F491916
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1225 | 453 | 1188 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0121492|Ga0436362_0121492_150_887 |
| Length | 245 |
| Sequence | MFPPGFYRFPATRRDGGGIATKGGHAMTLALGDTAPDFEAQATEGPVRFHEWIGDSWAVLFSHPKDFTPVCTTELGYMAKIKPEFDRRDVKIIGLSVDSTGDHERWVADIEETQGTAPNFPIIGDADFTVAKLYGMLPAATSGDAGTRTSADNQTVRNVFVVGPDKKIKLVLVYPMTTGRNFDEVLRVIDSLQMTAKHKVATPVNWKQGEDVIIAGSVSDDDAKKTYPQGWKSPKPYIRIVPQPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 5 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 6 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 7 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 8 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 9 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 10 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 11 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 12 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 13 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 14 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 15 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 16 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 17 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 18 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 19 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 20 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 21 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 22 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 23 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 24 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 25 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 26 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 27 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 28 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 29 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 30 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 31 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 32 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 33 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 34 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 37 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 38 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 40 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 151 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 158 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 282 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 283 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 284 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 285 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 286 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 287 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 288 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 289 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 290 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 291 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 294 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 379 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 380 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 409 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 417 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 419 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 436 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 449 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 450 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 451 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 452 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 453 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.1 |
| Metatranscriptomes | 1.88 |
| Isolates | 3.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.8 |
| Nodule | 1.14 |
| Rhizoplane | 5.71 |
| Rhizosphere | 86.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001546 | 3300001904 | Bacteria | 4188 |
| 2 | JGI24740J21852_10021331 | 3300001979 | Bacteria | 2247 |
| 3 | JGI24737J22298_10049062 | 3300001990 | Bacteria | 1285 |
| 4 | JGI24035J26624_1006303 | 3300002126 | Bacteria | 1142 |
| 5 | Ga0007417J51691_1073041 | 3300003544 | Bacteria | 975 |
| 6 | Ga0058860_11949334 | 3300004801 | Bacteria | 818 |
| 7 | Ga0058862_10157652 | 3300004803 | Bacteria | 858 |
| 8 | Ga0065712_10012833 | 3300005290 | Bacteria | 2220 |
| 9 | Ga0065712_10032685 | 3300005290 | Bacteria | 970 |
| 10 | Ga0065712_10151397 | 3300005290 | Bacteria | 1367 |
| 11 | Ga0065715_10009372 | 3300005293 | Bacteria | 4356 |
| 12 | Ga0065715_10055804 | 3300005293 | Bacteria | 962 |
| 13 | Ga0065707_10227701 | 3300005295 | Bacteria | 1200 |
| 14 | Ga0070658_10149875 | 3300005327 | Bacteria | 1952 |
| 15 | Ga0070658_10158544 | 3300005327 | Bacteria | 1898 |
| 16 | Ga0070676_10162115 | 3300005328 | Bacteria | 1440 |
| 17 | Ga0070683_100020623 | 3300005329 | Bacteria | 5866 |
| 18 | Ga0070683_100025751 | 3300005329 | Bacteria | 5288 |
| 19 | Ga0070683_100034751 | 3300005329 | Bacteria | 4606 |
| 20 | Ga0070683_100103425 | 3300005329 | Bacteria | 2684 |
| 21 | Ga0070690_100176681 | 3300005330 | Bacteria | 1473 |
| 22 | Ga0070680_100014149 | 3300005336 | Bacteria | 6231 |
| 23 | Ga0070680_100257606 | 3300005336 | Bacteria | 1475 |
| 24 | Ga0068868_100080096 | 3300005338 | Bacteria | 2617 |
| 25 | Ga0070660_100002826 | 3300005339 | Bacteria | 11944 |
| 26 | Ga0070660_100009935 | 3300005339 | Bacteria | 6714 |
| 27 | Ga0070660_100498792 | 3300005339 | Bacteria | 1013 |
| 28 | Ga0070691_10005642 | 3300005341 | Bacteria | 5704 |
| 29 | Ga0070691_10216479 | 3300005341 | Bacteria | 1013 |
| 30 | Ga0070661_100000041 | 3300005344 | Bacteria | 99916 |
| 31 | Ga0070661_100042290 | 3300005344 | Bacteria | 3326 |
| 32 | Ga0070661_100073409 | 3300005344 | Bacteria | 2519 |
| 33 | Ga0070661_100144694 | 3300005344 | Bacteria | 1793 |
| 34 | Ga0070692_10299253 | 3300005345 | Bacteria | 982 |
| 35 | Ga0070668_100029391 | 3300005347 | Bacteria | 4175 |
| 36 | Ga0070668_100093029 | 3300005347 | Bacteria | 2379 |
| 37 | Ga0070668_100140883 | 3300005347 | Bacteria | 1943 |
| 38 | Ga0070669_100051452 | 3300005353 | Bacteria | 3011 |
| 39 | Ga0070669_100107050 | 3300005353 | Bacteria | 2118 |
| 40 | Ga0070669_100236350 | 3300005353 | Bacteria | 1450 |
| 41 | Ga0070671_100098474 | 3300005355 | Bacteria | 2453 |
| 42 | Ga0070688_100067483 | 3300005365 | Bacteria | 2279 |
| 43 | Ga0070688_100104790 | 3300005365 | Bacteria | 1871 |
| 44 | Ga0070667_100017618 | 3300005367 | Bacteria | 5917 |
| 45 | Ga0070667_100683478 | 3300005367 | Bacteria | 949 |
| 46 | Ga0070709_10004332 | 3300005434 | Bacteria | 7649 |
| 47 | Ga0070709_10019181 | 3300005434 | Bacteria | 3948 |
| 48 | Ga0070714_100006242 | 3300005435 | Bacteria | 9178 |
| 49 | Ga0070714_100010508 | 3300005435 | Bacteria | 7318 |
| 50 | Ga0070714_100030048 | 3300005435 | Bacteria | 4521 |
| 51 | Ga0070714_100059408 | 3300005435 | Bacteria | 3278 |
| 52 | Ga0070714_100061341 | 3300005435 | Bacteria | 3229 |
| 53 | Ga0070714_100187329 | 3300005435 | Unclassified | 1886 |
| 54 | Ga0070714_100245371 | 3300005435 | Bacteria | 1654 |
| 55 | Ga0070713_100000082 | 3300005436 | Bacteria | 59649 |
| 56 | Ga0070713_100008049 | 3300005436 | Bacteria | 7447 |
| 57 | Ga0070713_100014411 | 3300005436 | Bacteria | 5872 |
| 58 | Ga0070713_100014989 | 3300005436 | Bacteria | 5773 |
| 59 | Ga0070713_100041798 | 3300005436 | Bacteria | 3738 |
| 60 | Ga0070713_100747518 | 3300005436 | Bacteria | 935 |
| 61 | Ga0070710_10003513 | 3300005437 | Bacteria | 7426 |
| 62 | Ga0070710_10078099 | 3300005437 | Bacteria | 1925 |
| 63 | Ga0070710_10088215 | 3300005437 | Bacteria | 1825 |
| 64 | Ga0070711_100005906 | 3300005439 | Bacteria | 7350 |
| 65 | Ga0070711_100035041 | 3300005439 | Bacteria | 3352 |
| 66 | Ga0070711_100057541 | 3300005439 | Bacteria | 2692 |
| 67 | Ga0070711_100167351 | 3300005439 | Bacteria | 1672 |
| 68 | Ga0070705_100199479 | 3300005440 | Bacteria | 1370 |
| 69 | Ga0070705_100243743 | 3300005440 | Bacteria | 1258 |
| 70 | Ga0070700_100189042 | 3300005441 | Bacteria | 1438 |
| 71 | Ga0070694_100013180 | 3300005444 | Bacteria | 5160 |
| 72 | Ga0070708_100000591 | 3300005445 | Bacteria | 27222 |
| 73 | Ga0070708_100005942 | 3300005445 | Bacteria | 9705 |
| 74 | Ga0070708_100024431 | 3300005445 | Bacteria | 5157 |
| 75 | Ga0070708_100132297 | 3300005445 | Bacteria | 2309 |
| 76 | Ga0070708_100179668 | 3300005445 | Bacteria | 1977 |
| 77 | Ga0070708_100504208 | 3300005445 | Bacteria | 1142 |
| 78 | Ga0070708_100639337 | 3300005445 | Bacteria | 1003 |
| 79 | Ga0070663_100083200 | 3300005455 | Bacteria | 2356 |
| 80 | Ga0070663_100120677 | 3300005455 | Bacteria | 1980 |
| 81 | Ga0070678_100089382 | 3300005456 | Bacteria | 2357 |
| 82 | Ga0070662_100485489 | 3300005457 | Bacteria | 1029 |
| 83 | Ga0070662_100673803 | 3300005457 | Bacteria | 874 |
| 84 | Ga0070681_10027219 | 3300005458 | Bacteria | 5749 |
| 85 | Ga0070681_10041200 | 3300005458 | Bacteria | 4627 |
| 86 | Ga0070681_10169066 | 3300005458 | Bacteria | 2108 |
| 87 | Ga0070681_10334269 | 3300005458 | Bacteria | 1424 |
| 88 | Ga0070706_100001102 | 3300005467 | Bacteria | 29219 |
| 89 | Ga0070706_100007691 | 3300005467 | Bacteria | 10077 |
| 90 | Ga0070706_100009021 | 3300005467 | Bacteria | 9286 |
| 91 | Ga0070706_100026212 | 3300005467 | Bacteria | 5364 |
| 92 | Ga0070706_100053581 | 3300005467 | Bacteria | 3723 |
| 93 | Ga0070706_100149766 | 3300005467 | Bacteria | 2178 |
| 94 | Ga0070706_100232846 | 3300005467 | Bacteria | 1719 |
| 95 | Ga0070707_100002467 | 3300005468 | Bacteria | 17624 |
| 96 | Ga0070707_100003569 | 3300005468 | Bacteria | 14676 |
| 97 | Ga0070707_100006204 | 3300005468 | Bacteria | 11132 |
| 98 | Ga0070707_100009048 | 3300005468 | Bacteria | 9237 |
| 99 | Ga0070707_100019118 | 3300005468 | Bacteria | 6451 |
| 100 | Ga0070707_100187051 | 3300005468 | Bacteria | 2019 |
| 101 | Ga0070707_100196087 | 3300005468 | Bacteria | 1969 |
| 102 | Ga0070707_100371521 | 3300005468 | Bacteria | 1389 |
| 103 | Ga0070698_100001309 | 3300005471 | Bacteria | 27709 |
| 104 | Ga0070698_100001661 | 3300005471 | Bacteria | 24810 |
| 105 | Ga0070698_100001665 | 3300005471 | Bacteria | 24789 |
| 106 | Ga0070698_100003182 | 3300005471 | Bacteria | 18095 |
| 107 | Ga0070698_100005317 | 3300005471 | Bacteria | 14093 |
| 108 | Ga0070698_100008526 | 3300005471 | Bacteria | 11064 |
| 109 | Ga0070698_100009752 | 3300005471 | Bacteria | 10264 |
| 110 | Ga0070698_100012150 | 3300005471 | Bacteria | 9125 |
| 111 | Ga0070698_100023955 | 3300005471 | Bacteria | 6373 |
| 112 | Ga0070698_100036344 | 3300005471 | Bacteria | 5089 |
| 113 | Ga0070698_100355926 | 3300005471 | Bacteria | 1396 |
| 114 | Ga0070699_100018447 | 3300005518 | Bacteria | 5994 |
| 115 | Ga0070699_100276844 | 3300005518 | Bacteria | 1503 |
| 116 | Ga0070699_100297810 | 3300005518 | Bacteria | 1447 |
| 117 | Ga0070699_100836271 | 3300005518 | Bacteria | 843 |
| 118 | Ga0070679_100023466 | 3300005530 | Bacteria | 6039 |
| 119 | Ga0070679_100209681 | 3300005530 | Bacteria | 1912 |
| 120 | Ga0070679_100241052 | 3300005530 | Bacteria | 1765 |
| 121 | Ga0070679_100614799 | 3300005530 | Bacteria | 1030 |
| 122 | Ga0070684_100041997 | 3300005535 | Bacteria | 3946 |
| 123 | Ga0070684_100086154 | 3300005535 | Bacteria | 2787 |
| 124 | Ga0070684_100105147 | 3300005535 | Bacteria | 2526 |
| 125 | Ga0070697_100003592 | 3300005536 | Bacteria | 11923 |
| 126 | Ga0070697_100036352 | 3300005536 | Bacteria | 3978 |
| 127 | Ga0070697_100065932 | 3300005536 | Bacteria | 2959 |
| 128 | Ga0070697_100068493 | 3300005536 | Bacteria | 2906 |
| 129 | Ga0070697_100100669 | 3300005536 | Bacteria | 2400 |
| 130 | Ga0070697_100715297 | 3300005536 | Bacteria | 884 |
| 131 | Ga0068853_100059756 | 3300005539 | Bacteria | 3293 |
| 132 | Ga0070695_100015384 | 3300005545 | Bacteria | 4621 |
| 133 | Ga0070695_100113218 | 3300005545 | Bacteria | 1844 |
| 134 | Ga0070696_100006691 | 3300005546 | Bacteria | 7700 |
| 135 | Ga0070696_100051921 | 3300005546 | Bacteria | 2852 |
| 136 | Ga0070696_100222347 | 3300005546 | Bacteria | 1417 |
| 137 | Ga0070693_100024784 | 3300005547 | Bacteria | 3222 |
| 138 | Ga0070665_100033882 | 3300005548 | Bacteria | 5137 |
| 139 | Ga0070665_100054303 | 3300005548 | Bacteria | 4018 |
| 140 | Ga0070665_101106780 | 3300005548 | Bacteria | 804 |
| 141 | Ga0068855_100019205 | 3300005563 | Bacteria | 8214 |
| 142 | Ga0068855_100040999 | 3300005563 | Bacteria | 5489 |
| 143 | Ga0068855_100127377 | 3300005563 | Bacteria | 2910 |
| 144 | Ga0068855_100157753 | 3300005563 | Bacteria | 2577 |
| 145 | Ga0068855_100239215 | 3300005563 | Bacteria | 2029 |
| 146 | Ga0068855_100338539 | 3300005563 | Bacteria | 1659 |
| 147 | Ga0070664_100022364 | 3300005564 | Bacteria | 5213 |
| 148 | Ga0068857_100218622 | 3300005577 | Bacteria | 1740 |
| 149 | Ga0068854_100192610 | 3300005578 | Bacteria | 1598 |
| 150 | Ga0068854_100663036 | 3300005578 | Bacteria | 897 |
| 151 | Ga0068856_100089394 | 3300005614 | Bacteria | 3063 |
| 152 | Ga0068856_100093010 | 3300005614 | Bacteria | 3001 |
| 153 | Ga0070702_100067488 | 3300005615 | Bacteria | 2101 |
| 154 | Ga0068852_100256473 | 3300005616 | Bacteria | 1677 |
| 155 | Ga0068852_100320332 | 3300005616 | Bacteria | 1505 |
| 156 | Ga0068852_100604052 | 3300005616 | Bacteria | 1101 |
| 157 | Ga0068859_100046143 | 3300005617 | Bacteria | 4377 |
| 158 | Ga0068864_100069399 | 3300005618 | Bacteria | 3064 |
| 159 | Ga0068864_100117908 | 3300005618 | Bacteria | 2370 |
| 160 | Ga0068864_100344065 | 3300005618 | Bacteria | 1406 |
| 161 | Ga0068866_10378935 | 3300005718 | Bacteria | 907 |
| 162 | Ga0068866_10532197 | 3300005718 | Bacteria | 783 |
| 163 | Ga0068861_100075446 | 3300005719 | Bacteria | 2625 |
| 164 | Ga0068851_10180533 | 3300005834 | Bacteria | 1169 |
| 165 | Ga0068870_10331509 | 3300005840 | Bacteria | 970 |
| 166 | Ga0068863_100011306 | 3300005841 | Bacteria | 8645 |
| 167 | Ga0068863_100601007 | 3300005841 | Bacteria | 1089 |
| 168 | Ga0068858_100920913 | 3300005842 | Bacteria | 855 |
| 169 | Ga0068860_100415631 | 3300005843 | Bacteria | 1332 |
| 170 | Ga0068862_100003797 | 3300005844 | Bacteria | 12871 |
| 171 | Ga0068862_100024969 | 3300005844 | Bacteria | 5017 |
| 172 | Ga0068862_100051631 | 3300005844 | Bacteria | 3517 |
| 173 | Ga0068862_100206612 | 3300005844 | Bacteria | 1773 |
| 174 | Ga0081455_10015272 | 3300005937 | Bacteria | 7466 |
| 175 | Ga0081455_10123148 | 3300005937 | Bacteria | 2040 |
| 176 | Ga0081455_10292865 | 3300005937 | Bacteria | 1171 |
| 177 | Ga0081455_10331401 | 3300005937 | Bacteria | 1080 |
| 178 | Ga0081539_10157753 | 3300005985 | Bacteria | 1085 |
| 179 | Ga0070717_10007092 | 3300006028 | Bacteria | 8301 |
| 180 | Ga0070717_10028432 | 3300006028 | Bacteria | 4476 |
| 181 | Ga0070717_10053770 | 3300006028 | Bacteria | 3319 |
| 182 | Ga0070717_10080610 | 3300006028 | Bacteria | 2731 |
| 183 | Ga0070717_10126030 | 3300006028 | Bacteria | 2199 |
| 184 | Ga0070717_10205681 | 3300006028 | Bacteria | 1726 |
| 185 | Ga0075363_100216879 | 3300006048 | Bacteria | 1096 |
| 186 | Ga0075432_10028966 | 3300006058 | Bacteria | 1911 |
| 187 | Ga0070715_10001832 | 3300006163 | Bacteria | 6349 |
| 188 | Ga0070715_10008237 | 3300006163 | Bacteria | 3626 |
| 189 | Ga0070716_100022208 | 3300006173 | Bacteria | 3350 |
| 190 | Ga0070716_100125681 | 3300006173 | Bacteria | 1613 |
| 191 | Ga0070716_100139619 | 3300006173 | Bacteria | 1543 |
| 192 | Ga0070712_100033486 | 3300006175 | Bacteria | 3477 |
| 193 | Ga0070712_100058375 | 3300006175 | Bacteria | 2714 |
| 194 | Ga0070712_100114211 | 3300006175 | Bacteria | 2021 |
| 195 | Ga0070712_100245177 | 3300006175 | Bacteria | 1429 |
| 196 | Ga0070712_100283796 | 3300006175 | Bacteria | 1334 |
| 197 | Ga0070712_100364011 | 3300006175 | Bacteria | 1187 |
| 198 | Ga0070712_100638582 | 3300006175 | Bacteria | 904 |
| 199 | Ga0097621_100105899 | 3300006237 | Bacteria | 2372 |
| 200 | Ga0068871_100116467 | 3300006358 | Bacteria | 2253 |
| 201 | Ga0075428_100015027 | 3300006844 | Bacteria | 8600 |
| 202 | Ga0075430_100000050 | 3300006846 | Bacteria | 61220 |
| 203 | Ga0075430_100002824 | 3300006846 | Bacteria | 14529 |
| 204 | Ga0075430_100038855 | 3300006846 | Bacteria | 4030 |
| 205 | Ga0075430_100082906 | 3300006846 | Bacteria | 2687 |
| 206 | Ga0075430_100097061 | 3300006846 | Bacteria | 2463 |
| 207 | Ga0075431_100007688 | 3300006847 | Bacteria | 10733 |
| 208 | Ga0075433_10001917 | 3300006852 | Bacteria | 15644 |
| 209 | Ga0075433_10087741 | 3300006852 | Bacteria | 2747 |
| 210 | Ga0075434_100012228 | 3300006871 | Bacteria | 8133 |
| 211 | Ga0075434_100181026 | 3300006871 | Bacteria | 2128 |
| 212 | Ga0075434_100409738 | 3300006871 | Bacteria | 1377 |
| 213 | Ga0075434_101307536 | 3300006871 | Bacteria | 736 |
| 214 | Ga0075429_100024107 | 3300006880 | Bacteria | 5277 |
| 215 | Ga0075429_100055826 | 3300006880 | Bacteria | 3437 |
| 216 | Ga0075429_100193489 | 3300006880 | Bacteria | 1782 |
| 217 | Ga0075429_100610396 | 3300006880 | Bacteria | 956 |
| 218 | Ga0068865_100061825 | 3300006881 | Bacteria | 2627 |
| 219 | Ga0075436_100000262 | 3300006914 | Bacteria | 32984 |
| 220 | Ga0097620_100046143 | 3300006931 | Bacteria | 4377 |
| 221 | Ga0075435_100752619 | 3300007076 | Bacteria | 848 |
| 222 | Ga0099794_10003354 | 3300007265 | Bacteria | 6097 |
| 223 | Ga0099795_10135711 | 3300007788 | Bacteria | 997 |
| 224 | Ga0105240_10066347 | 3300009093 | Bacteria | 4477 |
| 225 | Ga0105240_10067377 | 3300009093 | Bacteria | 4437 |
| 226 | Ga0111539_10367577 | 3300009094 | Bacteria | 1674 |
| 227 | Ga0105245_10008241 | 3300009098 | Bacteria | 9109 |
| 228 | Ga0105245_10069111 | 3300009098 | Bacteria | 3202 |
| 229 | Ga0105245_10355423 | 3300009098 | Bacteria | 1453 |
| 230 | Ga0105245_10498443 | 3300009098 | Bacteria | 1234 |
| 231 | Ga0105245_10689161 | 3300009098 | Bacteria | 1054 |
| 232 | Ga0114129_10019737 | 3300009147 | Bacteria | 9593 |
| 233 | Ga0114129_10083228 | 3300009147 | Bacteria | 4446 |
| 234 | Ga0114129_10084319 | 3300009147 | Bacteria | 4412 |
| 235 | Ga0114129_10233255 | 3300009147 | Bacteria | 2478 |
| 236 | Ga0114129_10284406 | 3300009147 | Bacteria | 2209 |
| 237 | Ga0114129_10425114 | 3300009147 | Bacteria | 1747 |
| 238 | Ga0114129_11686697 | 3300009147 | Bacteria | 774 |
| 239 | Ga0105241_10105659 | 3300009174 | Bacteria | 2246 |
| 240 | Ga0105241_10158884 | 3300009174 | Bacteria | 1856 |
| 241 | Ga0105242_10251780 | 3300009176 | Bacteria | 1592 |
| 242 | Ga0105242_10902046 | 3300009176 | Bacteria | 884 |
| 243 | Ga0105248_10266395 | 3300009177 | Bacteria | 1929 |
| 244 | Ga0105237_10517365 | 3300009545 | Bacteria | 1200 |
| 245 | Ga0105237_10673846 | 3300009545 | Bacteria | 1041 |
| 246 | Ga0105238_10085401 | 3300009551 | Bacteria | 3144 |
| 247 | Ga0105249_10257461 | 3300009553 | Bacteria | 1733 |
| 248 | Ga0105239_10184345 | 3300010375 | Bacteria | 2335 |
| 249 | Ga0105239_10193763 | 3300010375 | Bacteria | 2275 |
| 250 | Ga0105239_10225689 | 3300010375 | Bacteria | 2101 |
| 251 | Ga0105239_10226695 | 3300010375 | Bacteria | 2096 |
| 252 | Ga0105239_10230433 | 3300010375 | Bacteria | 2078 |
| 253 | Ga0105246_10118557 | 3300011119 | Bacteria | 1957 |
| 254 | Ga0105246_10225168 | 3300011119 | Bacteria | 1473 |
| 255 | Ga0157373_10005491 | 3300013100 | Bacteria | 9514 |
