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
700 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
701 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
702 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
703 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
704 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
705 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
706 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
707 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
708 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
709 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
710 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
711 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
712 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
713 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
714 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
715 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
716 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
717 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
718 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
719 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
720 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
721 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
722 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
723 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
724 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
725 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
726 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
727 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
728 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
729 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
730 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
731 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
732 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
733 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
734 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
735 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
736 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
737 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
738 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
739 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
740 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
741 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
742 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
743 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
744 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
745 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
746 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
747 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
748 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
749 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
750 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
751 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
752 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
753 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
754 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
755 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
756 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
757 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
758 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
759 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
760 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
761 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
762 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
763 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
764 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
765 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
766 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
767 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
768 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
769 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
770 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
771 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
772 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
773 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
774 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
775 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
776 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
777 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
778 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
779 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
780 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
781 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
782 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
783 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
784 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
785 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
786 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
787 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
788 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
789 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
790 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
791 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
792 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
793 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
794 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
795 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
796 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
797 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
798 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
799 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
800 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
801 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
802 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
803 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
804 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
805 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
806 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
807 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
808 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
809 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
810 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
811 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
812 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
813 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
814 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
815 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
816 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
817 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
818 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
819 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
820 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
821 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
822 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
823 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
824 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
825 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
826 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
827 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
828 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
829 8005258706 Rhizobium sp. R693 Isolate Nodule
830 8005275841 Rhizobium sp. N4311 Isolate Nodule
831 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
832 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
833 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
834 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
835 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
836 8005321885 Rhizobium sp. R72 Isolate Nodule
837 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
838 8005382845 Rhizobium sp. R634 Isolate Nodule
839 8005395548 Rhizobium sp. R339 Isolate Nodule
840 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
841 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
842 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
843 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
844 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
845 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
846 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
847 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
848 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
849 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
850 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
851 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
852 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
853 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
854 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
855 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
856 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
857 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
858 8018176218 Rhizobium sp. N122 Isolate Nodule
859 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
860 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
861 8024501048 Rhizobium sp. H4 Isolate Nodule
862 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
863 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
864 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
865 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
866 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
867 8056382006 Rhizobium croatiense 13T Isolate Nodule
868 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
869 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
870 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.64
Metatranscriptomes 0.16
Isolates 45.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 17.59
Nodule 35.42
Rhizoplane 1.38
Rhizosphere 32.41
Stem 0
Stem Tuber 0
Unclassified 12.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026791 3300001979 Bacteria 1926
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1001203 3300002737 Bacteria 15095
6 JGI25162J39368_1002942 3300002737 Bacteria 5755
7 JGI25154J39366_1000026 3300002738 Bacteria 200613
8 JGI25158J39367_1000160 3300002739 Bacteria 16034
9 JGI25157J39369_1000005 3300002741 Bacteria 269089
10 JGI25152J39213_1000493 3300002773 Bacteria 22302
11 JGI25152J39213_1000861 3300002773 Bacteria 14974
12 JGI25152J39213_1001207 3300002773 Bacteria 11855
13 JGI25152J39213_1001531 3300002773 Bacteria 9827
14 JGI25152J39213_1002263 3300002773 Bacteria 7434
15 JGI25150J39212_1000355 3300002774 Bacteria 22476
16 JGI25150J39212_1009798 3300002774 Bacteria 1808
17 JGI25150J39212_1013415 3300002774 Bacteria 1421
18 JGI25159J45721_1000242 3300002987 Bacteria 25793
19 JGI25159J45721_1000711 3300002987 Bacteria 14533
20 JGI25151J46595_10000409 3300003187 Bacteria 44077
21 JGI25151J46595_10000946 3300003187 Bacteria 22420
22 JGI25151J46595_10001865 3300003187 Bacteria 13494
23 JGI25151J46595_10004033 3300003187 Bacteria 7876
24 JGI25151J46595_10014430 3300003187 Bacteria 3520
25 JGI25165J46597_1001246 3300003214 Bacteria 15061
26 JGI25165J46597_1002528 3300003214 Bacteria 5747
27 JGI25165J46597_1004993 3300003214 Bacteria 2662
28 JGI25153J46596_10001894 3300003215 Bacteria 12408
29 JGI25153J46596_10007757 3300003215 Bacteria 5221
30 JGI25153J46596_10008884 3300003215 Bacteria 4743
31 JGI25153J46596_10065292 3300003215 Bacteria 968
32 rootL2_10007443 3300003322 Bacteria 3105
33 rootL2_10112950 3300003322 Bacteria 7748
34 rootH1_10078778 3300003323 Bacteria 1325
35 rootH1_10129646 3300003323 Bacteria 1181
36 JGI25160J50197_1000022 3300003354 Bacteria 201071
37 JGI25160J50197_1002301 3300003354 Bacteria 8957
38 JGI25160J50197_1002712 3300003354 Bacteria 8141
39 JGI25161J50226_1000024 3300003374 Bacteria 152176
40 JGI25161J50226_1000206 3300003374 Bacteria 38371
41 JGI25161J50226_1006719 3300003374 Bacteria 2038
42 Ga0055526_1000489 3300003771 Bacteria 31492
43 Ga0055526_1000926 3300003771 Bacteria 21784
44 Ga0055526_1004307 3300003771 Bacteria 8599
45 Ga0055526_1013134 3300003771 Bacteria 3534
46 Ga0055526_1018821 3300003771 Bacteria 2553
47 Ga0055524_1003779 3300003775 Bacteria 7202
48 Ga0055524_1005189 3300003775 Bacteria 5867
49 Ga0055524_1005277 3300003775 Bacteria 5803
50 Ga0055524_1014466 3300003775 Bacteria 2922
51 Ga0055536_1009179 3300003781 Bacteria 4132
52 Ga0055528_1000464 3300003790 Bacteria 32427
53 Ga0055528_1000478 3300003790 Bacteria 31939
54 Ga0055528_1001760 3300003790 Bacteria 12455
55 Ga0055528_1002389 3300003790 Bacteria 10126
56 Ga0055528_1011321 3300003790 Bacteria 3553
57 Ga0055528_1021586 3300003790 Bacteria 2037
58 Ga0055540_1000320 3300003792 Bacteria 42457
59 Ga0055540_1003981 3300003792 Bacteria 6880
60 Ga0058692_1002641 3300003856 Bacteria 5903
61 Ga0058692_1007147 3300003856 Bacteria 2991
62 Ga0055543_1000025 3300004625 Bacteria 137886
63 Ga0055543_1000248 3300004625 Bacteria 41302
64 Ga0055543_1002104 3300004625 Bacteria 6913
65 Ga0065165_1000200 3300005262 Bacteria 103564
66 Ga0065165_1001128 3300005262 Bacteria 31425
67 Ga0065165_1001369 3300005262 Bacteria 26829
68 Ga0065165_1006963 3300005262 Bacteria 5725
69 Ga0065165_1035870 3300005262 Bacteria 1518
70 Ga0065704_10166279 3300005289 Bacteria 1320
71 Ga0070658_10086291 3300005327 Bacteria 2582
72 Ga0070658_10297277 3300005327 Bacteria 1376
73 Ga0070658_10495653 3300005327 Bacteria 1055
74 Ga0070658_10669075 3300005327 Bacteria 901
75 Ga0070666_10137792 3300005335 Bacteria 1699
76 Ga0070682_100111494 3300005337 Bacteria 1824
77 Ga0068868_100461933 3300005338 Bacteria 1106
78 Ga0070660_100001762 3300005339 Bacteria 14850