| 256 | Ga0157373_10125771 | 3300013100 | Bacteria | 1803 |
| 257 | Ga0157371_10034859 | 3300013102 | Bacteria | 3608 |
| 258 | Ga0157371_10517536 | 3300013102 | Bacteria | 882 |
| 259 | Ga0157370_10014605 | 3300013104 | Bacteria | 8024 |
| 260 | Ga0157369_10108960 | 3300013105 | Bacteria | 2945 |
| 261 | Ga0157369_10396272 | 3300013105 | Bacteria | 1432 |
| 262 | Ga0157369_10411519 | 3300013105 | Bacteria | 1402 |
| 263 | Ga0157369_10622313 | 3300013105 | Bacteria | 1114 |
| 264 | Ga0157374_10134360 | 3300013296 | Bacteria | 2397 |
| 265 | Ga0157374_10248067 | 3300013296 | Bacteria | 1752 |
| 266 | Ga0157374_10704275 | 3300013296 | Unclassified | 1023 |
| 267 | Ga0157374_10928509 | 3300013296 | Bacteria | 888 |
| 268 | Ga0157378_10013399 | 3300013297 | Bacteria | 7166 |
| 269 | Ga0157378_10258498 | 3300013297 | Bacteria | 1670 |
| 270 | Ga0163162_10246069 | 3300013306 | Bacteria | 1920 |
| 271 | Ga0157372_10009012 | 3300013307 | Bacteria | 10605 |
| 272 | Ga0157372_10523820 | 3300013307 | Bacteria | 1382 |
| 273 | Ga0157372_10649493 | 3300013307 | Bacteria | 1228 |
| 274 | Ga0157372_11543382 | 3300013307 | Bacteria | 765 |
| 275 | Ga0157375_10043156 | 3300013308 | Bacteria | 4371 |
| 276 | Ga0157375_10247379 | 3300013308 | Bacteria | 1944 |
| 277 | Ga0163163_10455173 | 3300014325 | Bacteria | 1340 |
| 278 | Ga0157377_10311164 | 3300014745 | Bacteria | 1043 |
| 279 | Ga0157379_10427843 | 3300014968 | Bacteria | 1220 |
| 280 | Ga0157376_10039722 | 3300014969 | Bacteria | 3840 |
| 281 | Ga0157376_10732203 | 3300014969 | Bacteria | 997 |
| 282 | Ga0163161_10087384 | 3300017792 | Bacteria | 2303 |
| 283 | Ga0206356_11200080 | 3300020070 | Bacteria | 1188 |
| 284 | Ga0206356_11401552 | 3300020070 | Bacteria | 796 |
| 285 | Ga0206356_11423237 | 3300020070 | Bacteria | 4623 |
| 286 | Ga0206355_1410940 | 3300020076 | Bacteria | 842 |
| 287 | Ga0206355_1426974 | 3300020076 | Bacteria | 947 |
| 288 | Ga0206351_10822550 | 3300020077 | Bacteria | 826 |
| 289 | Ga0206352_10800806 | 3300020078 | Bacteria | 2116 |
| 290 | Ga0206350_10616182 | 3300020080 | Bacteria | 774 |
| 291 | Ga0206350_11571218 | 3300020080 | Bacteria | 872 |
| 292 | Ga0206353_10948023 | 3300020082 | Bacteria | 890 |
| 293 | Ga0206353_11285308 | 3300020082 | Bacteria | 858 |
| 294 | Ga0213874_10000875 | 3300021377 | Bacteria | 6159 |
| 295 | Ga0213876_10034717 | 3300021384 | Bacteria | 2660 |
| 296 | Ga0213875_10030019 | 3300021388 | Bacteria | 2577 |
| 297 | Ga0213875_10185488 | 3300021388 | Bacteria | 977 |
| 298 | Ga0224712_10054936 | 3300022467 | Bacteria | 1565 |
| 299 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 300 | Ga0209129_1000034 | 3300025258 | Bacteria | 330950 |
| 301 | Ga0209129_1016139 | 3300025258 | Bacteria | 1509 |
| 302 | Ga0209673_1016968 | 3300025273 | Bacteria | 2699 |
| 303 | Ga0207673_1007447 | 3300025290 | Bacteria | 1373 |
| 304 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 305 | Ga0209564_1017939 | 3300025295 | Bacteria | 2726 |
| 306 | Ga0209758_1000080 | 3300025297 | Bacteria | 261472 |
| 307 | Ga0209758_1065890 | 3300025297 | Bacteria | 1166 |
| 308 | Ga0209051_1003299 | 3300025303 | Bacteria | 10694 |
| 309 | Ga0207697_10061119 | 3300025315 | Bacteria | 1567 |
| 310 | Ga0207697_10074480 | 3300025315 | Bacteria | 1426 |
| 311 | Ga0207656_10058057 | 3300025321 | Bacteria | 1689 |
| 312 | Ga0207682_10027486 | 3300025893 | Bacteria | 2266 |
| 313 | Ga0207682_10092834 | 3300025893 | Bacteria | 1311 |
| 314 | Ga0207692_10012797 | 3300025898 | Bacteria | 3616 |
| 315 | Ga0207642_10397071 | 3300025899 | Bacteria | 824 |
| 316 | Ga0207688_10121520 | 3300025901 | Bacteria | 1524 |
| 317 | Ga0207680_10148066 | 3300025903 | Bacteria | 1563 |
| 318 | Ga0207647_10006363 | 3300025904 | Bacteria | 8586 |
| 319 | Ga0207685_10010235 | 3300025905 | Bacteria | 2760 |
| 320 | Ga0207645_10051560 | 3300025907 | Bacteria | 2629 |
| 321 | Ga0207645_10132124 | 3300025907 | Bacteria | 1625 |
| 322 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 323 | Ga0207705_10001112 | 3300025909 | Bacteria | 21864 |
| 324 | Ga0207705_10059268 | 3300025909 | Bacteria | 2763 |
| 325 | Ga0207705_10080866 | 3300025909 | Bacteria | 2368 |
| 326 | Ga0207684_10000287 | 3300025910 | Bacteria | 72313 |
| 327 | Ga0207684_10001612 | 3300025910 | Bacteria | 23951 |
| 328 | Ga0207684_10003745 | 3300025910 | Bacteria | 14699 |
| 329 | Ga0207684_10012300 | 3300025910 | Bacteria | 7450 |
| 330 | Ga0207684_10016316 | 3300025910 | Bacteria | 6377 |
| 331 | Ga0207684_10072963 | 3300025910 | Bacteria | 2915 |
| 332 | Ga0207684_10137217 | 3300025910 | Bacteria | 2101 |
| 333 | Ga0207684_10417763 | 3300025910 | Bacteria | 1153 |
| 334 | Ga0207684_10536785 | 3300025910 | Bacteria | 1001 |
| 335 | Ga0207707_10010851 | 3300025912 | Bacteria | 7918 |
| 336 | Ga0207707_10029690 | 3300025912 | Bacteria | 4781 |
| 337 | Ga0207707_10079930 | 3300025912 | Bacteria | 2855 |
| 338 | Ga0207707_10435848 | 3300025912 | Bacteria | 1122 |
| 339 | Ga0207695_10009282 | 3300025913 | Bacteria | 12181 |
| 340 | Ga0207695_10034241 | 3300025913 | Bacteria | 5528 |
| 341 | Ga0207695_10058643 | 3300025913 | Bacteria | 3995 |
| 342 | Ga0207695_10315814 | 3300025913 | Bacteria | 1452 |
| 343 | Ga0207671_10113745 | 3300025914 | Bacteria | 2062 |
| 344 | Ga0207671_10275252 | 3300025914 | Bacteria | 1327 |
| 345 | Ga0207693_10019972 | 3300025915 | Bacteria | 5328 |
| 346 | Ga0207693_10050939 | 3300025915 | Bacteria | 3250 |
| 347 | Ga0207693_10129786 | 3300025915 | Bacteria | 1981 |
| 348 | Ga0207693_10203299 | 3300025915 | Bacteria | 1558 |
| 349 | Ga0207693_10211232 | 3300025915 | Bacteria | 1525 |
| 350 | Ga0207693_10232135 | 3300025915 | Bacteria | 1449 |
| 351 | Ga0207663_10016574 | 3300025916 | Bacteria | 4089 |
| 352 | Ga0207663_10033096 | 3300025916 | Bacteria | 3075 |
| 353 | Ga0207663_10271893 | 3300025916 | Bacteria | 1255 |
| 354 | Ga0207663_10293832 | 3300025916 | Bacteria | 1211 |
| 355 | Ga0207660_10038806 | 3300025917 | Bacteria | 3326 |
| 356 | Ga0207660_10051037 | 3300025917 | Bacteria | 2939 |
| 357 | Ga0207660_10234018 | 3300025917 | Bacteria | 1445 |
| 358 | Ga0207660_10875937 | 3300025917 | Bacteria | 733 |
| 359 | Ga0207662_10093863 | 3300025918 | Bacteria | 1849 |
| 360 | Ga0207657_10001151 | 3300025919 | Bacteria | 28127 |
| 361 | Ga0207657_10010100 | 3300025919 | Bacteria | 9439 |
| 362 | Ga0207657_10223985 | 3300025919 | Bacteria | 1506 |
| 363 | Ga0207657_10330489 | 3300025919 | Bacteria | 1204 |
| 364 | Ga0207649_10000437 | 3300025920 | Bacteria | 30058 |
| 365 | Ga0207649_10001056 | 3300025920 | Bacteria | 16892 |
| 366 | Ga0207649_10020766 | 3300025920 | Bacteria | 3770 |
| 367 | Ga0207649_10120990 | 3300025920 | Bacteria | 1765 |
| 368 | Ga0207652_10034811 | 3300025921 | Bacteria | 4247 |
| 369 | Ga0207652_10126992 | 3300025921 | Bacteria | 2272 |
| 370 | Ga0207652_10161585 | 3300025921 | Bacteria | 2008 |
| 371 | Ga0207646_10002603 | 3300025922 | Bacteria | 21241 |
| 372 | Ga0207646_10005499 | 3300025922 | Bacteria | 13319 |
| 373 | Ga0207646_10018766 | 3300025922 | Bacteria | 6445 |
| 374 | Ga0207646_10021584 | 3300025922 | Bacteria | 5945 |
| 375 | Ga0207646_10022997 | 3300025922 | Bacteria | 5731 |
| 376 | Ga0207646_10042075 | 3300025922 | Bacteria | 4105 |
| 377 | Ga0207646_10146961 | 3300025922 | Bacteria | 2124 |
| 378 | Ga0207681_10043337 | 3300025923 | Bacteria | 3011 |
| 379 | Ga0207681_10060952 | 3300025923 | Bacteria | 2592 |
| 380 | Ga0207694_10094522 | 3300025924 | Bacteria | 2362 |
| 381 | Ga0207694_10114347 | 3300025924 | Bacteria | 2149 |
| 382 | Ga0207694_10427815 | 3300025924 | Bacteria | 1103 |
| 383 | Ga0207650_10140474 | 3300025925 | Bacteria | 1898 |
| 384 | Ga0207650_10323710 | 3300025925 | Bacteria | 1263 |
| 385 | Ga0207650_10346032 | 3300025925 | Bacteria | 1222 |
| 386 | Ga0207659_10077899 | 3300025926 | Bacteria | 2441 |
| 387 | Ga0207659_10165561 | 3300025926 | Bacteria | 1740 |
| 388 | Ga0207659_10310614 | 3300025926 | Bacteria | 1298 |
| 389 | Ga0207687_10016580 | 3300025927 | Bacteria | 4839 |
| 390 | Ga0207687_10134787 | 3300025927 | Bacteria | 1866 |
| 391 | Ga0207687_10176229 | 3300025927 | Bacteria | 1653 |
| 392 | Ga0207687_10604615 | 3300025927 | Bacteria | 924 |
| 393 | Ga0207700_10000495 | 3300025928 | Bacteria | 23059 |
| 394 | Ga0207700_10001708 | 3300025928 | Bacteria | 12470 |
| 395 | Ga0207700_10006711 | 3300025928 | Bacteria | 6985 |
| 396 | Ga0207700_10021242 | 3300025928 | Bacteria | 4428 |
| 397 | Ga0207700_10379976 | 3300025928 | Bacteria | 1235 |
| 398 | Ga0207700_10448107 | 3300025928 | Bacteria | 1137 |
| 399 | Ga0207664_10393164 | 3300025929 | Bacteria | 1232 |
| 400 | Ga0207664_10456760 | 3300025929 | Bacteria | 1140 |
| 401 | Ga0207664_10565907 | 3300025929 | Bacteria | 1020 |
| 402 | Ga0207644_10058187 | 3300025931 | Bacteria | 2793 |
| 403 | Ga0207644_10058907 | 3300025931 | Bacteria | 2777 |
| 404 | Ga0207706_10432010 | 3300025933 | Bacteria | 1140 |
| 405 | Ga0207686_10397204 | 3300025934 | Bacteria | 1049 |
| 406 | Ga0207669_10019618 | 3300025937 | Bacteria | 3525 |
| 407 | Ga0207669_10119530 | 3300025937 | Bacteria | 1785 |
| 408 | Ga0207704_10395652 | 3300025938 | Bacteria | 1089 |
| 409 | Ga0207665_10014600 | 3300025939 | Bacteria | 5170 |
| 410 | Ga0207665_10026504 | 3300025939 | Bacteria | 3826 |
| 411 | Ga0207665_10109420 | 3300025939 | Bacteria | 1939 |
| 412 | Ga0207665_10487148 | 3300025939 | Bacteria | 951 |
| 413 | Ga0207665_10689710 | 3300025939 | Bacteria | 802 |
| 414 | Ga0207691_10008622 | 3300025940 | Bacteria | 9784 |
| 415 | Ga0207691_10014130 | 3300025940 | Bacteria | 7616 |
| 416 | Ga0207691_10400166 | 3300025940 | Bacteria | 1171 |
| 417 | Ga0207691_10668477 | 3300025940 | Bacteria | 877 |
| 418 | Ga0207711_10233587 | 3300025941 | Bacteria | 1685 |
| 419 | Ga0207711_10621171 | 3300025941 | Bacteria | 1008 |
| 420 | Ga0207661_10007338 | 3300025944 | Bacteria | 7843 |
| 421 | Ga0207661_10126170 | 3300025944 | Bacteria | 2186 |
| 422 | Ga0207661_10543124 | 3300025944 | Bacteria | 1064 |
| 423 | Ga0207661_10614472 | 3300025944 | Bacteria | 998 |
| 424 | Ga0207679_10038942 | 3300025945 | Bacteria | 3392 |
| 425 | Ga0207667_10016318 | 3300025949 | Bacteria | 8393 |
| 426 | Ga0207667_10039559 | 3300025949 | Bacteria | 5025 |
| 427 | Ga0207667_10187034 | 3300025949 | Bacteria | 2126 |
| 428 | Ga0207667_10212620 | 3300025949 | Bacteria | 1982 |
| 429 | Ga0207667_10432725 | 3300025949 | Bacteria | 1338 |
| 430 | Ga0207667_11015163 | 3300025949 | Bacteria | 816 |
| 431 | Ga0207651_10035758 | 3300025960 | Bacteria | 3234 |
| 432 | Ga0207651_10277536 | 3300025960 | Bacteria | 1383 |
| 433 | Ga0207668_10036843 | 3300025972 | Bacteria | 3269 |
| 434 | Ga0207668_10075504 | 3300025972 | Bacteria | 2423 |
| 435 | Ga0207668_10170452 | 3300025972 | Bacteria | 1706 |
| 436 | Ga0207658_10027001 | 3300025986 | Bacteria | 4030 |
| 437 | Ga0207658_10599829 | 3300025986 | Bacteria | 989 |
| 438 | Ga0207658_10817168 | 3300025986 | Bacteria | 847 |
| 439 | Ga0207677_10034499 | 3300026023 | Bacteria | 3277 |
| 440 | Ga0207677_10338269 | 3300026023 | Bacteria | 1257 |
| 441 | Ga0207677_10356352 | 3300026023 | Bacteria | 1227 |
| 442 | Ga0207677_10692469 | 3300026023 | Bacteria | 903 |
| 443 | Ga0207703_10238303 | 3300026035 | Bacteria | 1634 |
| 444 | Ga0207703_10701232 | 3300026035 | Bacteria | 963 |
| 445 | Ga0207703_10938556 | 3300026035 | Bacteria | 829 |
| 446 | Ga0207639_10024980 | 3300026041 | Bacteria | 4330 |
| 447 | Ga0207678_10002001 | 3300026067 | Bacteria | 18558 |
| 448 | Ga0207678_10002336 | 3300026067 | Bacteria | 17192 |
| 449 | Ga0207678_10071991 | 3300026067 | Bacteria | 2962 |
| 450 | Ga0207678_10199936 | 3300026067 | Bacteria | 1709 |
| 451 | Ga0207708_10238797 | 3300026075 | Bacteria | 1461 |
| 452 | Ga0207702_10026849 | 3300026078 | Bacteria | 4782 |
| 453 | Ga0207702_10115195 | 3300026078 | Bacteria | 2397 |
| 454 | Ga0207641_10082954 | 3300026088 | Bacteria | 2786 |
| 455 | Ga0207648_10087664 | 3300026089 | Bacteria | 2716 |
| 456 | Ga0207648_10287839 | 3300026089 | Bacteria | 1470 |
| 457 | Ga0207676_10093139 | 3300026095 | Bacteria | 2480 |
| 458 | Ga0207676_10434459 | 3300026095 | Bacteria | 1234 |
| 459 | Ga0207674_10041150 | 3300026116 | Bacteria | 4780 |
| 460 | Ga0207674_10051455 | 3300026116 | Bacteria | 4203 |
| 461 | Ga0207675_100006106 | 3300026118 | Bacteria | 11460 |
| 462 | Ga0207675_100076071 | 3300026118 | Bacteria | 3143 |
| 463 | Ga0207675_100147270 | 3300026118 | Bacteria | 2240 |
| 464 | Ga0207675_100286920 | 3300026118 | Bacteria | 1600 |
| 465 | Ga0207675_100566513 | 3300026118 | Bacteria | 1136 |
| 466 | Ga0207683_10050814 | 3300026121 | Bacteria | 3632 |
| 467 | Ga0207683_10055241 | 3300026121 | Bacteria | 3482 |
| 468 | Ga0207683_10123567 | 3300026121 | Bacteria | 2325 |
| 469 | Ga0207683_10175152 | 3300026121 | Bacteria | 1944 |
| 470 | Ga0207683_11028031 | 3300026121 | Bacteria | 765 |
| 471 | Ga0207698_10021118 | 3300026142 | Bacteria | 4496 |
| 472 | Ga0207698_10879645 | 3300026142 | Bacteria | 902 |
| 473 | Ga0210000_1016667 | 3300027462 | Bacteria | 1111 |
| 474 | Ga0209588_1004952 | 3300027671 | Bacteria | 3788 |
| 475 | Ga0209588_1036169 | 3300027671 | Bacteria | 1588 |
| 476 | Ga0209588_1069206 | 3300027671 | Bacteria | 1140 |
| 477 | Ga0209974_10069386 | 3300027876 | Bacteria | 1200 |
| 478 | Ga0207428_10081941 | 3300027907 | Bacteria | 2519 |
| 479 | Ga0207428_10405189 | 3300027907 | Bacteria | 998 |
| 480 | Ga0268266_10033616 | 3300028379 | Bacteria | 4359 |
| 481 | Ga0268266_10033885 | 3300028379 | Bacteria | 4340 |
| 482 | Ga0268266_10211834 | 3300028379 | Bacteria | 1777 |
| 483 | Ga0268265_10010604 | 3300028380 | Bacteria | 6224 |
| 484 | Ga0268265_10018341 | 3300028380 | Bacteria | 4847 |
| 485 | Ga0268265_10123606 | 3300028380 | Bacteria | 2137 |
| 486 | Ga0268265_10170194 | 3300028380 | Bacteria | 1861 |
| 487 | Ga0268265_10232170 | 3300028380 | Bacteria | 1622 |
| 488 | Ga0268264_10077185 | 3300028381 | Bacteria | 2837 |
| 489 | Ga0268264_10795098 | 3300028381 | Bacteria | 945 |
| 490 | Ga0268264_10835103 | 3300028381 | Bacteria | 922 |
| 491 | Ga0265326_10095267 | 3300028558 | Bacteria | 844 |
| 492 | Ga0265318_10053413 | 3300028577 | Bacteria | 1515 |
| 493 | Ga0265332_10003112 | 3300031238 | Bacteria | 8088 |
| 494 | Ga0265325_10082744 | 3300031241 | Bacteria | 1593 |
| 495 | Ga0265340_10006253 | 3300031247 | Bacteria | 6561 |
| 496 | Ga0265340_10046072 | 3300031247 | Bacteria | 2128 |
| 497 | Ga0265339_10061653 | 3300031249 | Bacteria | 2017 |
| 498 | Ga0265327_10005193 | 3300031251 | Bacteria | 11011 |
| 499 | Ga0265327_10057916 | 3300031251 | Bacteria | 1991 |
| 500 | Ga0265316_10129932 | 3300031344 | Bacteria | 1898 |
| 501 | Ga0265342_10002150 | 3300031712 | Bacteria | 17367 |
| 502 | Ga0307405_10001892 | 3300031731 | Bacteria | 8995 |
| 503 | Ga0307412_10027123 | 3300031911 | Bacteria | 3568 |
| 504 | Ga0307409_100214464 | 3300031995 | Bacteria | 1733 |
| 505 | Ga0307409_100367408 | 3300031995 | Bacteria | 1363 |
| 506 | Ga0307416_100043186 | 3300032002 | Bacteria | 3528 |
| 507 | Ga0307415_100059084 | 3300032126 | Bacteria | 2643 |
| 508 | Ga0307415_100509731 | 3300032126 | Bacteria | 1054 |
| 509 | Ga0373926_0057098 | 3300035083 | Bacteria | 1417 |
| 510 | Ga0373926_0074850 | 3300035083 | Bacteria | 1247 |
| 511 | Ga0373928_0029574 | 3300035084 | Bacteria | 1205 |
| 512 | Ga0373934_0005878 | 3300035086 | Bacteria | 4541 |
| 513 | Ga0373934_0011767 | 3300035086 | Bacteria | 3296 |
| 514 | Ga0373940_0045844 | 3300035088 | Bacteria | 1215 |
| 515 | Ga0373944_0000572 | 3300035089 | Bacteria | 8715 |
| 516 | Ga0373944_0172869 | 3300035089 | Bacteria | 771 |
| 517 | Ga0373949_0073030 | 3300035090 | Bacteria | 902 |
| 518 | Ga0373949_0100103 | 3300035090 | Bacteria | 793 |
| 519 | Ga0373923_0001052 | 3300035111 | Bacteria | 7550 |
| 520 | Ga0373936_0001677 | 3300035113 | Bacteria | 8121 |
| 521 | Ga0373936_0001965 | 3300035113 | Bacteria | 7603 |
| 522 | Ga0373936_0007547 | 3300035113 | Bacteria | 4089 |
| 523 | Ga0373936_0016728 | 3300035113 | Bacteria | 2823 |
| 524 | Ga0373936_0078679 | 3300035113 | Bacteria | 1369 |
| 525 | Ga0373939_0011739 | 3300035114 | Bacteria | 2218 |
| 526 | Ga0373945_0000063 | 3300035116 | Bacteria | 23921 |
| 527 | Ga0373945_0004559 | 3300035116 | Bacteria | 4406 |
| 528 | Ga0373945_0006120 | 3300035116 | Bacteria | 3869 |
| 529 | Ga0373953_0003079 | 3300035117 | Bacteria | 5125 |
| 530 | Ga0373953_0011879 | 3300035117 | Bacteria | 3068 |
| 531 | Ga0373953_0065747 | 3300035117 | Bacteria | 1489 |
| 532 | Ga0373954_0006435 | 3300035118 | Bacteria | 5122 |
| 533 | Ga0373954_0067093 | 3300035118 | Bacteria | 1699 |
| 534 | Ga0373954_0107949 | 3300035118 | Bacteria | 1345 |
| 535 | Ga0373954_0149548 | 3300035118 | Bacteria | 1141 |
| 536 | Ga0373954_0254508 | 3300035118 | Bacteria | 865 |
| 537 | Ga0373956_0008798 | 3300035119 | Bacteria | 4090 |
| 538 | Ga0373956_0027712 | 3300035119 | Bacteria | 2462 |
| 539 | Ga0373957_0001538 | 3300035120 | Bacteria | 6279 |
| 540 | Ga0373957_0030952 | 3300035120 | Bacteria | 1963 |
| 541 | Ga0373943_0000622 | 3300035170 | Bacteria | 15355 |
| 542 | Ga0373943_0004489 | 3300035170 | Bacteria | 6313 |
| 543 | Ga0373943_0035951 | 3300035170 | Bacteria | 2370 |
| 544 | Ga0373943_0235235 | 3300035170 | Bacteria | 1025 |
| 545 | Ga0373946_0000960 | 3300035171 | Bacteria | 9878 |
| 546 | Ga0373946_0016156 | 3300035171 | Bacteria | 2840 |
| 547 | Ga0373946_0086188 | 3300035171 | Bacteria | 1384 |
| 548 | Ga0373955_0000453 | 3300035172 | Bacteria | 17348 |
| 549 | Ga0373955_0016314 | 3300035172 | Bacteria | 3654 |
| 550 | Ga0373955_0025435 | 3300035172 | Bacteria | 3039 |
| 551 | Ga0373955_0038075 | 3300035172 | Bacteria | 2561 |
| 552 | Ga0373961_0009728 | 3300035241 | Bacteria | 2356 |
| 553 | Ga0373924_0001176 | 3300035410 | Bacteria | 8411 |
| 554 | Ga0373924_0002934 | 3300035410 | Bacteria | 5790 |
| 555 | Ga0373924_0029532 | 3300035410 | Bacteria | 2192 |
| 556 | Ga0373935_0000153 | 3300035692 | Bacteria | 31831 |
| 557 | Ga0373935_0000853 | 3300035692 | Bacteria | 16426 |
| 558 | Ga0373935_0013196 | 3300035692 | Bacteria | 4982 |
| 559 | Ga0373935_0014512 | 3300035692 | Bacteria | 4754 |
| 560 | Ga0373935_0143482 | 3300035692 | Bacteria | 1615 |
| 561 | Ga0373927_0001934 | 3300035695 | Bacteria | 15296 |
| 562 | Ga0373927_0010376 | 3300035695 | Bacteria | 6215 |
| 563 | Ga0373927_0108336 | 3300035695 | Bacteria | 1810 |
| 564 | Ga0373927_0256628 | 3300035695 | Bacteria | 1149 |
| 565 | Ga0373927_0303279 | 3300035695 | Bacteria | 1051 |
| 566 | Ga0373927_0650727 | 3300035695 | Bacteria | 696 |
| 567 | Ga0373933_0008303 | 3300035724 | Bacteria | 5669 |
| 568 | Ga0373933_0017656 | 3300035724 | Bacteria | 4002 |
| 569 | Ga0373933_0026513 | 3300035724 | Bacteria | 3328 |
| 570 | Ga0373933_0420628 | 3300035724 | Bacteria | 873 |
| 571 | Ga0373933_0434075 | 3300035724 | Bacteria | 858 |
| 572 | Ga0373947_0000700 | 3300035725 | Bacteria | 19956 |
| 573 | Ga0373947_0000952 | 3300035725 | Bacteria | 17638 |
| 574 | Ga0373947_0007146 | 3300035725 | Bacteria | 6474 |
| 575 | Ga0373947_0023489 | 3300035725 | Bacteria | 3587 |
| 576 | Ga0373947_0066694 | 3300035725 | Bacteria | 2197 |
| 577 | Ga0373947_0397961 | 3300035725 | Bacteria | 929 |
| 578 | Ga0373937_0000432 | 3300036401 | Bacteria | 39000 |
| 579 | Ga0373937_0003993 | 3300036401 | Bacteria | 12483 |
| 580 | Ga0373937_0012033 | 3300036401 | Bacteria | 7593 |
| 581 | Ga0373937_0032444 | 3300036401 | Bacteria | 4737 |
| 582 | Ga0373937_0049470 | 3300036401 | Bacteria | 3849 |
| 583 | Ga0373937_0068681 | 3300036401 | Bacteria | 3267 |
| 584 | Ga0373937_0263203 | 3300036401 | Bacteria | 1626 |
| 585 | Ga0373925_0000084 | 3300037068 | Bacteria | 100945 |
| 586 | Ga0373925_0001188 | 3300037068 | Bacteria | 22971 |
| 587 | Ga0373925_0001533 | 3300037068 | Bacteria | 19714 |
| 588 | Ga0373925_0007011 | 3300037068 | Bacteria | 8230 |
| 589 | Ga0373925_0023535 | 3300037068 | Bacteria | 4494 |
| 590 | Ga0373925_0108941 | 3300037068 | Bacteria | 2138 |
| 591 | Ga0373925_0262048 | 3300037068 | Bacteria | 1389 |
| 592 | Ga0373925_0378935 | 3300037068 | Bacteria | 1152 |
| 593 | Ga0373925_0517020 | 3300037068 | Bacteria | 981 |
| 594 | Ga0373925_0626554 | 3300037068 | Bacteria | 886 |
| 595 | Ga0373925_0808488 | 3300037068 | Bacteria | 773 |
| 596 | Ga0373925_0824933 | 3300037068 | Bacteria | 764 |
| 597 | Ga0395899_0002594 | 3300037312 | Bacteria | 14563 |
| 598 | Ga0395899_0004284 | 3300037312 | Bacteria | 11152 |
| 599 | Ga0395899_0005207 | 3300037312 | Bacteria | 10115 |
| 600 | Ga0395899_0013064 | 3300037312 | Bacteria | 6350 |
| 601 | Ga0395899_0043707 | 3300037312 | Bacteria | 3341 |
| 602 | Ga0395899_0087977 | 3300037312 | Bacteria | 2254 |
| 603 | Ga0395899_0094522 | 3300037312 | Bacteria | 2163 |
| 604 | Ga0395899_0222945 | 3300037312 | Bacteria | 1305 |
| 605 | Ga0395899_0273927 | 3300037312 | Bacteria | 1150 |
| 606 | Ga0395899_0524011 | 3300037312 | Bacteria | 765 |
| 607 | Ga0395900_0002349 | 3300037418 | Bacteria | 20946 |
| 608 | Ga0395900_0005752 | 3300037418 | Bacteria | 12955 |
| 609 | Ga0395900_0025418 | 3300037418 | Bacteria | 6062 |
| 610 | Ga0395900_0080270 | 3300037418 | Bacteria | 3352 |
| 611 | Ga0395900_0177898 | 3300037418 | Bacteria | 2163 |
| 612 | Ga0395900_0209011 | 3300037418 | Bacteria | 1971 |
| 613 | Ga0395900_0210856 | 3300037418 | Bacteria | 1961 |
| 614 | Ga0395900_0233809 | 3300037418 | Bacteria | 1847 |
| 615 | Ga0395898_0000723 | 3300037466 | Bacteria | 58117 |
| 616 | Ga0395898_0001505 | 3300037466 | Bacteria | 32177 |
| 617 | Ga0395898_0006846 | 3300037466 | Bacteria | 12122 |
| 618 | Ga0395898_0011006 | 3300037466 | Bacteria | 9426 |
| 619 | Ga0395898_0015393 | 3300037466 | Bacteria | 7841 |
| 620 | Ga0395898_0040585 | 3300037466 | Bacteria | 4601 |
| 621 | Ga0395898_0045376 | 3300037466 | Bacteria | 4320 |
| 622 | Ga0395898_0059173 | 3300037466 | Bacteria | 3728 |
| 623 | Ga0395898_0073156 | 3300037466 | Bacteria | 3311 |
| 624 | Ga0395898_0114505 | 3300037466 | Bacteria | 2584 |
| 625 | Ga0395898_0137005 | 3300037466 | Bacteria | 2344 |
| 626 | Ga0395898_0169129 | 3300037466 | Bacteria | 2089 |
| 627 | Ga0395898_0435956 | 3300037466 | Bacteria | 1248 |
| 628 | Ga0395898_0708221 | 3300037466 | Bacteria | 948 |
| 629 | Ga0395905_0001654 | 3300037471 | Bacteria | 26354 |
| 630 | Ga0395905_0005407 | 3300037471 | Bacteria | 13052 |
| 631 | Ga0395905_0006660 | 3300037471 | Bacteria | 11582 |
| 632 | Ga0395905_0016600 | 3300037471 | Bacteria | 6997 |
| 633 | Ga0395905_0046735 | 3300037471 | Bacteria | 4059 |
| 634 | Ga0395905_0066264 | 3300037471 | Bacteria | 3382 |
| 635 | Ga0395905_0105078 | 3300037471 | Bacteria | 2651 |
| 636 | Ga0395905_0251504 | 3300037471 | Bacteria | 1651 |
| 637 | Ga0436364_0241003 | 3300037853 | Bacteria | 1388 |
| 638 | Ga0436364_0477471 | 3300037853 | Bacteria | 3780 |
| 639 | Ga0436364_0713202 | 3300037853 | Bacteria | 2266 |
| 640 | Ga0436364_0746810 | 3300037853 | Bacteria | 2175 |
| 641 | Ga0436364_0814406 | 3300037853 | Bacteria | 1231 |
| 642 | Ga0436364_1093749 | 3300037853 | Bacteria | 5074 |
| 643 | Ga0395901_0001895 | 3300038443 | Bacteria | 21606 |
| 644 | Ga0395901_0006183 | 3300038443 | Bacteria | 12132 |
| 645 | Ga0395901_0006836 | 3300038443 | Bacteria | 11523 |
| 646 | Ga0395901_0008365 | 3300038443 | Bacteria | 10460 |
| 647 | Ga0395901_0017842 | 3300038443 | Bacteria | 7244 |
| 648 | Ga0395901_0017952 | 3300038443 | Bacteria | 7222 |
| 649 | Ga0395901_0029170 | 3300038443 | Bacteria | 5678 |
| 650 | Ga0395901_0036453 | 3300038443 | Bacteria | 5084 |
| 651 | Ga0395901_0037977 | 3300038443 | Bacteria | 4980 |
| 652 | Ga0395901_0068301 | 3300038443 | Bacteria | 3702 |
| 653 | Ga0395901_0108335 | 3300038443 | Bacteria | 2916 |
| 654 | Ga0395901_0204928 | 3300038443 | Bacteria | 2067 |
| 655 | Ga0395901_0230163 | 3300038443 | Bacteria | 1935 |
| 656 | Ga0395901_0375975 | 3300038443 | Bacteria | 1463 |
| 657 | Ga0395901_0517071 | 3300038443 | Bacteria | 1213 |
| 658 | Ga0436365_0281644 | 3300039437 | Bacteria | 1149 |
| 659 | Ga0436365_0607389 | 3300039437 | Bacteria | 895 |
| 660 | Ga0436365_0982568 | 3300039437 | Bacteria | 1042 |
| 661 | Ga0436365_1143395 | 3300039437 | Bacteria | 12928 |
| 662 | Ga0436365_1308626 | 3300039437 | Bacteria | 8989 |
| 663 | Ga0436365_1423189 | 3300039437 | Bacteria | 984 |
| 664 | Ga0436365_1588830 | 3300039437 | Bacteria | 3914 |
| 665 | Ga0436361_0287188 | 3300039447 | Bacteria | 1676 |
| 666 | Ga0436363_0055457 | 3300039450 | Bacteria | 1458 |
| 667 | Ga0436363_0169393 | 3300039450 | Bacteria | 44740 |
| 668 | Ga0436363_0556565 | 3300039450 | Bacteria | 2561 |
| 669 | Ga0436363_0572802 | 3300039450 | Bacteria | 1920 |
| 670 | Ga0436363_0846140 | 3300039450 | Bacteria | 1450 |
| 671 | Ga0436363_0883032 | 3300039450 | Bacteria | 2519 |
| 672 | Ga0436363_1148610 | 3300039450 | Bacteria | 836 |
| 673 | Ga0436363_1548335 | 3300039450 | Bacteria | 1553 |
| 674 | Ga0436362_0121492 | 3300039453 | Bacteria | 934 |
| 675 | Ga0436362_0163841 | 3300039453 | Bacteria | 1350 |
| 676 | Ga0436362_0488184 | 3300039453 | Bacteria | 793 |
| 677 | Ga0436362_0719851 | 3300039453 | Bacteria | 806 |
| 678 | Ga0451800_1069473 | 3300041459 | Bacteria | 1222 |
| 679 | Ga0439433_0008716 | 3300041999 | Bacteria | 2202 |
| 680 | Ga0439442_049845 | 3300042002 | Bacteria | 883 |
| 681 | Ga0439443_008924 | 3300042003 | Bacteria | 1426 |
| 682 | Ga0439443_038857 | 3300042003 | Bacteria | 807 |
| 683 | Ga0439445_0009113 | 3300042004 | Bacteria | 2334 |
| 684 | Ga0439449_0001825 | 3300042007 | Bacteria | 8377 |
| 685 | Ga0439457_017883 | 3300042014 | Bacteria | 1573 |
| 686 | Ga0439446_0016149 | 3300042156 | Bacteria | 2078 |
| 687 | Ga0439458_0016417 | 3300042157 | Bacteria | 1684 |
| 688 | Ga0439435_0004503 | 3300042436 | Bacteria | 3007 |
| 689 | Ga0439444_0065734 | 3300042437 | Bacteria | 766 |
| 690 | Ga0466965_0352817 | 3300044683 | Bacteria | 806 |
| 691 | Ga0466966_0123662 | 3300044684 | Bacteria | 1588 |
| 692 | Ga0466966_0134402 | 3300044684 | Bacteria | 1513 |
| 693 | Ga0466966_0285728 | 3300044684 | Bacteria | 992 |
| 694 | Ga0466961_0006650 | 3300044693 | Bacteria | 7353 |
| 695 | Ga0466961_0019811 | 3300044693 | Bacteria | 4328 |
| 696 | Ga0466961_0247945 | 3300044693 | Bacteria | 1094 |
| 697 | Ga0466963_0037236 | 3300044694 | Bacteria | 3175 |
| 698 | Ga0466963_0038829 | 3300044694 | Bacteria | 3116 |
| 699 | Ga0466963_0072443 | 3300044694 | Bacteria | 2321 |
| 700 | Ga0466963_0254890 | 3300044694 | Bacteria | 1231 |
| 701 | Ga0466963_0485373 | 3300044694 | Bacteria | 872 |
| 702 | Ga0466964_0033357 | 3300044706 | Bacteria | 2051 |
| 703 | Ga0466964_0043162 | 3300044706 | Bacteria | 1829 |
| 704 | Ga0466964_0070097 | 3300044706 | Bacteria | 1480 |
| 705 | Ga0453684_0002923 | 3300044712 | Bacteria | 40048 |
| 706 | Ga0466971_0088103 | 3300044719 | Bacteria | 1419 |
| 707 | Ga0466970_0034219 | 3300044765 | Bacteria | 2689 |
| 708 | Ga0466957_0026773 | 3300044842 | Bacteria | 3423 |
| 709 | Ga0466957_0141990 | 3300044842 | Bacteria | 1548 |
| 710 | Ga0466957_0242800 | 3300044842 | Bacteria | 1195 |
| 711 | Ga0466957_0751384 | 3300044842 | Bacteria | 691 |
| 712 | Ga0466960_0138646 | 3300044901 | Bacteria | 1290 |
| 713 | Ga0466960_0239697 | 3300044901 | Bacteria | 1004 |
| 714 | Ga0466959_0008855 | 3300045049 | Bacteria | 7136 |
| 715 | Ga0466959_0102586 | 3300045049 | Bacteria | 2047 |
| 716 | Ga0466959_0206963 | 3300045049 | Bacteria | 1364 |
| 717 | Ga0451576_0080518 | 3300045051 | Bacteria | 3388 |
| 718 | Ga0451576_0118215 | 3300045051 | Bacteria | 2760 |
| 719 | Ga0466958_0026318 | 3300045836 | Bacteria | 3437 |
| 720 | Ga0466958_0033488 | 3300045836 | Bacteria | 3061 |
| 721 | Ga0466958_0168243 | 3300045836 | Bacteria | 1387 |
| 722 | Ga0466958_0231418 | 3300045836 | Bacteria | 1180 |
| 723 | Ga0466967_0094525 | 3300045976 | Bacteria | 2722 |
| 724 | Ga0466967_0113782 | 3300045976 | Bacteria | 2490 |
| 725 | Ga0466967_0114184 | 3300045976 | Bacteria | 2486 |
| 726 | Ga0466967_0118255 | 3300045976 | Bacteria | 2444 |
| 727 | Ga0466967_0130099 | 3300045976 | Bacteria | 2335 |
| 728 | Ga0466967_0212043 | 3300045976 | Bacteria | 1837 |
| 729 | Ga0466967_0441083 | 3300045976 | Bacteria | 1271 |
| 730 | Ga0466967_0729485 | 3300045976 | Bacteria | 982 |
| 731 | Ga0466967_0755429 | 3300045976 | Bacteria | 964 |
| 732 | Ga0466967_1219800 | 3300045976 | Bacteria | 749 |
| 733 | Ga0466967_1321174 | 3300045976 | Bacteria | 718 |
| 734 | Ga0495592_0000026 | 3300046454 | Bacteria | 136204 |
| 735 | Ga0495592_0015800 | 3300046454 | Bacteria | 5727 |
| 736 | Ga0495592_0062898 | 3300046454 | Bacteria | 2723 |
| 737 | Ga0495592_0392611 | 3300046454 | Bacteria | 880 |
| 738 | Ga0495603_0214284 | 3300046455 | Bacteria | 1112 |
| 739 | Ga0495629_0001876 | 3300046459 | Bacteria | 16411 |
| 740 | Ga0495629_0003585 | 3300046459 | Bacteria | 11725 |
| 741 | Ga0495629_0016858 | 3300046459 | Bacteria | 5243 |
| 742 | Ga0495629_0231257 | 3300046459 | Bacteria | 1274 |
| 743 | Ga0495629_0337578 | 3300046459 | Bacteria | 1029 |
| 744 | Ga0495641_0001982 | 3300046461 | Bacteria | 16628 |
| 745 | Ga0495641_0013375 | 3300046461 | Bacteria | 4514 |
| 746 | Ga0495641_0016836 | 3300046461 | Bacteria | 3834 |
| 747 | Ga0495641_0019613 | 3300046461 | Bacteria | 3453 |
| 748 | Ga0495641_0214288 | 3300046461 | Bacteria | 863 |
| 749 | Ga0495651_0001816 | 3300046462 | Bacteria | 16464 |
| 750 | Ga0495651_0003038 | 3300046462 | Bacteria | 12943 |
| 751 | Ga0495651_0007255 | 3300046462 | Bacteria | 8472 |
| 752 | Ga0495651_0010663 | 3300046462 | Bacteria | 7070 |
| 753 | Ga0495651_0037022 | 3300046462 | Bacteria | 3798 |
| 754 | Ga0495651_0038208 | 3300046462 | Bacteria | 3738 |
| 755 | Ga0495651_0581787 | 3300046462 | Bacteria | 708 |
| 756 | Ga0495653_0000155 | 3300046463 | Bacteria | 56764 |
| 757 | Ga0495653_0002608 | 3300046463 | Bacteria | 14343 |
| 758 | Ga0495653_0006734 | 3300046463 | Bacteria | 9432 |
| 759 | Ga0495653_0021100 | 3300046463 | Bacteria | 5279 |
| 760 | Ga0495653_0164048 | 3300046463 | Bacteria | 1540 |
| 761 | Ga0495580_0011599 | 3300046472 | Bacteria | 6817 |
| 762 | Ga0495580_0163642 | 3300046472 | Bacteria | 1539 |
| 763 | Ga0495582_0001032 | 3300046473 | Bacteria | 15593 |
| 764 | Ga0495582_0002403 | 3300046473 | Bacteria | 10450 |
| 765 | Ga0495582_0065678 | 3300046473 | Bacteria | 2005 |
| 766 | Ga0495582_0074538 | 3300046473 | Bacteria | 1879 |
| 767 | Ga0495582_0426708 | 3300046473 | Bacteria | 765 |
| 768 | Ga0495639_0001826 | 3300046475 | Bacteria | 9433 |
| 769 | Ga0495639_0012994 | 3300046475 | Bacteria | 3593 |
| 770 | Ga0495639_0031004 | 3300046475 | Bacteria | 2378 |
| 771 | Ga0495639_0102155 | 3300046475 | Bacteria | 1355 |
| 772 | Ga0495639_0158736 | 3300046475 | Bacteria | 1094 |
| 773 | Ga0495662_0002047 | 3300046476 | Bacteria | 10103 |
| 774 | Ga0495662_0003915 | 3300046476 | Bacteria | 7510 |
| 775 | Ga0495662_0007891 | 3300046476 | Bacteria | 5240 |
| 776 | Ga0495662_0050799 | 3300046476 | Bacteria | 2001 |
| 777 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 778 | Ga0495664_0000220 | 3300046477 | Bacteria | 27274 |
| 779 | Ga0495664_0002529 | 3300046477 | Bacteria | 9823 |
| 780 | Ga0495664_0112835 | 3300046477 | Bacteria | 1641 |
| 781 | Ga0495664_0177642 | 3300046477 | Bacteria | 1291 |
| 782 | Ga0495664_0314088 | 3300046477 | Bacteria | 945 |
| 783 | Ga0495594_0149699 | 3300046499 | Bacteria | 1325 |
| 784 | Ga0495596_0145773 | 3300046500 | Bacteria | 919 |
| 785 | Ga0495608_0000012 | 3300046511 | Bacteria | 242758 |
| 786 | Ga0495608_0032894 | 3300046511 | Bacteria | 3506 |
| 787 | Ga0495618_0000041 | 3300046514 | Bacteria | 96631 |
| 788 | Ga0495618_0009095 | 3300046514 | Bacteria | 5996 |
| 789 | Ga0495618_0018234 | 3300046514 | Bacteria | 4309 |
| 790 | Ga0495618_0042860 | 3300046514 | Bacteria | 2854 |
| 791 | Ga0495628_0000033 | 3300046516 | Bacteria | 118203 |
| 792 | Ga0495628_0040793 | 3300046516 | Bacteria | 3707 |
| 793 | Ga0495628_0079866 | 3300046516 | Bacteria | 2543 |
| 794 | Ga0495628_0231894 | 3300046516 | Bacteria | 1384 |
| 795 | Ga0495628_0386689 | 3300046516 | Bacteria | 1024 |
| 796 | Ga0495628_0497627 | 3300046516 | Bacteria | 880 |
| 797 | Ga0495630_0012136 | 3300046517 | Bacteria | 6247 |
| 798 | Ga0495630_0022265 | 3300046517 | Bacteria | 4681 |
| 799 | Ga0495630_0027669 | 3300046517 | Bacteria | 4209 |
| 800 | Ga0495630_0300935 | 3300046517 | Bacteria | 1225 |
| 801 | Ga0495630_0572363 | 3300046517 | Bacteria | 866 |
| 802 | Ga0495666_0036847 | 3300046526 | Bacteria | 2381 |
| 803 | Ga0495642_0013495 | 3300046528 | Bacteria | 3161 |
| 804 | Ga0495642_0151624 | 3300046528 | Bacteria | 1003 |
| 805 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 806 | Ga0495652_0004698 | 3300046529 | Bacteria | 13018 |
| 807 | Ga0495652_0062473 | 3300046529 | Bacteria | 3140 |
| 808 | Ga0495652_0148176 | 3300046529 | Bacteria | 1837 |
| 809 | Ga0495654_0173106 | 3300046530 | Bacteria | 940 |
| 810 | Ga0495665_0001683 | 3300046531 | Bacteria | 11870 |
| 811 | Ga0495665_0004311 | 3300046531 | Bacteria | 7684 |
| 812 | Ga0495665_0008753 | 3300046531 | Bacteria | 5495 |
| 813 | Ga0495665_0174354 | 3300046531 | Bacteria | 1119 |
| 814 | Ga0495640_0000010 | 3300046533 | Bacteria | 214167 |
| 815 | Ga0495640_0002641 | 3300046533 | Bacteria | 14389 |
| 816 | Ga0495640_0008984 | 3300046533 | Bacteria | 7802 |
| 817 | Ga0495640_0018232 | 3300046533 | Bacteria | 5213 |
| 818 | Ga0495640_0031590 | 3300046533 | Bacteria | 3777 |
| 819 | Ga0495640_0032474 | 3300046533 | Bacteria | 3718 |
| 820 | Ga0495640_0101304 | 3300046533 | Bacteria | 1890 |
| 821 | Ga0495586_0003605 | 3300046535 | Bacteria | 8296 |
| 822 | Ga0495586_0043597 | 3300046535 | Bacteria | 2416 |
| 823 | Ga0495586_0050399 | 3300046535 | Bacteria | 2253 |
| 824 | Ga0495586_0113973 | 3300046535 | Bacteria | 1506 |
| 825 | Ga0495586_0198746 | 3300046535 | Bacteria | 1136 |
| 826 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 827 | Ga0495587_0007562 | 3300046536 | Bacteria | 7031 |
| 828 | Ga0495587_0008658 | 3300046536 | Bacteria | 6537 |
| 829 | Ga0495587_0045647 | 3300046536 | Bacteria | 2603 |
| 830 | Ga0495598_0008068 | 3300046537 | Bacteria | 2441 |
| 831 | Ga0495621_0008651 | 3300046539 | Bacteria | 3061 |
| 832 | Ga0495645_0000026 | 3300046543 | Bacteria | 118737 |
| 833 | Ga0495645_0047561 | 3300046543 | Bacteria | 3125 |
| 834 | Ga0495645_0066433 | 3300046543 | Bacteria | 2606 |
| 835 | Ga0495645_0071177 | 3300046543 | Bacteria | 2508 |
| 836 | Ga0495645_0104989 | 3300046543 | Bacteria | 2005 |
| 837 | Ga0495645_0129699 | 3300046543 | Bacteria | 1768 |
| 838 | Ga0495645_0164328 | 3300046543 | Bacteria | 1532 |
| 839 | Ga0495667_0000132 | 3300046559 | Bacteria | 52219 |
| 840 | Ga0495667_0003797 | 3300046559 | Bacteria | 10145 |
| 841 | Ga0495667_0004922 | 3300046559 | Bacteria | 9033 |
| 842 | Ga0495667_0015481 | 3300046559 | Bacteria | 5153 |
| 843 | Ga0495667_0017451 | 3300046559 | Bacteria | 4847 |
| 844 | Ga0495667_0022160 | 3300046559 | Bacteria | 4280 |
| 845 | Ga0495667_0026272 | 3300046559 | Bacteria | 3923 |
| 846 | Ga0495656_0068202 | 3300046615 | Bacteria | 1572 |
| 847 | Ga0495634_0000285 | 3300046642 | Bacteria | 48349 |
| 848 | Ga0495634_0007957 | 3300046642 | Bacteria | 7909 |
| 849 | Ga0495634_0009612 | 3300046642 | Bacteria | 7124 |
| 850 | Ga0495634_0027295 | 3300046642 | Bacteria | 3973 |
| 851 | Ga0495634_0041359 | 3300046642 | Bacteria | 3130 |
| 852 | Ga0495634_0100485 | 3300046642 | Bacteria | 1869 |
| 853 | Ga0495634_0223302 | 3300046642 | Bacteria | 1162 |
| 854 | Ga0495635_0000113 | 3300046663 | Bacteria | 48231 |
| 855 | Ga0495635_0001457 | 3300046663 | Bacteria | 15839 |
| 856 | Ga0495635_0013023 | 3300046663 | Bacteria | 5822 |
| 857 | Ga0495635_0031578 | 3300046663 | Bacteria | 3675 |
| 858 | Ga0495635_0034738 | 3300046663 | Bacteria | 3497 |
| 859 | Ga0495635_0110013 | 3300046663 | Bacteria | 1882 |
| 860 | Ga0495635_0307270 | 3300046663 | Bacteria | 1063 |
| 861 | Ga0495635_0395775 | 3300046663 | Bacteria | 918 |
| 862 | Ga0495659_0110170 | 3300046664 | Bacteria | 1075 |
| 863 | Ga0495657_0000258 | 3300046675 | Bacteria | 48270 |
| 864 | Ga0495657_0008915 | 3300046675 | Bacteria | 7639 |
| 865 | Ga0495657_0012718 | 3300046675 | Bacteria | 6241 |
| 866 | Ga0495657_0174237 | 3300046675 | Bacteria | 1323 |
| 867 | Ga0495657_0301447 | 3300046675 | Bacteria | 955 |
| 868 | Ga0495599_0000070 | 3300046678 | Bacteria | 71413 |
| 869 | Ga0495599_0009684 | 3300046678 | Bacteria | 5895 |
| 870 | Ga0495599_0060391 | 3300046678 | Bacteria | 2370 |
| 871 | Ga0495599_0070258 | 3300046678 | Bacteria | 2185 |
| 872 | Ga0495599_0168426 | 3300046678 | Bacteria | 1352 |
| 873 | Ga0495599_0178339 | 3300046678 | Bacteria | 1310 |
| 874 | Ga0495623_0000003 | 3300046679 | Bacteria | 147316 |
| 875 | Ga0495623_0012706 | 3300046679 | Bacteria | 5452 |
| 876 | Ga0495623_0175327 | 3300046679 | Bacteria | 1249 |
| 877 | Ga0495646_0000070 | 3300046680 | Bacteria | 47494 |
| 878 | Ga0495646_0012319 | 3300046680 | Bacteria | 5438 |
| 879 | Ga0495646_0044888 | 3300046680 | Bacteria | 2701 |
| 880 | Ga0495647_0011297 | 3300046681 | Bacteria | 3059 |
| 881 | Ga0495647_0012544 | 3300046681 | Bacteria | 2920 |
| 882 | Ga0495658_0000863 | 3300046683 | Bacteria | 16308 |
| 883 | Ga0495658_0014068 | 3300046683 | Bacteria | 4079 |
| 884 | Ga0495658_0014130 | 3300046683 | Bacteria | 4072 |
| 885 | Ga0495658_0076084 | 3300046683 | Bacteria | 1961 |
| 886 | Ga0495658_0553662 | 3300046683 | Bacteria | 736 |
| 887 | Ga0495669_0134178 | 3300046684 | Bacteria | 1167 |
| 888 | Ga0495613_0004947 | 3300046689 | Bacteria | 10008 |
| 889 | Ga0495613_0015917 | 3300046689 | Bacteria | 5599 |
| 890 | Ga0495613_0091833 | 3300046689 | Bacteria | 2199 |
| 891 | Ga0495613_0154256 | 3300046689 | Bacteria | 1637 |
| 892 | Ga0495613_0210676 | 3300046689 | Bacteria | 1367 |
| 893 | Ga0495613_0242681 | 3300046689 | Bacteria | 1259 |
| 894 | Ga0495624_0006089 | 3300046690 | Bacteria | 8596 |
| 895 | Ga0495624_0006919 | 3300046690 | Bacteria | 7999 |
| 896 | Ga0495624_0020464 | 3300046690 | Bacteria | 4403 |
| 897 | Ga0495624_0072914 | 3300046690 | Bacteria | 2135 |
| 898 | Ga0495624_0229357 | 3300046690 | Bacteria | 1125 |
| 899 | Ga0495671_0106647 | 3300046692 | Bacteria | 1368 |
| 900 | Ga0495671_0195273 | 3300046692 | Bacteria | 982 |
| 901 | Ga0495600_0000007 | 3300046809 | Bacteria | 150995 |
| 902 | Ga0495600_0024425 | 3300046809 | Bacteria | 3889 |
| 903 | Ga0495600_0111697 | 3300046809 | Bacteria | 1779 |
| 904 | Ga0495581_0003231 | 3300047315 | Bacteria | 9341 |
| 905 | Ga0495581_0004944 | 3300047315 | Bacteria | 7715 |
| 906 | Ga0495581_0015110 | 3300047315 | Bacteria | 4482 |