79 Ga0070668_100007262 3300005347 Bacteria 8215
80 Ga0070668_100031244 3300005347 Bacteria 4051
81 Ga0070668_100046535 3300005347 Bacteria 3332
82 Ga0070669_100036316 3300005353 Bacteria 3570
83 Ga0070669_100451166 3300005353 Bacteria 1060
84 Ga0070671_100017417 3300005355 Bacteria 5819
85 Ga0070671_100057348 3300005355 Bacteria 3240
86 Ga0070673_100436412 3300005364 Bacteria 1176
87 Ga0070659_100256225 3300005366 Bacteria 1451
88 Ga0070667_100300329 3300005367 Bacteria 1446
89 Ga0070714_100356364 3300005435 Bacteria 1375
90 Ga0070710_10000347 3300005437 Bacteria 22041
91 Ga0070663_100076567 3300005455 Bacteria 2447
92 Ga0070678_100282533 3300005456 Bacteria 1404
93 Ga0070679_100174329 3300005530 Bacteria 2123
94 Ga0070679_100314869 3300005530 Bacteria 1515
95 Ga0068853_100000565 3300005539 Bacteria 25355
96 Ga0068853_100133742 3300005539 Bacteria 2222
97 Ga0070672_100340495 3300005543 Bacteria 1277
98 Ga0070665_100002585 3300005548 Bacteria 19803
99 Ga0070665_100250452 3300005548 Bacteria 1772
100 Ga0070665_100264906 3300005548 Bacteria 1720
101 Ga0068855_100174023 3300005563 Bacteria 2437
102 Ga0068855_100174184 3300005563 Bacteria 2435
103 Ga0068855_100412760 3300005563 Bacteria 1478
104 Ga0068857_100523358 3300005577 Bacteria 1115
105 Ga0068854_100064409 3300005578 Bacteria 2663
106 Ga0068856_100008285 3300005614 Bacteria 10132
107 Ga0068852_100002107 3300005616 Bacteria 13607
108 Ga0068852_100693968 3300005616 Bacteria 1028
109 Ga0068864_100629438 3300005618 Bacteria 1043
110 Ga0068858_100113296 3300005842 Bacteria 2533
111 Ga0068862_100436295 3300005844 Bacteria 1232
112 Ga0068862_100459150 3300005844 Bacteria 1202
113 Ga0081455_10331566 3300005937 Bacteria 1080
114 Ga0081540_1024832 3300005983 Bacteria 3467
115 Ga0075365_10001348 3300006038 Bacteria 11002
116 Ga0075365_10002567 3300006038 Bacteria 8967
117 Ga0075365_10004465 3300006038 Bacteria 7415
118 Ga0075365_10019507 3300006038 Bacteria 4187
119 Ga0075363_100017783 3300006048 Bacteria 3531
120 Ga0075363_100085685 3300006048 Bacteria 1729
121 Ga0075364_10019248 3300006051 Bacteria 4283
122 Ga0075364_10023714 3300006051 Bacteria 3887
123 Ga0075364_10030856 3300006051 Bacteria 3442
124 Ga0075364_10075249 3300006051 Bacteria 2228
125 Ga0075362_10010334 3300006177 Bacteria 3642
126 Ga0075362_10024045 3300006177 Bacteria 2582
127 Ga0075362_10024504 3300006177 Bacteria 2560
128 Ga0075362_10064807 3300006177 Bacteria 1658
129 Ga0075367_10001293 3300006178 Bacteria 10595
130 Ga0075367_10005583 3300006178 Bacteria 6265
131 Ga0075367_10031396 3300006178 Bacteria 3050
132 Ga0075367_10052945 3300006178 Bacteria 2404
133 Ga0075369_10005102 3300006186 Bacteria 4890
134 Ga0075369_10008926 3300006186 Bacteria 3878
135 Ga0075369_10016107 3300006186 Bacteria 3010
136 Ga0075369_10021032 3300006186 Bacteria 2677
137 Ga0075369_10047809 3300006186 Bacteria 1845
138 Ga0075369_10130850 3300006186 Bacteria 1140
139 Ga0075366_10121241 3300006195 Bacteria 1576
140 Ga0075370_10003397 3300006353 Bacteria 7569
141 Ga0075370_10010473 3300006353 Bacteria 4848
142 Ga0075370_10230185 3300006353 Bacteria 1097
143 Ga0075428_100007760 3300006844 Bacteria 11891
144 Ga0075428_100008766 3300006844 Bacteria 11220
145 Ga0075428_100015954 3300006844 Bacteria 8312
146 Ga0075430_100004866 3300006846 Bacteria 11302
147 Ga0075430_100013807 3300006846 Bacteria 6882
148 Ga0075430_100149217 3300006846 Bacteria 1947
149 Ga0075431_100013114 3300006847 Bacteria 8375
150 Ga0075431_100187367 3300006847 Bacteria 2121
151 Ga0075429_100014301 3300006880 Bacteria 6882
152 Ga0075429_100120586 3300006880 Bacteria 2292
153 Ga0099826_10000040 3300006948 Bacteria 98176
154 Ga0105240_10000013 3300009093 Bacteria 483458
155 Ga0105240_10007818 3300009093 Bacteria 15442
156 Ga0105240_10139857 3300009093 Bacteria 2895
157 Ga0105247_10009605 3300009101 Bacteria 5871
158 Ga0114129_10004136 3300009147 Bacteria 20497
159 Ga0114129_10006996 3300009147 Bacteria 16060
160 Ga0114129_10069404 3300009147 Bacteria 4912
161 Ga0114129_10172676 3300009147 Bacteria 2946
162 Ga0105243_10028578 3300009148 Bacteria 4281
163 Ga0105243_10072373 3300009148 Bacteria 2790
164 Ga0105243_10133392 3300009148 Bacteria 2110
165 Ga0105243_10400584 3300009148 Bacteria 1275
166 Ga0105241_10049194 3300009174 Bacteria 3210
167 Ga0105241_10062149 3300009174 Bacteria 2878
168 Ga0105248_10009144 3300009177 Bacteria 10897
169 Ga0105248_10081859 3300009177 Bacteria 3629
170 Ga0105237_10000071 3300009545 Bacteria 135695
171 Ga0105237_10002420 3300009545 Bacteria 23173
172 Ga0105237_10010647 3300009545 Bacteria 9772
173 Ga0105237_10016814 3300009545 Bacteria 7593
174 Ga0105237_10376657 3300009545 Bacteria 1424
175 Ga0105238_10051937 3300009551 Bacteria 4122
176 Ga0105249_10082542 3300009553 Bacteria 2991
177 Ga0123341_1000097 3300009765 Bacteria 37335
178 Ga0123342_1020788 3300009766 Bacteria 4728
179 Ga0105035_100701 3300009988 Bacteria 2095
180 Ga0105028_109017 3300009993 Bacteria 1044
181 Ga0105239_10001189 3300010375 Bacteria 35605
182 Ga0105239_10388041 3300010375 Bacteria 1579
183 Ga0105239_10430728 3300010375 Bacteria 1495
184 Ga0105246_10080022 3300011119 Bacteria 2325
185 Ga0105246_10248696 3300011119 Bacteria 1410
186 Ga0157326_1006039 3300012513 Bacteria 1289
187 Ga0157373_10111877 3300013100 Bacteria 1920
188 Ga0157371_10000042 3300013102 Bacteria 198938
189 Ga0157370_10000035 3300013104 Bacteria 137103
190 Ga0157370_10003431 3300013104 Bacteria 18611
191 Ga0157369_10064646 3300013105 Bacteria 3939
192 Ga0157369_10098498 3300013105 Bacteria 3118
193 Ga0157369_10234860 3300013105 Bacteria 1916
194 Ga0171463_1002 3300013249 Bacteria 1274851
195 Ga0171462_1067 3300013250 Bacteria 13661
196 Ga0157374_10040993 3300013296 Bacteria 4264
197 Ga0157374_10118195 3300013296 Bacteria 2556
198 Ga0163163_10028230 3300014325 Bacteria 5386
199 Ga0157380_10185827 3300014326 Bacteria 1830
200 Ga0157376_10293960 3300014969 Bacteria 1535
201 Ga0182007_10006551 3300015262 Bacteria 4991
202 Ga0182005_1001647 3300015265 Bacteria 8685
203 Ga0183363_1046 3300015690 Bacteria 40582
204 Ga0214544_1000771 3300021320 Bacteria 61917
205 Ga0214542_1000032 3300021321 Bacteria 171690
206 Ga0214542_1021618 3300021321 Bacteria 4352
207 Ga0214543_1000016 3300021327 Bacteria 295257
208 Ga0214543_1009269 3300021327 Bacteria 15462
209 Ga0228711_1000006 3300022739 Bacteria 202437
210 Ga0228710_1000004 3300022740 Bacteria 250560
211 Ga0209435_100009 3300025206 Bacteria 476614
212 Ga0209436_100127 3300025208 Bacteria 37528
213 Ga0209672_102531 3300025228 Bacteria 4406
214 Ga0207427_103104 3300025231 Bacteria 3742
215 Ga0209437_100057 3300025233 Bacteria 362922
216 Ga0209437_100772 3300025233 Bacteria 15151
217 Ga0207425_1000052 3300025245 Bacteria 162123
218 Ga0207425_1012086 3300025245 Bacteria 2036
219 Ga0207425_1017797 3300025245 Bacteria 1553
220 Ga0209646_1000018 3300025246 Bacteria 476716
221 Ga0209646_1010000 3300025246 Bacteria 1494
222 Ga0209026_1000043 3300025250 Bacteria 269142
223 Ga0209677_100426 3300025253 Bacteria 25046
224 Ga0209148_1000305 3300025254 Bacteria 70375
225 Ga0209759_1000007 3300025256 Bacteria 476614
226 Ga0209759_1020957 3300025256 Bacteria 1503
227 Ga0209129_1000141 3300025258 Bacteria 119150
228 Ga0209129_1000312 3300025258 Bacteria 43311
229 Ga0209129_1000357 3300025258 Bacteria 38204
230 Ga0209129_1001779 3300025258 Bacteria 11495
231 Ga0209129_1004734 3300025258 Bacteria 5161
232 Ga0209129_1011981 3300025258 Bacteria 2029
233 Ga0209129_1011984 3300025258 Bacteria 2028
234 Ga0209233_1000130 3300025261 Bacteria 205687
235 Ga0209233_1000255 3300025261 Bacteria 82230
236 Ga0209233_1000290 3300025261 Bacteria 64394
237 Ga0209233_1000332 3300025261 Bacteria 48225
238 Ga0209233_1004820 3300025261 Bacteria 4543
239 Ga0209455_1006533 3300025272 Bacteria 3427
240 Ga0209673_1000584 3300025273 Bacteria 57616
241 Ga0209673_1000616 3300025273 Bacteria 54474
242 Ga0209673_1000890 3300025273 Bacteria 38476
243 Ga0209673_1001948 3300025273 Bacteria 16219
244 Ga0209673_1002261 3300025273 Bacteria 13869
245 Ga0209673_1002508 3300025273 Bacteria 12618
246 Ga0209673_1002576 3300025273 Bacteria 12296
247 Ga0209673_1004618 3300025273 Bacteria 7295
248 Ga0209130_1000002 3300025284 Bacteria 722648
249 Ga0209130_1000164 3300025284 Bacteria 97595
250 Ga0209130_1000830 3300025284 Bacteria 25965
251 Ga0209130_1006186 3300025284 Bacteria 3939
252 Ga0209676_1000097 3300025292 Bacteria 237203
253 Ga0209676_1000256 3300025292 Bacteria 112819
254 Ga0209025_1000144 3300025294 Bacteria 181446
255 Ga0209025_1000374 3300025294 Bacteria 93607
256 Ga0209025_1000857 3300025294 Bacteria 48082
257 Ga0209025_1001024 3300025294 Bacteria 41149
258 Ga0209025_1001822 3300025294 Bacteria 25091
259 Ga0209025_1006010 3300025294 Bacteria 9634
260 Ga0209025_1021041 3300025294 Bacteria 3534
261 Ga0209025_1047953 3300025294 Bacteria 1738
262 Ga0209025_1053412 3300025294 Bacteria 1585
263 Ga0209025_1066981 3300025294 Bacteria 1300
264 Ga0209564_1000900 3300025295 Bacteria 39003
265 Ga0209564_1000914 3300025295 Bacteria 38607
266 Ga0209564_1001996 3300025295 Bacteria 17840
267 Ga0209564_1008825 3300025295 Bacteria 4906
268 Ga0209564_1011645 3300025295 Bacteria 3917
269 Ga0209564_1018123 3300025295 Bacteria 2703
270 Ga0209564_1030026 3300025295 Bacteria 1694
271 Ga0209758_1000229 3300025297 Bacteria 119657
272 Ga0209758_1000744 3300025297 Bacteria 47380
273 Ga0209758_1001147 3300025297 Bacteria 33967
274 Ga0209758_1001197 3300025297 Bacteria 32795
275 Ga0209758_1001885 3300025297 Bacteria 22881
276 Ga0209758_1002066 3300025297 Bacteria 21435
277 Ga0209758_1002485 3300025297 Bacteria 18743
278 Ga0209758_1003392 3300025297 Bacteria 14554
279 Ga0209050_1005209 3300025298 Bacteria 8312
280 Ga0209050_1019700 3300025298 Bacteria 2548
281 Ga0209256_1000260 3300025299 Bacteria 93956
282 Ga0209256_1000739 3300025299 Bacteria 42871
283 Ga0209256_1001392 3300025299 Bacteria 25218
284 Ga0209256_1001817 3300025299 Bacteria 20042
285 Ga0209256_1005354 3300025299 Bacteria 7432
286 Ga0209256_1007001 3300025299 Bacteria 5731
287 Ga0209256_1014775 3300025299 Bacteria 2779
288 Ga0207426_1000013 3300025302 Bacteria 721897
289 Ga0207426_1000082 3300025302 Bacteria 298939
290 Ga0207426_1000287 3300025302 Bacteria 100566
291 Ga0207426_1000812 3300025302 Bacteria 33529
292 Ga0207426_1001778 3300025302 Bacteria 16206
293 Ga0209051_1000195 3300025303 Bacteria 107201
294 Ga0209051_1002486 3300025303 Bacteria 13148
295 Ga0209051_1003965 3300025303 Bacteria 9419
296 Ga0209051_1007413 3300025303 Bacteria 5998
297 Ga0209051_1061436 3300025303 Bacteria 1180
298 Ga0209257_1004297 3300025304 Bacteria 11202
299 Ga0209257_1007822 3300025304 Bacteria 6326
300 Ga0209257_1011479 3300025304 Bacteria 4260
301 Ga0209257_1014939 3300025304 Bacteria 3282
302 Ga0207697_10035302 3300025315 Bacteria 2046
303 Ga0207692_10001908 3300025898 Bacteria 7931
304 Ga0207688_10010706 3300025901 Bacteria 4991
305 Ga0207680_10194829 3300025903 Bacteria 1378
306 Ga0207647_10019341 3300025904 Bacteria 4582
307 Ga0207647_10143634 3300025904 Bacteria 1398
308 Ga0207705_10002602 3300025909 Bacteria 13868
309 Ga0207695_10000044 3300025913 Bacteria 440819
310 Ga0207695_10000136 3300025913 Bacteria 217596
311 Ga0207671_10000043 3300025914 Bacteria 206915
312 Ga0207671_10000099 3300025914 Bacteria 132378
313 Ga0207671_10005950 3300025914 Bacteria 11056
314 Ga0207671_10392991 3300025914 Bacteria 1103
315 Ga0207657_10003030 3300025919 Bacteria 17989
316 Ga0207681_10423472 3300025923 Bacteria 1079
317 Ga0207681_10445926 3300025923 Bacteria 1052
318 Ga0207664_10112941 3300025929 Bacteria 2262
319 Ga0207644_10028013 3300025931 Bacteria 3896
320 Ga0207644_10194257 3300025931 Bacteria 1597
321 Ga0207706_10236571 3300025933 Bacteria 1597
322 Ga0207709_10118553 3300025935 Bacteria 1783
323 Ga0207691_10313136 3300025940 Bacteria 1347
324 Ga0207711_10037909 3300025941 Bacteria 4097
325 Ga0207667_10032885 3300025949 Bacteria 5582
326 Ga0207651_10381920 3300025960 Bacteria 1194
327 Ga0207668_10007860 3300025972 Bacteria 6340
328 Ga0207668_10035197 3300025972 Bacteria 3332
329 Ga0207668_10224012 3300025972 Bacteria 1512
330 Ga0207640_10050225 3300025981 Bacteria 2704
331 Ga0207658_10162608 3300025986 Bacteria 1831
332 Ga0207677_10298518 3300026023 Bacteria 1330
333 Ga0207703_10048242 3300026035 Bacteria 3437
334 Ga0207678_10000459 3300026067 Bacteria 36973
335 Ga0207678_10040377 3300026067 Bacteria 4048
336 Ga0207678_10046776 3300026067 Bacteria 3742
337 Ga0207678_10105168 3300026067 Bacteria 2408
338 Ga0207708_10125570 3300026075 Bacteria 2002
339 Ga0207702_10006190 3300026078 Bacteria 10352
340 Ga0207641_10284022 3300026088 Bacteria 1558
341 Ga0207676_10360053 3300026095 Bacteria 1348
342 Ga0207674_10052495 3300026116 Bacteria 4158
343 Ga0207698_10332056 3300026142 Bacteria 1428
344 Ga0209281_1000102 3300027111 Bacteria 221665
345 Ga0209281_1000563 3300027111 Bacteria 44757
346 Ga0209371_1000003 3300027312 Bacteria 1122971
347 Ga0209371_1000998 3300027312 Bacteria 21742
348 Ga0209371_1001347 3300027312 Bacteria 17020
349 Ga0209282_1000013 3300027666 Bacteria 215053
350 Ga0209282_1000150 3300027666 Bacteria 41053
351 Ga0209974_10036341 3300027876 Bacteria 1636
352 Ga0268266_10000391 3300028379 Bacteria 66400
353 Ga0268266_10002425 3300028379 Bacteria 20076
354 Ga0268265_10374449 3300028380 Bacteria 1308
355 Ga0307517_10013188 3300028786 Bacteria 11254
356 Ga0307515_10004240 3300028794 Bacteria 29769
357 Ga0307515_10025103 3300028794 Bacteria 10334
358 Ga0268256_1000004 3300030500 Bacteria 1122967
359 Ga0268256_1001200 3300030500 Bacteria 16565
360 Ga0268256_1002297 3300030500 Bacteria 9909
361 Ga0268256_1029509 3300030500 Bacteria 1341
362 Ga0307512_10092747 3300030522 Bacteria 2093
363 Ga0316177_1124381 3300030731 Bacteria 5146
364 Ga0314311_1040023 3300030733 Bacteria 7981