| 907 | Ga0495581_0021363 | 3300047315 | Bacteria | 3753 |
| 908 | Ga0495581_0024853 | 3300047315 | Bacteria | 3471 |
| 909 | Ga0495581_0100813 | 3300047315 | Bacteria | 1677 |
| 910 | Ga0495604_0000010 | 3300047317 | Bacteria | 312236 |
| 911 | Ga0495604_0001295 | 3300047317 | Bacteria | 20451 |
| 912 | Ga0495604_0029640 | 3300047317 | Bacteria | 4354 |
| 913 | Ga0495604_0062518 | 3300047317 | Bacteria | 2843 |
| 914 | Ga0495674_0000013 | 3300047319 | Bacteria | 248475 |
| 915 | Ga0495674_0003143 | 3300047319 | Bacteria | 16039 |
| 916 | Ga0495674_0004127 | 3300047319 | Bacteria | 14021 |
| 917 | Ga0495674_0010021 | 3300047319 | Bacteria | 8982 |
| 918 | Ga0495674_0011758 | 3300047319 | Bacteria | 8255 |
| 919 | Ga0495674_0058105 | 3300047319 | Bacteria | 3383 |
| 920 | Ga0495672_0047694 | 3300047320 | Bacteria | 2546 |
| 921 | Ga0495676_0001106 | 3300047321 | Bacteria | 22893 |
| 922 | Ga0495676_0006015 | 3300047321 | Bacteria | 11149 |
| 923 | Ga0495676_0051111 | 3300047321 | Bacteria | 3309 |
| 924 | Ga0495676_0200526 | 3300047321 | Bacteria | 1387 |
| 925 | Ga0495676_0267646 | 3300047321 | Bacteria | 1161 |
| 926 | Ga0495680_0003074 | 3300047322 | Bacteria | 16634 |
| 927 | Ga0495680_0003453 | 3300047322 | Bacteria | 15563 |
| 928 | Ga0495680_0005738 | 3300047322 | Bacteria | 11624 |
| 929 | Ga0495680_0014676 | 3300047322 | Bacteria | 6776 |
| 930 | Ga0495680_0029339 | 3300047322 | Bacteria | 4505 |
| 931 | Ga0495680_0034479 | 3300047322 | Bacteria | 4085 |
| 932 | Ga0495680_0042583 | 3300047322 | Bacteria | 3601 |
| 933 | Ga0495680_0068616 | 3300047322 | Bacteria | 2707 |
| 934 | Ga0495683_0284350 | 3300047323 | Bacteria | 715 |
| 935 | Ga0495675_0000253 | 3300047444 | Bacteria | 38594 |
| 936 | Ga0495675_0058499 | 3300047444 | Bacteria | 2444 |
| 937 | Ga0495685_108872 | 3300047447 | Bacteria | 913 |
| 938 | Ga0495684_0000008 | 3300047471 | Bacteria | 201370 |
| 939 | Ga0495684_0007003 | 3300047471 | Bacteria | 8756 |
| 940 | Ga0495684_0008374 | 3300047471 | Bacteria | 8012 |
| 941 | Ga0495684_0010160 | 3300047471 | Bacteria | 7280 |
| 942 | Ga0495684_0011194 | 3300047471 | Bacteria | 6934 |
| 943 | Ga0495684_0012423 | 3300047471 | Bacteria | 6568 |
| 944 | Ga0495684_0461515 | 3300047471 | Bacteria | 880 |
| 945 | Ga0495684_0492987 | 3300047471 | Bacteria | 844 |
| 946 | Ga0495593_0000137 | 3300047673 | Bacteria | 35364 |
| 947 | Ga0495593_0001564 | 3300047673 | Bacteria | 13500 |
| 948 | Ga0495593_0007543 | 3300047673 | Bacteria | 6356 |
| 949 | Ga0495593_0112778 | 3300047673 | Bacteria | 1387 |
| 950 | Ga0495593_0234396 | 3300047673 | Bacteria | 920 |
| 951 | Ga0495602_0000264 | 3300048088 | Bacteria | 48258 |
| 952 | Ga0495602_0002962 | 3300048088 | Bacteria | 17410 |
| 953 | Ga0495602_0029367 | 3300048088 | Bacteria | 5237 |
| 954 | Ga0495602_0054854 | 3300048088 | Bacteria | 3515 |
| 955 | Ga0495602_0059412 | 3300048088 | Bacteria | 3337 |
| 956 | Ga0495602_0095371 | 3300048088 | Bacteria | 2456 |
| 957 | Ga0495602_0118253 | 3300048088 | Bacteria | 2138 |
| 958 | Ga0495614_0054957 | 3300048089 | Bacteria | 1708 |
| 959 | Ga0495614_0241648 | 3300048089 | Bacteria | 824 |
| 960 | Ga0496100_0015265 | 3300048903 | Bacteria | 4482 |
| 961 | Ga0496100_0203372 | 3300048903 | Bacteria | 1445 |
| 962 | Ga0496101_0087376 | 3300048904 | Bacteria | 2314 |
| 963 | Ga0496101_0103881 | 3300048904 | Bacteria | 2130 |
| 964 | Ga0496101_0151883 | 3300048904 | Bacteria | 1772 |
| 965 | Ga0496101_0312080 | 3300048904 | Bacteria | 1233 |
| 966 | Ga0496101_0330343 | 3300048904 | Bacteria | 1197 |
| 967 | Ga0496102_0008851 | 3300048905 | Bacteria | 8638 |
| 968 | Ga0496102_0034171 | 3300048905 | Bacteria | 4573 |
| 969 | Ga0496102_0114872 | 3300048905 | Bacteria | 2512 |
| 970 | Ga0496102_0250887 | 3300048905 | Bacteria | 1669 |
| 971 | Ga0496103_0051990 | 3300048906 | Bacteria | 2537 |
| 972 | Ga0496103_0073987 | 3300048906 | Bacteria | 2135 |
| 973 | Ga0496103_0396739 | 3300048906 | Bacteria | 886 |
| 974 | Ga0496104_0004620 | 3300048907 | Bacteria | 11999 |
| 975 | Ga0496104_0026940 | 3300048907 | Bacteria | 5314 |
| 976 | Ga0496104_0096681 | 3300048907 | Bacteria | 2826 |
| 977 | Ga0496104_0394302 | 3300048907 | Bacteria | 1296 |
| 978 | Ga0496104_0428175 | 3300048907 | Bacteria | 1235 |
| 979 | Ga0496104_0605797 | 3300048907 | Bacteria | 1005 |
| 980 | Ga0496104_0785421 | 3300048907 | Bacteria | 859 |
| 981 | Ga0496105_0031670 | 3300048908 | Bacteria | 4336 |
| 982 | Ga0496105_0102458 | 3300048908 | Bacteria | 2364 |
| 983 | Ga0496105_0106800 | 3300048908 | Bacteria | 2311 |
| 984 | Ga0496105_0108903 | 3300048908 | Bacteria | 2287 |
| 985 | Ga0496105_0112560 | 3300048908 | Bacteria | 2246 |
| 986 | Ga0496105_0280613 | 3300048908 | Bacteria | 1343 |
| 987 | Ga0496105_0411425 | 3300048908 | Bacteria | 1072 |
| 988 | Ga0496106_0000080 | 3300048909 | Bacteria | 76997 |
| 989 | Ga0496106_0802828 | 3300048909 | Bacteria | 746 |
| 990 | Ga0496107_0001928 | 3300048910 | Bacteria | 13160 |
| 991 | Ga0496107_0317446 | 3300048910 | Bacteria | 1159 |
| 992 | Ga0496107_0487376 | 3300048910 | Bacteria | 915 |
| 993 | Ga0496108_0032356 | 3300048911 | Bacteria | 4345 |
| 994 | Ga0496108_0095736 | 3300048911 | Bacteria | 2528 |
| 995 | Ga0496108_0114095 | 3300048911 | Bacteria | 2313 |
| 996 | Ga0496108_0429483 | 3300048911 | Bacteria | 1154 |
| 997 | Ga0496108_0775645 | 3300048911 | Bacteria | 828 |
| 998 | Ga0496109_0001577 | 3300048912 | Bacteria | 19030 |
| 999 | Ga0496109_0115733 | 3300048912 | Bacteria | 2495 |
| 1000 | Ga0496109_0362684 | 3300048912 | Bacteria | 1369 |
| 1001 | Ga0496109_0446793 | 3300048912 | Bacteria | 1221 |
| 1002 | Ga0496109_0547642 | 3300048912 | Bacteria | 1091 |
| 1003 | Ga0496110_0025060 | 3300048913 | Bacteria | 5093 |
| 1004 | Ga0496110_0084804 | 3300048913 | Bacteria | 2828 |
| 1005 | Ga0496110_0258689 | 3300048913 | Bacteria | 1584 |
| 1006 | Ga0496110_0789910 | 3300048913 | Bacteria | 853 |
| 1007 | Ga0496111_0000600 | 3300048914 | Bacteria | 18996 |
| 1008 | Ga0496111_0601557 | 3300048914 | Bacteria | 805 |
| 1009 | Ga0496112_0012198 | 3300048915 | Bacteria | 7888 |
| 1010 | Ga0496112_0097705 | 3300048915 | Bacteria | 2907 |
| 1011 | Ga0496112_0105277 | 3300048915 | Bacteria | 2791 |
| 1012 | Ga0496112_0126770 | 3300048915 | Bacteria | 2523 |
| 1013 | Ga0496112_0228649 | 3300048915 | Bacteria | 1815 |
| 1014 | Ga0496112_0947746 | 3300048915 | Bacteria | 782 |
| 1015 | Ga0496113_0030702 | 3300048916 | Bacteria | 3892 |
| 1016 | Ga0496113_0103015 | 3300048916 | Bacteria | 2213 |
| 1017 | Ga0496113_0291029 | 3300048916 | Bacteria | 1307 |
| 1018 | Ga0496113_0633391 | 3300048916 | Bacteria | 855 |
| 1019 | Ga0496114_0008209 | 3300048917 | Bacteria | 8273 |
| 1020 | Ga0496114_0033322 | 3300048917 | Unclassified | 4244 |
| 1021 | Ga0496114_0043584 | 3300048917 | Bacteria | 3721 |
| 1022 | Ga0496114_0219059 | 3300048917 | Bacteria | 1670 |
| 1023 | Ga0496114_0253648 | 3300048917 | Bacteria | 1548 |
| 1024 | Ga0496114_0723951 | 3300048917 | Bacteria | 871 |
| 1025 | Ga0496115_0002965 | 3300048918 | Bacteria | 12203 |
| 1026 | Ga0496115_0055305 | 3300048918 | Bacteria | 3188 |
| 1027 | Ga0496115_0200274 | 3300048918 | Bacteria | 1649 |
| 1028 | Ga0496115_0662796 | 3300048918 | Bacteria | 824 |
| 1029 | Ga0496116_0004347 | 3300048919 | Bacteria | 13551 |
| 1030 | Ga0496116_0018572 | 3300048919 | Bacteria | 5352 |
| 1031 | Ga0496116_0047984 | 3300048919 | Bacteria | 2870 |
| 1032 | Ga0496116_0147561 | 3300048919 | Bacteria | 1312 |
| 1033 | Ga0496117_0021082 | 3300048920 | Bacteria | 5289 |
| 1034 | Ga0496118_0007568 | 3300048921 | Bacteria | 11460 |
| 1035 | Ga0496119_0234953 | 3300048922 | Bacteria | 931 |
| 1036 | Ga0496121_0028239 | 3300048924 | Bacteria | 5227 |
| 1037 | Ga0496121_0041108 | 3300048924 | Bacteria | 4046 |
| 1038 | Ga0496122_0024068 | 3300048925 | Bacteria | 5340 |
| 1039 | Ga0496123_0083889 | 3300048926 | Bacteria | 1924 |
| 1040 | Ga0496124_0003625 | 3300048927 | Bacteria | 18745 |
| 1041 | Ga0496124_0014196 | 3300048927 | Bacteria | 7717 |
| 1042 | Ga0496124_0135254 | 3300048927 | Bacteria | 1952 |
| 1043 | Ga0496125_0006540 | 3300048928 | Bacteria | 12561 |
| 1044 | Ga0496126_0040560 | 3300048929 | Bacteria | 4315 |
| 1045 | Ga0501031_0164817 | 3300049568 | Bacteria | 1449 |
| 1046 | Ga0501032_0595240 | 3300049569 | Bacteria | 704 |
| 1047 | Ga0501033_0331952 | 3300049570 | Bacteria | 1067 |
| 1048 | Ga0501036_0079229 | 3300049572 | Bacteria | 2779 |
| 1049 | Ga0501036_0174756 | 3300049572 | Bacteria | 1809 |
| 1050 | Ga0501036_0370251 | 3300049572 | Bacteria | 1196 |
| 1051 | Ga0501038_0027623 | 3300049574 | Bacteria | 5047 |
| 1052 | Ga0501038_0195479 | 3300049574 | Bacteria | 1626 |
| 1053 | Ga0501039_0083413 | 3300049575 | Bacteria | 2489 |
| 1054 | Ga0501041_0042610 | 3300049577 | Bacteria | 2759 |
| 1055 | Ga0501042_0075638 | 3300049578 | Bacteria | 2410 |
| 1056 | Ga0501042_0351802 | 3300049578 | Bacteria | 1066 |
| 1057 | Ga0501046_0055704 | 3300049580 | Bacteria | 3106 |
| 1058 | Ga0501046_0242546 | 3300049580 | Bacteria | 1329 |
| 1059 | Ga0501047_0009041 | 3300049581 | Bacteria | 9409 |
| 1060 | Ga0501047_0076364 | 3300049581 | Bacteria | 3224 |
| 1061 | Ga0501048_0064100 | 3300049582 | Bacteria | 2599 |
| 1062 | Ga0501067_0007851 | 3300049583 | Bacteria | 5930 |
| 1063 | Ga0501067_0018620 | 3300049583 | Bacteria | 3844 |
| 1064 | Ga0501069_0005726 | 3300049585 | Bacteria | 6477 |
| 1065 | Ga0501069_0022744 | 3300049585 | Bacteria | 3413 |
| 1066 | Ga0501070_0037984 | 3300049586 | Bacteria | 4018 |
| 1067 | Ga0501070_0133410 | 3300049586 | Bacteria | 2051 |
| 1068 | Ga0501070_0212427 | 3300049586 | Bacteria | 1588 |
| 1069 | Ga0501072_0009444 | 3300049588 | Bacteria | 7416 |
| 1070 | Ga0501072_0054312 | 3300049588 | Bacteria | 3156 |
| 1071 | Ga0501072_0096462 | 3300049588 | Bacteria | 2350 |
| 1072 | Ga0501073_0044779 | 3300049589 | Bacteria | 3119 |
| 1073 | Ga0501073_0120098 | 3300049589 | Bacteria | 1821 |
| 1074 | Ga0501073_0650401 | 3300049589 | Bacteria | 728 |
| 1075 | Ga0501074_0016085 | 3300049590 | Bacteria | 5437 |
| 1076 | Ga0501074_0096018 | 3300049590 | Bacteria | 2123 |
| 1077 | Ga0501074_0331483 | 3300049590 | Bacteria | 1080 |
| 1078 | Ga0501074_0505059 | 3300049590 | Bacteria | 856 |
| 1079 | Ga0501075_0066655 | 3300049591 | Bacteria | 2717 |
| 1080 | Ga0501076_0003344 | 3300049592 | Bacteria | 11254 |
| 1081 | Ga0501076_0041189 | 3300049592 | Bacteria | 3632 |
| 1082 | Ga0501076_0152764 | 3300049592 | Bacteria | 1878 |
| 1083 | Ga0501076_0578577 | 3300049592 | Bacteria | 926 |
| 1084 | Ga0501077_0013776 | 3300049593 | Bacteria | 5071 |
| 1085 | Ga0501077_0032171 | 3300049593 | Bacteria | 3339 |
| 1086 | Ga0501077_0120137 | 3300049593 | Bacteria | 1665 |
| 1087 | Ga0501219_005207 | 3300049703 | Bacteria | 925 |
| 1088 | Ga0501079_0010485 | 3300049741 | Bacteria | 7046 |
| 1089 | Ga0501079_0404163 | 3300049741 | Bacteria | 1071 |
| 1090 | Ga0501080_0094204 | 3300049742 | Bacteria | 2781 |
| 1091 | Ga0501080_0156207 | 3300049742 | Bacteria | 2107 |
| 1092 | Ga0501080_0300785 | 3300049742 | Bacteria | 1455 |
| 1093 | Ga0501080_0715976 | 3300049742 | Bacteria | 882 |
| 1094 | Ga0501081_0023585 | 3300049743 | Bacteria | 4124 |
| 1095 | Ga0501081_0078102 | 3300049743 | Bacteria | 2314 |
| 1096 | Ga0501081_0204071 | 3300049743 | Bacteria | 1434 |
| 1097 | Ga0501083_0085608 | 3300049744 | Bacteria | 2085 |
| 1098 | Ga0501083_0281151 | 3300049744 | Bacteria | 1082 |
| 1099 | Ga0501035_0054899 | 3300049822 | Bacteria | 3558 |
| 1100 | Ga0501044_0000222 | 3300049823 | Bacteria | 71930 |
| 1101 | Ga0501045_0016710 | 3300049824 | Bacteria | 5213 |
| 1102 | nmdc:mga03n38_85932_c1 | 3300050490 | Bacteria | 1488 |
| 1103 | nmdc:mga00v17_27387_c1 | 3300050491 | Bacteria | 3327 |
| 1104 | nmdc:mga0k408_77654_c1 | 3300050493 | Bacteria | 1942 |
| 1105 | nmdc:mga05p37_110601_c1 | 3300050507 | Bacteria | 3380 |
| 1106 | nmdc:mga05p37_130341_c1 | 3300050507 | Bacteria | 3085 |
| 1107 | nmdc:mga05p37_251403_c1 | 3300050507 | Bacteria | 2120 |
| 1108 | nmdc:mga05p37_251953_c1 | 3300050507 | Bacteria | 2117 |
| 1109 | nmdc:mga05p37_441882_c1 | 3300050507 | Bacteria | 1508 |
| 1110 | nmdc:mga05p37_5066_c1 | 3300050507 | Bacteria | 15447 |
| 1111 | nmdc:mga09592_4709_c1 | 3300050508 | Bacteria | 11049 |
| 1112 | nmdc:mga09592_66292_c1 | 3300050508 | Bacteria | 3060 |
| 1113 | nmdc:mga0qj67_111240_c1 | 3300050509 | Bacteria | 2211 |
| 1114 | nmdc:mga0qj67_111501_c1 | 3300050509 | Bacteria | 2209 |
| 1115 | nmdc:mga0qj67_168264_c1 | 3300050509 | Bacteria | 1780 |
| 1116 | nmdc:mga0qj67_256242_c1 | 3300050509 | Bacteria | 1419 |
| 1117 | nmdc:mga0qj67_45819_c1 | 3300050509 | Bacteria | 3450 |
| 1118 | nmdc:mga06r32_123078_c1 | 3300050510 | Bacteria | 2560 |
| 1119 | nmdc:mga06r32_361204_c1 | 3300050510 | Bacteria | 1436 |
| 1120 | nmdc:mga08y16_1092714_c1 | 3300050511 | Bacteria | 773 |
| 1121 | nmdc:mga08y16_715495_c1 | 3300050511 | Bacteria | 1000 |
| 1122 | nmdc:mga08y16_7942_c1 | 3300050511 | Bacteria | 11106 |
| 1123 | nmdc:mga08y16_96211_c1 | 3300050511 | Bacteria | 3084 |
| 1124 | nmdc:mga0n895_1081549_c1 | 3300050512 | Bacteria | 780 |
| 1125 | nmdc:mga0n895_232262_c1 | 3300050512 | Bacteria | 1872 |
| 1126 | nmdc:mga0n895_293222_c1 | 3300050512 | Unclassified | 1649 |
| 1127 | nmdc:mga0n895_523505_c1 | 3300050512 | Bacteria | 1193 |
| 1128 | nmdc:mga0n895_633543_c1 | 3300050512 | Bacteria | 1069 |
| 1129 | nmdc:mga0n895_969_c1 | 3300050512 | Bacteria | 13990 |
| 1130 | nmdc:mga0rr50_559929_c1 | 3300050513 | Bacteria | 973 |
| 1131 | nmdc:mga0rr50_59735_c1 | 3300050513 | Bacteria | 2864 |
| 1132 | nmdc:mga0rr50_689068_c1 | 3300050513 | Bacteria | 872 |
| 1133 | nmdc:mga08x19_258241_c1 | 3300050514 | Bacteria | 1204 |
| 1134 | nmdc:mga08x19_453_c1 | 3300050514 | Bacteria | 27975 |
| 1135 | nmdc:mga0a205_19407_c1 | 3300050515 | Bacteria | 6408 |
| 1136 | nmdc:mga0a205_50550_c1 | 3300050515 | Bacteria | 4013 |
| 1137 | nmdc:mga0a205_98346_c1 | 3300050515 | Bacteria | 2825 |
| 1138 | nmdc:mga0sz30_111766_c1 | 3300050516 | Bacteria | 1198 |
| 1139 | nmdc:mga0sz30_44143_c1 | 3300050516 | Bacteria | 1877 |
| 1140 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 1141 | Ga0495601_0002673 | 3300053077 | Bacteria | 10100 |
| 1142 | Ga0495601_0009699 | 3300053077 | Bacteria | 5697 |
| 1143 | Ga0495601_0137572 | 3300053077 | Bacteria | 1592 |
| 1144 | Ga0495601_0444194 | 3300053077 | Bacteria | 839 |
| 1145 | Ga0495612_0000009 | 3300053078 | Bacteria | 229858 |
| 1146 | Ga0495612_0005512 | 3300053078 | Bacteria | 5231 |
| 1147 | Ga0495612_0095485 | 3300053078 | Bacteria | 1262 |
| 1148 | Ga0495612_0149167 | 3300053078 | Bacteria | 1017 |
| 1149 | Ga0495595_0000075 | 3300053084 | Bacteria | 48300 |
| 1150 | Ga0495595_0000640 | 3300053084 | Bacteria | 13290 |
| 1151 | Ga0495595_0013680 | 3300053084 | Bacteria | 3431 |
| 1152 | Ga0495595_0068086 | 3300053084 | Bacteria | 1679 |
| 1153 | Ga0495595_0100821 | 3300053084 | Bacteria | 1393 |
| 1154 | Ga0495619_0000039 | 3300053085 | Bacteria | 118681 |
| 1155 | Ga0495619_0001034 | 3300053085 | Bacteria | 18264 |
| 1156 | Ga0495619_0002157 | 3300053085 | Bacteria | 13040 |
| 1157 | Ga0495619_0002259 | 3300053085 | Bacteria | 12728 |
| 1158 | Ga0495619_0024111 | 3300053085 | Bacteria | 3901 |
| 1159 | Ga0500641_0021543 | 3300053096 | Bacteria | 2459 |
| 1160 | Ga0500654_094665 | 3300053099 | Bacteria | 1309 |
| 1161 | Ga0500595_004295 | 3300053119 | Bacteria | 6422 |
| 1162 | Ga0500618_003215 | 3300053125 | Bacteria | 5692 |
| 1163 | Ga0500616_0042715 | 3300053153 | Bacteria | 2426 |
| 1164 | Ga0500616_0047451 | 3300053153 | Bacteria | 2280 |
| 1165 | Ga0500627_0174739 | 3300053158 | Bacteria | 967 |
| 1166 | Ga0501084_0014155 | 3300054114 | Bacteria | 6605 |
| 1167 | Ga0501084_0046021 | 3300054114 | Bacteria | 3654 |
| 1168 | Ga0501084_0093516 | 3300054114 | Bacteria | 2524 |
| 1169 | Ga0501084_0123741 | 3300054114 | Bacteria | 2175 |
| 1170 | Ga0501084_0280819 | 3300054114 | Bacteria | 1406 |
| 1171 | Ga0587066_020355 | 3300059490 | Bacteria | 1089 |
| 1172 | Ga0587070_027916 | 3300059491 | Bacteria | 1003 |
| 1173 | Ga0587070_055869 | 3300059491 | Bacteria | 802 |
| 1174 | Ga0587073_0093273 | 3300059492 | Bacteria | 769 |
| 1175 | Ga0587080_033368 | 3300059503 | Bacteria | 907 |
| 1176 | Ga0587128_043366 | 3300059630 | Bacteria | 795 |
| 1177 | Ga0587076_012844 | 3300059645 | Bacteria | 1259 |
| 1178 | Ga0587114_038702 | 3300059655 | Bacteria | 763 |
| 1179 | Ga0501082_0000371 | 3300060353 | Bacteria | 39631 |
| 1180 | Ga0501082_0009046 | 3300060353 | Bacteria | 8591 |
| 1181 | Ga0501082_0022842 | 3300060353 | Bacteria | 5388 |
| 1182 | Ga0501082_0312034 | 3300060353 | Bacteria | 1370 |
| 1183 | Ga0501082_0934797 | 3300060353 | Bacteria | 758 |
| 1184 | Ga0466962_0042318 | 3300061719 | Bacteria | 2180 |
| 1185 | Ga0530510_0052853 | 3300061734 | Bacteria | 2935 |
| 1186 | Ga0530510_0078131 | 3300061734 | Bacteria | 2406 |
| 1187 | Ga0530510_0127126 | 3300061734 | Bacteria | 1874 |
| 1188 | Ga0530510_0198832 | 3300061734 | Bacteria | 1488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046475 | Ga0495639_0102155 | Ga0495639_0102155_705_1334 | 188 |
| 2 | iso_pu_bacteria | 3005452660 | 3005453847 | 196 |
| 3 | 3300035724 | Ga0373933_0420628 | Ga0373933_0420628_14_634 | 198 |
| 4 | 3300046692 | Ga0495671_0106647 | Ga0495671_0106647_44_664 | 198 |
| 5 | 3300048909 | Ga0496106_0802828 | Ga0496106_0802828_113_733 | 198 |
| 6 | 3300027462 | Ga0210000_1016667 | Ga0210000_10166672 | 200 |
| 7 | 3300005471 | Ga0070698_100023955 | Ga0070698_1000239554 | 204 |
| 8 | 3300059491 | Ga0587070_027916 | Ga0587070_027916_207_821 | 204 |
| 9 | 3300050512 | nmdc:mga0n895_633543_c1 | nmdc:mga0n895_633543_c1_75_734 | 211 |
| 10 | 3300035090 | Ga0373949_0073030 | Ga0373949_0073030_18_659 | 212 |
| 11 | 3300046533 | Ga0495640_0101304 | Ga0495640_0101304_356_997 | 212 |
| 12 | 3300025315 | Ga0207697_10061119 | Ga0207697_100611191 | 214 |
| 13 | iso_pu_bacteria | 2510917028 | 2511181980 | 214 |
| 14 | iso_pu_bacteria | 2513237088 | 2513598064 | 214 |
| 15 | iso_pu_bacteria | 2534681796 | 2535516092 | 214 |
| 16 | iso_pu_bacteria | 2582581294 | 2585199810 | 214 |
| 17 | iso_pu_bacteria | 2585427594 | 2585846636 | 214 |
| 18 | iso_pu_bacteria | 2738541293 | 2738799330 | 214 |
| 19 | iso_pu_bacteria | 2996887358 | 2996892345 | 214 |
| 20 | iso_pu_bacteria | 8005258706 | 8005259627 | 214 |
| 21 | iso_pu_bacteria | 8005321885 | 8005326872 | 214 |
| 22 | iso_pu_bacteria | 8005542996 | 8005544766 | 214 |
| 23 | iso_pu_bacteria | 2513237094 | 2513642656 | 215 |
| 24 | iso_pu_bacteria | 2513237144 | 2513911553 | 215 |
| 25 | iso_pu_bacteria | 2513237146 | 2513929070 | 215 |
| 26 | iso_pu_bacteria | 2582581299 | 2585232483 | 215 |
| 27 | iso_pu_bacteria | 2582581304 | 2585254284 | 215 |
| 28 | iso_pu_bacteria | 2582581306 | 2585266543 | 215 |
| 29 | iso_pu_bacteria | 2582581865 | 2585387559 | 215 |
| 30 | iso_pu_bacteria | 2582581866 | 2585394165 | 215 |
| 31 | iso_pu_bacteria | 2599185170 | 2599414717 | 215 |
| 32 | iso_pu_bacteria | 2643221643 | 2644239652 | 215 |
| 33 | iso_pu_bacteria | 2835312727 | 2835317752 | 215 |
| 34 | iso_pu_bacteria | 2838035591 | 2838039564 | 215 |
| 35 | iso_pu_bacteria | 2838661181 | 2838667959 | 215 |
| 36 | iso_pu_bacteria | 2844163670 | 2844168181 | 215 |
| 37 | iso_pu_bacteria | 2852387548 | 2852391441 | 215 |