365 Ga0316182_1202552 3300030745 Bacteria 1586
366 Ga0307513_10081852 3300031456 Bacteria 3325
367 Ga0307509_10105576 3300031507 Bacteria 2838
368 Ga0307408_100291335 3300031548 Bacteria 1363
369 Ga0307408_100361291 3300031548 Bacteria 1235
370 Ga0307408_100411623 3300031548 Bacteria 1164
371 Ga0307508_10017913 3300031616 Bacteria 6436
372 Ga0307514_10023355 3300031649 Bacteria 5018
373 Ga0307516_10028576 3300031730 Bacteria 5642
374 Ga0307405_10000651 3300031731 Bacteria 13391
375 Ga0307405_10001743 3300031731 Bacteria 9291
376 Ga0307405_10331739 3300031731 Bacteria 1166
377 Ga0307413_10030735 3300031824 Bacteria 3020
378 Ga0307410_10145161 3300031852 Bacteria 1760
379 Ga0307406_10010585 3300031901 Bacteria 5206
380 Ga0307406_10050209 3300031901 Bacteria 2643
381 Ga0307406_10191622 3300031901 Bacteria 1497
382 Ga0307407_10063534 3300031903 Bacteria 2166
383 Ga0307412_10001987 3300031911 Bacteria 11320
384 Ga0307412_10031012 3300031911 Bacteria 3372
385 Ga0307412_10324270 3300031911 Bacteria 1227
386 Ga0315914_1000004 3300031967 Bacteria 288534
387 Ga0307409_100000181 3300031995 Bacteria 24481
388 Ga0307409_100064948 3300031995 Bacteria 2869
389 Ga0307409_100220145 3300031995 Bacteria 1713
390 Ga0307416_100011847 3300032002 Bacteria 5844
391 Ga0307414_10127305 3300032004 Bacteria 1970
392 Ga0307414_10619725 3300032004 Bacteria 972
393 Ga0307411_10008197 3300032005 Bacteria 5393
394 Ga0307411_10267341 3300032005 Bacteria 1354
395 Ga0307411_10300107 3300032005 Bacteria 1288
396 Ga0307415_100000148 3300032126 Bacteria 31023
397 Ga0307415_100034769 3300032126 Bacteria 3285
398 Ga0307507_10027619 3300033179 Bacteria 6077
399 Ga0307510_10081429 3300033180 Bacteria 3139
400 Ga0307510_10100597 3300033180 Bacteria 2683
401 Ga0315913_1000055 3300033430 Bacteria 58182
402 Ga0315915_1000003 3300033464 Bacteria 407996
403 Ga0316212_1007769 3300033547 Bacteria 1548
404 Ga0395899_0048208 3300037312 Bacteria 3171
405 Ga0395898_0095647 3300037466 Bacteria 2854
406 Ga0395901_0101100 3300038443 Bacteria 3025
407 Ga0436360_0070791 3300039438 Bacteria 2255
408 Ga0436360_1011386 3300039438 Bacteria 1752
409 Ga0439436_0030841 3300041404 Bacteria 1557
410 Ga0439465_0008671 3300041413 Bacteria 3206
411 Ga0439465_0023002 3300041413 Bacteria 1960
412 Ga0439465_0117235 3300041413 Bacteria 931
413 Ga0451802_1411238 3300041460 Bacteria 1556
414 Ga0451845_0333885 3300041501 Bacteria 4304
415 Ga0451851_0470152 3300041507 Bacteria 1513
416 Ga0451843_0046155 3300041509 Bacteria 2275
417 Ga0451853_3055762 3300041512 Bacteria 3202
418 Ga0439445_0027998 3300042004 Bacteria 1451
419 Ga0439449_0001583 3300042007 Bacteria 8928
420 Ga0439449_0031779 3300042007 Bacteria 1968
421 Ga0439449_0035952 3300042007 Bacteria 1843
422 Ga0466972_0001921 3300044658 Bacteria 10193
423 Ga0466972_0002978 3300044658 Bacteria 8382
424 Ga0466972_0052262 3300044658 Bacteria 1970
425 Ga0466965_0002969 3300044683 Bacteria 7348
426 Ga0466965_0028214 3300044683 Bacteria 2726
427 Ga0466965_0104737 3300044683 Bacteria 1449
428 Ga0466968_0051109 3300044735 Bacteria 1765
429 Ga0466970_0064151 3300044765 Bacteria 1969
430 Ga0466957_0074802 3300044842 Bacteria 2101
431 Ga0466957_0320856 3300044842 Bacteria 1045
432 Ga0466960_0018879 3300044901 Bacteria 3028
433 Ga0466960_0020911 3300044901 Bacteria 2906
434 Ga0451576_0146143 3300045051 Bacteria 2465
435 Ga0495617_031549 3300046452 Bacteria 1779
436 Ga0495638_0000393 3300046460 Bacteria 53859
437 Ga0495605_0000832 3300046474 Bacteria 21775
438 Ga0495605_0128552 3300046474 Bacteria 1144
439 Ga0495662_0015516 3300046476 Bacteria 3697
440 Ga0495585_0018147 3300046492 Bacteria 4061
441 Ga0495607_0210175 3300046501 Bacteria 958
442 Ga0495583_0007210 3300046506 Bacteria 7050
443 Ga0495583_0091327 3300046506 Bacteria 1310
444 Ga0495606_0001613 3300046507 Bacteria 29410
445 Ga0495606_0017853 3300046507 Bacteria 5343
446 Ga0495606_0018190 3300046507 Bacteria 5280
447 Ga0495606_0094411 3300046507 Bacteria 1833
448 Ga0495610_0004797 3300046512 Bacteria 9868
449 Ga0495610_0006514 3300046512 Bacteria 8009
450 Ga0495610_0017073 3300046512 Bacteria 4150
451 Ga0495610_0033794 3300046512 Bacteria 2640
452 Ga0495616_0007526 3300046513 Bacteria 6519
453 Ga0495620_0000419 3300046515 Bacteria 28341
454 Ga0495620_0035733 3300046515 Bacteria 2230
455 Ga0495631_0002319 3300046518 Bacteria 10844
456 Ga0495643_0008514 3300046522 Bacteria 6483
457 Ga0495643_0035802 3300046522 Bacteria 2731
458 Ga0495643_0049454 3300046522 Bacteria 2267
459 Ga0495643_0166468 3300046522 Bacteria 1081
460 Ga0495648_0043505 3300046524 Bacteria 2814
461 Ga0495652_0146768 3300046529 Bacteria 1848
462 Ga0495609_0207207 3300046538 Bacteria 818
463 Ga0495597_0009339 3300046542 Bacteria 4850
464 Ga0495597_0019632 3300046542 Bacteria 3159
465 Ga0495597_0039884 3300046542 Bacteria 2100
466 Ga0495645_0018535 3300046543 Bacteria 5001
467 Ga0495625_0001497 3300046660 Bacteria 28081
468 Ga0495625_0065711 3300046660 Bacteria 2556
469 Ga0495625_0068313 3300046660 Bacteria 2499
470 Ga0495625_0110100 3300046660 Bacteria 1883
471 Ga0495588_0181501 3300046674 Bacteria 1112
472 Ga0495624_0151270 3300046690 Bacteria 1420
473 Ga0495670_0014187 3300046691 Bacteria 3921
474 Ga0495670_0027101 3300046691 Bacteria 2837
475 Ga0495670_0247397 3300046691 Bacteria 950
476 Ga0495649_0004007 3300046694 Bacteria 9708
477 Ga0495589_0078012 3300046794 Bacteria 1613
478 Ga0495660_0042753 3300046810 Bacteria 2502
479 Ga0495604_0025521 3300047317 Bacteria 4709
480 Ga0495604_0054994 3300047317 Bacteria 3069
481 Ga0495636_0001079 3300047318 Bacteria 10250
482 Ga0495672_0028222 3300047320 Bacteria 3553
483 Ga0495683_0002213 3300047323 Bacteria 11897
484 Ga0495687_004605 3300047443 Bacteria 9213
485 Ga0495687_009007 3300047443 Bacteria 5637
486 Ga0495687_015362 3300047443 Bacteria 3897
487 Ga0495687_105285 3300047443 Bacteria 1049
488 Ga0495685_018992 3300047447 Bacteria 2360
489 Ga0495681_0004413 3300047470 Bacteria 9606
490 Ga0495686_0013754 3300047472 Bacteria 5606
491 Ga0495686_0017404 3300047472 Bacteria 4845
492 Ga0496102_0033995 3300048905 Bacteria 4585
493 Ga0496102_0041920 3300048905 Bacteria 4147
494 Ga0496103_0025893 3300048906 Bacteria 3548
495 Ga0496104_0041056 3300048907 Bacteria 4337
496 Ga0496104_0167520 3300048907 Bacteria 2107
497 Ga0496105_0006351 3300048908 Bacteria 9079
498 Ga0496105_0117903 3300048908 Bacteria 2189
499 Ga0496106_0000490 3300048909 Bacteria 28105
500 Ga0496109_0243689 3300048912 Bacteria 1692
501 Ga0496111_0533464 3300048914 Bacteria 862
502 Ga0496113_0572367 3300048916 Bacteria 905
503 Ga0496116_0001183 3300048919 Bacteria 30639
504 Ga0496116_0042278 3300048919 Bacteria 3117
505 Ga0496116_0068890 3300048919 Bacteria 2252
506 Ga0496117_0000036 3300048920 Bacteria 325635
507 Ga0496117_0012929 3300048920 Bacteria 7315
508 Ga0496118_0002329 3300048921 Bacteria 25761
509 Ga0496118_0027736 3300048921 Bacteria 4784
510 Ga0496118_0028305 3300048921 Bacteria 4723
511 Ga0496118_0043304 3300048921 Bacteria 3541
512 Ga0496118_0049355 3300048921 Bacteria 3242
513 Ga0496118_0067101 3300048921 Bacteria 2615
514 Ga0496118_0083178 3300048921 Bacteria 2239
515 Ga0496119_0016153 3300048922 Bacteria 5701
516 Ga0496119_0036900 3300048922 Bacteria 3183
517 Ga0496119_0087555 3300048922 Bacteria 1777
518 Ga0496119_0108615 3300048922 Bacteria 1544
519 Ga0496120_0000036 3300048923 Bacteria 206505
520 Ga0496121_0000005 3300048924 Bacteria 1034486
521 Ga0496121_0002070 3300048924 Bacteria 31759
522 Ga0496121_0024651 3300048924 Bacteria 5743
523 Ga0496121_0041492 3300048924 Bacteria 4020
524 Ga0496121_0331008 3300048924 Bacteria 1021
525 Ga0496122_0000002 3300048925 Bacteria 905834
526 Ga0496122_0008486 3300048925 Bacteria 11065
527 Ga0496122_0257689 3300048925 Bacteria 970
528 Ga0496123_0000002 3300048926 Bacteria 1811682
529 Ga0496123_0010831 3300048926 Bacteria 7995
530 Ga0496123_0011879 3300048926 Bacteria 7485
531 Ga0496123_0109713 3300048926 Bacteria 1580
532 Ga0496124_0000080 3300048927 Bacteria 210439
533 Ga0496124_0004382 3300048927 Bacteria 16507
534 Ga0496124_0044542 3300048927 Bacteria 3806
535 Ga0496124_0061233 3300048927 Bacteria 3155
536 Ga0496124_0061251 3300048927 Bacteria 3154
537 Ga0496124_0069587 3300048927 Bacteria 2921
538 Ga0496124_0105128 3300048927 Bacteria 2282
539 Ga0496124_0369927 3300048927 Bacteria 1006
540 Ga0496125_0000159 3300048928 Bacteria 151205
541 Ga0496125_0000381 3300048928 Bacteria 82386
542 Ga0496125_0011518 3300048928 Bacteria 8836
543 Ga0496125_0038894 3300048928 Bacteria 4107
544 Ga0496126_0272377 3300048929 Bacteria 1405
545 Ga0496126_0488740 3300048929 Bacteria 985
546 Ga0495678_013297 3300049459 Bacteria 3871
547 Ga0495678_054477 3300049459 Unclassified 1531
548 Ga0495682_0079709 3300049460 Bacteria 1178
549 Ga0501031_0000460 3300049568 Bacteria 23596
550 Ga0501031_0000517 3300049568 Bacteria 22611
551 Ga0501031_0315348 3300049568 Bacteria 1013
552 Ga0501032_0000232 3300049569 Bacteria 46458
553 Ga0501032_0003497 3300049569 Bacteria 12010
554 Ga0501033_0000450 3300049570 Bacteria 39159
555 Ga0501033_0015663 3300049570 Bacteria 5748
556 Ga0501033_0017798 3300049570 Bacteria 5366
557 Ga0501034_0001627 3300049571 Bacteria 29108
558 Ga0501034_0003974 3300049571 Bacteria 16614
559 Ga0501034_0035747 3300049571 Bacteria 5036
560 Ga0501034_0049658 3300049571 Bacteria 4233
561 Ga0501034_0051191 3300049571 Bacteria 4164
562 Ga0501034_0279207 3300049571 Bacteria 1610
563 Ga0501036_0016815 3300049572 Bacteria 6110
564 Ga0501036_0022260 3300049572 Bacteria 5330
565 Ga0501036_0089301 3300049572 Bacteria 2604
566 Ga0501036_0264158 3300049572 Bacteria 1442
567 Ga0501036_0360876 3300049572 Bacteria 1213
568 Ga0501037_0000226 3300049573 Bacteria 49205
569 Ga0501037_0000231 3300049573 Bacteria 48188
570 Ga0501038_0000130 3300049574 Bacteria 63940
571 Ga0501038_0000264 3300049574 Bacteria 44267
572 Ga0501038_0018372 3300049574 Bacteria 6312
573 Ga0501039_0000456 3300049575 Bacteria 29710
574 Ga0501039_0005986 3300049575 Bacteria 9218
575 Ga0501040_0096357 3300049576 Bacteria 2060
576 Ga0501040_0211721 3300049576 Unclassified 1378
577 Ga0501042_0000963 3300049578 Bacteria 16249
578 Ga0501043_0000147 3300049579 Bacteria 65326
579 Ga0501043_0009199 3300049579 Bacteria 7764
580 Ga0501046_0000067 3300049580 Bacteria 114617
581 Ga0501046_0002136 3300049580 Bacteria 18679
582 Ga0501047_0001781 3300049581 Bacteria 20821
583 Ga0501047_0031506 3300049581 Bacteria 5113
584 Ga0501047_0085094 3300049581 Bacteria 3038
585 Ga0501047_0173948 3300049581 Bacteria 2022
586 Ga0501048_0000007 3300049582 Bacteria 86855
587 Ga0501048_0003947 3300049582 Bacteria 11277
588 Ga0501069_0000220 3300049585 Bacteria 25553
589 Ga0501069_0001018 3300049585 Bacteria 13361
590 Ga0501069_0163626 3300049585 Bacteria 1282
591 Ga0501070_0001078 3300049586 Bacteria 24457
592 Ga0501070_0005189 3300049586 Bacteria 11094
593 Ga0501070_0030405 3300049586 Bacteria 4525
594 Ga0501070_0050474 3300049586 Bacteria 3454
595 Ga0501073_0007934 3300049589 Bacteria 7876
596 Ga0501074_0003820 3300049590 Bacteria 10718
597 Ga0501261_017946 3300049690 Bacteria 994
598 Ga0501080_0000330 3300049742 Bacteria 36255
599 Ga0501080_0002004 3300049742 Bacteria 17585
600 Ga0501083_0000004 3300049744 Bacteria 207886
601 Ga0501083_0016248 3300049744 Bacteria 5212
602 Ga0501083_0114036 3300049744 Bacteria 1775
603 Ga0501035_0001684 3300049822 Bacteria 22359
604 Ga0501035_0006672 3300049822 Bacteria 10789
605 Ga0501035_0020784 3300049822 Bacteria 6032
606 Ga0501035_0020842 3300049822 Bacteria 6023
607 Ga0501035_0494149 3300049822 Bacteria 1008
608 Ga0501035_0519569 3300049822 Bacteria 978
609 Ga0501044_0000755 3300049823 Bacteria 39069
610 Ga0501044_0026318 3300049823 Bacteria 6160
611 Ga0501044_0089190 3300049823 Bacteria 3113
612 Ga0501044_0369290 3300049823 Bacteria 1351
613 Ga0501045_0575280 3300049824 Bacteria 835
614 nmdc:mga03683_1781_c1 3300050489 Bacteria 6517
615 nmdc:mga03683_5499_c1 3300050489 Bacteria 4281
616 nmdc:mga03683_9967_c1 3300050489 Bacteria 3396
617 nmdc:mga03n38_103286_c1 3300050490 Bacteria 1378
618 nmdc:mga03n38_85912_c1 3300050490 Bacteria 1488
619 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
620 nmdc:mga00v17_27140_c1 3300050491 Bacteria 3341
621 nmdc:mga0yw44_1027_c1 3300050492 Bacteria 10708
622 nmdc:mga0yw44_2126_c1 3300050492 Bacteria 8307
623 nmdc:mga0yw44_972_c1 3300050492 Bacteria 10912
624 nmdc:mga0k408_149911_c1 3300050493 Bacteria 1389
625 nmdc:mga0k408_58554_c1 3300050493 Bacteria 2238
626 nmdc:mga06z11_2714_c1 3300050494 Bacteria 6779
627 nmdc:mga07m45_232952_c1 3300050496 Bacteria 1072
628 nmdc:mga07m45_48111_c1 3300050496 Bacteria 2398
629 nmdc:mga05p37_1219_c1 3300050507 Bacteria 29772
630 nmdc:mga05p37_13693_c1 3300050507 Bacteria 9721
631 nmdc:mga05p37_285524_c1 3300050507 Bacteria 1966
632 nmdc:mga05p37_69035_c1 3300050507 Bacteria 4347
633 nmdc:mga09592_553_c1 3300050508 Bacteria 28439
634 nmdc:mga0qj67_1587_c1 3300050509 Bacteria 15991
635 nmdc:mga0qj67_162049_c1 3300050509 Bacteria 1815
636 nmdc:mga06r32_24266_c1 3300050510 Bacteria 5625
637 nmdc:mga06r32_415_c1 3300050510 Bacteria 35846
638 nmdc:mga0sz30_1633_c1 3300050516 Bacteria 7984
639 Ga0500635_0000073 3300053080 Bacteria 65023
640 Ga0500578_0043021 3300053086 Bacteria 2899
641 Ga0500660_097463 3300053100 Bacteria 1293
642 Ga0500556_0115066 3300053104 Bacteria 1046
643 Ga0500569_015471 3300053109 Bacteria 1911
644 Ga0500569_018073 3300053109 Bacteria 1815
645 Ga0500580_065834 3300053113 Bacteria 1501
646 Ga0500594_0005833 3300053118 Bacteria 2741
647 Ga0500595_000538 3300053119 Bacteria 22785
648 Ga0500595_037146 3300053119 Bacteria 1591
649 Ga0500595_051387 3300053119 Bacteria 1276
650 Ga0500642_0028242 3300053130 Bacteria 2312
651 Ga0500658_0000083 3300053134 Bacteria 43599
652 Ga0500561_0000036 3300053137 Bacteria 27979
653 Ga0500568_0051304 3300053139 Bacteria 1623