| 38 | iso_pu_bacteria | 2933016740 | 2933017617 | 215 |
| 39 | iso_pu_bacteria | 2989771324 | 2989774115 | 215 |
| 40 | iso_pu_bacteria | 3005710791 | 3005716697 | 215 |
| 41 | iso_pu_bacteria | 643348564 | 643600467 | 215 |
| 42 | 3300032126 | Ga0307415_100059084 | Ga0307415_1000590841 | 216 |
| 43 | 3300046692 | Ga0495671_0195273 | Ga0495671_0195273_23_745 | 216 |
| 44 | 3300002126 | JGI24035J26624_1006303 | JGI24035J26624_10063031 | 217 |
| 45 | 3300003544 | Ga0007417J51691_1073041 | Ga0007417J51691_10730411 | 217 |
| 46 | 3300004803 | Ga0058862_10157652 | Ga0058862_101576521 | 217 |
| 47 | 3300005290 | Ga0065712_10032685 | Ga0065712_100326852 | 217 |
| 48 | 3300005290 | Ga0065712_10151397 | Ga0065712_101513971 | 217 |
| 49 | 3300005293 | Ga0065715_10009372 | Ga0065715_100093723 | 217 |
| 50 | 3300005293 | Ga0065715_10055804 | Ga0065715_100558042 | 217 |
| 51 | 3300005329 | Ga0070683_100020623 | Ga0070683_1000206233 | 217 |
| 52 | 3300005329 | Ga0070683_100034751 | Ga0070683_1000347513 | 217 |
| 53 | 3300005365 | Ga0070688_100104790 | Ga0070688_1001047902 | 217 |
| 54 | 3300005434 | Ga0070709_10019181 | Ga0070709_100191812 | 217 |
| 55 | 3300005435 | Ga0070714_100030048 | Ga0070714_1000300482 | 217 |
| 56 | 3300005435 | Ga0070714_100187329 | Ga0070714_1001873291 | 217 |
| 57 | 3300005436 | Ga0070713_100014411 | Ga0070713_1000144112 | 217 |
| 58 | 3300005436 | Ga0070713_100747518 | Ga0070713_1007475182 | 217 |
| 59 | 3300005437 | Ga0070710_10088215 | Ga0070710_100882152 | 217 |
| 60 | 3300005439 | Ga0070711_100057541 | Ga0070711_1000575413 | 217 |
| 61 | 3300005445 | Ga0070708_100179668 | Ga0070708_1001796681 | 217 |
| 62 | 3300005458 | Ga0070681_10334269 | Ga0070681_103342692 | 217 |
| 63 | 3300005467 | Ga0070706_100007691 | Ga0070706_1000076912 | 217 |
| 64 | 3300005468 | Ga0070707_100003569 | Ga0070707_10000356915 | 217 |
| 65 | 3300005471 | Ga0070698_100005317 | Ga0070698_10000531711 | 217 |
| 66 | 3300005530 | Ga0070679_100241052 | Ga0070679_1002410521 | 217 |
| 67 | 3300005535 | Ga0070684_100086154 | Ga0070684_1000861543 | 217 |
| 68 | 3300005536 | Ga0070697_100036352 | Ga0070697_1000363523 | 217 |
| 69 | 3300005536 | Ga0070697_100100669 | Ga0070697_1001006693 | 217 |
| 70 | 3300005545 | Ga0070695_100015384 | Ga0070695_1000153845 | 217 |
| 71 | 3300005546 | Ga0070696_100006691 | Ga0070696_1000066914 | 217 |
| 72 | 3300005546 | Ga0070696_100051921 | Ga0070696_1000519212 | 217 |
| 73 | 3300005548 | Ga0070665_100054303 | Ga0070665_1000543033 | 217 |
| 74 | 3300005564 | Ga0070664_100022364 | Ga0070664_1000223645 | 217 |
| 75 | 3300005578 | Ga0068854_100663036 | Ga0068854_1006630361 | 217 |
| 76 | 3300005614 | Ga0068856_100093010 | Ga0068856_1000930102 | 217 |
| 77 | 3300005618 | Ga0068864_100344065 | Ga0068864_1003440652 | 217 |
| 78 | 3300005840 | Ga0068870_10331509 | Ga0068870_103315092 | 217 |
| 79 | 3300005937 | Ga0081455_10123148 | Ga0081455_101231483 | 217 |
| 80 | 3300006028 | Ga0070717_10053770 | Ga0070717_100537703 | 217 |
| 81 | 3300006028 | Ga0070717_10205681 | Ga0070717_102056811 | 217 |
| 82 | 3300006163 | Ga0070715_10008237 | Ga0070715_100082372 | 217 |
| 83 | 3300006173 | Ga0070716_100022208 | Ga0070716_1000222082 | 217 |
| 84 | 3300006175 | Ga0070712_100033486 | Ga0070712_1000334863 | 217 |
| 85 | 3300006175 | Ga0070712_100114211 | Ga0070712_1001142112 | 217 |
| 86 | 3300006175 | Ga0070712_100283796 | Ga0070712_1002837962 | 217 |
| 87 | 3300006175 | Ga0070712_100364011 | Ga0070712_1003640112 | 217 |
| 88 | 3300006846 | Ga0075430_100082906 | Ga0075430_1000829062 | 217 |
| 89 | 3300006871 | Ga0075434_100181026 | Ga0075434_1001810263 | 217 |
| 90 | 3300006914 | Ga0075436_100000262 | Ga0075436_10000026212 | 217 |
| 91 | 3300009147 | Ga0114129_10083228 | Ga0114129_100832282 | 217 |
| 92 | 3300010375 | Ga0105239_10226695 | Ga0105239_102266952 | 217 |
| 93 | 3300011119 | Ga0105246_10118557 | Ga0105246_101185572 | 217 |
| 94 | 3300013296 | Ga0157374_10248067 | Ga0157374_102480672 | 217 |
| 95 | 3300013296 | Ga0157374_10704275 | Ga0157374_107042752 | 217 |
| 96 | 3300013296 | Ga0157374_10928509 | Ga0157374_109285091 | 217 |
| 97 | 3300013297 | Ga0157378_10013399 | Ga0157378_100133996 | 217 |
| 98 | 3300013307 | Ga0157372_10523820 | Ga0157372_105238202 | 217 |
| 99 | 3300014325 | Ga0163163_10455173 | Ga0163163_104551732 | 217 |
| 100 | 3300014745 | Ga0157377_10311164 | Ga0157377_103111641 | 217 |
| 101 | 3300014969 | Ga0157376_10039722 | Ga0157376_100397224 | 217 |
| 102 | 3300014969 | Ga0157376_10732203 | Ga0157376_107322031 | 217 |
| 103 | 3300025290 | Ga0207673_1007447 | Ga0207673_10074472 | 217 |
| 104 | 3300025315 | Ga0207697_10074480 | Ga0207697_100744802 | 217 |
| 105 | 3300025903 | Ga0207680_10148066 | Ga0207680_101480662 | 217 |
| 106 | 3300025905 | Ga0207685_10010235 | Ga0207685_100102352 | 217 |
| 107 | 3300025910 | Ga0207684_10012300 | Ga0207684_100123003 | 217 |
| 108 | 3300025915 | Ga0207693_10019972 | Ga0207693_100199723 | 217 |
| 109 | 3300025915 | Ga0207693_10203299 | Ga0207693_102032992 | 217 |
| 110 | 3300025915 | Ga0207693_10211232 | Ga0207693_102112322 | 217 |
| 111 | 3300025916 | Ga0207663_10033096 | Ga0207663_100330963 | 217 |
| 112 | 3300025922 | Ga0207646_10021584 | Ga0207646_100215843 | 217 |
| 113 | 3300025927 | Ga0207687_10176229 | Ga0207687_101762292 | 217 |
| 114 | 3300025928 | Ga0207700_10001708 | Ga0207700_100017085 | 217 |
| 115 | 3300025939 | Ga0207665_10026504 | Ga0207665_100265043 | 217 |
| 116 | 3300025939 | Ga0207665_10487148 | Ga0207665_104871481 | 217 |
| 117 | 3300025944 | Ga0207661_10007338 | Ga0207661_100073387 | 217 |
| 118 | 3300025986 | Ga0207658_10817168 | Ga0207658_108171681 | 217 |
| 119 | 3300026035 | Ga0207703_10238303 | Ga0207703_102383032 | 217 |
| 120 | 3300026067 | Ga0207678_10002001 | Ga0207678_100020012 | 217 |
| 121 | 3300026078 | Ga0207702_10026849 | Ga0207702_100268492 | 217 |
| 122 | 3300026121 | Ga0207683_10050814 | Ga0207683_100508142 | 217 |
| 123 | 3300027876 | Ga0209974_10069386 | Ga0209974_100693862 | 217 |
| 124 | 3300028379 | Ga0268266_10033616 | Ga0268266_100336162 | 217 |
| 125 | 3300028381 | Ga0268264_10835103 | Ga0268264_108351032 | 217 |
| 126 | 3300035113 | Ga0373936_0007547 | Ga0373936_0007547_491_1144 | 217 |
| 127 | 3300035119 | Ga0373956_0008798 | Ga0373956_0008798_1347_2000 | 217 |
| 128 | 3300035120 | Ga0373957_0001538 | Ga0373957_0001538_1005_1658 | 217 |
| 129 | 3300035692 | Ga0373935_0014512 | Ga0373935_0014512_1077_1730 | 217 |
| 130 | 3300035725 | Ga0373947_0007146 | Ga0373947_0007146_964_1617 | 217 |
| 131 | 3300036401 | Ga0373937_0068681 | Ga0373937_0068681_1547_2200 | 217 |
| 132 | 3300036401 | Ga0373937_0263203 | Ga0373937_0263203_920_1573 | 217 |
| 133 | 3300037068 | Ga0373925_0517020 | Ga0373925_0517020_146_799 | 217 |
| 134 | 3300037068 | Ga0373925_0824933 | Ga0373925_0824933_53_706 | 217 |
| 135 | 3300042157 | Ga0439458_0016417 | Ga0439458_0016417_385_1038 | 217 |
| 136 | 3300042436 | Ga0439435_0004503 | Ga0439435_0004503_83_736 | 217 |
| 137 | 3300042437 | Ga0439444_0065734 | Ga0439444_0065734_55_708 | 217 |
| 138 | 3300044684 | Ga0466966_0285728 | Ga0466966_0285728_49_702 | 217 |
| 139 | 3300044901 | Ga0466960_0239697 | Ga0466960_0239697_176_958 | 217 |
| 140 | 3300045051 | Ga0451576_0080518 | Ga0451576_0080518_1783_2436 | 217 |
| 141 | 3300046454 | Ga0495592_0392611 | Ga0495592_0392611_174_827 | 217 |
| 142 | 3300046455 | Ga0495603_0214284 | Ga0495603_0214284_206_859 | 217 |
| 143 | 3300046459 | Ga0495629_0003585 | Ga0495629_0003585_919_1572 | 217 |
| 144 | 3300046462 | Ga0495651_0037022 | Ga0495651_0037022_891_1544 | 217 |
| 145 | 3300046462 | Ga0495651_0581787 | Ga0495651_0581787_16_669 | 217 |
| 146 | 3300046472 | Ga0495580_0163642 | Ga0495580_0163642_648_1301 | 217 |
| 147 | 3300046473 | Ga0495582_0002403 | Ga0495582_0002403_1714_2367 | 217 |
| 148 | 3300046476 | Ga0495662_0007891 | Ga0495662_0007891_1517_2170 | 217 |
| 149 | 3300046514 | Ga0495618_0018234 | Ga0495618_0018234_2638_3291 | 217 |
| 150 | 3300046516 | Ga0495628_0497627 | Ga0495628_0497627_174_827 | 217 |
| 151 | 3300046517 | Ga0495630_0300935 | Ga0495630_0300935_519_1172 | 217 |
| 152 | 3300046526 | Ga0495666_0036847 | Ga0495666_0036847_1432_2085 | 217 |
| 153 | 3300046531 | Ga0495665_0008753 | Ga0495665_0008753_4669_5322 | 217 |
| 154 | 3300046533 | Ga0495640_0018232 | Ga0495640_0018232_2178_2831 | 217 |
| 155 | 3300046535 | Ga0495586_0043597 | Ga0495586_0043597_52_705 | 217 |
| 156 | 3300046536 | Ga0495587_0008658 | Ga0495587_0008658_4910_5563 | 217 |
| 157 | 3300046543 | Ga0495645_0066433 | Ga0495645_0066433_296_949 | 217 |
| 158 | 3300046559 | Ga0495667_0022160 | Ga0495667_0022160_2517_3170 | 217 |
| 159 | 3300046642 | Ga0495634_0007957 | Ga0495634_0007957_4501_5154 | 217 |
| 160 | 3300046642 | Ga0495634_0223302 | Ga0495634_0223302_361_1014 | 217 |
| 161 | 3300046663 | Ga0495635_0395775 | Ga0495635_0395775_88_741 | 217 |
| 162 | 3300046675 | Ga0495657_0012718 | Ga0495657_0012718_3370_4023 | 217 |
| 163 | 3300046679 | Ga0495623_0175327 | Ga0495623_0175327_301_954 | 217 |
| 164 | 3300046683 | Ga0495658_0014068 | Ga0495658_0014068_978_1631 | 217 |
| 165 | 3300046683 | Ga0495658_0553662 | Ga0495658_0553662_52_705 | 217 |
| 166 | 3300046689 | Ga0495613_0015917 | Ga0495613_0015917_301_954 | 217 |
| 167 | 3300046689 | Ga0495613_0154256 | Ga0495613_0154256_967_1620 | 217 |
| 168 | 3300046690 | Ga0495624_0006919 | Ga0495624_0006919_2908_3561 | 217 |
| 169 | 3300046690 | Ga0495624_0229357 | Ga0495624_0229357_320_973 | 217 |
| 170 | 3300046809 | Ga0495600_0024425 | Ga0495600_0024425_603_1256 | 217 |
| 171 | 3300047315 | Ga0495581_0100813 | Ga0495581_0100813_295_948 | 217 |
| 172 | 3300047321 | Ga0495676_0267646 | Ga0495676_0267646_189_842 | 217 |
| 173 | 3300047322 | Ga0495680_0068616 | Ga0495680_0068616_1019_1672 | 217 |
| 174 | 3300047471 | Ga0495684_0008374 | Ga0495684_0008374_4042_4695 | 217 |
| 175 | 3300047471 | Ga0495684_0461515 | Ga0495684_0461515_174_827 | 217 |
| 176 | 3300047673 | Ga0495593_0007543 | Ga0495593_0007543_4371_5024 | 217 |
| 177 | 3300047673 | Ga0495593_0234396 | Ga0495593_0234396_42_695 | 217 |
| 178 | 3300048088 | Ga0495602_0059412 | Ga0495602_0059412_302_955 | 217 |
| 179 | 3300048088 | Ga0495602_0095371 | Ga0495602_0095371_1483_2136 | 217 |
| 180 | 3300048905 | Ga0496102_0250887 | Ga0496102_0250887_960_1613 | 217 |
| 181 | 3300048907 | Ga0496104_0026940 | Ga0496104_0026940_3481_4134 | 217 |
| 182 | 3300048908 | Ga0496105_0031670 | Ga0496105_0031670_1513_2166 | 217 |
| 183 | 3300048908 | Ga0496105_0106800 | Ga0496105_0106800_50_703 | 217 |
| 184 | 3300048908 | Ga0496105_0411425 | Ga0496105_0411425_122_775 | 217 |
| 185 | 3300048911 | Ga0496108_0429483 | Ga0496108_0429483_22_675 | 217 |
| 186 | 3300048911 | Ga0496108_0775645 | Ga0496108_0775645_98_751 | 217 |
| 187 | 3300048912 | Ga0496109_0115733 | Ga0496109_0115733_1100_1753 | 217 |
| 188 | 3300048917 | Ga0496114_0033322 | Ga0496114_0033322_3460_4113 | 217 |
| 189 | 3300048918 | Ga0496115_0055305 | Ga0496115_0055305_2013_2666 | 217 |
| 190 | 3300049583 | Ga0501067_0018620 | Ga0501067_0018620_2329_2982 | 217 |
| 191 | 3300049585 | Ga0501069_0005726 | Ga0501069_0005726_2746_3399 | 217 |
| 192 | 3300050507 | nmdc:mga05p37_251953_c1 | nmdc:mga05p37_251953_c1_1350_2003 | 217 |
| 193 | 3300050512 | nmdc:mga0n895_293222_c1 | nmdc:mga0n895_293222_c1_19_672 | 217 |
| 194 | 3300050514 | nmdc:mga08x19_453_c1 | nmdc:mga08x19_453_c1_27021_27674 | 217 |
| 195 | 3300053077 | Ga0495601_0137572 | Ga0495601_0137572_891_1544 | 217 |
| 196 | 3300053077 | Ga0495601_0444194 | Ga0495601_0444194_174_827 | 217 |
| 197 | 3300053084 | Ga0495595_0013680 | Ga0495595_0013680_22_675 | 217 |
| 198 | 3300053084 | Ga0495595_0068086 | Ga0495595_0068086_642_1295 | 217 |
| 199 | 3300053085 | Ga0495619_0024111 | Ga0495619_0024111_2219_2872 | 217 |
| 200 | 3300005327 | Ga0070658_10149875 | Ga0070658_101498753 | 218 |
| 201 | 3300005327 | Ga0070658_10158544 | Ga0070658_101585442 | 218 |
| 202 | 3300005328 | Ga0070676_10162115 | Ga0070676_101621152 | 218 |
| 203 | 3300005329 | Ga0070683_100025751 | Ga0070683_1000257512 | 218 |
| 204 | 3300005329 | Ga0070683_100103425 | Ga0070683_1001034252 | 218 |
| 205 | 3300005336 | Ga0070680_100014149 | Ga0070680_1000141494 | 218 |
| 206 | 3300005336 | Ga0070680_100257606 | Ga0070680_1002576062 | 218 |
| 207 | 3300005339 | Ga0070660_100002826 | Ga0070660_10000282610 | 218 |
| 208 | 3300005339 | Ga0070660_100498792 | Ga0070660_1004987922 | 218 |
| 209 | 3300005344 | Ga0070661_100073409 | Ga0070661_1000734093 | 218 |
| 210 | 3300005344 | Ga0070661_100144694 | Ga0070661_1001446941 | 218 |
| 211 | 3300005345 | Ga0070692_10299253 | Ga0070692_102992531 | 218 |
| 212 | 3300005347 | Ga0070668_100140883 | Ga0070668_1001408832 | 218 |
| 213 | 3300005353 | Ga0070669_100051452 | Ga0070669_1000514523 | 218 |
| 214 | 3300005353 | Ga0070669_100107050 | Ga0070669_1001070501 | 218 |
| 215 | 3300005367 | Ga0070667_100683478 | Ga0070667_1006834782 | 218 |
| 216 | 3300005435 | Ga0070714_100006242 | Ga0070714_1000062422 | 218 |
| 217 | 3300005435 | Ga0070714_100061341 | Ga0070714_1000613413 | 218 |
| 218 | 3300005435 | Ga0070714_100245371 | Ga0070714_1002453712 | 218 |
| 219 | 3300005436 | Ga0070713_100000082 | Ga0070713_10000008240 | 218 |
| 220 | 3300005436 | Ga0070713_100014989 | Ga0070713_1000149893 | 218 |
| 221 | 3300005436 | Ga0070713_100041798 | Ga0070713_1000417982 | 218 |
| 222 | 3300005437 | Ga0070710_10078099 | Ga0070710_100780992 | 218 |
| 223 | 3300005439 | Ga0070711_100005906 | Ga0070711_1000059064 | 218 |
| 224 | 3300005439 | Ga0070711_100167351 | Ga0070711_1001673512 | 218 |
| 225 | 3300005440 | Ga0070705_100199479 | Ga0070705_1001994791 | 218 |
| 226 | 3300005441 | Ga0070700_100189042 | Ga0070700_1001890422 | 218 |
| 227 | 3300005444 | Ga0070694_100013180 | Ga0070694_1000131805 | 218 |
| 228 | 3300005445 | Ga0070708_100000591 | Ga0070708_10000059125 | 218 |
| 229 | 3300005445 | Ga0070708_100005942 | Ga0070708_1000059426 | 218 |
| 230 | 3300005445 | Ga0070708_100024431 | Ga0070708_1000244313 | 218 |
| 231 | 3300005445 | Ga0070708_100639337 | Ga0070708_1006393372 | 218 |
| 232 | 3300005457 | Ga0070662_100673803 | Ga0070662_1006738031 | 218 |
| 233 | 3300005458 | Ga0070681_10027219 | Ga0070681_100272194 | 218 |
| 234 | 3300005458 | Ga0070681_10041200 | Ga0070681_100412003 | 218 |
| 235 | 3300005467 | Ga0070706_100009021 | Ga0070706_1000090214 | 218 |
| 236 | 3300005467 | Ga0070706_100026212 | Ga0070706_1000262122 | 218 |
| 237 | 3300005467 | Ga0070706_100053581 | Ga0070706_1000535812 | 218 |
| 238 | 3300005468 | Ga0070707_100006204 | Ga0070707_1000062047 | 218 |
| 239 | 3300005468 | Ga0070707_100019118 | Ga0070707_1000191188 | 218 |
| 240 | 3300005468 | Ga0070707_100196087 | Ga0070707_1001960872 | 218 |
| 241 | 3300005471 | Ga0070698_100001665 | Ga0070698_10000166514 | 218 |
| 242 | 3300005471 | Ga0070698_100003182 | Ga0070698_1000031825 | 218 |
| 243 | 3300005471 | Ga0070698_100009752 | Ga0070698_1000097522 | 218 |
| 244 | 3300005471 | Ga0070698_100012150 | Ga0070698_1000121505 | 218 |
| 245 | 3300005518 | Ga0070699_100276844 | Ga0070699_1002768442 | 218 |
| 246 | 3300005518 | Ga0070699_100297810 | Ga0070699_1002978103 | 218 |
| 247 | 3300005530 | Ga0070679_100023466 | Ga0070679_1000234668 | 218 |
| 248 | 3300005530 | Ga0070679_100614799 | Ga0070679_1006147991 | 218 |
| 249 | 3300005535 | Ga0070684_100041997 | Ga0070684_1000419976 | 218 |
| 250 | 3300005536 | Ga0070697_100065932 | Ga0070697_1000659323 | 218 |
| 251 | 3300005545 | Ga0070695_100113218 | Ga0070695_1001132182 | 218 |
| 252 | 3300005547 | Ga0070693_100024784 | Ga0070693_1000247845 | 218 |
| 253 | 3300005548 | Ga0070665_100033882 | Ga0070665_1000338825 | 218 |
| 254 | 3300005563 | Ga0068855_100019205 | Ga0068855_1000192053 | 218 |
| 255 | 3300005563 | Ga0068855_100040999 | Ga0068855_1000409992 | 218 |
| 256 | 3300005563 | Ga0068855_100157753 | Ga0068855_1001577532 | 218 |
| 257 | 3300005563 | Ga0068855_100239215 | Ga0068855_1002392152 | 218 |
| 258 | 3300005563 | Ga0068855_100338539 | Ga0068855_1003385392 | 218 |
| 259 | 3300005615 | Ga0070702_100067488 | Ga0070702_1000674881 | 218 |
| 260 | 3300005616 | Ga0068852_100320332 | Ga0068852_1003203322 | 218 |
| 261 | 3300005618 | Ga0068864_100069399 | Ga0068864_1000693993 | 218 |
| 262 | 3300005718 | Ga0068866_10378935 | Ga0068866_103789352 | 218 |
| 263 | 3300005719 | Ga0068861_100075446 | Ga0068861_1000754462 | 218 |
| 264 | 3300005841 | Ga0068863_100601007 | Ga0068863_1006010072 | 218 |
| 265 | 3300005843 | Ga0068860_100415631 | Ga0068860_1004156312 | 218 |
| 266 | 3300005844 | Ga0068862_100051631 | Ga0068862_1000516312 | 218 |
| 267 | 3300005844 | Ga0068862_100206612 | Ga0068862_1002066122 | 218 |
| 268 | 3300005937 | Ga0081455_10292865 | Ga0081455_102928652 | 218 |
| 269 | 3300005985 | Ga0081539_10157753 | Ga0081539_101577532 | 218 |
| 270 | 3300006028 | Ga0070717_10028432 | Ga0070717_100284324 | 218 |
| 271 | 3300006028 | Ga0070717_10080610 | Ga0070717_100806103 | 218 |
| 272 | 3300006028 | Ga0070717_10126030 | Ga0070717_101260302 | 218 |
| 273 | 3300006048 | Ga0075363_100216879 | Ga0075363_1002168791 | 218 |
| 274 | 3300006175 | Ga0070712_100058375 | Ga0070712_1000583753 | 218 |
| 275 | 3300006175 | Ga0070712_100245177 | Ga0070712_1002451772 | 218 |
| 276 | 3300006175 | Ga0070712_100638582 | Ga0070712_1006385822 | 218 |
| 277 | 3300006852 | Ga0075433_10001917 | Ga0075433_1000191714 | 218 |
| 278 | 3300006871 | Ga0075434_100409738 | Ga0075434_1004097381 | 218 |
| 279 | 3300006871 | Ga0075434_101307536 | Ga0075434_1013075361 | 218 |
| 280 | 3300006880 | Ga0075429_100193489 | Ga0075429_1001934892 | 218 |
| 281 | 3300006881 | Ga0068865_100061825 | Ga0068865_1000618252 | 218 |
| 282 | 3300009093 | Ga0105240_10066347 | Ga0105240_100663471 | 218 |
| 283 | 3300009093 | Ga0105240_10067377 | Ga0105240_100673773 | 218 |
| 284 | 3300009098 | Ga0105245_10355423 | Ga0105245_103554232 | 218 |
| 285 | 3300009098 | Ga0105245_10689161 | Ga0105245_106891612 | 218 |
| 286 | 3300009147 | Ga0114129_10084319 | Ga0114129_100843194 | 218 |
| 287 | 3300009147 | Ga0114129_10233255 | Ga0114129_102332551 | 218 |
| 288 | 3300009147 | Ga0114129_10284406 | Ga0114129_102844063 | 218 |
| 289 | 3300009176 | Ga0105242_10902046 | Ga0105242_109020461 | 218 |
| 290 | 3300009545 | Ga0105237_10517365 | Ga0105237_105173652 | 218 |
| 291 | 3300009553 | Ga0105249_10257461 | Ga0105249_102574612 | 218 |
| 292 | 3300010375 | Ga0105239_10184345 | Ga0105239_101843452 | 218 |
| 293 | 3300010375 | Ga0105239_10230433 | Ga0105239_102304332 | 218 |
| 294 | 3300013102 | Ga0157371_10517536 | Ga0157371_105175361 | 218 |
| 295 | 3300013104 | Ga0157370_10014605 | Ga0157370_100146057 | 218 |
| 296 | 3300013105 | Ga0157369_10108960 | Ga0157369_101089602 | 218 |
| 297 | 3300013105 | Ga0157369_10396272 | Ga0157369_103962722 | 218 |
| 298 | 3300013105 | Ga0157369_10411519 | Ga0157369_104115193 | 218 |
| 299 | 3300013296 | Ga0157374_10134360 | Ga0157374_101343603 | 218 |
| 300 | 3300013297 | Ga0157378_10258498 | Ga0157378_102584982 | 218 |
| 301 | 3300013307 | Ga0157372_11543382 | Ga0157372_115433821 | 218 |
| 302 | 3300013308 | Ga0157375_10247379 | Ga0157375_102473794 | 218 |
| 303 | 3300014968 | Ga0157379_10427843 | Ga0157379_104278432 | 218 |
| 304 | 3300017792 | Ga0163161_10087384 | Ga0163161_100873842 | 218 |
| 305 | 3300020070 | Ga0206356_11200080 | Ga0206356_112000801 | 218 |
| 306 | 3300020070 | Ga0206356_11423237 | Ga0206356_114232375 | 218 |
| 307 | 3300020076 | Ga0206355_1410940 | Ga0206355_14109402 | 218 |
| 308 | 3300020077 | Ga0206351_10822550 | Ga0206351_108225501 | 218 |
| 309 | 3300020078 | Ga0206352_10800806 | Ga0206352_108008062 | 218 |
| 310 | 3300020080 | Ga0206350_10616182 | Ga0206350_106161821 | 218 |
| 311 | 3300020080 | Ga0206350_11571218 | Ga0206350_115712181 | 218 |
| 312 | 3300020082 | Ga0206353_11285308 | Ga0206353_112853081 | 218 |
| 313 | 3300021388 | Ga0213875_10030019 | Ga0213875_100300192 | 218 |
| 314 | 3300021388 | Ga0213875_10185488 | Ga0213875_101854882 | 218 |
| 315 | 3300022467 | Ga0224712_10054936 | Ga0224712_100549362 | 218 |
| 316 | 3300025245 | Ga0207425_1000010 | Ga0207425_1000010286 | 218 |
| 317 | 3300025258 | Ga0209129_1000034 | Ga0209129_100003455 | 218 |
| 318 | 3300025258 | Ga0209129_1016139 | Ga0209129_10161392 | 218 |
| 319 | 3300025273 | Ga0209673_1016968 | Ga0209673_10169681 | 218 |
| 320 | 3300025294 | Ga0209025_1000022 | Ga0209025_1000022296 | 218 |
| 321 | 3300025295 | Ga0209564_1017939 | Ga0209564_10179394 | 218 |
| 322 | 3300025297 | Ga0209758_1000080 | Ga0209758_1000080225 | 218 |
| 323 | 3300025303 | Ga0209051_1003299 | Ga0209051_100329910 | 218 |
| 324 | 3300025898 | Ga0207692_10012797 | Ga0207692_100127972 | 218 |
| 325 | 3300025899 | Ga0207642_10397071 | Ga0207642_103970711 | 218 |
| 326 | 3300025909 | Ga0207705_10059268 | Ga0207705_100592684 | 218 |
| 327 | 3300025909 | Ga0207705_10080866 | Ga0207705_100808662 | 218 |
| 328 | 3300025910 | Ga0207684_10001612 | Ga0207684_100016128 | 218 |
| 329 | 3300025910 | Ga0207684_10003745 | Ga0207684_1000374511 | 218 |
| 330 | 3300025910 | Ga0207684_10016316 | Ga0207684_100163162 | 218 |
| 331 | 3300025910 | Ga0207684_10536785 | Ga0207684_105367852 | 218 |
| 332 | 3300025912 | Ga0207707_10029690 | Ga0207707_100296902 | 218 |
| 333 | 3300025912 | Ga0207707_10079930 | Ga0207707_100799302 | 218 |
| 334 | 3300025913 | Ga0207695_10058643 | Ga0207695_100586432 | 218 |
| 335 | 3300025913 | Ga0207695_10315814 | Ga0207695_103158142 | 218 |
| 336 | 3300025915 | Ga0207693_10129786 | Ga0207693_101297862 | 218 |
| 337 | 3300025915 | Ga0207693_10232135 | Ga0207693_102321351 | 218 |
| 338 | 3300025916 | Ga0207663_10016574 | Ga0207663_100165741 | 218 |
| 339 | 3300025916 | Ga0207663_10271893 | Ga0207663_102718931 | 218 |
| 340 | 3300025916 | Ga0207663_10293832 | Ga0207663_102938321 | 218 |
| 341 | 3300025917 | Ga0207660_10051037 | Ga0207660_100510371 | 218 |
| 342 | 3300025917 | Ga0207660_10234018 | Ga0207660_102340182 | 218 |
| 343 | 3300025917 | Ga0207660_10875937 | Ga0207660_108759371 | 218 |
| 344 | 3300025919 | Ga0207657_10001151 | Ga0207657_100011513 | 218 |
| 345 | 3300025919 | Ga0207657_10223985 | Ga0207657_102239853 | 218 |
| 346 | 3300025919 | Ga0207657_10330489 | Ga0207657_103304892 | 218 |
| 347 | 3300025920 | Ga0207649_10120990 | Ga0207649_101209902 | 218 |
| 348 | 3300025921 | Ga0207652_10034811 | Ga0207652_100348115 | 218 |
| 349 | 3300025921 | Ga0207652_10161585 | Ga0207652_101615852 | 218 |
| 350 | 3300025922 | Ga0207646_10002603 | Ga0207646_1000260312 | 218 |
| 351 | 3300025922 | Ga0207646_10005499 | Ga0207646_100054994 | 218 |
| 352 | 3300025922 | Ga0207646_10018766 | Ga0207646_100187666 | 218 |
| 353 | 3300025923 | Ga0207681_10043337 | Ga0207681_100433373 | 218 |
| 354 | 3300025923 | Ga0207681_10060952 | Ga0207681_100609523 | 218 |
| 355 | 3300025926 | Ga0207659_10310614 | Ga0207659_103106142 | 218 |
| 356 | 3300025928 | Ga0207700_10000495 | Ga0207700_1000049516 | 218 |
| 357 | 3300025928 | Ga0207700_10006711 | Ga0207700_100067117 | 218 |
| 358 | 3300025928 | Ga0207700_10021242 | Ga0207700_100212423 | 218 |
| 359 | 3300025928 | Ga0207700_10379976 | Ga0207700_103799762 | 218 |
| 360 | 3300025928 | Ga0207700_10448107 | Ga0207700_104481072 | 218 |
| 361 | 3300025929 | Ga0207664_10393164 | Ga0207664_103931642 | 218 |
| 362 | 3300025929 | Ga0207664_10565907 | Ga0207664_105659071 | 218 |
| 363 | 3300025938 | Ga0207704_10395652 | Ga0207704_103956522 | 218 |
| 364 | 3300025939 | Ga0207665_10014600 | Ga0207665_100146005 | 218 |
| 365 | 3300025939 | Ga0207665_10109420 | Ga0207665_101094202 | 218 |
| 366 | 3300025940 | Ga0207691_10400166 | Ga0207691_104001662 | 218 |
| 367 | 3300025944 | Ga0207661_10126170 | Ga0207661_101261702 | 218 |
| 368 | 3300025949 | Ga0207667_10187034 | Ga0207667_101870342 | 218 |
| 369 | 3300025949 | Ga0207667_10212620 | Ga0207667_102126203 | 218 |
| 370 | 3300025949 | Ga0207667_10432725 | Ga0207667_104327252 | 218 |
| 371 | 3300025949 | Ga0207667_11015163 | Ga0207667_110151631 | 218 |
| 372 | 3300025972 | Ga0207668_10036843 | Ga0207668_100368433 | 218 |
| 373 | 3300025986 | Ga0207658_10599829 | Ga0207658_105998291 | 218 |
| 374 | 3300026023 | Ga0207677_10338269 | Ga0207677_103382692 | 218 |
| 375 | 3300026067 | Ga0207678_10071991 | Ga0207678_100719911 | 218 |
| 376 | 3300026075 | Ga0207708_10238797 | Ga0207708_102387972 | 218 |
| 377 | 3300026095 | Ga0207676_10093139 | Ga0207676_100931392 | 218 |
| 378 | 3300026118 | Ga0207675_100147270 | Ga0207675_1001472702 | 218 |
| 379 | 3300026121 | Ga0207683_10175152 | Ga0207683_101751522 | 218 |
| 380 | 3300028379 | Ga0268266_10033885 | Ga0268266_100338855 | 218 |
| 381 | 3300028379 | Ga0268266_10211834 | Ga0268266_102118342 | 218 |
| 382 | 3300028380 | Ga0268265_10123606 | Ga0268265_101236062 | 218 |
| 383 | 3300028381 | Ga0268264_10077185 | Ga0268264_100771852 | 218 |
| 384 | 3300028577 | Ga0265318_10053413 | Ga0265318_100534132 | 218 |
| 385 | 3300031247 | Ga0265340_10046072 | Ga0265340_100460721 | 218 |
| 386 | 3300031731 | Ga0307405_10001892 | Ga0307405_100018925 | 218 |
| 387 | 3300031911 | Ga0307412_10027123 | Ga0307412_100271233 | 218 |
| 388 | 3300031995 | Ga0307409_100214464 | Ga0307409_1002144641 | 218 |
| 389 | 3300032002 | Ga0307416_100043186 | Ga0307416_1000431862 | 218 |
| 390 | 3300035083 | Ga0373926_0057098 | Ga0373926_0057098_248_913 | 218 |
| 391 | 3300035086 | Ga0373934_0005878 | Ga0373934_0005878_1100_1756 | 218 |
| 392 | 3300035089 | Ga0373944_0000572 | Ga0373944_0000572_776_1441 | 218 |
| 393 | 3300035113 | Ga0373936_0001965 | Ga0373936_0001965_130_795 | 218 |
| 394 | 3300035113 | Ga0373936_0016728 | Ga0373936_0016728_246_902 | 218 |
| 395 | 3300035113 | Ga0373936_0078679 | Ga0373936_0078679_326_982 | 218 |
| 396 | 3300035116 | Ga0373945_0000063 | Ga0373945_0000063_13506_14171 | 218 |
| 397 | 3300035117 | Ga0373953_0011879 | Ga0373953_0011879_1437_2093 | 218 |
| 398 | 3300035118 | Ga0373954_0254508 | Ga0373954_0254508_187_843 | 218 |
| 399 | 3300035120 | Ga0373957_0030952 | Ga0373957_0030952_1074_1730 | 218 |
| 400 | 3300035170 | Ga0373943_0004489 | Ga0373943_0004489_4051_4707 | 218 |
| 401 | 3300035171 | Ga0373946_0000960 | Ga0373946_0000960_6914_7579 | 218 |
| 402 | 3300035171 | Ga0373946_0086188 | Ga0373946_0086188_396_1052 | 218 |
| 403 | 3300035172 | Ga0373955_0025435 | Ga0373955_0025435_1284_1940 | 218 |
| 404 | 3300035410 | Ga0373924_0001176 | Ga0373924_0001176_4097_4753 | 218 |
| 405 | 3300035410 | Ga0373924_0029532 | Ga0373924_0029532_517_1176 | 218 |
| 406 | 3300035692 | Ga0373935_0000853 | Ga0373935_0000853_13720_14385 | 218 |
| 407 | 3300035692 | Ga0373935_0143482 | Ga0373935_0143482_926_1582 | 218 |
| 408 | 3300035695 | Ga0373927_0001934 | Ga0373927_0001934_8879_9544 | 218 |
| 409 | 3300035695 | Ga0373927_0303279 | Ga0373927_0303279_167_823 | 218 |
| 410 | 3300035724 | Ga0373933_0026513 | Ga0373933_0026513_1573_2229 | 218 |
| 411 | 3300035725 | Ga0373947_0000952 | Ga0373947_0000952_10929_11594 | 218 |
| 412 | 3300035725 | Ga0373947_0023489 | Ga0373947_0023489_2380_3036 | 218 |
| 413 | 3300035725 | Ga0373947_0397961 | Ga0373947_0397961_186_860 | 218 |
| 414 | 3300036401 | Ga0373937_0032444 | Ga0373937_0032444_2982_3638 | 218 |
| 415 | 3300036401 | Ga0373937_0049470 | Ga0373937_0049470_50_730 | 218 |
| 416 | 3300037068 | Ga0373925_0007011 | Ga0373925_0007011_2667_3332 | 218 |
| 417 | 3300037068 | Ga0373925_0023535 | Ga0373925_0023535_3131_3787 | 218 |
| 418 | 3300037068 | Ga0373925_0626554 | Ga0373925_0626554_79_735 | 218 |
| 419 | 3300037312 | Ga0395899_0002594 | Ga0395899_0002594_7036_7692 | 218 |
| 420 | 3300037312 | Ga0395899_0004284 | Ga0395899_0004284_4307_4990 | 218 |
| 421 | 3300037312 | Ga0395899_0005207 | Ga0395899_0005207_3404_4060 | 218 |
| 422 | 3300037312 | Ga0395899_0013064 | Ga0395899_0013064_5468_6124 | 218 |
| 423 | 3300037312 | Ga0395899_0043707 | Ga0395899_0043707_2659_3315 | 218 |
| 424 | 3300037312 | Ga0395899_0222945 | Ga0395899_0222945_159_815 | 218 |
| 425 | 3300037312 | Ga0395899_0524011 | Ga0395899_0524011_23_679 | 218 |
| 426 | 3300037418 | Ga0395900_0002349 | Ga0395900_0002349_17263_17919 | 218 |
| 427 | 3300037418 | Ga0395900_0005752 | Ga0395900_0005752_7140_7796 | 218 |
| 428 | 3300037418 | Ga0395900_0025418 | Ga0395900_0025418_1793_2449 | 218 |
| 429 | 3300037418 | Ga0395900_0177898 | Ga0395900_0177898_1231_1887 | 218 |
| 430 | 3300037418 | Ga0395900_0233809 | Ga0395900_0233809_204_860 | 218 |
| 431 | 3300037466 | Ga0395898_0000723 | Ga0395898_0000723_4147_4803 | 218 |
| 432 | 3300037466 | Ga0395898_0006846 | Ga0395898_0006846_5196_5879 | 218 |
| 433 | 3300037466 | Ga0395898_0015393 | Ga0395898_0015393_1365_2021 | 218 |
| 434 | 3300037466 | Ga0395898_0040585 | Ga0395898_0040585_3500_4156 | 218 |
| 435 | 3300037466 | Ga0395898_0045376 | Ga0395898_0045376_2129_2785 | 218 |
| 436 | 3300037466 | Ga0395898_0073156 | Ga0395898_0073156_741_1397 | 218 |
| 437 | 3300037466 | Ga0395898_0169129 | Ga0395898_0169129_1287_1943 | 218 |
| 438 | 3300037466 | Ga0395898_0435956 | Ga0395898_0435956_384_1040 | 218 |
| 439 | 3300037466 | Ga0395898_0708221 | Ga0395898_0708221_34_708 | 218 |
| 440 | 3300037471 | Ga0395905_0001654 | Ga0395905_0001654_10106_10762 | 218 |
| 441 | 3300037471 | Ga0395905_0006660 | Ga0395905_0006660_7624_8280 | 218 |
| 442 | 3300037471 | Ga0395905_0016600 | Ga0395905_0016600_4649_5305 | 218 |
| 443 | 3300037471 | Ga0395905_0046735 | Ga0395905_0046735_239_928 | 218 |
| 444 | 3300037471 | Ga0395905_0066264 | Ga0395905_0066264_250_906 | 218 |
| 445 | 3300037853 | Ga0436364_0241003 | Ga0436364_0241003_209_865 | 218 |
| 446 | 3300037853 | Ga0436364_0477471 | Ga0436364_0477471_315_971 | 218 |
| 447 | 3300037853 | Ga0436364_0746810 | Ga0436364_0746810_1503_2159 | 218 |
| 448 | 3300037853 | Ga0436364_0814406 | Ga0436364_0814406_368_1024 | 218 |
| 449 | 3300037853 | Ga0436364_1093749 | Ga0436364_1093749_3990_4646 | 218 |
| 450 | 3300038443 | Ga0395901_0001895 | Ga0395901_0001895_3633_4289 | 218 |
| 451 | 3300038443 | Ga0395901_0006183 | Ga0395901_0006183_8449_9105 | 218 |
| 452 | 3300038443 | Ga0395901_0017952 | Ga0395901_0017952_3539_4195 | 218 |
| 453 | 3300038443 | Ga0395901_0029170 | Ga0395901_0029170_3314_3997 | 218 |
| 454 | 3300038443 | Ga0395901_0036453 | Ga0395901_0036453_1272_1928 | 218 |
| 455 | 3300038443 | Ga0395901_0037977 | Ga0395901_0037977_438_1094 | 218 |
| 456 | 3300038443 | Ga0395901_0068301 | Ga0395901_0068301_1507_2163 | 218 |
| 457 | 3300038443 | Ga0395901_0108335 | Ga0395901_0108335_1435_2091 | 218 |
| 458 | 3300038443 | Ga0395901_0230163 | Ga0395901_0230163_565_1254 | 218 |
| 459 | 3300038443 | Ga0395901_0517071 | Ga0395901_0517071_107_763 | 218 |
| 460 | 3300039437 | Ga0436365_0607389 | Ga0436365_0607389_170_826 | 218 |
| 461 | 3300039447 | Ga0436361_0287188 | Ga0436361_0287188_890_1546 | 218 |
| 462 | 3300039450 | Ga0436363_0055457 | Ga0436363_0055457_404_1060 | 218 |
| 463 | 3300039450 | Ga0436363_0883032 | Ga0436363_0883032_1192_1848 | 218 |
| 464 | 3300039450 | Ga0436363_1548335 | Ga0436363_1548335_805_1461 | 218 |
| 465 | 3300039453 | Ga0436362_0488184 | Ga0436362_0488184_121_780 | 218 |
| 466 | 3300041459 | Ga0451800_1069473 | Ga0451800_1069473_533_1207 | 218 |
| 467 | 3300041999 | Ga0439433_0008716 | Ga0439433_0008716_894_1550 | 218 |
| 468 | 3300042002 | Ga0439442_049845 | Ga0439442_049845_132_791 | 218 |
| 469 | 3300042003 | Ga0439443_008924 | Ga0439443_008924_692_1348 | 218 |
| 470 | 3300042007 | Ga0439449_0001825 | Ga0439449_0001825_1196_1852 | 218 |
| 471 | 3300042014 | Ga0439457_017883 | Ga0439457_017883_256_915 | 218 |
| 472 | 3300044683 | Ga0466965_0352817 | Ga0466965_0352817_72_728 | 218 |
| 473 | 3300044684 | Ga0466966_0123662 | Ga0466966_0123662_505_1161 | 218 |
| 474 | 3300044684 | Ga0466966_0134402 | Ga0466966_0134402_134_790 | 218 |
| 475 | 3300044693 | Ga0466961_0006650 | Ga0466961_0006650_2164_2820 | 218 |
| 476 | 3300044693 | Ga0466961_0019811 | Ga0466961_0019811_2508_3164 | 218 |
| 477 | 3300044693 | Ga0466961_0247945 | Ga0466961_0247945_244_927 | 218 |
| 478 | 3300044694 | Ga0466963_0038829 | Ga0466963_0038829_326_982 | 218 |
| 479 | 3300044694 | Ga0466963_0485373 | Ga0466963_0485373_204_860 | 218 |
| 480 | 3300044706 | Ga0466964_0033357 | Ga0466964_0033357_409_1065 | 218 |
| 481 | 3300044706 | Ga0466964_0043162 | Ga0466964_0043162_928_1602 | 218 |
| 482 | 3300044765 | Ga0466970_0034219 | Ga0466970_0034219_189_845 | 218 |
| 483 | 3300044842 | Ga0466957_0141990 | Ga0466957_0141990_123_782 | 218 |
| 484 | 3300044842 | Ga0466957_0242800 | Ga0466957_0242800_290_946 | 218 |
| 485 | 3300044842 | Ga0466957_0751384 | Ga0466957_0751384_23_679 | 218 |
| 486 | 3300044901 | Ga0466960_0138646 | Ga0466960_0138646_95_751 | 218 |
| 487 | 3300045049 | Ga0466959_0008855 | Ga0466959_0008855_198_854 | 218 |
| 488 | 3300045049 | Ga0466959_0102586 | Ga0466959_0102586_429_1085 | 218 |
| 489 | 3300045049 | Ga0466959_0206963 | Ga0466959_0206963_180_857 | 218 |
| 490 | 3300045836 | Ga0466958_0026318 | Ga0466958_0026318_202_858 | 218 |
| 491 | 3300045836 | Ga0466958_0231418 | Ga0466958_0231418_278_934 | 218 |
| 492 | 3300045976 | Ga0466967_0094525 | Ga0466967_0094525_1054_1710 | 218 |
| 493 | 3300045976 | Ga0466967_0114184 | Ga0466967_0114184_1088_1744 | 218 |
| 494 | 3300045976 | Ga0466967_0118255 | Ga0466967_0118255_1086_1742 | 218 |
| 495 | 3300045976 | Ga0466967_0441083 | Ga0466967_0441083_398_1054 | 218 |
| 496 | 3300045976 | Ga0466967_0729485 | Ga0466967_0729485_299_955 | 218 |
| 497 | 3300045976 | Ga0466967_0755429 | Ga0466967_0755429_89_763 | 218 |
| 498 | 3300046459 | Ga0495629_0231257 | Ga0495629_0231257_24_680 | 218 |
| 499 | 3300046459 | Ga0495629_0337578 | Ga0495629_0337578_218_874 | 218 |
| 500 | 3300046461 | Ga0495641_0013375 | Ga0495641_0013375_3365_4030 | 218 |
| 501 | 3300046461 | Ga0495641_0016836 | Ga0495641_0016836_1342_1998 | 218 |
| 502 | 3300046461 | Ga0495641_0019613 | Ga0495641_0019613_2151_2807 | 218 |
| 503 | 3300046462 | Ga0495651_0007255 | Ga0495651_0007255_6633_7313 | 218 |
| 504 | 3300046462 | Ga0495651_0010663 | Ga0495651_0010663_6041_6706 | 218 |
| 505 | 3300046463 | Ga0495653_0002608 | Ga0495653_0002608_11576_12241 | 218 |
| 506 | 3300046463 | Ga0495653_0164048 | Ga0495653_0164048_676_1356 | 218 |
| 507 | 3300046472 | Ga0495580_0011599 | Ga0495580_0011599_1832_2488 | 218 |
| 508 | 3300046473 | Ga0495582_0074538 | Ga0495582_0074538_912_1568 | 218 |
| 509 | 3300046473 | Ga0495582_0426708 | Ga0495582_0426708_26_682 | 218 |
| 510 | 3300046475 | Ga0495639_0012994 | Ga0495639_0012994_2233_2889 | 218 |
| 511 | 3300046475 | Ga0495639_0031004 | Ga0495639_0031004_1096_1761 | 218 |
| 512 | 3300046476 | Ga0495662_0003915 | Ga0495662_0003915_2574_3230 | 218 |
| 513 | 3300046477 | Ga0495664_0000220 | Ga0495664_0000220_7996_8661 | 218 |
| 514 | 3300046477 | Ga0495664_0002529 | Ga0495664_0002529_7248_7904 | 218 |
| 515 | 3300046477 | Ga0495664_0177642 | Ga0495664_0177642_327_983 | 218 |
| 516 | 3300046499 | Ga0495594_0149699 | Ga0495594_0149699_48_707 | 218 |
| 517 | 3300046511 | Ga0495608_0032894 | Ga0495608_0032894_1465_2121 | 218 |
| 518 | 3300046514 | Ga0495618_0042860 | Ga0495618_0042860_1437_2102 | 218 |
| 519 | 3300046516 | Ga0495628_0040793 | Ga0495628_0040793_256_912 | 218 |
| 520 | 3300046516 | Ga0495628_0231894 | Ga0495628_0231894_235_900 | 218 |
| 521 | 3300046517 | Ga0495630_0012136 | Ga0495630_0012136_4020_4685 | 218 |
| 522 | 3300046517 | Ga0495630_0572363 | Ga0495630_0572363_173_829 | 218 |
| 523 | 3300046528 | Ga0495642_0013495 | Ga0495642_0013495_1817_2473 | 218 |
| 524 | 3300046528 | Ga0495642_0151624 | Ga0495642_0151624_302_976 | 218 |
| 525 | 3300046529 | Ga0495652_0148176 | Ga0495652_0148176_401_1057 | 218 |
| 526 | 3300046530 | Ga0495654_0173106 | Ga0495654_0173106_46_729 | 218 |
| 527 | 3300046531 | Ga0495665_0004311 | Ga0495665_0004311_2160_2825 | 218 |
| 528 | 3300046531 | Ga0495665_0174354 | Ga0495665_0174354_428_1087 | 218 |
| 529 | 3300046533 | Ga0495640_0031590 | Ga0495640_0031590_114_770 | 218 |
| 530 | 3300046533 | Ga0495640_0032474 | Ga0495640_0032474_1038_1703 | 218 |
| 531 | 3300046535 | Ga0495586_0003605 | Ga0495586_0003605_944_1600 | 218 |
| 532 | 3300046535 | Ga0495586_0050399 | Ga0495586_0050399_284_940 | 218 |
| 533 | 3300046535 | Ga0495586_0113973 | Ga0495586_0113973_254_910 | 218 |
| 534 | 3300046535 | Ga0495586_0198746 | Ga0495586_0198746_396_1052 | 218 |
| 535 | 3300046536 | Ga0495587_0045647 | Ga0495587_0045647_1927_2583 | 218 |
| 536 | 3300046543 | Ga0495645_0047561 | Ga0495645_0047561_37_693 | 218 |
| 537 | 3300046543 | Ga0495645_0071177 | Ga0495645_0071177_563_1228 | 218 |
| 538 | 3300046543 | Ga0495645_0164328 | Ga0495645_0164328_242_898 | 218 |
| 539 | 3300046559 | Ga0495667_0003797 | Ga0495667_0003797_2043_2708 | 218 |
| 540 | 3300046559 | Ga0495667_0017451 | Ga0495667_0017451_1734_2390 | 218 |
| 541 | 3300046559 | Ga0495667_0026272 | Ga0495667_0026272_2468_3148 | 218 |
| 542 | 3300046615 | Ga0495656_0068202 | Ga0495656_0068202_447_1121 | 218 |
| 543 | 3300046642 | Ga0495634_0009612 | Ga0495634_0009612_5376_6032 | 218 |
| 544 | 3300046642 | Ga0495634_0041359 | Ga0495634_0041359_409_1074 | 218 |
| 545 | 3300046663 | Ga0495635_0001457 | Ga0495635_0001457_2129_2794 | 218 |
| 546 | 3300046663 | Ga0495635_0031578 | Ga0495635_0031578_1799_2455 | 218 |
| 547 | 3300046663 | Ga0495635_0110013 | Ga0495635_0110013_744_1400 | 218 |
| 548 | 3300046664 | Ga0495659_0110170 | Ga0495659_0110170_318_974 | 218 |
| 549 | 3300046675 | Ga0495657_0008915 | Ga0495657_0008915_3896_4561 | 218 |
| 550 | 3300046675 | Ga0495657_0301447 | Ga0495657_0301447_265_945 | 218 |
| 551 | 3300046678 | Ga0495599_0009684 | Ga0495599_0009684_2503_3159 | 218 |
| 552 | 3300046678 | Ga0495599_0070258 | Ga0495599_0070258_581_1246 | 218 |
| 553 | 3300046678 | Ga0495599_0178339 | Ga0495599_0178339_557_1255 | 218 |
| 554 | 3300046681 | Ga0495647_0012544 | Ga0495647_0012544_1829_2488 | 218 |
| 555 | 3300046683 | Ga0495658_0014130 | Ga0495658_0014130_2152_2808 | 218 |
| 556 | 3300046690 | Ga0495624_0006089 | Ga0495624_0006089_3689_4354 | 218 |
| 557 | 3300046690 | Ga0495624_0020464 | Ga0495624_0020464_624_1280 | 218 |
| 558 | 3300046809 | Ga0495600_0111697 | Ga0495600_0111697_426_1091 | 218 |
| 559 | 3300047315 | Ga0495581_0015110 | Ga0495581_0015110_3780_4436 | 218 |
| 560 | 3300047315 | Ga0495581_0024853 | Ga0495581_0024853_2352_3017 | 218 |
| 561 | 3300047317 | Ga0495604_0062518 | Ga0495604_0062518_1926_2582 | 218 |
| 562 | 3300047319 | Ga0495674_0003143 | Ga0495674_0003143_4868_5533 | 218 |
| 563 | 3300047319 | Ga0495674_0010021 | Ga0495674_0010021_3789_4445 | 218 |
| 564 | 3300047319 | Ga0495674_0058105 | Ga0495674_0058105_2313_2969 | 218 |
| 565 | 3300047320 | Ga0495672_0047694 | Ga0495672_0047694_1245_1904 | 218 |
| 566 | 3300047321 | Ga0495676_0006015 | Ga0495676_0006015_8067_8732 | 218 |