654 Ga0500573_0010576 3300053140 Bacteria 5151
655 Ga0500588_0008325 3300053146 Bacteria 2419
656 Ga0500616_0000187 3300053153 Bacteria 101361
657 Ga0500616_0003602 3300053153 Bacteria 11670
658 Ga0500616_0033163 3300053153 Bacteria 2818
659 Ga0500616_0085813 3300053153 Bacteria 1571
660 Ga0500616_0118906 3300053153 Bacteria 1265
661 Ga0500622_0000308 3300053156 Bacteria 50027
662 Ga0500622_0070275 3300053156 Bacteria 1771
663 Ga0500627_0035582 3300053158 Bacteria 2116
664 Ga0500627_0100243 3300053158 Bacteria 1300
665 Ga0500634_0052914 3300053161 Bacteria 2179
666 Ga0500636_0000011 3300053177 Bacteria 140769
667 Ga0500636_0000283 3300053177 Bacteria 28087
668 Ga0500636_0023544 3300053177 Bacteria 3640
669 Ga0501084_0000908 3300054114 Bacteria 22886
670 Ga0501084_0002439 3300054114 Bacteria 14960
671 Ga0587106_000487 3300059605 Bacteria 2796
672 Ga0587072_005462 3300059643 Bacteria 1898

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10619725 Ga0307414_106197251 238
2 3300046501 Ga0495607_0210175 Ga0495607_0210175_19_771 244
3 3300025923 Ga0207681_10423472 Ga0207681_104234722 245
4 3300046538 Ga0495609_0207207 Ga0495609_0207207_34_807 245
5 3300048922 Ga0496119_0016153 Ga0496119_0016153_21_773 245
6 3300006038 Ga0075365_10019507 Ga0075365_100195074 246
7 3300026088 Ga0207641_10284022 Ga0207641_102840223 249
8 3300049824 Ga0501045_0575280 Ga0501045_0575280_15_770 249
9 3300046660 Ga0495625_0068313 Ga0495625_0068313_1713_2486 252
10 3300048916 Ga0496113_0572367 Ga0496113_0572367_14_787 252
11 3300005327 Ga0070658_10086291 Ga0070658_100862913 255
12 3300049568 Ga0501031_0315348 Ga0501031_0315348_190_981 256
13 3300049585 Ga0501069_0163626 Ga0501069_0163626_10_894 256
14 3300049586 Ga0501070_0050474 Ga0501070_0050474_1657_2541 256
15 3300049822 Ga0501035_0020842 Ga0501035_0020842_3683_4567 256
16 3300049823 Ga0501044_0026318 Ga0501044_0026318_5114_5998 256
17 3300031731 Ga0307405_10331739 Ga0307405_103317391 257
18 3300032005 Ga0307411_10300107 Ga0307411_103001072 257
19 3300044735 Ga0466968_0051109 Ga0466968_0051109_980_1753 257
20 3300048914 Ga0496111_0533464 Ga0496111_0533464_78_851 257
21 3300005338 Ga0068868_100461933 Ga0068868_1004619332 262
22 3300005530 Ga0070679_100314869 Ga0070679_1003148692 262
23 3300026023 Ga0207677_10298518 Ga0207677_102985182 262
24 3300046691 Ga0495670_0247397 Ga0495670_0247397_126_932 262
25 3300003322 rootL2_10007443 rootL2_100074433 263
26 3300003323 rootH1_10129646 rootH1_101296462 263
27 3300013296 Ga0157374_10118195 Ga0157374_101181952 263
28 3300049571 Ga0501034_0049658 Ga0501034_0049658_958_1848 263
29 3300041413 Ga0439465_0117235 Ga0439465_0117235_13_906 264
30 3300044842 Ga0466957_0320856 Ga0466957_0320856_131_958 264
31 3300033180 Ga0307510_10100597 Ga0307510_101005972 266
32 3300028794 Ga0307515_10025103 Ga0307515_100251036 267
33 3300032005 Ga0307411_10008197 Ga0307411_100081973 267
34 3300049571 Ga0501034_0279207 Ga0501034_0279207_375_1265 268
35 iso_pu_bacteria 2554235003 2554245857 268
36 iso_pu_bacteria 2558860242 2559296377 268
37 iso_pu_bacteria 2643221693 2644522821 268
38 iso_pu_bacteria 2808606387 2808988595 268
39 3300053161 Ga0500634_0052914 Ga0500634_0052914_392_1204 270
40 3300009545 Ga0105237_10000071 Ga0105237_10000071133 271
41 3300010375 Ga0105239_10001189 Ga0105239_100011896 271
42 3300025914 Ga0207671_10000099 Ga0207671_1000009947 271
43 3300028379 Ga0268266_10000391 Ga0268266_1000039154 271
44 3300049576 Ga0501040_0211721 Ga0501040_0211721_496_1326 271
45 3300005327 Ga0070658_10669075 Ga0070658_106690751 272
46 3300005456 Ga0070678_100282533 Ga0070678_1002825332 272
47 3300005548 Ga0070665_100002585 Ga0070665_10000258524 272
48 3300006177 Ga0075362_10064807 Ga0075362_100648072 272
49 3300006178 Ga0075367_10052945 Ga0075367_100529452 272
50 3300006186 Ga0075369_10047809 Ga0075369_100478092 272
51 3300009148 Ga0105243_10133392 Ga0105243_101333922 272
52 3300013100 Ga0157373_10111877 Ga0157373_101118772 272
53 3300013102 Ga0157371_10000042 Ga0157371_10000042120 272
54 3300013104 Ga0157370_10000035 Ga0157370_1000003570 272
55 3300025935 Ga0207709_10118553 Ga0207709_101185532 272
56 3300028379 Ga0268266_10002425 Ga0268266_100024254 272
57 3300046674 Ga0495588_0181501 Ga0495588_0181501_274_1092 272
58 3300047470 Ga0495681_0004413 Ga0495681_0004413_8252_9070 272
59 3300048920 Ga0496117_0000036 Ga0496117_0000036_236928_237746 272
60 3300048922 Ga0496119_0087555 Ga0496119_0087555_339_1157 272
61 3300048923 Ga0496120_0000036 Ga0496120_0000036_142667_143485 272
62 3300048925 Ga0496122_0000002 Ga0496122_0000002_643620_644438 272
63 3300048926 Ga0496123_0000002 Ga0496123_0000002_1167245_1168063 272
64 3300048926 Ga0496123_0000002 Ga0496123_0000002_643620_644438 272
65 3300048927 Ga0496124_0069587 Ga0496124_0069587_1427_2245 272
66 3300049823 Ga0501044_0369290 Ga0501044_0369290_26_844 272
67 3300050489 nmdc:mga03683_5499_c1 nmdc:mga03683_5499_c1_2788_3606 272
68 3300050490 nmdc:mga03n38_103286_c1 nmdc:mga03n38_103286_c1_131_949 272
69 3300050491 nmdc:mga00v17_19_c1 nmdc:mga00v17_19_c1_82507_83325 272
70 3300050492 nmdc:mga0yw44_1027_c1 nmdc:mga0yw44_1027_c1_4342_5160 272
71 3300050493 nmdc:mga0k408_58554_c1 nmdc:mga0k408_58554_c1_339_1157 272
72 3300050516 nmdc:mga0sz30_1633_c1 nmdc:mga0sz30_1633_c1_6110_6928 272
73 3300053137 Ga0500561_0000036 Ga0500561_0000036_8354_9172 272
74 3300005983 Ga0081540_1024832 Ga0081540_10248322 273
75 3300006844 Ga0075428_100008766 Ga0075428_1000087667 273
76 3300006846 Ga0075430_100004866 Ga0075430_1000048664 273
77 3300006846 Ga0075430_100149217 Ga0075430_1001492172 273
78 3300006847 Ga0075431_100187367 Ga0075431_1001873672 273
79 3300006880 Ga0075429_100120586 Ga0075429_1001205863 273
80 3300009147 Ga0114129_10004136 Ga0114129_1000413615 273
81 3300009147 Ga0114129_10069404 Ga0114129_100694044 273
82 3300050492 nmdc:mga0yw44_972_c1 nmdc:mga0yw44_972_c1_6003_6875 273
83 3300050507 nmdc:mga05p37_13693_c1 nmdc:mga05p37_13693_c1_1017_1841 273
84 3300050507 nmdc:mga05p37_69035_c1 nmdc:mga05p37_69035_c1_1461_2285 273
85 3300050509 nmdc:mga0qj67_162049_c1 nmdc:mga0qj67_162049_c1_699_1523 273
86 3300050510 nmdc:mga06r32_24266_c1 nmdc:mga06r32_24266_c1_330_1154 273
87 3300006844 Ga0075428_100015954 Ga0075428_1000159547 274
88 3300006846 Ga0075430_100013807 Ga0075430_1000138076 274
89 3300006847 Ga0075431_100013114 Ga0075431_1000131147 274
90 3300006880 Ga0075429_100014301 Ga0075429_1000143016 274
91 3300009147 Ga0114129_10006996 Ga0114129_100069962 274
92 3300009147 Ga0114129_10172676 Ga0114129_101726762 274
93 3300009988 Ga0105035_100701 Ga0105035_1007012 274
94 3300009993 Ga0105028_109017 Ga0105028_1090172 274
95 3300030731 Ga0316177_1124381 Ga0316177_11243813 274
96 3300030733 Ga0314311_1040023 Ga0314311_10400234 274
97 3300050507 nmdc:mga05p37_1219_c1 nmdc:mga05p37_1219_c1_14912_15739 274
98 3300050507 nmdc:mga05p37_285524_c1 nmdc:mga05p37_285524_c1_152_979 274
99 3300050508 nmdc:mga09592_553_c1 nmdc:mga09592_553_c1_21396_22223 274
100 3300050509 nmdc:mga0qj67_1587_c1 nmdc:mga0qj67_1587_c1_14497_15324 274
101 3300050510 nmdc:mga06r32_415_c1 nmdc:mga06r32_415_c1_21313_22140 274
102 iso_pu_bacteria 2558860280 2559425394 274
103 iso_pu_bacteria 2585428059 2587743766 274
104 3300005327 Ga0070658_10495653 Ga0070658_104956531 275
105 3300005437 Ga0070710_10000347 Ga0070710_100003472 275
106 3300005563 Ga0068855_100412760 Ga0068855_1004127602 275
107 3300006844 Ga0075428_100007760 Ga0075428_1000077608 275
108 3300025898 Ga0207692_10001908 Ga0207692_100019085 275
109 3300025904 Ga0207647_10143634 Ga0207647_101436342 275
110 3300031548 Ga0307408_100361291 Ga0307408_1003612912 275
111 3300031731 Ga0307405_10001743 Ga0307405_100017432 275
112 3300031852 Ga0307410_10145161 Ga0307410_101451612 275
113 3300031901 Ga0307406_10050209 Ga0307406_100502093 275
114 3300031911 Ga0307412_10031012 Ga0307412_100310124 275
115 3300031995 Ga0307409_100000181 Ga0307409_1000001816 275
116 3300032002 Ga0307416_100011847 Ga0307416_1000118473 275
117 3300032005 Ga0307411_10267341 Ga0307411_102673412 275
118 3300032126 Ga0307415_100000148 Ga0307415_1000001489 275
119 3300044658 Ga0466972_0001921 Ga0466972_0001921_781_1617 275
120 3300044683 Ga0466965_0002969 Ga0466965_0002969_4319_5155 275
121 3300044901 Ga0466960_0020911 Ga0466960_0020911_601_1437 275
122 3300053080 Ga0500635_0000073 Ga0500635_0000073_10692_11552 275
123 iso_pu_bacteria 2816332139 2816503937 275
124 3300025254 Ga0209148_1000305 Ga0209148_100030534 276
125 3300025272 Ga0209455_1006533 Ga0209455_10065334 276
126 iso_pu_bacteria 2643221618 2644105946 276
127 iso_pu_bacteria 2643221626 2644147089 276
128 iso_pu_bacteria 2643221655 2644310558 276
129 iso_pu_bacteria 2643221659 2644334657 276
130 iso_pu_bacteria 2643221698 2644545148 276
131 iso_pu_bacteria 2643221712 2644612660 276
132 iso_pu_bacteria 8003314358 8003321353 276
133 3300005347 Ga0070668_100046535 Ga0070668_1000465352 277
134 3300005353 Ga0070669_100036316 Ga0070669_1000363163 277
135 3300005355 Ga0070671_100057348 Ga0070671_1000573482 277
136 3300005364 Ga0070673_100436412 Ga0070673_1004364122 277
137 3300005366 Ga0070659_100256225 Ga0070659_1002562251 277
138 3300005367 Ga0070667_100300329 Ga0070667_1003003291 277
139 3300005539 Ga0068853_100133742 Ga0068853_1001337422 277
140 3300005563 Ga0068855_100174023 Ga0068855_1001740233 277
141 3300005616 Ga0068852_100693968 Ga0068852_1006939681 277
142 3300005618 Ga0068864_100629438 Ga0068864_1006294381 277
143 3300005842 Ga0068858_100113296 Ga0068858_1001132963 277
144 3300006051 Ga0075364_10075249 Ga0075364_100752492 277
145 3300006177 Ga0075362_10024045 Ga0075362_100240453 277
146 3300006178 Ga0075367_10031396 Ga0075367_100313962 277
147 3300009093 Ga0105240_10139857 Ga0105240_101398572 277
148 3300009101 Ga0105247_10009605 Ga0105247_100096054 277
149 3300009148 Ga0105243_10028578 Ga0105243_100285782 277
150 3300009174 Ga0105241_10049194 Ga0105241_100491943 277
151 3300009177 Ga0105248_10081859 Ga0105248_100818593 277
152 3300009545 Ga0105237_10016814 Ga0105237_100168144 277
153 3300011119 Ga0105246_10080022 Ga0105246_100800223 277
154 3300013296 Ga0157374_10040993 Ga0157374_100409933 277
155 3300014325 Ga0163163_10028230 Ga0163163_100282305 277
156 3300025304 Ga0209257_1014939 Ga0209257_10149393 277
157 3300025315 Ga0207697_10035302 Ga0207697_100353022 277
158 3300025903 Ga0207680_10194829 Ga0207680_101948291 277
159 3300025904 Ga0207647_10019341 Ga0207647_100193414 277
160 3300025914 Ga0207671_10392991 Ga0207671_103929911 277
161 3300025931 Ga0207644_10194257 Ga0207644_101942572 277
162 3300025960 Ga0207651_10381920 Ga0207651_103819202 277
163 3300025972 Ga0207668_10035197 Ga0207668_100351972 277
164 3300026035 Ga0207703_10048242 Ga0207703_100482423 277
165 3300026067 Ga0207678_10040377 Ga0207678_100403772 277
166 3300026095 Ga0207676_10360053 Ga0207676_103600531 277
167 3300026116 Ga0207674_10052495 Ga0207674_100524953 277
168 3300046474 Ga0495605_0128552 Ga0495605_0128552_234_1106 277
169 3300046542 Ga0495597_0019632 Ga0495597_0019632_1706_2578 277
170 3300048905 Ga0496102_0033995 Ga0496102_0033995_866_1738 277
171 3300048906 Ga0496103_0025893 Ga0496103_0025893_1811_2683 277
172 3300048907 Ga0496104_0041056 Ga0496104_0041056_959_1831 277
173 3300048908 Ga0496105_0006351 Ga0496105_0006351_134_1006 277
174 3300048912 Ga0496109_0243689 Ga0496109_0243689_578_1450 277
175 3300048921 Ga0496118_0083178 Ga0496118_0083178_50_922 277
176 3300049459 Ga0495678_054477 Ga0495678_054477_27_890 277
177 3300050493 nmdc:mga0k408_149911_c1 nmdc:mga0k408_149911_c1_470_1342 277
178 3300050496 nmdc:mga07m45_232952_c1 nmdc:mga07m45_232952_c1_38_910 277
179 3300005543 Ga0070672_100340495 Ga0070672_1003404952 278
180 3300006038 Ga0075365_10002567 Ga0075365_100025675 278
181 3300009148 Ga0105243_10400584 Ga0105243_104005842 278
182 3300025940 Ga0207691_10313136 Ga0207691_103131362 278
183 3300027876 Ga0209974_10036341 Ga0209974_100363412 278
184 3300005435 Ga0070714_100356364 Ga0070714_1003563642 279
185 3300005577 Ga0068857_100523358 Ga0068857_1005233581 279
186 3300013105 Ga0157369_10234860 Ga0157369_102348602 279
187 3300013249 Ga0171463_1002 Ga0171463_1002382 279
188 3300015690 Ga0183363_1046 Ga0183363_104613 279
189 3300025261 Ga0209233_1004820 Ga0209233_10048204 279
190 3300025929 Ga0207664_10112941 Ga0207664_101129412 279
191 3300026067 Ga0207678_10000459 Ga0207678_100004597 279
192 3300026075 Ga0207708_10125570 Ga0207708_101255702 279
193 3300028794 Ga0307515_10004240 Ga0307515_100042403 279
194 3300031507 Ga0307509_10105576 Ga0307509_101055762 279
195 3300031616 Ga0307508_10017913 Ga0307508_100179132 279
196 3300031649 Ga0307514_10023355 Ga0307514_100233552 279
197 3300033179 Ga0307507_10027619 Ga0307507_100276196 279
198 3300044658 Ga0466972_0002978 Ga0466972_0002978_4335_5180 279
199 3300044683 Ga0466965_0104737 Ga0466965_0104737_318_1163 279
200 iso_pu_bacteria 2917554339 2917555077 279
201 3300003781 Ga0055536_1009179 Ga0055536_10091794 280
202 3300005347 Ga0070668_100031244 Ga0070668_1000312444 280
203 3300025292 Ga0209676_1000097 Ga0209676_1000097234 280
204 3300025298 Ga0209050_1019700 Ga0209050_10197002 280
205 3300025972 Ga0207668_10007860 Ga0207668_100078605 280
206 3300046660 Ga0495625_0110100 Ga0495625_0110100_598_1497 280
207 3300049572 Ga0501036_0360876 Ga0501036_0360876_52_933 280
208 iso_pu_bacteria 2844533157 2844533831 280
209 iso_pu_bacteria 3005445848 3005450605 280
210 3300005539 Ga0068853_100000565 Ga0068853_1000005656 281
211 3300009545 Ga0105237_10376657 Ga0105237_103766572 281
212 3300013105 Ga0157369_10064646 Ga0157369_100646463 281
213 3300025304 Ga0209257_1004297 Ga0209257_10042976 281
214 3300037312 Ga0395899_0048208 Ga0395899_0048208_554_1438 281
215 3300038443 Ga0395901_0101100 Ga0395901_0101100_149_1033 281
216 3300049568 Ga0501031_0000517 Ga0501031_0000517_7579_8475 281
217 3300049569 Ga0501032_0000232 Ga0501032_0000232_37162_38058 281
218 3300049570 Ga0501033_0000450 Ga0501033_0000450_21662_22558 281
219 3300049571 Ga0501034_0001627 Ga0501034_0001627_21019_21915 281
220 3300049572 Ga0501036_0016815 Ga0501036_0016815_589_1485 281
221 3300049573 Ga0501037_0000226 Ga0501037_0000226_11051_11947 281
222 3300049574 Ga0501038_0000130 Ga0501038_0000130_33122_34018 281
223 3300049575 Ga0501039_0000456 Ga0501039_0000456_22044_22940 281
224 3300049579 Ga0501043_0000147 Ga0501043_0000147_20342_21238 281
225 3300049580 Ga0501046_0000067 Ga0501046_0000067_57837_58733 281
226 3300049581 Ga0501047_0001781 Ga0501047_0001781_7615_8511 281
227 3300049582 Ga0501048_0000007 Ga0501048_0000007_48722_49618 281
228 3300049585 Ga0501069_0001018 Ga0501069_0001018_1295_2191 281
229 3300049586 Ga0501070_0001078 Ga0501070_0001078_7194_8090 281
230 3300049742 Ga0501080_0000330 Ga0501080_0000330_32297_33193 281
231 3300049744 Ga0501083_0114036 Ga0501083_0114036_476_1372 281
232 3300049822 Ga0501035_0001684 Ga0501035_0001684_7327_8223 281
233 3300049823 Ga0501044_0000755 Ga0501044_0000755_7608_8504 281
234 3300054114 Ga0501084_0002439 Ga0501084_0002439_9097_9993 281
235 iso_pu_bacteria 2508501114 2509074855 281
236 iso_pu_bacteria 2643221629 2644168391 281
237 iso_pu_bacteria 2643221662 2644349925 281
238 iso_pu_bacteria 2821443989 2821445656 281
239 iso_pu_bacteria 2835312727 2835318609 281
240 iso_pu_bacteria 8005301065 8005301679 281
241 iso_pu_bacteria 8018127388 8018128486 281
242 3300005347 Ga0070668_100007262 Ga0070668_1000072624 282
243 3300005844 Ga0068862_100459150 Ga0068862_1004591502 282
244 3300046507 Ga0495606_0094411 Ga0495606_0094411_739_1611 282
245 3300048921 Ga0496118_0002329 Ga0496118_0002329_21209_22081 282
246 3300045051 Ga0451576_0146143 Ga0451576_0146143_346_1206 283
247 3300053153 Ga0500616_0118906 Ga0500616_0118906_123_977 283
248 3300053177 Ga0500636_0023544 Ga0500636_0023544_663_1529 283
249 iso_pu_bacteria 2508501050 2508727108 283
250 iso_pu_bacteria 2537561587 2537873468 283
251 iso_pu_bacteria 2599185210 2599605574 283
252 iso_pu_bacteria 2600255279 2601611769 283
253 iso_pu_bacteria 2600255308 2601749500 283
254 iso_pu_bacteria 2643221582 2643917656 283
255 iso_pu_bacteria 2757320392 2757572240 283
256 iso_pu_bacteria 2775506901 2776262737 283
257 iso_pu_bacteria 2818991439 2819557827 283
258 iso_pu_bacteria 2838675328 2838679775 283
259 iso_pu_bacteria 2838714209 2838717455 283
260 iso_pu_bacteria 2838719591 2838724344 283
261 iso_pu_bacteria 2838724970 2838729339 283
262 iso_pu_bacteria 2841846520 2841850766 283
263 iso_pu_bacteria 2841859092 2841864055 283
264 iso_pu_bacteria 2842124991 2842129571 283
265 iso_pu_bacteria 2842130223 2842134716 283
266 iso_pu_bacteria 2842152218 2842156766 283
267 iso_pu_bacteria 2842170452 2842173024 283
268 iso_pu_bacteria 2842175837 2842180384 283
269 iso_pu_bacteria 2842187318 2842191957 283
270 iso_pu_bacteria 2842211629 2842216273 283
271 iso_pu_bacteria 2842224351 2842228993 283
272 iso_pu_bacteria 2842515876 2842520837 283
273 iso_pu_bacteria 2899792073 2899793629 283
274 iso_pu_bacteria 2899845264 2899848722 283
275 iso_pu_bacteria 2919114240 2919119209 283
276 iso_pu_bacteria 2926754445 2926759240 283
277 iso_pu_bacteria 2926760298 2926763323 283
278 iso_pu_bacteria 2929138655 2929142966 283
279 iso_pu_bacteria 2933006813 2933011371 283
280 iso_pu_bacteria 2933011516 2933016550 283
281 iso_pu_bacteria 2933594066 2933596057 283
282 iso_pu_bacteria 2979089926 2979091644 283
283 iso_pu_bacteria 2979095461 2979097165 283
284 iso_pu_bacteria 2979100975 2979102868 283
285 iso_pu_bacteria 2984509177 2984509243 283
286 iso_pu_bacteria 2984518228 2984520058 283
287 iso_pu_bacteria 2984601300 2984604320 283
288 iso_pu_bacteria 650716007 650842770 283
289 iso_pu_bacteria 8003570095 8003574805 283
290 iso_pu_bacteria 8054460903 8054464674 283
291 3300005262 Ga0065165_1001128 Ga0065165_100112816 284
292 3300021320 Ga0214544_1000771 Ga0214544_100077137 284
293 3300021321 Ga0214542_1000032 Ga0214542_100003255 284
294 3300021327 Ga0214543_1000016 Ga0214543_1000016223 284
295 3300025297 Ga0209758_1003392 Ga0209758_100339210 284
296 3300031901 Ga0307406_10010585 Ga0307406_100105854 284
297 3300039438 Ga0436360_1011386 Ga0436360_1011386_528_1403 284
298 3300041413 Ga0439465_0023002 Ga0439465_0023002_642_1538 284
299 3300046522 Ga0495643_0035802 Ga0495643_0035802_106_984 284
300 3300046522 Ga0495643_0049454 Ga0495643_0049454_1253_2131 284
301 3300046542 Ga0495597_0039884 Ga0495597_0039884_747_1625 284
302 3300048921 Ga0496118_0049355 Ga0496118_0049355_2227_3105 284
303 3300048921 Ga0496118_0067101 Ga0496118_0067101_719_1603 284
304 3300048925 Ga0496122_0008486 Ga0496122_0008486_6554_7432 284
305 3300048926 Ga0496123_0011879 Ga0496123_0011879_4658_5536 284
306 3300048928 Ga0496125_0000381 Ga0496125_0000381_43255_44124 284
307 3300049568 Ga0501031_0000460 Ga0501031_0000460_19047_19946 284
308 3300049569 Ga0501032_0003497 Ga0501032_0003497_7491_8390 284
309 3300049570 Ga0501033_0015663 Ga0501033_0015663_4488_5387 284
310 3300049571 Ga0501034_0003974 Ga0501034_0003974_12349_13248 284
311 3300049572 Ga0501036_0022260 Ga0501036_0022260_3534_4433 284
312 3300049573 Ga0501037_0000231 Ga0501037_0000231_41691_42590 284
313 3300049574 Ga0501038_0000264 Ga0501038_0000264_39153_40052 284
314 3300049575 Ga0501039_0005986 Ga0501039_0005986_4431_5330 284
315 3300049576 Ga0501040_0096357 Ga0501040_0096357_841_1740 284
316 3300049579 Ga0501043_0009199 Ga0501043_0009199_119_1018 284
317 3300049580 Ga0501046_0002136 Ga0501046_0002136_13802_14701 284
318 3300049581 Ga0501047_0031506 Ga0501047_0031506_4096_4995 284
319 3300049582 Ga0501048_0003947 Ga0501048_0003947_4511_5410 284
320 3300049585 Ga0501069_0000220 Ga0501069_0000220_1892_2791 284
321 3300049586 Ga0501070_0005189 Ga0501070_0005189_5983_6882 284
322 3300049589 Ga0501073_0007934 Ga0501073_0007934_6309_7208 284
323 3300049590 Ga0501074_0003820 Ga0501074_0003820_3296_4195 284
324 3300049742 Ga0501080_0002004 Ga0501080_0002004_12090_12989 284
325 3300049744 Ga0501083_0016248 Ga0501083_0016248_654_1553 284
326 3300049822 Ga0501035_0006672 Ga0501035_0006672_3367_4266 284
327 3300050489 nmdc:mga03683_9967_c1 nmdc:mga03683_9967_c1_2243_3121 284
328 3300053086 Ga0500578_0043021 Ga0500578_0043021_1112_1990 284
329 3300053153 Ga0500616_0033163 Ga0500616_0033163_1031_1909 284
330 3300054114 Ga0501084_0000908 Ga0501084_0000908_369_1268 284
331 iso_pu_bacteria 2867346516 2867348024 284
332 iso_pu_bacteria 2867346516 2867350203 284
333 iso_pu_bacteria 2894232714 2894241243 284
334 3300002773 JGI25152J39213_1000493 JGI25152J39213_100049312 285
335 3300002774 JGI25150J39212_1000355 JGI25150J39212_100035512 285
336 3300003187 JGI25151J46595_10000946 JGI25151J46595_1000094611 285
337 3300003215 JGI25153J46596_10001894 JGI25153J46596_100018946 285
338 3300006177 Ga0075362_10024504 Ga0075362_100245042 285
339 3300006195 Ga0075366_10121241 Ga0075366_101212412 285
340 3300006353 Ga0075370_10230185 Ga0075370_102301852 285
341 3300025245 Ga0207425_1000052 Ga0207425_100005282 285
342 3300025258 Ga0209129_1000141 Ga0209129_100014112 285
343 3300025273 Ga0209673_1004618 Ga0209673_10046186 285
344 3300025284 Ga0209130_1000830 Ga0209130_10008306 285
345 3300025294 Ga0209025_1000144 Ga0209025_1000144114 285
346 3300025297 Ga0209758_1000229 Ga0209758_1000229114 285
347 3300025302 Ga0207426_1000287 Ga0207426_100028789 285
348 3300031731 Ga0307405_10000651 Ga0307405_100006515 285
349 3300031901 Ga0307406_10191622 Ga0307406_101916222 285
350 3300031911 Ga0307412_10001987 Ga0307412_1000198713 285
351 3300037466 Ga0395898_0095647 Ga0395898_0095647_1838_2740 285
352 3300039438 Ga0436360_0070791 Ga0436360_0070791_996_1856 285
353 3300046512 Ga0495610_0033794 Ga0495610_0033794_57_920 285
354 3300046691 Ga0495670_0014187 Ga0495670_0014187_70_957 285
355 3300048919 Ga0496116_0001183 Ga0496116_0001183_6413_7297 285
356 3300048919 Ga0496116_0042278 Ga0496116_0042278_2186_3070 285
357 3300048924 Ga0496121_0024651 Ga0496121_0024651_4813_5697 285
358 3300048926 Ga0496123_0010831 Ga0496123_0010831_1033_1917 285
359 3300048927 Ga0496124_0004382 Ga0496124_0004382_3363_4247 285
360 3300048927 Ga0496124_0044542 Ga0496124_0044542_2677_3561 285
361 3300048928 Ga0496125_0011518 Ga0496125_0011518_7476_8360 285
362 3300050489 nmdc:mga03683_1781_c1 nmdc:mga03683_1781_c1_4618_5511 285
363 iso_pu_bacteria 2513237094 2513641467 285
364 iso_pu_bacteria 2519899620 2520378318 285
365 iso_pu_bacteria 2529292951 2530648456 285
366 iso_pu_bacteria 2643221580 2643910908 285
367 iso_pu_bacteria 2643221591 2643965928 285
368 iso_pu_bacteria 2838668709 2838672657 285
369 iso_pu_bacteria 2838701080 2838705020 285
370 iso_pu_bacteria 2842146304 2842150014 285
371 iso_pu_bacteria 2842250916 2842254701 285
372 iso_pu_bacteria 2842489311 2842493983 285
373 iso_pu_bacteria 2844315083 2844320827 285
374 iso_pu_bacteria 2894817345 2894818903 285
375 iso_pu_bacteria 2903727486 2903728103 285
376 iso_pu_bacteria 2906602504 2906608110 285
377 iso_pu_bacteria 639633055 639645957 285
378 iso_pu_bacteria 8055431914 8055435338 285
379 iso_pu_bacteria 8056967851 8056969206 285
380 3300002773 JGI25152J39213_1002263 JGI25152J39213_10022635 286
381 3300003187 JGI25151J46595_10001865 JGI25151J46595_1000186512 286
382 3300003215 JGI25153J46596_10065292 JGI25153J46596_100652921 286
383 3300003771 Ga0055526_1000926 Ga0055526_10009267 286
384 3300003771 Ga0055526_1013134 Ga0055526_10131343 286
385 3300003775 Ga0055524_1003779 Ga0055524_10037793 286
386 3300003790 Ga0055528_1000464 Ga0055528_10004649 286
387 3300003790 Ga0055528_1011321 Ga0055528_10113212 286
388 3300005335 Ga0070666_10137792 Ga0070666_101377921 286
389 3300005353 Ga0070669_100451166 Ga0070669_1004511661 286
390 3300005355 Ga0070671_100017417 Ga0070671_1000174175 286
391 3300005844 Ga0068862_100436295 Ga0068862_1004362951 286
392 3300006038 Ga0075365_10004465 Ga0075365_100044654 286
393 3300006178 Ga0075367_10001293 Ga0075367_100012939 286
394 3300006186 Ga0075369_10005102 Ga0075369_100051023 286
395 3300009177 Ga0105248_10009144 Ga0105248_100091445 286
396 3300009766 Ga0123342_1020788 Ga0123342_10207882 286
397 3300011119 Ga0105246_10248696 Ga0105246_102486962 286
398 3300014326 Ga0157380_10185827 Ga0157380_101858272 286
399 3300025258 Ga0209129_1001779 Ga0209129_10017797 286
400 3300025273 Ga0209673_1000616 Ga0209673_100061620 286
401 3300025273 Ga0209673_1002508 Ga0209673_10025087 286
402 3300025284 Ga0209130_1006186 Ga0209130_10061863 286
403 3300025294 Ga0209025_1001024 Ga0209025_100102428 286
404 3300025294 Ga0209025_1053412 Ga0209025_10534122 286
405 3300025295 Ga0209564_1000900 Ga0209564_100090020 286
406 3300025295 Ga0209564_1008825 Ga0209564_10088255 286
407 3300025295 Ga0209564_1011645 Ga0209564_10116453 286
408 3300025297 Ga0209758_1002485 Ga0209758_10024851 286
409 3300025299 Ga0209256_1001392 Ga0209256_10013923 286
410 3300025299 Ga0209256_1005354 Ga0209256_10053543 286
411 3300025302 Ga0207426_1001778 Ga0207426_10017786 286
412 3300025303 Ga0209051_1003965 Ga0209051_10039652 286
413 3300025923 Ga0207681_10445926 Ga0207681_104459261 286
414 3300025931 Ga0207644_10028013 Ga0207644_100280132 286
415 3300025941 Ga0207711_10037909 Ga0207711_100379092 286
416 3300025986 Ga0207658_10162608 Ga0207658_101626082 286
417 3300026067 Ga0207678_10046776 Ga0207678_100467763 286
418 3300028380 Ga0268265_10374449 Ga0268265_103744492 286
419 3300031730 Ga0307516_10028576 Ga0307516_100285765 286
420 3300046474 Ga0495605_0000832 Ga0495605_0000832_3911_4783 286
421 3300048905 Ga0496102_0041920 Ga0496102_0041920_49_933 286
422 3300048908 Ga0496105_0117903 Ga0496105_0117903_24_908 286
423 3300048919 Ga0496116_0068890 Ga0496116_0068890_18_902 286
424 3300048920 Ga0496117_0012929 Ga0496117_0012929_228_1091 286
425 3300048921 Ga0496118_0027736 Ga0496118_0027736_1370_2233 286
426 3300048922 Ga0496119_0108615 Ga0496119_0108615_39_902 286
427 3300048924 Ga0496121_0002070 Ga0496121_0002070_13971_14834 286
428 3300048927 Ga0496124_0061251 Ga0496124_0061251_205_1089 286
429 3300048929 Ga0496126_0272377 Ga0496126_0272377_89_952 286
430 3300048929 Ga0496126_0488740 Ga0496126_0488740_98_961 286
431 3300049459 Ga0495678_013297 Ga0495678_013297_2649_3521 286
432 3300049578 Ga0501042_0000963 Ga0501042_0000963_968_1873 286
433 3300049744 Ga0501083_0000004 Ga0501083_0000004_165287_166192 286
434 3300053109 Ga0500569_015471 Ga0500569_015471_622_1494 286
435 3300053119 Ga0500595_000538 Ga0500595_000538_7119_7982 286
436 3300053119 Ga0500595_037146 Ga0500595_037146_576_1439 286
437 3300053130 Ga0500642_0028242 Ga0500642_0028242_1037_1900 286
438 3300053146 Ga0500588_0008325 Ga0500588_0008325_1413_2276 286
439 3300053158 Ga0500627_0100243 Ga0500627_0100243_320_1183 286
440 iso_pu_bacteria 2582581867 2585399562 286
441 iso_pu_bacteria 2585427528 2585542849 286
442 iso_pu_bacteria 2585427593 2585841209 286
443 iso_pu_bacteria 2643221674 2644412156 286
444 iso_pu_bacteria 2889790730 2889795101 286
445 iso_pu_bacteria 2889914905 2889914914 286
446 iso_pu_bacteria 2899803654 2899804634 286
447 iso_pu_bacteria 8008485437 8008491366 286
448 iso_pu_bacteria 8025524527 8025530696 286
449 3300002739 JGI25158J39367_1000160 JGI25158J39367_100016013 287
450 3300002773 JGI25152J39213_1000861 JGI25152J39213_10008616 287
451 3300002773 JGI25152J39213_1001207 JGI25152J39213_10012077 287
452 3300002773 JGI25152J39213_1001531 JGI25152J39213_10015317 287
453 3300002774 JGI25150J39212_1009798 JGI25150J39212_10097981 287
454 3300002774 JGI25150J39212_1013415 JGI25150J39212_10134151 287
455 3300002987 JGI25159J45721_1000711 JGI25159J45721_10007117 287
456 3300003187 JGI25151J46595_10000409 JGI25151J46595_1000040914 287
457 3300003187 JGI25151J46595_10004033 JGI25151J46595_100040332 287
458 3300003187 JGI25151J46595_10014430 JGI25151J46595_100144302 287