| 567 | 3300047322 | Ga0495680_0014676 | Ga0495680_0014676_3994_4659 | 218 |
| 568 | 3300047322 | Ga0495680_0029339 | Ga0495680_0029339_3155_3835 | 218 |
| 569 | 3300047322 | Ga0495680_0034479 | Ga0495680_0034479_1100_1756 | 218 |
| 570 | 3300047444 | Ga0495675_0058499 | Ga0495675_0058499_926_1606 | 218 |
| 571 | 3300047471 | Ga0495684_0010160 | Ga0495684_0010160_2937_3602 | 218 |
| 572 | 3300047471 | Ga0495684_0492987 | Ga0495684_0492987_76_732 | 218 |
| 573 | 3300047673 | Ga0495593_0112778 | Ga0495593_0112778_317_982 | 218 |
| 574 | 3300048088 | Ga0495602_0029367 | Ga0495602_0029367_3881_4561 | 218 |
| 575 | 3300048088 | Ga0495602_0054854 | Ga0495602_0054854_144_800 | 218 |
| 576 | 3300048089 | Ga0495614_0241648 | Ga0495614_0241648_81_737 | 218 |
| 577 | 3300048904 | Ga0496101_0087376 | Ga0496101_0087376_1264_1923 | 218 |
| 578 | 3300048904 | Ga0496101_0151883 | Ga0496101_0151883_32_688 | 218 |
| 579 | 3300048905 | Ga0496102_0114872 | Ga0496102_0114872_1313_1969 | 218 |
| 580 | 3300048906 | Ga0496103_0073987 | Ga0496103_0073987_895_1551 | 218 |
| 581 | 3300048906 | Ga0496103_0396739 | Ga0496103_0396739_176_832 | 218 |
| 582 | 3300048907 | Ga0496104_0428175 | Ga0496104_0428175_148_804 | 218 |
| 583 | 3300048907 | Ga0496104_0785421 | Ga0496104_0785421_127_783 | 218 |
| 584 | 3300048911 | Ga0496108_0032356 | Ga0496108_0032356_2590_3246 | 218 |
| 585 | 3300048913 | Ga0496110_0084804 | Ga0496110_0084804_679_1335 | 218 |
| 586 | 3300048913 | Ga0496110_0258689 | Ga0496110_0258689_168_824 | 218 |
| 587 | 3300048915 | Ga0496112_0097705 | Ga0496112_0097705_194_850 | 218 |
| 588 | 3300048915 | Ga0496112_0105277 | Ga0496112_0105277_1191_1847 | 218 |
| 589 | 3300048915 | Ga0496112_0947746 | Ga0496112_0947746_68_730 | 218 |
| 590 | 3300048916 | Ga0496113_0291029 | Ga0496113_0291029_596_1252 | 218 |
| 591 | 3300048918 | Ga0496115_0002965 | Ga0496115_0002965_9154_9810 | 218 |
| 592 | 3300048918 | Ga0496115_0662796 | Ga0496115_0662796_50_712 | 218 |
| 593 | 3300048919 | Ga0496116_0004347 | Ga0496116_0004347_10389_11048 | 218 |
| 594 | 3300048919 | Ga0496116_0018572 | Ga0496116_0018572_168_827 | 218 |
| 595 | 3300048919 | Ga0496116_0047984 | Ga0496116_0047984_156_815 | 218 |
| 596 | 3300048919 | Ga0496116_0147561 | Ga0496116_0147561_167_826 | 218 |
| 597 | 3300048920 | Ga0496117_0021082 | Ga0496117_0021082_2486_3145 | 218 |
| 598 | 3300048921 | Ga0496118_0007568 | Ga0496118_0007568_1522_2181 | 218 |
| 599 | 3300048922 | Ga0496119_0234953 | Ga0496119_0234953_75_734 | 218 |
| 600 | 3300048924 | Ga0496121_0028239 | Ga0496121_0028239_2469_3128 | 218 |
| 601 | 3300048924 | Ga0496121_0041108 | Ga0496121_0041108_1518_2177 | 218 |
| 602 | 3300048925 | Ga0496122_0024068 | Ga0496122_0024068_3330_3989 | 218 |
| 603 | 3300048926 | Ga0496123_0083889 | Ga0496123_0083889_1120_1779 | 218 |
| 604 | 3300048927 | Ga0496124_0003625 | Ga0496124_0003625_1705_2364 | 218 |
| 605 | 3300048927 | Ga0496124_0014196 | Ga0496124_0014196_6339_6998 | 218 |
| 606 | 3300048927 | Ga0496124_0135254 | Ga0496124_0135254_257_916 | 218 |
| 607 | 3300048928 | Ga0496125_0006540 | Ga0496125_0006540_681_1340 | 218 |
| 608 | 3300048929 | Ga0496126_0040560 | Ga0496126_0040560_127_786 | 218 |
| 609 | 3300049569 | Ga0501032_0595240 | Ga0501032_0595240_29_685 | 218 |
| 610 | 3300049578 | Ga0501042_0351802 | Ga0501042_0351802_268_942 | 218 |
| 611 | 3300049581 | Ga0501047_0076364 | Ga0501047_0076364_1243_1899 | 218 |
| 612 | 3300049583 | Ga0501067_0007851 | Ga0501067_0007851_3393_4049 | 218 |
| 613 | 3300049585 | Ga0501069_0022744 | Ga0501069_0022744_272_928 | 218 |
| 614 | 3300049586 | Ga0501070_0037984 | Ga0501070_0037984_1286_1942 | 218 |
| 615 | 3300049586 | Ga0501070_0212427 | Ga0501070_0212427_741_1397 | 218 |
| 616 | 3300049588 | Ga0501072_0096462 | Ga0501072_0096462_402_1064 | 218 |
| 617 | 3300049589 | Ga0501073_0650401 | Ga0501073_0650401_55_711 | 218 |
| 618 | 3300049590 | Ga0501074_0016085 | Ga0501074_0016085_1736_2392 | 218 |
| 619 | 3300049592 | Ga0501076_0578577 | Ga0501076_0578577_41_730 | 218 |
| 620 | 3300049703 | Ga0501219_005207 | Ga0501219_005207_182_838 | 218 |
| 621 | 3300049742 | Ga0501080_0300785 | Ga0501080_0300785_220_876 | 218 |
| 622 | 3300049742 | Ga0501080_0715976 | Ga0501080_0715976_66_722 | 218 |
| 623 | 3300049822 | Ga0501035_0054899 | Ga0501035_0054899_616_1272 | 218 |
| 624 | 3300050507 | nmdc:mga05p37_251403_c1 | nmdc:mga05p37_251403_c1_1067_1741 | 218 |
| 625 | 3300050512 | nmdc:mga0n895_1081549_c1 | nmdc:mga0n895_1081549_c1_69_725 | 218 |
| 626 | 3300050512 | nmdc:mga0n895_523505_c1 | nmdc:mga0n895_523505_c1_379_1035 | 218 |
| 627 | 3300050513 | nmdc:mga0rr50_559929_c1 | nmdc:mga0rr50_559929_c1_26_688 | 218 |
| 628 | 3300050514 | nmdc:mga08x19_258241_c1 | nmdc:mga08x19_258241_c1_68_724 | 218 |
| 629 | 3300050515 | nmdc:mga0a205_98346_c1 | nmdc:mga0a205_98346_c1_867_1523 | 218 |
| 630 | 3300050516 | nmdc:mga0sz30_111766_c1 | nmdc:mga0sz30_111766_c1_390_1049 | 218 |
| 631 | 3300053077 | Ga0495601_0009699 | Ga0495601_0009699_4115_4771 | 218 |
| 632 | 3300053078 | Ga0495612_0095485 | Ga0495612_0095485_354_1010 | 218 |
| 633 | 3300053078 | Ga0495612_0149167 | Ga0495612_0149167_68_733 | 218 |
| 634 | 3300053125 | Ga0500618_003215 | Ga0500618_003215_3164_3823 | 218 |
| 635 | 3300059490 | Ga0587066_020355 | Ga0587066_020355_76_732 | 218 |
| 636 | 3300059492 | Ga0587073_0093273 | Ga0587073_0093273_63_737 | 218 |
| 637 | 3300059630 | Ga0587128_043366 | Ga0587128_043366_78_752 | 218 |
| 638 | 3300059645 | Ga0587076_012844 | Ga0587076_012844_99_758 | 218 |
| 639 | 3300059655 | Ga0587114_038702 | Ga0587114_038702_78_752 | 218 |
| 640 | 3300061734 | Ga0530510_0198832 | Ga0530510_0198832_241_897 | 218 |
| 641 | 3300004801 | Ga0058860_11949334 | Ga0058860_119493341 | 219 |
| 642 | 3300005290 | Ga0065712_10012833 | Ga0065712_100128332 | 219 |
| 643 | 3300005295 | Ga0065707_10227701 | Ga0065707_102277011 | 219 |
| 644 | 3300005330 | Ga0070690_100176681 | Ga0070690_1001766812 | 219 |
| 645 | 3300005338 | Ga0068868_100080096 | Ga0068868_1000800962 | 219 |
| 646 | 3300005341 | Ga0070691_10005642 | Ga0070691_100056425 | 219 |
| 647 | 3300005341 | Ga0070691_10216479 | Ga0070691_102164791 | 219 |
| 648 | 3300005344 | Ga0070661_100000041 | Ga0070661_100000041105 | 219 |
| 649 | 3300005344 | Ga0070661_100042290 | Ga0070661_1000422902 | 219 |
| 650 | 3300005347 | Ga0070668_100029391 | Ga0070668_1000293911 | 219 |
| 651 | 3300005347 | Ga0070668_100093029 | Ga0070668_1000930293 | 219 |
| 652 | 3300005353 | Ga0070669_100236350 | Ga0070669_1002363502 | 219 |
| 653 | 3300005355 | Ga0070671_100098474 | Ga0070671_1000984744 | 219 |
| 654 | 3300005365 | Ga0070688_100067483 | Ga0070688_1000674833 | 219 |
| 655 | 3300005367 | Ga0070667_100017618 | Ga0070667_1000176185 | 219 |
| 656 | 3300005434 | Ga0070709_10004332 | Ga0070709_100043323 | 219 |
| 657 | 3300005435 | Ga0070714_100010508 | Ga0070714_1000105085 | 219 |
| 658 | 3300005435 | Ga0070714_100059408 | Ga0070714_1000594081 | 219 |
| 659 | 3300005436 | Ga0070713_100008049 | Ga0070713_1000080496 | 219 |
| 660 | 3300005437 | Ga0070710_10003513 | Ga0070710_1000351310 | 219 |
| 661 | 3300005439 | Ga0070711_100035041 | Ga0070711_1000350413 | 219 |
| 662 | 3300005445 | Ga0070708_100132297 | Ga0070708_1001322972 | 219 |
| 663 | 3300005445 | Ga0070708_100504208 | Ga0070708_1005042081 | 219 |
| 664 | 3300005455 | Ga0070663_100120677 | Ga0070663_1001206772 | 219 |
| 665 | 3300005456 | Ga0070678_100089382 | Ga0070678_1000893822 | 219 |
| 666 | 3300005457 | Ga0070662_100485489 | Ga0070662_1004854891 | 219 |
| 667 | 3300005458 | Ga0070681_10169066 | Ga0070681_101690661 | 219 |
| 668 | 3300005467 | Ga0070706_100001102 | Ga0070706_1000011023 | 219 |
| 669 | 3300005467 | Ga0070706_100149766 | Ga0070706_1001497662 | 219 |
| 670 | 3300005467 | Ga0070706_100232846 | Ga0070706_1002328462 | 219 |
| 671 | 3300005468 | Ga0070707_100002467 | Ga0070707_1000024679 | 219 |
| 672 | 3300005468 | Ga0070707_100009048 | Ga0070707_1000090487 | 219 |
| 673 | 3300005468 | Ga0070707_100187051 | Ga0070707_1001870512 | 219 |
| 674 | 3300005468 | Ga0070707_100371521 | Ga0070707_1003715211 | 219 |
| 675 | 3300005471 | Ga0070698_100001309 | Ga0070698_10000130919 | 219 |
| 676 | 3300005471 | Ga0070698_100001661 | Ga0070698_10000166116 | 219 |
| 677 | 3300005471 | Ga0070698_100008526 | Ga0070698_1000085268 | 219 |
| 678 | 3300005471 | Ga0070698_100036344 | Ga0070698_1000363445 | 219 |
| 679 | 3300005471 | Ga0070698_100355926 | Ga0070698_1003559262 | 219 |
| 680 | 3300005518 | Ga0070699_100018447 | Ga0070699_1000184477 | 219 |
| 681 | 3300005518 | Ga0070699_100836271 | Ga0070699_1008362711 | 219 |
| 682 | 3300005530 | Ga0070679_100209681 | Ga0070679_1002096812 | 219 |
| 683 | 3300005536 | Ga0070697_100003592 | Ga0070697_1000035928 | 219 |
| 684 | 3300005536 | Ga0070697_100068493 | Ga0070697_1000684932 | 219 |
| 685 | 3300005536 | Ga0070697_100715297 | Ga0070697_1007152971 | 219 |
| 686 | 3300005539 | Ga0068853_100059756 | Ga0068853_1000597563 | 219 |
| 687 | 3300005546 | Ga0070696_100222347 | Ga0070696_1002223472 | 219 |
| 688 | 3300005548 | Ga0070665_101106780 | Ga0070665_1011067801 | 219 |
| 689 | 3300005563 | Ga0068855_100127377 | Ga0068855_1001273773 | 219 |
| 690 | 3300005577 | Ga0068857_100218622 | Ga0068857_1002186222 | 219 |
| 691 | 3300005614 | Ga0068856_100089394 | Ga0068856_1000893942 | 219 |
| 692 | 3300005616 | Ga0068852_100256473 | Ga0068852_1002564732 | 219 |
| 693 | 3300005617 | Ga0068859_100046143 | Ga0068859_1000461436 | 219 |
| 694 | 3300005618 | Ga0068864_100117908 | Ga0068864_1001179082 | 219 |
| 695 | 3300005718 | Ga0068866_10532197 | Ga0068866_105321971 | 219 |
| 696 | 3300005834 | Ga0068851_10180533 | Ga0068851_101805332 | 219 |
| 697 | 3300005841 | Ga0068863_100011306 | Ga0068863_1000113068 | 219 |
| 698 | 3300005842 | Ga0068858_100920913 | Ga0068858_1009209131 | 219 |
| 699 | 3300005844 | Ga0068862_100003797 | Ga0068862_1000037974 | 219 |
| 700 | 3300005844 | Ga0068862_100024969 | Ga0068862_1000249693 | 219 |
| 701 | 3300005937 | Ga0081455_10015272 | Ga0081455_100152728 | 219 |
| 702 | 3300005937 | Ga0081455_10331401 | Ga0081455_103314012 | 219 |
| 703 | 3300006028 | Ga0070717_10007092 | Ga0070717_100070924 | 219 |
| 704 | 3300006058 | Ga0075432_10028966 | Ga0075432_100289662 | 219 |
| 705 | 3300006163 | Ga0070715_10001832 | Ga0070715_100018327 | 219 |
| 706 | 3300006173 | Ga0070716_100125681 | Ga0070716_1001256811 | 219 |
| 707 | 3300006173 | Ga0070716_100139619 | Ga0070716_1001396192 | 219 |
| 708 | 3300006237 | Ga0097621_100105899 | Ga0097621_1001058993 | 219 |
| 709 | 3300006358 | Ga0068871_100116467 | Ga0068871_1001164673 | 219 |
| 710 | 3300006844 | Ga0075428_100015027 | Ga0075428_1000150275 | 219 |
| 711 | 3300006846 | Ga0075430_100000050 | Ga0075430_10000005058 | 219 |
| 712 | 3300006846 | Ga0075430_100002824 | Ga0075430_1000028244 | 219 |
| 713 | 3300006846 | Ga0075430_100038855 | Ga0075430_1000388555 | 219 |
| 714 | 3300006846 | Ga0075430_100097061 | Ga0075430_1000970612 | 219 |
| 715 | 3300006847 | Ga0075431_100007688 | Ga0075431_1000076888 | 219 |
| 716 | 3300006852 | Ga0075433_10087741 | Ga0075433_100877413 | 219 |
| 717 | 3300006871 | Ga0075434_100012228 | Ga0075434_1000122288 | 219 |
| 718 | 3300006880 | Ga0075429_100024107 | Ga0075429_1000241073 | 219 |
| 719 | 3300006880 | Ga0075429_100055826 | Ga0075429_1000558262 | 219 |
| 720 | 3300006880 | Ga0075429_100610396 | Ga0075429_1006103961 | 219 |
| 721 | 3300006931 | Ga0097620_100046143 | Ga0097620_1000461436 | 219 |
| 722 | 3300007076 | Ga0075435_100752619 | Ga0075435_1007526191 | 219 |
| 723 | 3300007265 | Ga0099794_10003354 | Ga0099794_100033547 | 219 |
| 724 | 3300007788 | Ga0099795_10135711 | Ga0099795_101357112 | 219 |
| 725 | 3300009094 | Ga0111539_10367577 | Ga0111539_103675771 | 219 |
| 726 | 3300009098 | Ga0105245_10008241 | Ga0105245_100082412 | 219 |
| 727 | 3300009098 | Ga0105245_10069111 | Ga0105245_100691111 | 219 |
| 728 | 3300009098 | Ga0105245_10498443 | Ga0105245_104984432 | 219 |
| 729 | 3300009147 | Ga0114129_10019737 | Ga0114129_100197372 | 219 |
| 730 | 3300009147 | Ga0114129_10425114 | Ga0114129_104251142 | 219 |
| 731 | 3300009147 | Ga0114129_11686697 | Ga0114129_116866971 | 219 |
| 732 | 3300009174 | Ga0105241_10105659 | Ga0105241_101056592 | 219 |
| 733 | 3300009176 | Ga0105242_10251780 | Ga0105242_102517801 | 219 |
| 734 | 3300009177 | Ga0105248_10266395 | Ga0105248_102663952 | 219 |
| 735 | 3300009545 | Ga0105237_10673846 | Ga0105237_106738462 | 219 |
| 736 | 3300009551 | Ga0105238_10085401 | Ga0105238_100854013 | 219 |
| 737 | 3300010375 | Ga0105239_10225689 | Ga0105239_102256892 | 219 |
| 738 | 3300011119 | Ga0105246_10225168 | Ga0105246_102251682 | 219 |
| 739 | 3300013100 | Ga0157373_10005491 | Ga0157373_100054917 | 219 |
| 740 | 3300013105 | Ga0157369_10622313 | Ga0157369_106223132 | 219 |
| 741 | 3300013306 | Ga0163162_10246069 | Ga0163162_102460692 | 219 |
| 742 | 3300013308 | Ga0157375_10043156 | Ga0157375_100431564 | 219 |
| 743 | 3300020070 | Ga0206356_11401552 | Ga0206356_114015521 | 219 |
| 744 | 3300021377 | Ga0213874_10000875 | Ga0213874_100008754 | 219 |
| 745 | 3300021384 | Ga0213876_10034717 | Ga0213876_100347172 | 219 |
| 746 | 3300025297 | Ga0209758_1065890 | Ga0209758_10658902 | 219 |
| 747 | 3300025321 | Ga0207656_10058057 | Ga0207656_100580572 | 219 |
| 748 | 3300025893 | Ga0207682_10027486 | Ga0207682_100274864 | 219 |
| 749 | 3300025893 | Ga0207682_10092834 | Ga0207682_100928341 | 219 |
| 750 | 3300025901 | Ga0207688_10121520 | Ga0207688_101215202 | 219 |
| 751 | 3300025907 | Ga0207645_10051560 | Ga0207645_100515602 | 219 |
| 752 | 3300025907 | Ga0207645_10132124 | Ga0207645_101321242 | 219 |
| 753 | 3300025910 | Ga0207684_10000287 | Ga0207684_100002878 | 219 |
| 754 | 3300025910 | Ga0207684_10072963 | Ga0207684_100729632 | 219 |
| 755 | 3300025910 | Ga0207684_10137217 | Ga0207684_101372172 | 219 |
| 756 | 3300025910 | Ga0207684_10417763 | Ga0207684_104177631 | 219 |
| 757 | 3300025912 | Ga0207707_10010851 | Ga0207707_100108516 | 219 |
| 758 | 3300025912 | Ga0207707_10435848 | Ga0207707_104358481 | 219 |
| 759 | 3300025913 | Ga0207695_10009282 | Ga0207695_1000928210 | 219 |
| 760 | 3300025914 | Ga0207671_10113745 | Ga0207671_101137452 | 219 |
| 761 | 3300025914 | Ga0207671_10275252 | Ga0207671_102752521 | 219 |
| 762 | 3300025915 | Ga0207693_10050939 | Ga0207693_100509394 | 219 |
| 763 | 3300025917 | Ga0207660_10038806 | Ga0207660_100388065 | 219 |
| 764 | 3300025918 | Ga0207662_10093863 | Ga0207662_100938632 | 219 |
| 765 | 3300025920 | Ga0207649_10000437 | Ga0207649_1000043726 | 219 |
| 766 | 3300025920 | Ga0207649_10020766 | Ga0207649_100207663 | 219 |
| 767 | 3300025921 | Ga0207652_10126992 | Ga0207652_101269922 | 219 |
| 768 | 3300025922 | Ga0207646_10022997 | Ga0207646_100229974 | 219 |
| 769 | 3300025922 | Ga0207646_10042075 | Ga0207646_100420753 | 219 |
| 770 | 3300025922 | Ga0207646_10146961 | Ga0207646_101469612 | 219 |
| 771 | 3300025924 | Ga0207694_10094522 | Ga0207694_100945223 | 219 |
| 772 | 3300025924 | Ga0207694_10114347 | Ga0207694_101143473 | 219 |
| 773 | 3300025925 | Ga0207650_10140474 | Ga0207650_101404742 | 219 |
| 774 | 3300025925 | Ga0207650_10323710 | Ga0207650_103237101 | 219 |
| 775 | 3300025925 | Ga0207650_10346032 | Ga0207650_103460322 | 219 |
| 776 | 3300025926 | Ga0207659_10077899 | Ga0207659_100778993 | 219 |
| 777 | 3300025926 | Ga0207659_10165561 | Ga0207659_101655612 | 219 |
| 778 | 3300025927 | Ga0207687_10016580 | Ga0207687_100165802 | 219 |
| 779 | 3300025927 | Ga0207687_10134787 | Ga0207687_101347872 | 219 |
| 780 | 3300025927 | Ga0207687_10604615 | Ga0207687_106046151 | 219 |
| 781 | 3300025931 | Ga0207644_10058187 | Ga0207644_100581872 | 219 |
| 782 | 3300025931 | Ga0207644_10058907 | Ga0207644_100589071 | 219 |
| 783 | 3300025933 | Ga0207706_10432010 | Ga0207706_104320101 | 219 |
| 784 | 3300025934 | Ga0207686_10397204 | Ga0207686_103972042 | 219 |
| 785 | 3300025937 | Ga0207669_10019618 | Ga0207669_100196182 | 219 |
| 786 | 3300025937 | Ga0207669_10119530 | Ga0207669_101195301 | 219 |
| 787 | 3300025939 | Ga0207665_10689710 | Ga0207665_106897101 | 219 |
| 788 | 3300025940 | Ga0207691_10008622 | Ga0207691_1000862211 | 219 |
| 789 | 3300025940 | Ga0207691_10014130 | Ga0207691_100141303 | 219 |
| 790 | 3300025940 | Ga0207691_10668477 | Ga0207691_106684772 | 219 |
| 791 | 3300025941 | Ga0207711_10233587 | Ga0207711_102335872 | 219 |
| 792 | 3300025941 | Ga0207711_10621171 | Ga0207711_106211711 | 219 |
| 793 | 3300025944 | Ga0207661_10543124 | Ga0207661_105431242 | 219 |
| 794 | 3300025944 | Ga0207661_10614472 | Ga0207661_106144721 | 219 |
| 795 | 3300025949 | Ga0207667_10016318 | Ga0207667_100163187 | 219 |
| 796 | 3300025960 | Ga0207651_10035758 | Ga0207651_100357582 | 219 |
| 797 | 3300025960 | Ga0207651_10277536 | Ga0207651_102775362 | 219 |
| 798 | 3300025972 | Ga0207668_10075504 | Ga0207668_100755043 | 219 |
| 799 | 3300025972 | Ga0207668_10170452 | Ga0207668_101704522 | 219 |
| 800 | 3300025986 | Ga0207658_10027001 | Ga0207658_100270014 | 219 |
| 801 | 3300026023 | Ga0207677_10034499 | Ga0207677_100344992 | 219 |
| 802 | 3300026023 | Ga0207677_10692469 | Ga0207677_106924691 | 219 |
| 803 | 3300026035 | Ga0207703_10701232 | Ga0207703_107012321 | 219 |
| 804 | 3300026035 | Ga0207703_10938556 | Ga0207703_109385561 | 219 |
| 805 | 3300026041 | Ga0207639_10024980 | Ga0207639_100249804 | 219 |
| 806 | 3300026067 | Ga0207678_10199936 | Ga0207678_101999362 | 219 |
| 807 | 3300026078 | Ga0207702_10115195 | Ga0207702_101151951 | 219 |
| 808 | 3300026088 | Ga0207641_10082954 | Ga0207641_100829541 | 219 |
| 809 | 3300026089 | Ga0207648_10087664 | Ga0207648_100876643 | 219 |
| 810 | 3300026089 | Ga0207648_10287839 | Ga0207648_102878391 | 219 |
| 811 | 3300026095 | Ga0207676_10434459 | Ga0207676_104344591 | 219 |
| 812 | 3300026116 | Ga0207674_10051455 | Ga0207674_100514553 | 219 |
| 813 | 3300026118 | Ga0207675_100006106 | Ga0207675_10000610610 | 219 |
| 814 | 3300026118 | Ga0207675_100076071 | Ga0207675_1000760712 | 219 |
| 815 | 3300026118 | Ga0207675_100286920 | Ga0207675_1002869201 | 219 |
| 816 | 3300026118 | Ga0207675_100566513 | Ga0207675_1005665131 | 219 |
| 817 | 3300026121 | Ga0207683_10055241 | Ga0207683_100552412 | 219 |
| 818 | 3300026121 | Ga0207683_10123567 | Ga0207683_101235674 | 219 |
| 819 | 3300026121 | Ga0207683_11028031 | Ga0207683_110280311 | 219 |
| 820 | 3300026142 | Ga0207698_10879645 | Ga0207698_108796451 | 219 |
| 821 | 3300027671 | Ga0209588_1004952 | Ga0209588_10049523 | 219 |
| 822 | 3300027671 | Ga0209588_1036169 | Ga0209588_10361691 | 219 |
| 823 | 3300027671 | Ga0209588_1069206 | Ga0209588_10692062 | 219 |
| 824 | 3300027907 | Ga0207428_10081941 | Ga0207428_100819411 | 219 |
| 825 | 3300027907 | Ga0207428_10405189 | Ga0207428_104051891 | 219 |
| 826 | 3300028380 | Ga0268265_10010604 | Ga0268265_100106043 | 219 |
| 827 | 3300028380 | Ga0268265_10018341 | Ga0268265_100183416 | 219 |
| 828 | 3300028380 | Ga0268265_10170194 | Ga0268265_101701941 | 219 |
| 829 | 3300028380 | Ga0268265_10232170 | Ga0268265_102321702 | 219 |
| 830 | 3300028381 | Ga0268264_10795098 | Ga0268264_107950982 | 219 |
| 831 | 3300028558 | Ga0265326_10095267 | Ga0265326_100952671 | 219 |
| 832 | 3300031238 | Ga0265332_10003112 | Ga0265332_100031124 | 219 |
| 833 | 3300031241 | Ga0265325_10082744 | Ga0265325_100827442 | 219 |