459 3300003214 JGI25165J46597_1004993 JGI25165J46597_10049933 287
460 3300003215 JGI25153J46596_10007757 JGI25153J46596_100077574 287
461 3300003215 JGI25153J46596_10008884 JGI25153J46596_100088844 287
462 3300003354 JGI25160J50197_1002301 JGI25160J50197_10023017 287
463 3300003354 JGI25160J50197_1002712 JGI25160J50197_10027125 287
464 3300003374 JGI25161J50226_1000206 JGI25161J50226_100020632 287
465 3300003374 JGI25161J50226_1006719 JGI25161J50226_10067192 287
466 3300003771 Ga0055526_1000489 Ga0055526_100048919 287
467 3300003771 Ga0055526_1004307 Ga0055526_10043077 287
468 3300003771 Ga0055526_1018821 Ga0055526_10188212 287
469 3300003775 Ga0055524_1005189 Ga0055524_10051894 287
470 3300003775 Ga0055524_1005277 Ga0055524_10052772 287
471 3300003790 Ga0055528_1000478 Ga0055528_100047813 287
472 3300003790 Ga0055528_1001760 Ga0055528_10017608 287
473 3300003790 Ga0055528_1002389 Ga0055528_10023897 287
474 3300003790 Ga0055528_1021586 Ga0055528_10215862 287
475 3300003792 Ga0055540_1000320 Ga0055540_100032027 287
476 3300003792 Ga0055540_1003981 Ga0055540_10039815 287
477 3300003856 Ga0058692_1002641 Ga0058692_10026412 287
478 3300003856 Ga0058692_1007147 Ga0058692_10071472 287
479 3300004625 Ga0055543_1000248 Ga0055543_100024824 287
480 3300004625 Ga0055543_1002104 Ga0055543_10021044 287
481 3300005262 Ga0065165_1001369 Ga0065165_100136925 287
482 3300005262 Ga0065165_1006963 Ga0065165_10069633 287
483 3300005262 Ga0065165_1035870 Ga0065165_10358702 287
484 3300005289 Ga0065704_10166279 Ga0065704_101662791 287
485 3300005327 Ga0070658_10297277 Ga0070658_102972772 287
486 3300005337 Ga0070682_100111494 Ga0070682_1001114942 287
487 3300005339 Ga0070660_100001762 Ga0070660_1000017626 287
488 3300005455 Ga0070663_100076567 Ga0070663_1000765672 287
489 3300005530 Ga0070679_100174329 Ga0070679_1001743292 287
490 3300005548 Ga0070665_100264906 Ga0070665_1002649062 287
491 3300005563 Ga0068855_100174184 Ga0068855_1001741843 287
492 3300006038 Ga0075365_10001348 Ga0075365_100013489 287
493 3300006048 Ga0075363_100085685 Ga0075363_1000856852 287
494 3300006051 Ga0075364_10023714 Ga0075364_100237142 287
495 3300006051 Ga0075364_10030856 Ga0075364_100308563 287
496 3300006177 Ga0075362_10010334 Ga0075362_100103343 287
497 3300006178 Ga0075367_10005583 Ga0075367_100055835 287
498 3300006186 Ga0075369_10008926 Ga0075369_100089264 287
499 3300006186 Ga0075369_10016107 Ga0075369_100161073 287
500 3300006186 Ga0075369_10021032 Ga0075369_100210322 287
501 3300006353 Ga0075370_10003397 Ga0075370_100033972 287
502 3300006948 Ga0099826_10000040 Ga0099826_1000004053 287
503 3300009148 Ga0105243_10072373 Ga0105243_100723732 287
504 3300009551 Ga0105238_10051937 Ga0105238_100519372 287
505 3300009553 Ga0105249_10082542 Ga0105249_100825422 287
506 3300009765 Ga0123341_1000097 Ga0123341_10000977 287
507 3300012513 Ga0157326_1006039 Ga0157326_10060392 287
508 3300013105 Ga0157369_10098498 Ga0157369_100984983 287
509 3300025208 Ga0209436_100127 Ga0209436_10012733 287
510 3300025231 Ga0207427_103104 Ga0207427_1031043 287
511 3300025245 Ga0207425_1012086 Ga0207425_10120862 287
512 3300025245 Ga0207425_1017797 Ga0207425_10177972 287
513 3300025258 Ga0209129_1000312 Ga0209129_100031223 287
514 3300025258 Ga0209129_1000357 Ga0209129_100035719 287
515 3300025258 Ga0209129_1004734 Ga0209129_10047342 287
516 3300025258 Ga0209129_1011981 Ga0209129_10119812 287
517 3300025258 Ga0209129_1011984 Ga0209129_10119842 287
518 3300025261 Ga0209233_1000290 Ga0209233_100029041 287
519 3300025273 Ga0209673_1000584 Ga0209673_100058428 287
520 3300025273 Ga0209673_1000890 Ga0209673_100089017 287
521 3300025273 Ga0209673_1001948 Ga0209673_100194812 287
522 3300025273 Ga0209673_1002261 Ga0209673_10022617 287
523 3300025273 Ga0209673_1002576 Ga0209673_10025769 287
524 3300025284 Ga0209130_1000002 Ga0209130_1000002697 287
525 3300025294 Ga0209025_1000374 Ga0209025_100037454 287
526 3300025294 Ga0209025_1000857 Ga0209025_100085725 287
527 3300025294 Ga0209025_1001822 Ga0209025_100182221 287
528 3300025294 Ga0209025_1047953 Ga0209025_10479532 287
529 3300025294 Ga0209025_1066981 Ga0209025_10669811 287
530 3300025295 Ga0209564_1000914 Ga0209564_100091426 287
531 3300025295 Ga0209564_1001996 Ga0209564_100199614 287
532 3300025295 Ga0209564_1018123 Ga0209564_10181232 287
533 3300025295 Ga0209564_1030026 Ga0209564_10300262 287
534 3300025297 Ga0209758_1000744 Ga0209758_10007442 287
535 3300025297 Ga0209758_1001147 Ga0209758_100114732 287
536 3300025297 Ga0209758_1001197 Ga0209758_100119722 287
537 3300025297 Ga0209758_1001885 Ga0209758_100188513 287
538 3300025297 Ga0209758_1002066 Ga0209758_100206619 287
539 3300025298 Ga0209050_1005209 Ga0209050_10052092 287
540 3300025299 Ga0209256_1000260 Ga0209256_100026032 287
541 3300025299 Ga0209256_1000739 Ga0209256_100073926 287
542 3300025299 Ga0209256_1001817 Ga0209256_100181714 287
543 3300025299 Ga0209256_1007001 Ga0209256_10070013 287
544 3300025299 Ga0209256_1014775 Ga0209256_10147752 287
545 3300025302 Ga0207426_1000013 Ga0207426_1000013697 287
546 3300025302 Ga0207426_1000812 Ga0207426_100081222 287
547 3300025303 Ga0209051_1000195 Ga0209051_100019529 287
548 3300025303 Ga0209051_1002486 Ga0209051_10024862 287
549 3300025303 Ga0209051_1007413 Ga0209051_10074133 287
550 3300025303 Ga0209051_1061436 Ga0209051_10614362 287
551 3300025304 Ga0209257_1007822 Ga0209257_10078223 287
552 3300025304 Ga0209257_1011479 Ga0209257_10114792 287
553 3300025901 Ga0207688_10010706 Ga0207688_100107063 287
554 3300025909 Ga0207705_10002602 Ga0207705_100026027 287
555 3300025919 Ga0207657_10003030 Ga0207657_100030309 287
556 3300025949 Ga0207667_10032885 Ga0207667_100328854 287
557 3300025972 Ga0207668_10224012 Ga0207668_102240121 287
558 3300026067 Ga0207678_10105168 Ga0207678_101051682 287
559 3300027312 Ga0209371_1000003 Ga0209371_1000003145 287
560 3300027312 Ga0209371_1000998 Ga0209371_10009988 287
561 3300027666 Ga0209282_1000150 Ga0209282_100015038 287
562 3300028786 Ga0307517_10013188 Ga0307517_100131886 287
563 3300030500 Ga0268256_1000004 Ga0268256_1000004906 287
564 3300030500 Ga0268256_1002297 Ga0268256_10022975 287
565 3300030500 Ga0268256_1029509 Ga0268256_10295092 287
566 3300030745 Ga0316182_1202552 Ga0316182_12025522 287
567 3300041460 Ga0451802_1411238 Ga0451802_1411238_350_1237 287
568 3300041501 Ga0451845_0333885 Ga0451845_0333885_1222_2109 287
569 3300041507 Ga0451851_0470152 Ga0451851_0470152_515_1402 287
570 3300041509 Ga0451843_0046155 Ga0451843_0046155_722_1609 287
571 3300041512 Ga0451853_3055762 Ga0451853_3055762_845_1732 287
572 3300042007 Ga0439449_0001583 Ga0439449_0001583_3016_3894 287
573 3300044683 Ga0466965_0028214 Ga0466965_0028214_1777_2694 287
574 3300044842 Ga0466957_0074802 Ga0466957_0074802_630_1547 287
575 3300046507 Ga0495606_0017853 Ga0495606_0017853_4306_5193 287
576 3300046512 Ga0495610_0006514 Ga0495610_0006514_4019_4906 287
577 3300046515 Ga0495620_0035733 Ga0495620_0035733_87_974 287
578 3300046522 Ga0495643_0166468 Ga0495643_0166468_195_1070 287
579 3300046691 Ga0495670_0027101 Ga0495670_0027101_730_1617 287
580 3300046794 Ga0495589_0078012 Ga0495589_0078012_285_1163 287
581 3300046810 Ga0495660_0042753 Ga0495660_0042753_372_1259 287
582 3300047443 Ga0495687_015362 Ga0495687_015362_591_1469 287
583 3300047447 Ga0495685_018992 Ga0495685_018992_1021_1899 287
584 3300047472 Ga0495686_0013754 Ga0495686_0013754_642_1529 287
585 3300048907 Ga0496104_0167520 Ga0496104_0167520_229_1104 287
586 3300048909 Ga0496106_0000490 Ga0496106_0000490_521_1408 287
587 3300048921 Ga0496118_0028305 Ga0496118_0028305_234_1109 287
588 3300048921 Ga0496118_0043304 Ga0496118_0043304_387_1262 287
589 3300048922 Ga0496119_0036900 Ga0496119_0036900_1778_2653 287
590 3300048924 Ga0496121_0000005 Ga0496121_0000005_909714_910589 287
591 3300048924 Ga0496121_0331008 Ga0496121_0331008_40_927 287
592 3300048925 Ga0496122_0257689 Ga0496122_0257689_30_917 287
593 3300048926 Ga0496123_0109713 Ga0496123_0109713_185_1060 287
594 3300048927 Ga0496124_0000080 Ga0496124_0000080_106249_107124 287
595 3300048927 Ga0496124_0061233 Ga0496124_0061233_249_1136 287
596 3300048927 Ga0496124_0369927 Ga0496124_0369927_52_927 287
597 3300048928 Ga0496125_0000159 Ga0496125_0000159_33811_34686 287
598 3300048928 Ga0496125_0038894 Ga0496125_0038894_2967_3854 287
599 3300049570 Ga0501033_0017798 Ga0501033_0017798_1178_2059 287
600 3300049571 Ga0501034_0035747 Ga0501034_0035747_1760_2641 287
601 3300049572 Ga0501036_0089301 Ga0501036_0089301_1564_2451 287
602 3300049574 Ga0501038_0018372 Ga0501038_0018372_2058_2945 287
603 3300049581 Ga0501047_0085094 Ga0501047_0085094_429_1310 287
604 3300049586 Ga0501070_0030405 Ga0501070_0030405_2240_3121 287
605 3300049822 Ga0501035_0020784 Ga0501035_0020784_1603_2484 287
606 3300049822 Ga0501035_0494149 Ga0501035_0494149_80_967 287
607 3300050491 nmdc:mga00v17_27140_c1 nmdc:mga00v17_27140_c1_1785_2660 287
608 3300050492 nmdc:mga0yw44_2126_c1 nmdc:mga0yw44_2126_c1_7193_8080 287
609 3300050494 nmdc:mga06z11_2714_c1 nmdc:mga06z11_2714_c1_3206_4093 287
610 3300053100 Ga0500660_097463 Ga0500660_097463_241_1119 287
611 3300053109 Ga0500569_018073 Ga0500569_018073_116_1003 287
612 3300053113 Ga0500580_065834 Ga0500580_065834_219_1097 287
613 3300053134 Ga0500658_0000083 Ga0500658_0000083_30853_31740 287
614 3300053139 Ga0500568_0051304 Ga0500568_0051304_669_1556 287
615 3300053140 Ga0500573_0010576 Ga0500573_0010576_2241_3119 287
616 3300053156 Ga0500622_0000308 Ga0500622_0000308_11850_12737 287
617 3300053177 Ga0500636_0000011 Ga0500636_0000011_128801_129676 287
618 3300053177 Ga0500636_0000283 Ga0500636_0000283_21281_22156 287
619 3300059643 Ga0587072_005462 Ga0587072_005462_699_1574 287
620 iso_pu_bacteria 2508501122 2509112219 287
621 iso_pu_bacteria 2509276019 2509379500 287
622 iso_pu_bacteria 2510065057 2510307139 287
623 iso_pu_bacteria 2510917028 2511185268 287
624 iso_pu_bacteria 2511231052 2511498714 287
625 iso_pu_bacteria 2512047086 2512534851 287
626 iso_pu_bacteria 2512875026 2512973321 287
627 iso_pu_bacteria 2513237086 2513587034 287
628 iso_pu_bacteria 2513237088 2513595668 287
629 iso_pu_bacteria 2513237089 2513603676 287
630 iso_pu_bacteria 2513237091 2513619444 287
631 iso_pu_bacteria 2513237138 2513865303 287
632 iso_pu_bacteria 2513237140 2513886042 287
633 iso_pu_bacteria 2513237143 2513904380 287
634 iso_pu_bacteria 2513237156 2513983384 287
635 iso_pu_bacteria 2513237160 2514005916 287
636 iso_pu_bacteria 2515154107 2515607154 287
637 iso_pu_bacteria 2516143018 2516208010 287
638 iso_pu_bacteria 2516653046 2516894991 287
639 iso_pu_bacteria 2517487022 2517571676 287
640 iso_pu_bacteria 2524023207 2524452595 287
641 iso_pu_bacteria 2534681796 2535514517 287
642 iso_pu_bacteria 2551306084 2551675564 287
643 iso_pu_bacteria 2551306085 2551685321 287
644 iso_pu_bacteria 2551306086 2551693960 287
645 iso_pu_bacteria 2551306087 2551698093 287
646 iso_pu_bacteria 2551306089 2551713109 287
647 iso_pu_bacteria 2551306090 2551716947 287
648 iso_pu_bacteria 2551306091 2551728264 287
649 iso_pu_bacteria 2551306091 2551728571 287
650 iso_pu_bacteria 2551306092 2551733167 287
651 iso_pu_bacteria 2551306093 2551744595 287
652 iso_pu_bacteria 2558860100 2558867609 287
653 iso_pu_bacteria 2582581283 2585167302 287
654 iso_pu_bacteria 2582581294 2585201347 287
655 iso_pu_bacteria 2582581299 2585231004 287
656 iso_pu_bacteria 2582581304 2585256480 287
657 iso_pu_bacteria 2582581867 2585399154 287
658 iso_pu_bacteria 2585427590 2585818697 287
659 iso_pu_bacteria 2585427594 2585843639 287
660 iso_pu_bacteria 2643221599 2644004280 287
661 iso_pu_bacteria 2643221634 2644191161 287
662 iso_pu_bacteria 2643221643 2644237718 287
663 iso_pu_bacteria 2657244999 2657684931 287
664 iso_pu_bacteria 2690316117 2692319028 287
665 iso_pu_bacteria 2738541293 2738800718 287
666 iso_pu_bacteria 2751185821 2753463607 287
667 iso_pu_bacteria 2791355091 2792621650 287
668 iso_pu_bacteria 2791355092 2792627665 287
669 iso_pu_bacteria 2791355094 2792640380 287
670 iso_pu_bacteria 2802428858 2802721250 287
671 iso_pu_bacteria 2802428859 2802724563 287
672 iso_pu_bacteria 2802428860 2802729770 287
673 iso_pu_bacteria 2802428861 2802737116 287
674 iso_pu_bacteria 2802428862 2802746871 287
675 iso_pu_bacteria 2802428863 2802751733 287
676 iso_pu_bacteria 2802429268 2804755716 287
677 iso_pu_bacteria 2838074704 2838075794 287
678 iso_pu_bacteria 2840764183 2840768350 287
679 iso_pu_bacteria 2844163670 2844165646 287
680 iso_pu_bacteria 2847417321 2847422472 287
681 iso_pu_bacteria 2848992105 2848998119 287
682 iso_pu_bacteria 2850079185 2850079282 287
683 iso_pu_bacteria 2855825444 2855827626 287
684 iso_pu_bacteria 2855839649 2855843002 287
685 iso_pu_bacteria 2855872281 2855875809 287
686 iso_pu_bacteria 2858800743 2858801957 287
687 iso_pu_bacteria 2862705112 2862708551 287
688 iso_pu_bacteria 2896384573 2896388243 287
689 iso_pu_bacteria 2913295892 2913296236 287
690 iso_pu_bacteria 2915980308 2915983213 287
691 iso_pu_bacteria 2915986958 2915991694 287
692 iso_pu_bacteria 2915993759 2915998940 287
693 iso_pu_bacteria 2916000859 2916002891 287
694 iso_pu_bacteria 2916007675 2916011231 287
695 iso_pu_bacteria 2916014648 2916018749 287
696 iso_pu_bacteria 2916021584 2916025409 287
697 iso_pu_bacteria 2916028427 2916032219 287
698 iso_pu_bacteria 2916035215 2916038116 287
699 iso_pu_bacteria 2916041962 2916042358 287
700 iso_pu_bacteria 2916048683 2916050083 287
701 iso_pu_bacteria 2916055098 2916059013 287
702 iso_pu_bacteria 2916061851 2916063524 287
703 iso_pu_bacteria 2916068649 2916075085 287
704 iso_pu_bacteria 2916076590 2916078506 287
705 iso_pu_bacteria 2920760137 2920764352 287
706 iso_pu_bacteria 2921201388 2921206388 287
707 iso_pu_bacteria 2921208531 2921211242 287
708 iso_pu_bacteria 2921237296 2921241210 287
709 iso_pu_bacteria 2921244191 2921249360 287
710 iso_pu_bacteria 2921250672 2921256209 287
711 iso_pu_bacteria 2921257292 2921258746 287
712 iso_pu_bacteria 2921263974 2921268225 287
713 iso_pu_bacteria 2921282425 2921285262 287
714 iso_pu_bacteria 2921289301 2921293420 287
715 iso_pu_bacteria 2923556063 2923556125 287
716 iso_pu_bacteria 2924144063 2924147844 287
717 iso_pu_bacteria 2924150972 2924151907 287
718 iso_pu_bacteria 2924158325 2924163295 287
719 iso_pu_bacteria 2924165586 2924171100 287
720 iso_pu_bacteria 2924172951 2924178487 287
721 iso_pu_bacteria 2924179722 2924185002 287
722 iso_pu_bacteria 2924186466 2924192107 287
723 iso_pu_bacteria 2924193448 2924196286 287
724 iso_pu_bacteria 2924200457 2924203998 287
725 iso_pu_bacteria 2924207177 2924210664 287
726 iso_pu_bacteria 2924214083 2924219966 287
727 iso_pu_bacteria 2924221636 2924225548 287
728 iso_pu_bacteria 2924228884 2924232394 287
729 iso_pu_bacteria 2936996657 2936998859 287
730 iso_pu_bacteria 2937002841 2937007132 287
731 iso_pu_bacteria 2937009748 2937013264 287
732 iso_pu_bacteria 2937016420 2937019954 287
733 iso_pu_bacteria 2937023124 2937025550 287
734 iso_pu_bacteria 2937029754 2937032508 287
735 iso_pu_bacteria 2937036028 2937039171 287
736 iso_pu_bacteria 2937042894 2937043221 287
737 iso_pu_bacteria 2937049772 2937053158 287
738 iso_pu_bacteria 2937056579 2937061974 287
739 iso_pu_bacteria 2937063883 2937065708 287
740 iso_pu_bacteria 2937071275 2937075755 287
741 iso_pu_bacteria 2937078374 2937084042 287
742 iso_pu_bacteria 2937084907 2937087345 287
743 iso_pu_bacteria 2937091812 2937097658 287
744 iso_pu_bacteria 2937098957 2937100246 287
745 iso_pu_bacteria 2937106411 2937111198 287
746 iso_pu_bacteria 2937113482 2937115945 287
747 iso_pu_bacteria 2937119839 2937123511 287
748 iso_pu_bacteria 2937126314 2937129166 287
749 iso_pu_bacteria 2957375807 2957378136 287
750 iso_pu_bacteria 2957382221 2957386328 287
751 iso_pu_bacteria 2957388812 2957392679 287
752 iso_pu_bacteria 2957395598 2957401630 287
753 iso_pu_bacteria 2957402308 2957404963 287
754 iso_pu_bacteria 2957408893 2957411936 287
755 iso_pu_bacteria 2957415311 2957417142 287
756 iso_pu_bacteria 2957422303 2957427988 287
757 iso_pu_bacteria 2957430029 2957433002 287
758 iso_pu_bacteria 2957437181 2957439245 287
759 iso_pu_bacteria 2957443900 2957446579 287
760 iso_pu_bacteria 2957450854 2957455828 287
761 iso_pu_bacteria 2957457609 2957461204 287
762 iso_pu_bacteria 2957464669 2957467688 287
763 iso_pu_bacteria 2957471148 2957471793 287
764 iso_pu_bacteria 2957478035 2957483180 287
765 iso_pu_bacteria 2957484790 2957486981 287
766 iso_pu_bacteria 2957491536 2957493851 287
767 iso_pu_bacteria 2957498199 2957502331 287
768 iso_pu_bacteria 2957505466 2957506288 287
769 iso_pu_bacteria 2960584000 2960587202 287
770 iso_pu_bacteria 2960591022 2960593049 287
771 iso_pu_bacteria 2960597568 2960601180 287
772 iso_pu_bacteria 2960603979 2960608169 287
773 iso_pu_bacteria 2960610863 2960612271 287
774 iso_pu_bacteria 2960617483 2960620260 287
775 iso_pu_bacteria 2960624210 2960626011 287
776 iso_pu_bacteria 2960631154 2960635492 287
777 iso_pu_bacteria 2960637947 2960643896 287
778 iso_pu_bacteria 2960645483 2960651957 287
779 iso_pu_bacteria 2960652885 2960655943 287
780 iso_pu_bacteria 2960660292 2960663090 287
781 iso_pu_bacteria 2960667422 2960671323 287
782 iso_pu_bacteria 2960674078 2960678032 287
783 iso_pu_bacteria 2960680706 2960683819 287
784 iso_pu_bacteria 2960687367 2960689234 287
785 iso_pu_bacteria 2960693952 2960697053 287
786 iso_pu_bacteria 2964607997 2964613680 287
787 iso_pu_bacteria 2964615318 2964616376 287
788 iso_pu_bacteria 2964621998 2964625348 287
789 iso_pu_bacteria 2964628898 2964632050 287
790 iso_pu_bacteria 2964636051 2964640465 287
791 iso_pu_bacteria 2964643177 2964647371 287
792 iso_pu_bacteria 2964649959 2964653745 287
793 iso_pu_bacteria 2964656573 2964662410 287
794 iso_pu_bacteria 2964663802 2964667431 287
795 iso_pu_bacteria 2964670856 2964676282 287
796 iso_pu_bacteria 2964678106 2964684971 287
797 iso_pu_bacteria 2964685014 2964687822 287
798 iso_pu_bacteria 2964691889 2964695719 287
799 iso_pu_bacteria 2964698721 2964702355 287
800 iso_pu_bacteria 2964705432 2964708147 287
801 iso_pu_bacteria 2964712639 2964717427 287
802 iso_pu_bacteria 2964719344 2964722583 287
803 iso_pu_bacteria 2967664464 2967669727 287
804 iso_pu_bacteria 2967671571 2967675225 287
805 iso_pu_bacteria 2967678726 2967684290 287
806 iso_pu_bacteria 2967686174 2967688334 287
807 iso_pu_bacteria 2967693043 2967695755 287
808 iso_pu_bacteria 2967699805 2967700216 287
809 iso_pu_bacteria 2967706974 2967711265 287
810 iso_pu_bacteria 2967714385 2967719508 287
811 iso_pu_bacteria 2967721400 2967727577 287
812 iso_pu_bacteria 2967728569 2967733933 287
813 iso_pu_bacteria 2967735183 2967738584 287
814 iso_pu_bacteria 2967742019 2967747576 287
815 iso_pu_bacteria 2967748971 2967752887 287
816 iso_pu_bacteria 2967755722 2967756436 287
817 iso_pu_bacteria 2967762386 2967765332 287
818 iso_pu_bacteria 2967769361 2967773032 287
819 iso_pu_bacteria 2967775926 2967781436 287
820 iso_pu_bacteria 2970019648 2970025354 287
821 iso_pu_bacteria 2970026789 2970028825 287
822 iso_pu_bacteria 2970033650 2970038099 287
823 iso_pu_bacteria 2970040964 2970044378 287
824 iso_pu_bacteria 2970047711 2970054285 287
825 iso_pu_bacteria 2970054988 2970059132 287
826 iso_pu_bacteria 2970061556 2970067967 287
827 iso_pu_bacteria 2970068827 2970074327 287
828 iso_pu_bacteria 2970076120 2970080244 287
829 iso_pu_bacteria 2970082768 2970087641 287
830 iso_pu_bacteria 2970088815 2970092134 287
831 iso_pu_bacteria 2970095765 2970097856 287
832 iso_pu_bacteria 2970102677 2970104377 287
833 iso_pu_bacteria 2970109326 2970111794 287
834 iso_pu_bacteria 2970116247 2970120829 287
835 iso_pu_bacteria 2970122695 2970122896 287
836 iso_pu_bacteria 2970129317 2970132269 287
837 iso_pu_bacteria 2970136068 2970137744 287
838 iso_pu_bacteria 2970143518 2970145421 287
839 iso_pu_bacteria 2970149975 2970153764 287
840 iso_pu_bacteria 2970156795 2970163866 287
841 iso_pu_bacteria 2970164137 2970168522 287
842 iso_pu_bacteria 2970170962 2970174556 287
843 iso_pu_bacteria 2970177841 2970184374 287
844 iso_pu_bacteria 2970184632 2970190352 287
845 iso_pu_bacteria 2970191845 2970195876 287
846 iso_pu_bacteria 2977516862 2977522224 287
847 iso_pu_bacteria 2977523885 2977525683 287
848 iso_pu_bacteria 2977530762 2977530782 287
849 iso_pu_bacteria 2977544691 2977546809 287
850 iso_pu_bacteria 2977551784 2977557133 287
851 iso_pu_bacteria 2977558990 2977562077 287
852 iso_pu_bacteria 2977565890 2977568754 287
853 iso_pu_bacteria 2977572785 2977576784 287
854 iso_pu_bacteria 2977579622 2977582560 287
855 iso_pu_bacteria 2996887358 2996889687 287
856 iso_pu_bacteria 3005452660 3005456280 287
857 iso_pu_bacteria 643692032 643823656 287
858 iso_pu_bacteria 648276728 648740449 287
859 iso_pu_bacteria 8003992118 8003995581 287
860 iso_pu_bacteria 8003999396 8004003348 287
861 iso_pu_bacteria 8005258706 8005261535 287
862 iso_pu_bacteria 8005321885 8005324214 287
863 iso_pu_bacteria 8005542996 8005543170 287
864 3300005937 Ga0081455_10331566 Ga0081455_103315662 288
865 3300025292 Ga0209676_1000256 Ga0209676_100025617 288
866 3300030522 Ga0307512_10092747 Ga0307512_100927472 288
867 3300031824 Ga0307413_10030735 Ga0307413_100307353 288
868 3300031903 Ga0307407_10063534 Ga0307407_100635342 288
869 3300031995 Ga0307409_100064948 Ga0307409_1000649483 288
870 3300032004 Ga0307414_10127305 Ga0307414_101273052 288
871 3300032126 Ga0307415_100034769 Ga0307415_1000347693 288
872 3300041404 Ga0439436_0030841 Ga0439436_0030841_312_1199 288
873 3300044658 Ga0466972_0052262 Ga0466972_0052262_437_1357 288
874 3300044765 Ga0466970_0064151 Ga0466970_0064151_30_950 288
875 3300044901 Ga0466960_0018879 Ga0466960_0018879_1743_2663 288
876 3300046506 Ga0495583_0091327 Ga0495583_0091327_164_1051 288
877 3300047318 Ga0495636_0001079 Ga0495636_0001079_8877_9764 288
878 3300047443 Ga0495687_009007 Ga0495687_009007_3290_4177 288
879 3300049690 Ga0501261_017946 Ga0501261_017946_31_900 288
880 3300049823 Ga0501044_0089190 Ga0501044_0089190_37_918 288
881 iso_pu_bacteria 2509276021 2509389142 288
882 iso_pu_bacteria 2509276033 2509444696 288
883 iso_pu_bacteria 2510065019 2510135519 288
884 iso_pu_bacteria 2510461076 2510896981 288
885 iso_pu_bacteria 2510917030 2511194386 288
886 iso_pu_bacteria 2513237084 2513570713 288
887 iso_pu_bacteria 2513237085 2513575068 288
888 iso_pu_bacteria 2513237093 2513633855 288
889 iso_pu_bacteria 2513237103 2513712996 288
890 iso_pu_bacteria 2513237144 2513912565 288
891 iso_pu_bacteria 2513237146 2513924190 288
892 iso_pu_bacteria 2513237162 2514023507 288
893 iso_pu_bacteria 2515075009 2515114709 288
894 iso_pu_bacteria 2515154113 2515636708 288
895 iso_pu_bacteria 2515154114 2515644879 288
896 iso_pu_bacteria 2515154116 2515661185 288
897 iso_pu_bacteria 2515154134 2515741294 288
898 iso_pu_bacteria 2516653077 2517038336 288
899 iso_pu_bacteria 2516653085 2517078614 288
900 iso_pu_bacteria 2517093000 2517097351 288
901 iso_pu_bacteria 2517287029 2517408804 288
902 iso_pu_bacteria 2582581298 2585223140 288
903 iso_pu_bacteria 2585427526 2585524071 288
904 iso_pu_bacteria 2585427528 2585543571 288
905 iso_pu_bacteria 2585427529 2585546264 288
906 iso_pu_bacteria 2585427593 2585841999 288
907 iso_pu_bacteria 2599185170 2599419857 288
908 iso_pu_bacteria 2615840624 2616294065 288
909 iso_pu_bacteria 2643221629 2644167350 288
910 iso_pu_bacteria 2643221662 2644349866 288
911 iso_pu_bacteria 2718217882 2719183223 288
912 iso_pu_bacteria 2718217927 2719387948 288
913 iso_pu_bacteria 2718217997 2719667565 288
914 iso_pu_bacteria 2718218009 2719733940 288
915 iso_pu_bacteria 2718218199 2720493985 288
916 iso_pu_bacteria 2718218232 2720615448 288
917 iso_pu_bacteria 2718218233 2720622232 288
918 iso_pu_bacteria 2718218235 2720633586 288
919 iso_pu_bacteria 2718218269 2720777286 288
920 iso_pu_bacteria 2718218363 2721149335 288
921 iso_pu_bacteria 2718218365 2721160737 288
922 iso_pu_bacteria 2718218366 2721166148 288
923 iso_pu_bacteria 2718218423 2721401581 288
924 iso_pu_bacteria 2721755514 2722842318 288
925 iso_pu_bacteria 2721755556 2723028884 288
926 iso_pu_bacteria 2721755684 2723562500 288
927 iso_pu_bacteria 2721755685 2723569193 288
928 iso_pu_bacteria 2721755809 2724040395 288
929 iso_pu_bacteria 2721755810 2724046696 288
930 iso_pu_bacteria 2721755819 2724091893 288
931 iso_pu_bacteria 2721755822 2724106458 288
932 iso_pu_bacteria 2721755823 2724112263 288
933 iso_pu_bacteria 2724679232 2725947219 288
934 iso_pu_bacteria 2728369352 2730109820 288
935 iso_pu_bacteria 2728369365 2730166458 288
936 iso_pu_bacteria 2728369397 2730300369 288
937 iso_pu_bacteria 2738541333 2739038818 288
938 iso_pu_bacteria 2765235942 2766067321 288
939 iso_pu_bacteria 2791355256 2793298346 288
940 iso_pu_bacteria 2791355259 2793315809 288
941 iso_pu_bacteria 2791355260 2793323594 288
942 iso_pu_bacteria 2791355261 2793330365 288
943 iso_pu_bacteria 2791355262 2793335530 288
944 iso_pu_bacteria 2791355263 2793340917 288
945 iso_pu_bacteria 2791355264 2793350900 288
946 iso_pu_bacteria 2791355265 2793354656 288
947 iso_pu_bacteria 2791355266 2793358648 288
948 iso_pu_bacteria 2791355267 2793369132 288
949 iso_pu_bacteria 2802429605 2805929027 288
950 iso_pu_bacteria 2802429606 2805934649 288
951 iso_pu_bacteria 2802429633 2806049228 288
952 iso_pu_bacteria 2802429634 2806056145 288
953 iso_pu_bacteria 2802429635 2806063153 288
954 iso_pu_bacteria 2802429636 2806070751 288
955 iso_pu_bacteria 2802429637 2806077612 288
956 iso_pu_bacteria 2838016132 2838020793 288
957 iso_pu_bacteria 2838022645 2838028210 288
958 iso_pu_bacteria 2838035591 2838039614 288
959 iso_pu_bacteria 2838042994 2838044971 288
960 iso_pu_bacteria 2838048938 2838053064 288
961 iso_pu_bacteria 2838061910 2838064855 288
962 iso_pu_bacteria 2838068647 2838070370 288
963 iso_pu_bacteria 2838661181 2838663886 288
964 iso_pu_bacteria 2838680041 2838685465 288
965 iso_pu_bacteria 2838686498 2838689956 288
966 iso_pu_bacteria 2838694306 2838696079 288
967 iso_pu_bacteria 2838707686 2838713478 288
968 iso_pu_bacteria 2841760612 2841765112 288
969 iso_pu_bacteria 2841851746 2841852829 288
970 iso_pu_bacteria 2841864319 2841870343 288
971 iso_pu_bacteria 2842077413 2842082712 288
972 iso_pu_bacteria 2842110456 2842112870 288
973 iso_pu_bacteria 2842118031 2842123729 288
974 iso_pu_bacteria 2842156927 2842160156 288
975 iso_pu_bacteria 2842163707 2842165865 288
976 iso_pu_bacteria 2842180545 2842184178 288
977 iso_pu_bacteria 2842192696 2842196490 288
978 iso_pu_bacteria 2842198810 2842204364 288
979 iso_pu_bacteria 2842205361 2842208781 288
980 iso_pu_bacteria 2842217011 2842219540 288
981 iso_pu_bacteria 2842229732 2842231760 288
982 iso_pu_bacteria 2842237096 2842242784 288
983 iso_pu_bacteria 2842243621 2842245738 288
984 iso_pu_bacteria 2842257432 2842260116 288
985 iso_pu_bacteria 2842264693 2842266997 288
986 iso_pu_bacteria 2842271015 2842273560 288
987 iso_pu_bacteria 2842278818 2842282529 288
988 iso_pu_bacteria 2842285085 2842289925 288
989 iso_pu_bacteria 2842291075 2842296857 288
990 iso_pu_bacteria 2842304105 2842308588 288
991 iso_pu_bacteria 2842311132 2842312102 288
992 iso_pu_bacteria 2842317721 2842321660 288
993 iso_pu_bacteria 2842341865 2842348227 288
994 iso_pu_bacteria 2842363717 2842367632 288
995 iso_pu_bacteria 2842370503 2842376150 288
996 iso_pu_bacteria 2842377471 2842383359 288
997 iso_pu_bacteria 2842384541 2842390492 288
998 iso_pu_bacteria 2842395702 2842397993 288
999 iso_pu_bacteria 2842402390 2842407534 288
1000 iso_pu_bacteria 2842409023 2842414165 288
1001 iso_pu_bacteria 2842415677 2842420975 288
1002 iso_pu_bacteria 2842422224 2842423984 288
1003 iso_pu_bacteria 2842428310 2842431307 288
1004 iso_pu_bacteria 2842434925 2842437642 288
1005 iso_pu_bacteria 2842441272 2842444457 288
1006 iso_pu_bacteria 2842447887 2842451119 288
1007 iso_pu_bacteria 2842462802 2842465450 288
1008 iso_pu_bacteria 2842469257 2842472081 288
1009 iso_pu_bacteria 2842495871 2842502110 288
1010 iso_pu_bacteria 2844104063 2844106722 288
1011 iso_pu_bacteria 2844454524 2844456704 288
1012 iso_pu_bacteria 2851182111 2851187718 288
1013 iso_pu_bacteria 2851246043 2851248762 288
1014 iso_pu_bacteria 2857516855 2857521005 288
1015 iso_pu_bacteria 2919100787 2919101983 288
1016 iso_pu_bacteria 2933016740 2933020585 288
1017 iso_pu_bacteria 2933570622 2933575036 288
1018 iso_pu_bacteria 2933586486 2933588240 288
1019 iso_pu_bacteria 2933599457 2933601174 288
1020 iso_pu_bacteria 2935894831 2935900096 288
1021 iso_pu_bacteria 2935901341 2935902209 288
1022 iso_pu_bacteria 2936367885 2936369656 288
1023 iso_pu_bacteria 2936375103 2936380394 288
1024 iso_pu_bacteria 2936381700 2936385139 288
1025 iso_pu_bacteria 2937822353 2937827152 288
1026 iso_pu_bacteria 2996893221 2996896243 288
1027 iso_pu_bacteria 3005409236 3005410515 288
1028 iso_pu_bacteria 3005445848 3005449949 288
1029 iso_pu_bacteria 8005275841 8005278148 288
1030 iso_pu_bacteria 8005282627 8005282824 288
1031 iso_pu_bacteria 8005289223 8005291766 288
1032 iso_pu_bacteria 8005301065 8005305367 288
1033 iso_pu_bacteria 8005307578 8005310139 288
1034 iso_pu_bacteria 8005376324 8005378213 288
1035 iso_pu_bacteria 8005382845 8005384239 288
1036 iso_pu_bacteria 8005395548 8005399485 288
1037 iso_pu_bacteria 8005430974 8005432404 288
1038 iso_pu_bacteria 8005460587 8005465404 288
1039 iso_pu_bacteria 8005497431 8005497956 288
1040 iso_pu_bacteria 8005556819 8005559853 288
1041 iso_pu_bacteria 8005563573 8005564649 288
1042 iso_pu_bacteria 8005570704 8005570983 288
1043 iso_pu_bacteria 8005619151 8005619172 288
1044 iso_pu_bacteria 8005626139 8005627735 288
1045 iso_pu_bacteria 8005668836 8005669363 288
1046 iso_pu_bacteria 8005688590 8005692880 288
1047 iso_pu_bacteria 8005695170 8005701619 288
1048 iso_pu_bacteria 8018127388 8018132429 288
1049 iso_pu_bacteria 8018163183 8018167111 288
1050 iso_pu_bacteria 8018176218 8018176763 288
1051 iso_pu_bacteria 8023680758 8023681385 288
1052 iso_pu_bacteria 8024479707 8024481782 288
1053 iso_pu_bacteria 8024501048 8024506215 288
1054 iso_pu_bacteria 8056375014 8056381336 288
1055 iso_pu_bacteria 8056382006 8056382793 288
1056 iso_pu_bacteria 8057874678 8057877237 288
1057 3300005578 Ga0068854_100064409 Ga0068854_1000644092 289
1058 3300005616 Ga0068852_100002107 Ga0068852_1000021077 289
1059 3300009093 Ga0105240_10007818 Ga0105240_100078188 289
1060 3300009174 Ga0105241_10062149 Ga0105241_100621492 289
1061 3300009545 Ga0105237_10002420 Ga0105237_1000242010 289
1062 3300010375 Ga0105239_10388041 Ga0105239_103880412 289
1063 3300010375 Ga0105239_10430728 Ga0105239_104307281 289
1064 3300014969 Ga0157376_10293960 Ga0157376_102939601 289
1065 3300025913 Ga0207695_10000136 Ga0207695_10000136111 289
1066 3300025914 Ga0207671_10005950 Ga0207671_100059502 289
1067 3300025981 Ga0207640_10050225 Ga0207640_100502253 289
1068 3300026142 Ga0207698_10332056 Ga0207698_103320562 289
1069 3300031548 Ga0307408_100411623 Ga0307408_1004116231 289
1070 3300031911 Ga0307412_10324270 Ga0307412_103242702 289
1071 3300033180 Ga0307510_10081429 Ga0307510_100814292 289
1072 3300033547 Ga0316212_1007769 Ga0316212_10077692 289
1073 3300046507 Ga0495606_0018190 Ga0495606_0018190_584_1456 289
1074 3300046524 Ga0495648_0043505 Ga0495648_0043505_432_1304 289
1075 3300046529 Ga0495652_0146768 Ga0495652_0146768_169_1041 289
1076 3300046690 Ga0495624_0151270 Ga0495624_0151270_250_1122 289
1077 3300047317 Ga0495604_0025521 Ga0495604_0025521_679_1551 289
1078 3300047472 Ga0495686_0017404 Ga0495686_0017404_2339_3211 289
1079 3300048927 Ga0496124_0105128 Ga0496124_0105128_885_1757 289
1080 3300049460 Ga0495682_0079709 Ga0495682_0079709_175_1047 289
1081 3300049571 Ga0501034_0051191 Ga0501034_0051191_1449_2333 289
1082 3300053119 Ga0500595_051387 Ga0500595_051387_389_1261 289
1083 iso_pu_bacteria 2643221557 2643809549 289
1084 iso_pu_bacteria 2643221668 2644375889 289
1085 iso_pu_bacteria 2920822456 2920827530 289
1086 3300006051 Ga0075364_10019248 Ga0075364_100192483 290
1087 3300006186 Ga0075369_10130850 Ga0075369_101308502 290
1088 3300046506 Ga0495583_0007210 Ga0495583_0007210_4214_5122 290
1089 3300046512 Ga0495610_0017073 Ga0495610_0017073_2770_3678 290
1090 3300046513 Ga0495616_0007526 Ga0495616_0007526_1856_2764 290
1091 3300046515 Ga0495620_0000419 Ga0495620_0000419_18635_19543 290
1092 3300046522 Ga0495643_0008514 Ga0495643_0008514_2243_3151 290
1093 3300046542 Ga0495597_0009339 Ga0495597_0009339_136_1044 290
1094 3300046660 Ga0495625_0065711 Ga0495625_0065711_511_1419 290
1095 3300046694 Ga0495649_0004007 Ga0495649_0004007_6040_6948 290
1096 3300047323 Ga0495683_0002213 Ga0495683_0002213_6432_7340 290
1097 3300047443 Ga0495687_004605 Ga0495687_004605_5039_5947 290
1098 3300048924 Ga0496121_0041492 Ga0496121_0041492_1573_2463 290
1099 3300050490 nmdc:mga03n38_85912_c1 nmdc:mga03n38_85912_c1_399_1274 290
1100 3300050496 nmdc:mga07m45_48111_c1 nmdc:mga07m45_48111_c1_1181_2056 290
1101 3300053153 Ga0500616_0000187 Ga0500616_0000187_56739_57647 290
1102 3300053156 Ga0500622_0070275 Ga0500622_0070275_806_1714 290
1103 iso_pu_bacteria 2510917022 2511133099 290
1104 iso_pu_bacteria 2524023209 2524458621 290
1105 iso_pu_bacteria 2582581307 2585271836 290
1106 iso_pu_bacteria 2582581308 2585279798 290
1107 iso_pu_bacteria 2582581315 2585326662 290
1108 iso_pu_bacteria 2582581316 2585333828 290
1109 iso_pu_bacteria 2585427527 2585531798 290
1110 iso_pu_bacteria 2585427530 2585551254 290
1111 iso_pu_bacteria 2585427531 2585563798 290
1112 iso_pu_bacteria 2585427608 2585897004 290
1113 iso_pu_bacteria 2585427609 2585907137 290
1114 iso_pu_bacteria 2585428125 2587982869 290
1115 iso_pu_bacteria 2615840626 2616306589 290
1116 iso_pu_bacteria 2615840698 2616551226 290
1117 iso_pu_bacteria 2617270742 2617382977 290
1118 iso_pu_bacteria 2667528174 2671113350 290
1119 iso_pu_bacteria 2775507266 2778179043 290
1120 iso_pu_bacteria 2818991448 2819611637 290
1121 iso_pu_bacteria 2818991453 2819638685 290
1122 iso_pu_bacteria 2838029111 2838031064 290
1123 iso_pu_bacteria 2842298080 2842300118 290
1124 iso_pu_bacteria 2842357229 2842359029 290
1125 iso_pu_bacteria 2842475841 2842477796 290
1126 iso_pu_bacteria 2842482326 2842485093 290
1127 iso_pu_bacteria 2842502639 2842504332 290
1128 iso_pu_bacteria 2842509118 2842511551 290
1129 iso_pu_bacteria 2852387548 2852391908 290
1130 iso_pu_bacteria 2874123672 2874128762 290
1131 iso_pu_bacteria 2919408235 2919411195 290
1132 iso_pu_bacteria 3005416602 3005421489 290
1133 iso_pu_bacteria 8005314921 8005319808 290
1134 iso_pu_bacteria 8005484373 8005490433 290
1135 iso_pu_bacteria 8005645114 8005647076 290
1136 iso_pu_bacteria 8005682033 8005687006 290
1137 iso_pu_bacteria 8046767195 8046767403 290
1138 iso_pu_bacteria 8057575449 8057578461 290
1139 3300021321 Ga0214542_1021618 Ga0214542_10216184 291
1140 3300021327 Ga0214543_1009269 Ga0214543_100926911 291
1141 3300022739 Ga0228711_1000006 Ga0228711_1000006175 291
1142 3300022740 Ga0228710_1000004 Ga0228710_1000004226 291
1143 3300025294 Ga0209025_1021041 Ga0209025_10210412 291
1144 3300025933 Ga0207706_10236571 Ga0207706_102365712 291
1145 3300027111 Ga0209281_1000102 Ga0209281_1000102158 291
1146 3300027111 Ga0209281_1000563 Ga0209281_100056317 291
1147 3300027666 Ga0209282_1000013 Ga0209282_1000013193 291
1148 3300031456 Ga0307513_10081852 Ga0307513_100818523 291
1149 3300031548 Ga0307408_100291335 Ga0307408_1002913352 291
1150 3300031967 Ga0315914_1000004 Ga0315914_1000004228 291
1151 3300031995 Ga0307409_100220145 Ga0307409_1002201452 291
1152 3300033430 Ga0315913_1000055 Ga0315913_100005521 291
1153 3300033464 Ga0315915_1000003 Ga0315915_1000003335 291
1154 3300042007 Ga0439449_0035952 Ga0439449_0035952_847_1734 291
1155 3300046452 Ga0495617_031549 Ga0495617_031549_315_1202 291
1156 3300046460 Ga0495638_0000393 Ga0495638_0000393_30808_31695 291
1157 3300046492 Ga0495585_0018147 Ga0495585_0018147_567_1454 291
1158 3300046512 Ga0495610_0004797 Ga0495610_0004797_1695_2579 291
1159 3300046518 Ga0495631_0002319 Ga0495631_0002319_4969_5856 291
1160 3300046543 Ga0495645_0018535 Ga0495645_0018535_3210_4097 291
1161 3300046660 Ga0495625_0001497 Ga0495625_0001497_15254_16141 291
1162 3300047320 Ga0495672_0028222 Ga0495672_0028222_2385_3272 291
1163 3300047443 Ga0495687_105285 Ga0495687_105285_118_1002 291
1164 3300049572 Ga0501036_0264158 Ga0501036_0264158_480_1373 291
1165 3300049581 Ga0501047_0173948 Ga0501047_0173948_213_1106 291
1166 3300049822 Ga0501035_0519569 Ga0501035_0519569_72_965 291
1167 3300053104 Ga0500556_0115066 Ga0500556_0115066_149_1036 291
1168 3300053118 Ga0500594_0005833 Ga0500594_0005833_863_1750 291
1169 3300053153 Ga0500616_0003602 Ga0500616_0003602_10503_11390 291
1170 3300053153 Ga0500616_0085813 Ga0500616_0085813_567_1460 291
1171 3300053158 Ga0500627_0035582 Ga0500627_0035582_1086_1973 291
1172 3300003775 Ga0055524_1014466 Ga0055524_10144662 292
1173 3300013250 Ga0171462_1067 Ga0171462_10678 292
1174 3300025294 Ga0209025_1006010 Ga0209025_10060105 292
1175 3300041413 Ga0439465_0008671 Ga0439465_0008671_2023_2910 292
1176 3300042004 Ga0439445_0027998 Ga0439445_0027998_306_1193 292
1177 3300042007 Ga0439449_0031779 Ga0439449_0031779_1006_1893 292
1178 3300046476 Ga0495662_0015516 Ga0495662_0015516_1245_2123 292
1179 3300047317 Ga0495604_0054994 Ga0495604_0054994_636_1514 292
1180 iso_pu_bacteria 2558860983 2561467604 293
1181 3300001979 JGI24740J21852_10026791 JGI24740J21852_100267912 294
1182 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004128 294
1183 3300002705 JGI25156J39149_1000014 JGI25156J39149_100001452 294
1184 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001544 294
1185 3300002737 JGI25162J39368_1001203 JGI25162J39368_100120311 294
1186 3300002737 JGI25162J39368_1002942 JGI25162J39368_10029423 294
1187 3300002738 JGI25154J39366_1000026 JGI25154J39366_100002656 294
1188 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005135 294
1189 3300002987 JGI25159J45721_1000242 JGI25159J45721_100024213 294
1190 3300003214 JGI25165J46597_1001246 JGI25165J46597_10012463 294
1191 3300003214 JGI25165J46597_1002528 JGI25165J46597_10025283 294
1192 3300003322 rootL2_10112950 rootL2_101129505 294
1193 3300003323 rootH1_10078778 rootH1_100787782 294
1194 3300003354 JGI25160J50197_1000022 JGI25160J50197_100002239 294
1195 3300003374 JGI25161J50226_1000024 JGI25161J50226_100002493 294
1196 3300004625 Ga0055543_1000025 Ga0055543_100002539 294
1197 3300005262 Ga0065165_1000200 Ga0065165_100020039 294
1198 3300005548 Ga0070665_100250452 Ga0070665_1002504522 294
1199 3300005614 Ga0068856_100008285 Ga0068856_1000082854 294
1200 3300006048 Ga0075363_100017783 Ga0075363_1000177832 294
1201 3300006353 Ga0075370_10010473 Ga0075370_100104733 294
1202 3300009093 Ga0105240_10000013 Ga0105240_10000013361 294
1203 3300009545 Ga0105237_10010647 Ga0105237_100106471 294
1204 3300013104 Ga0157370_10003431 Ga0157370_1000343115 294
1205 3300015262 Ga0182007_10006551 Ga0182007_100065512 294
1206 3300015265 Ga0182005_1001647 Ga0182005_10016474 294
1207 3300025206 Ga0209435_100009 Ga0209435_100009132 294
1208 3300025228 Ga0209672_102531 Ga0209672_1025313 294
1209 3300025233 Ga0209437_100057 Ga0209437_100057341 294
1210 3300025233 Ga0209437_100772 Ga0209437_1007723 294
1211 3300025246 Ga0209646_1000018 Ga0209646_1000018132 294
1212 3300025246 Ga0209646_1010000 Ga0209646_10100002 294
1213 3300025250 Ga0209026_1000043 Ga0209026_1000043132 294
1214 3300025253 Ga0209677_100426 Ga0209677_1004268 294
1215 3300025256 Ga0209759_1000007 Ga0209759_1000007132 294
1216 3300025256 Ga0209759_1020957 Ga0209759_10209572 294
1217 3300025261 Ga0209233_1000130 Ga0209233_1000130143 294
1218 3300025261 Ga0209233_1000255 Ga0209233_100025524 294
1219 3300025261 Ga0209233_1000332 Ga0209233_100033238 294
1220 3300025284 Ga0209130_1000164 Ga0209130_100016452 294
1221 3300025302 Ga0207426_1000082 Ga0207426_100008252 294
1222 3300025913 Ga0207695_10000044 Ga0207695_10000044318 294
1223 3300025914 Ga0207671_10000043 Ga0207671_10000043170 294
1224 3300026078 Ga0207702_10006190 Ga0207702_100061906 294
1225 3300027312 Ga0209371_1001347 Ga0209371_10013475 294
1226 3300030500 Ga0268256_1001200 Ga0268256_100120011 294
1227 3300046507 Ga0495606_0001613 Ga0495606_0001613_14482_15366 294
1228 3300059605 Ga0587106_000487 Ga0587106_000487_560_1444 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

116

302

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8672 18 281
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8592 14 282
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8539 13 284
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8477 13 284
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8304 20 294
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9482 21 284 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9361 21 278 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9281 21 284 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9207 21 284 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9173 21 280 1.10.3720.10
ID Description Score Start End GO Terms
AF-H0HFA4-F1-model_v4 deleted 0.9823 24 294
AF-A0A4Q3HBY0-F1-model_v4 Carbohydrate ABC transporter permease 0.9822 72 294 GO:0005886
GO:0055085
AF-A0A402AR11-F1-model_v4 ABC transporter permease 0.981 46 294 GO:0005886
GO:0055085
AF-A0A7Y2M325-F1-model_v4 deleted 0.9798 46 294
AF-H0HFA4-F1-model_v4 deleted 0.9752 24 294

Feature Viewer

pLDDT pTM Quality
86.23 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map