| 834 | 3300031247 | Ga0265340_10006253 | Ga0265340_100062535 | 219 |
| 835 | 3300031249 | Ga0265339_10061653 | Ga0265339_100616533 | 219 |
| 836 | 3300031251 | Ga0265327_10005193 | Ga0265327_100051934 | 219 |
| 837 | 3300031251 | Ga0265327_10057916 | Ga0265327_100579163 | 219 |
| 838 | 3300031344 | Ga0265316_10129932 | Ga0265316_101299323 | 219 |
| 839 | 3300031712 | Ga0265342_10002150 | Ga0265342_100021504 | 219 |
| 840 | 3300031995 | Ga0307409_100367408 | Ga0307409_1003674082 | 219 |
| 841 | 3300032126 | Ga0307415_100509731 | Ga0307415_1005097311 | 219 |
| 842 | 3300035083 | Ga0373926_0074850 | Ga0373926_0074850_502_1161 | 219 |
| 843 | 3300035084 | Ga0373928_0029574 | Ga0373928_0029574_441_1103 | 219 |
| 844 | 3300035086 | Ga0373934_0011767 | Ga0373934_0011767_1582_2241 | 219 |
| 845 | 3300035088 | Ga0373940_0045844 | Ga0373940_0045844_461_1120 | 219 |
| 846 | 3300035089 | Ga0373944_0172869 | Ga0373944_0172869_10_669 | 219 |
| 847 | 3300035090 | Ga0373949_0100103 | Ga0373949_0100103_40_699 | 219 |
| 848 | 3300035111 | Ga0373923_0001052 | Ga0373923_0001052_240_899 | 219 |
| 849 | 3300035113 | Ga0373936_0001677 | Ga0373936_0001677_4307_4966 | 219 |
| 850 | 3300035114 | Ga0373939_0011739 | Ga0373939_0011739_178_840 | 219 |
| 851 | 3300035116 | Ga0373945_0004559 | Ga0373945_0004559_1186_1845 | 219 |
| 852 | 3300035116 | Ga0373945_0006120 | Ga0373945_0006120_57_716 | 219 |
| 853 | 3300035117 | Ga0373953_0003079 | Ga0373953_0003079_3110_3769 | 219 |
| 854 | 3300035117 | Ga0373953_0065747 | Ga0373953_0065747_186_845 | 219 |
| 855 | 3300035118 | Ga0373954_0006435 | Ga0373954_0006435_3643_4302 | 219 |
| 856 | 3300035118 | Ga0373954_0067093 | Ga0373954_0067093_53_712 | 219 |
| 857 | 3300035118 | Ga0373954_0107949 | Ga0373954_0107949_55_714 | 219 |
| 858 | 3300035118 | Ga0373954_0149548 | Ga0373954_0149548_436_1095 | 219 |
| 859 | 3300035119 | Ga0373956_0027712 | Ga0373956_0027712_612_1271 | 219 |
| 860 | 3300035170 | Ga0373943_0000622 | Ga0373943_0000622_8083_8742 | 219 |
| 861 | 3300035170 | Ga0373943_0035951 | Ga0373943_0035951_1675_2334 | 219 |
| 862 | 3300035170 | Ga0373943_0235235 | Ga0373943_0235235_217_876 | 219 |
| 863 | 3300035171 | Ga0373946_0016156 | Ga0373946_0016156_163_822 | 219 |
| 864 | 3300035172 | Ga0373955_0000453 | Ga0373955_0000453_14917_15576 | 219 |
| 865 | 3300035172 | Ga0373955_0016314 | Ga0373955_0016314_915_1574 | 219 |
| 866 | 3300035172 | Ga0373955_0038075 | Ga0373955_0038075_1802_2461 | 219 |
| 867 | 3300035241 | Ga0373961_0009728 | Ga0373961_0009728_1448_2110 | 219 |
| 868 | 3300035410 | Ga0373924_0002934 | Ga0373924_0002934_3696_4355 | 219 |
| 869 | 3300035692 | Ga0373935_0000153 | Ga0373935_0000153_806_1465 | 219 |
| 870 | 3300035692 | Ga0373935_0013196 | Ga0373935_0013196_2180_2839 | 219 |
| 871 | 3300035695 | Ga0373927_0010376 | Ga0373927_0010376_5049_5708 | 219 |
| 872 | 3300035695 | Ga0373927_0108336 | Ga0373927_0108336_573_1232 | 219 |
| 873 | 3300035695 | Ga0373927_0256628 | Ga0373927_0256628_435_1094 | 219 |
| 874 | 3300035695 | Ga0373927_0650727 | Ga0373927_0650727_13_672 | 219 |
| 875 | 3300035724 | Ga0373933_0008303 | Ga0373933_0008303_32_691 | 219 |
| 876 | 3300035724 | Ga0373933_0017656 | Ga0373933_0017656_1353_2012 | 219 |
| 877 | 3300035724 | Ga0373933_0434075 | Ga0373933_0434075_163_822 | 219 |
| 878 | 3300035725 | Ga0373947_0000700 | Ga0373947_0000700_14411_15070 | 219 |
| 879 | 3300035725 | Ga0373947_0066694 | Ga0373947_0066694_1205_1864 | 219 |
| 880 | 3300036401 | Ga0373937_0000432 | Ga0373937_0000432_36901_37560 | 219 |
| 881 | 3300036401 | Ga0373937_0003993 | Ga0373937_0003993_606_1265 | 219 |
| 882 | 3300036401 | Ga0373937_0012033 | Ga0373937_0012033_5867_6526 | 219 |
| 883 | 3300037068 | Ga0373925_0000084 | Ga0373925_0000084_56334_56993 | 219 |
| 884 | 3300037068 | Ga0373925_0001188 | Ga0373925_0001188_10193_10852 | 219 |
| 885 | 3300037068 | Ga0373925_0001533 | Ga0373925_0001533_2366_3025 | 219 |
| 886 | 3300037068 | Ga0373925_0108941 | Ga0373925_0108941_1030_1689 | 219 |
| 887 | 3300037068 | Ga0373925_0262048 | Ga0373925_0262048_489_1148 | 219 |
| 888 | 3300037068 | Ga0373925_0378935 | Ga0373925_0378935_307_966 | 219 |
| 889 | 3300037068 | Ga0373925_0808488 | Ga0373925_0808488_78_737 | 219 |
| 890 | 3300037312 | Ga0395899_0087977 | Ga0395899_0087977_671_1330 | 219 |
| 891 | 3300037312 | Ga0395899_0273927 | Ga0395899_0273927_189_848 | 219 |
| 892 | 3300037418 | Ga0395900_0080270 | Ga0395900_0080270_430_1089 | 219 |
| 893 | 3300037418 | Ga0395900_0209011 | Ga0395900_0209011_500_1159 | 219 |
| 894 | 3300037466 | Ga0395898_0001505 | Ga0395898_0001505_28047_28706 | 219 |
| 895 | 3300037466 | Ga0395898_0059173 | Ga0395898_0059173_513_1172 | 219 |
| 896 | 3300037466 | Ga0395898_0114505 | Ga0395898_0114505_1328_1987 | 219 |
| 897 | 3300037466 | Ga0395898_0137005 | Ga0395898_0137005_1323_1982 | 219 |
| 898 | 3300037471 | Ga0395905_0005407 | Ga0395905_0005407_976_1635 | 219 |
| 899 | 3300037471 | Ga0395905_0105078 | Ga0395905_0105078_816_1475 | 219 |
| 900 | 3300037853 | Ga0436364_0713202 | Ga0436364_0713202_794_1456 | 219 |
| 901 | 3300038443 | Ga0395901_0006836 | Ga0395901_0006836_1847_2506 | 219 |
| 902 | 3300038443 | Ga0395901_0008365 | Ga0395901_0008365_6897_7556 | 219 |
| 903 | 3300038443 | Ga0395901_0017842 | Ga0395901_0017842_5467_6126 | 219 |
| 904 | 3300038443 | Ga0395901_0204928 | Ga0395901_0204928_1190_1849 | 219 |
| 905 | 3300039437 | Ga0436365_0281644 | Ga0436365_0281644_73_732 | 219 |
| 906 | 3300039437 | Ga0436365_0982568 | Ga0436365_0982568_343_1017 | 219 |
| 907 | 3300039437 | Ga0436365_1143395 | Ga0436365_1143395_1287_1946 | 219 |
| 908 | 3300039437 | Ga0436365_1308626 | Ga0436365_1308626_3698_4357 | 219 |
| 909 | 3300039437 | Ga0436365_1423189 | Ga0436365_1423189_160_819 | 219 |
| 910 | 3300039437 | Ga0436365_1588830 | Ga0436365_1588830_1572_2231 | 219 |
| 911 | 3300039450 | Ga0436363_0169393 | Ga0436363_0169393_41675_42334 | 219 |
| 912 | 3300039450 | Ga0436363_0556565 | Ga0436363_0556565_672_1331 | 219 |
| 913 | 3300039450 | Ga0436363_0572802 | Ga0436363_0572802_520_1179 | 219 |
| 914 | 3300039450 | Ga0436363_0846140 | Ga0436363_0846140_378_1037 | 219 |
| 915 | 3300039453 | Ga0436362_0121492 | Ga0436362_0121492_150_887 | 219 |
| 916 | 3300039453 | Ga0436362_0163841 | Ga0436362_0163841_76_735 | 219 |
| 917 | 3300039453 | Ga0436362_0719851 | Ga0436362_0719851_84_743 | 219 |
| 918 | 3300042003 | Ga0439443_038857 | Ga0439443_038857_49_708 | 219 |
| 919 | 3300042004 | Ga0439445_0009113 | Ga0439445_0009113_1414_2073 | 219 |
| 920 | 3300042156 | Ga0439446_0016149 | Ga0439446_0016149_1187_1846 | 219 |
| 921 | 3300044694 | Ga0466963_0037236 | Ga0466963_0037236_2488_3150 | 219 |
| 922 | 3300044694 | Ga0466963_0254890 | Ga0466963_0254890_214_876 | 219 |
| 923 | 3300044706 | Ga0466964_0070097 | Ga0466964_0070097_772_1434 | 219 |
| 924 | 3300044712 | Ga0453684_0002923 | Ga0453684_0002923_37489_38169 | 219 |
| 925 | 3300044719 | Ga0466971_0088103 | Ga0466971_0088103_147_809 | 219 |
| 926 | 3300044842 | Ga0466957_0026773 | Ga0466957_0026773_2414_3073 | 219 |
| 927 | 3300045051 | Ga0451576_0118215 | Ga0451576_0118215_2086_2745 | 219 |
| 928 | 3300045836 | Ga0466958_0033488 | Ga0466958_0033488_376_1035 | 219 |
| 929 | 3300045836 | Ga0466958_0168243 | Ga0466958_0168243_114_776 | 219 |
| 930 | 3300045976 | Ga0466967_0113782 | Ga0466967_0113782_1134_1793 | 219 |
| 931 | 3300045976 | Ga0466967_0130099 | Ga0466967_0130099_1624_2286 | 219 |
| 932 | 3300045976 | Ga0466967_0212043 | Ga0466967_0212043_1147_1812 | 219 |
| 933 | 3300045976 | Ga0466967_1219800 | Ga0466967_1219800_72_731 | 219 |
| 934 | 3300045976 | Ga0466967_1321174 | Ga0466967_1321174_24_683 | 219 |
| 935 | 3300046454 | Ga0495592_0000026 | Ga0495592_0000026_97989_98648 | 219 |
| 936 | 3300046454 | Ga0495592_0015800 | Ga0495592_0015800_4994_5653 | 219 |
| 937 | 3300046454 | Ga0495592_0062898 | Ga0495592_0062898_1370_2029 | 219 |
| 938 | 3300046459 | Ga0495629_0001876 | Ga0495629_0001876_12585_13244 | 219 |
| 939 | 3300046459 | Ga0495629_0016858 | Ga0495629_0016858_2124_2783 | 219 |
| 940 | 3300046461 | Ga0495641_0001982 | Ga0495641_0001982_5102_5761 | 219 |
| 941 | 3300046461 | Ga0495641_0214288 | Ga0495641_0214288_13_672 | 219 |
| 942 | 3300046462 | Ga0495651_0001816 | Ga0495651_0001816_10682_11341 | 219 |
| 943 | 3300046462 | Ga0495651_0003038 | Ga0495651_0003038_8273_8932 | 219 |
| 944 | 3300046462 | Ga0495651_0038208 | Ga0495651_0038208_685_1344 | 219 |
| 945 | 3300046463 | Ga0495653_0000155 | Ga0495653_0000155_3731_4390 | 219 |
| 946 | 3300046463 | Ga0495653_0006734 | Ga0495653_0006734_4572_5231 | 219 |
| 947 | 3300046463 | Ga0495653_0021100 | Ga0495653_0021100_669_1328 | 219 |
| 948 | 3300046473 | Ga0495582_0001032 | Ga0495582_0001032_13513_14172 | 219 |
| 949 | 3300046473 | Ga0495582_0065678 | Ga0495582_0065678_962_1621 | 219 |
| 950 | 3300046475 | Ga0495639_0001826 | Ga0495639_0001826_1887_2546 | 219 |
| 951 | 3300046475 | Ga0495639_0158736 | Ga0495639_0158736_191_850 | 219 |
| 952 | 3300046476 | Ga0495662_0002047 | Ga0495662_0002047_4717_5376 | 219 |
| 953 | 3300046476 | Ga0495662_0050799 | Ga0495662_0050799_1277_1936 | 219 |
| 954 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_713141_713800 | 219 |
| 955 | 3300046477 | Ga0495664_0112835 | Ga0495664_0112835_603_1262 | 219 |
| 956 | 3300046477 | Ga0495664_0314088 | Ga0495664_0314088_143_802 | 219 |
| 957 | 3300046500 | Ga0495596_0145773 | Ga0495596_0145773_209_898 | 219 |
| 958 | 3300046511 | Ga0495608_0000012 | Ga0495608_0000012_198171_198830 | 219 |
| 959 | 3300046514 | Ga0495618_0000041 | Ga0495618_0000041_52029_52688 | 219 |
| 960 | 3300046514 | Ga0495618_0009095 | Ga0495618_0009095_225_884 | 219 |
| 961 | 3300046516 | Ga0495628_0000033 | Ga0495628_0000033_3769_4428 | 219 |
| 962 | 3300046516 | Ga0495628_0079866 | Ga0495628_0079866_314_973 | 219 |
| 963 | 3300046516 | Ga0495628_0386689 | Ga0495628_0386689_283_942 | 219 |
| 964 | 3300046517 | Ga0495630_0022265 | Ga0495630_0022265_3498_4157 | 219 |
| 965 | 3300046517 | Ga0495630_0027669 | Ga0495630_0027669_2545_3204 | 219 |
| 966 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_113277_113936 | 219 |
| 967 | 3300046529 | Ga0495652_0004698 | Ga0495652_0004698_10795_11454 | 219 |
| 968 | 3300046529 | Ga0495652_0062473 | Ga0495652_0062473_2304_2963 | 219 |
| 969 | 3300046531 | Ga0495665_0001683 | Ga0495665_0001683_7785_8444 | 219 |
| 970 | 3300046533 | Ga0495640_0000010 | Ga0495640_0000010_113455_114114 | 219 |
| 971 | 3300046533 | Ga0495640_0002641 | Ga0495640_0002641_8298_8957 | 219 |
| 972 | 3300046533 | Ga0495640_0008984 | Ga0495640_0008984_3466_4125 | 219 |
| 973 | 3300046536 | Ga0495587_0000003 | Ga0495587_0000003_379475_380134 | 219 |
| 974 | 3300046536 | Ga0495587_0007562 | Ga0495587_0007562_3851_4510 | 219 |
| 975 | 3300046537 | Ga0495598_0008068 | Ga0495598_0008068_1225_1884 | 219 |
| 976 | 3300046539 | Ga0495621_0008651 | Ga0495621_0008651_1197_1856 | 219 |
| 977 | 3300046543 | Ga0495645_0000026 | Ga0495645_0000026_74113_74772 | 219 |
| 978 | 3300046543 | Ga0495645_0104989 | Ga0495645_0104989_1249_1908 | 219 |
| 979 | 3300046543 | Ga0495645_0129699 | Ga0495645_0129699_302_961 | 219 |
| 980 | 3300046559 | Ga0495667_0000132 | Ga0495667_0000132_46324_46983 | 219 |
| 981 | 3300046559 | Ga0495667_0004922 | Ga0495667_0004922_5304_5963 | 219 |
| 982 | 3300046559 | Ga0495667_0015481 | Ga0495667_0015481_3894_4553 | 219 |
| 983 | 3300046642 | Ga0495634_0000285 | Ga0495634_0000285_43929_44588 | 219 |
| 984 | 3300046642 | Ga0495634_0027295 | Ga0495634_0027295_389_1048 | 219 |
| 985 | 3300046642 | Ga0495634_0100485 | Ga0495634_0100485_446_1105 | 219 |
| 986 | 3300046663 | Ga0495635_0000113 | Ga0495635_0000113_43915_44574 | 219 |
| 987 | 3300046663 | Ga0495635_0013023 | Ga0495635_0013023_546_1205 | 219 |
| 988 | 3300046663 | Ga0495635_0034738 | Ga0495635_0034738_138_797 | 219 |
| 989 | 3300046663 | Ga0495635_0307270 | Ga0495635_0307270_393_1052 | 219 |
| 990 | 3300046675 | Ga0495657_0000258 | Ga0495657_0000258_43940_44599 | 219 |
| 991 | 3300046675 | Ga0495657_0174237 | Ga0495657_0174237_620_1279 | 219 |
| 992 | 3300046678 | Ga0495599_0000070 | Ga0495599_0000070_43937_44596 | 219 |
| 993 | 3300046678 | Ga0495599_0060391 | Ga0495599_0060391_659_1318 | 219 |
| 994 | 3300046678 | Ga0495599_0168426 | Ga0495599_0168426_620_1279 | 219 |
| 995 | 3300046679 | Ga0495623_0000003 | Ga0495623_0000003_3734_4393 | 219 |
| 996 | 3300046679 | Ga0495623_0012706 | Ga0495623_0012706_2777_3436 | 219 |
| 997 | 3300046680 | Ga0495646_0000070 | Ga0495646_0000070_43920_44579 | 219 |
| 998 | 3300046680 | Ga0495646_0012319 | Ga0495646_0012319_3063_3722 | 219 |
| 999 | 3300046680 | Ga0495646_0044888 | Ga0495646_0044888_467_1126 | 219 |
| 1000 | 3300046681 | Ga0495647_0011297 | Ga0495647_0011297_852_1511 | 219 |
| 1001 | 3300046683 | Ga0495658_0000863 | Ga0495658_0000863_11363_12022 | 219 |
| 1002 | 3300046683 | Ga0495658_0076084 | Ga0495658_0076084_384_1043 | 219 |
| 1003 | 3300046689 | Ga0495613_0004947 | Ga0495613_0004947_4740_5399 | 219 |
| 1004 | 3300046689 | Ga0495613_0091833 | Ga0495613_0091833_440_1099 | 219 |
| 1005 | 3300046689 | Ga0495613_0210676 | Ga0495613_0210676_159_818 | 219 |
| 1006 | 3300046689 | Ga0495613_0242681 | Ga0495613_0242681_23_682 | 219 |
| 1007 | 3300046690 | Ga0495624_0072914 | Ga0495624_0072914_232_891 | 219 |
| 1008 | 3300046809 | Ga0495600_0000007 | Ga0495600_0000007_106401_107060 | 219 |
| 1009 | 3300047315 | Ga0495581_0003231 | Ga0495581_0003231_5643_6302 | 219 |
| 1010 | 3300047315 | Ga0495581_0004944 | Ga0495581_0004944_3790_4449 | 219 |
| 1011 | 3300047315 | Ga0495581_0021363 | Ga0495581_0021363_985_1644 | 219 |
| 1012 | 3300047317 | Ga0495604_0000010 | Ga0495604_0000010_198195_198854 | 219 |
| 1013 | 3300047317 | Ga0495604_0001295 | Ga0495604_0001295_11792_12451 | 219 |
| 1014 | 3300047317 | Ga0495604_0029640 | Ga0495604_0029640_3157_3816 | 219 |
| 1015 | 3300047319 | Ga0495674_0000013 | Ga0495674_0000013_113277_113936 | 219 |
| 1016 | 3300047319 | Ga0495674_0004127 | Ga0495674_0004127_5274_5933 | 219 |
| 1017 | 3300047319 | Ga0495674_0011758 | Ga0495674_0011758_5772_6431 | 219 |
| 1018 | 3300047321 | Ga0495676_0001106 | Ga0495676_0001106_7938_8597 | 219 |
| 1019 | 3300047321 | Ga0495676_0051111 | Ga0495676_0051111_248_907 | 219 |
| 1020 | 3300047321 | Ga0495676_0200526 | Ga0495676_0200526_455_1114 | 219 |
| 1021 | 3300047322 | Ga0495680_0003074 | Ga0495680_0003074_10768_11427 | 219 |
| 1022 | 3300047322 | Ga0495680_0003453 | Ga0495680_0003453_11910_12569 | 219 |
| 1023 | 3300047322 | Ga0495680_0005738 | Ga0495680_0005738_6646_7305 | 219 |
| 1024 | 3300047322 | Ga0495680_0042583 | Ga0495680_0042583_359_1018 | 219 |
| 1025 | 3300047323 | Ga0495683_0284350 | Ga0495683_0284350_21_683 | 219 |
| 1026 | 3300047444 | Ga0495675_0000253 | Ga0495675_0000253_20147_20806 | 219 |
| 1027 | 3300047447 | Ga0495685_108872 | Ga0495685_108872_187_846 | 219 |
| 1028 | 3300047471 | Ga0495684_0000008 | Ga0495684_0000008_113278_113937 | 219 |
| 1029 | 3300047471 | Ga0495684_0007003 | Ga0495684_0007003_1237_1896 | 219 |
| 1030 | 3300047471 | Ga0495684_0011194 | Ga0495684_0011194_2599_3258 | 219 |
| 1031 | 3300047471 | Ga0495684_0012423 | Ga0495684_0012423_226_885 | 219 |
| 1032 | 3300047673 | Ga0495593_0000137 | Ga0495593_0000137_23249_23908 | 219 |
| 1033 | 3300047673 | Ga0495593_0001564 | Ga0495593_0001564_6499_7158 | 219 |
| 1034 | 3300048088 | Ga0495602_0000264 | Ga0495602_0000264_3698_4357 | 219 |
| 1035 | 3300048088 | Ga0495602_0002962 | Ga0495602_0002962_5867_6526 | 219 |
| 1036 | 3300048088 | Ga0495602_0118253 | Ga0495602_0118253_128_787 | 219 |
| 1037 | 3300048089 | Ga0495614_0054957 | Ga0495614_0054957_391_1050 | 219 |
| 1038 | 3300048903 | Ga0496100_0015265 | Ga0496100_0015265_1065_1724 | 219 |
| 1039 | 3300048903 | Ga0496100_0203372 | Ga0496100_0203372_254_943 | 219 |
| 1040 | 3300048904 | Ga0496101_0103881 | Ga0496101_0103881_554_1213 | 219 |
| 1041 | 3300048904 | Ga0496101_0312080 | Ga0496101_0312080_66_725 | 219 |
| 1042 | 3300048904 | Ga0496101_0330343 | Ga0496101_0330343_272_931 | 219 |
| 1043 | 3300048905 | Ga0496102_0008851 | Ga0496102_0008851_3357_4016 | 219 |
| 1044 | 3300048905 | Ga0496102_0034171 | Ga0496102_0034171_1716_2375 | 219 |
| 1045 | 3300048906 | Ga0496103_0051990 | Ga0496103_0051990_1827_2486 | 219 |
| 1046 | 3300048907 | Ga0496104_0004620 | Ga0496104_0004620_11181_11840 | 219 |
| 1047 | 3300048907 | Ga0496104_0096681 | Ga0496104_0096681_619_1302 | 219 |
| 1048 | 3300048907 | Ga0496104_0394302 | Ga0496104_0394302_347_1006 | 219 |
| 1049 | 3300048907 | Ga0496104_0605797 | Ga0496104_0605797_294_983 | 219 |
| 1050 | 3300048908 | Ga0496105_0102458 | Ga0496105_0102458_994_1653 | 219 |
| 1051 | 3300048908 | Ga0496105_0108903 | Ga0496105_0108903_715_1374 | 219 |
| 1052 | 3300048908 | Ga0496105_0112560 | Ga0496105_0112560_1443_2102 | 219 |
| 1053 | 3300048908 | Ga0496105_0280613 | Ga0496105_0280613_283_942 | 219 |
| 1054 | 3300048909 | Ga0496106_0000080 | Ga0496106_0000080_27255_27914 | 219 |
| 1055 | 3300048910 | Ga0496107_0001928 | Ga0496107_0001928_3061_3720 | 219 |
| 1056 | 3300048910 | Ga0496107_0317446 | Ga0496107_0317446_40_699 | 219 |
| 1057 | 3300048910 | Ga0496107_0487376 | Ga0496107_0487376_229_888 | 219 |
| 1058 | 3300048911 | Ga0496108_0095736 | Ga0496108_0095736_1577_2236 | 219 |
| 1059 | 3300048911 | Ga0496108_0114095 | Ga0496108_0114095_1180_1839 | 219 |
| 1060 | 3300048912 | Ga0496109_0001577 | Ga0496109_0001577_5700_6359 | 219 |
| 1061 | 3300048912 | Ga0496109_0362684 | Ga0496109_0362684_311_970 | 219 |
| 1062 | 3300048912 | Ga0496109_0446793 | Ga0496109_0446793_215_874 | 219 |
| 1063 | 3300048912 | Ga0496109_0547642 | Ga0496109_0547642_314_973 | 219 |
| 1064 | 3300048913 | Ga0496110_0025060 | Ga0496110_0025060_1828_2487 | 219 |
| 1065 | 3300048913 | Ga0496110_0789910 | Ga0496110_0789910_151_810 | 219 |
| 1066 | 3300048914 | Ga0496111_0000600 | Ga0496111_0000600_13007_13666 | 219 |
| 1067 | 3300048914 | Ga0496111_0601557 | Ga0496111_0601557_29_688 | 219 |
| 1068 | 3300048915 | Ga0496112_0012198 | Ga0496112_0012198_4788_5447 | 219 |
| 1069 | 3300048915 | Ga0496112_0126770 | Ga0496112_0126770_994_1653 | 219 |
| 1070 | 3300048915 | Ga0496112_0228649 | Ga0496112_0228649_187_846 | 219 |
| 1071 | 3300048916 | Ga0496113_0030702 | Ga0496113_0030702_308_967 | 219 |
| 1072 | 3300048916 | Ga0496113_0103015 | Ga0496113_0103015_1001_1660 | 219 |
| 1073 | 3300048916 | Ga0496113_0633391 | Ga0496113_0633391_101_760 | 219 |
| 1074 | 3300048917 | Ga0496114_0008209 | Ga0496114_0008209_6375_7034 | 219 |
| 1075 | 3300048917 | Ga0496114_0043584 | Ga0496114_0043584_1954_2613 | 219 |
| 1076 | 3300048917 | Ga0496114_0219059 | Ga0496114_0219059_524_1183 | 219 |
| 1077 | 3300048917 | Ga0496114_0253648 | Ga0496114_0253648_653_1312 | 219 |
| 1078 | 3300048917 | Ga0496114_0723951 | Ga0496114_0723951_104_763 | 219 |
| 1079 | 3300048918 | Ga0496115_0200274 | Ga0496115_0200274_572_1231 | 219 |
| 1080 | 3300049568 | Ga0501031_0164817 | Ga0501031_0164817_269_928 | 219 |
| 1081 | 3300049570 | Ga0501033_0331952 | Ga0501033_0331952_279_938 | 219 |
| 1082 | 3300049572 | Ga0501036_0079229 | Ga0501036_0079229_1488_2147 | 219 |
| 1083 | 3300049572 | Ga0501036_0174756 | Ga0501036_0174756_1072_1731 | 219 |
| 1084 | 3300049572 | Ga0501036_0370251 | Ga0501036_0370251_276_938 | 219 |
| 1085 | 3300049574 | Ga0501038_0027623 | Ga0501038_0027623_2834_3493 | 219 |
| 1086 | 3300049574 | Ga0501038_0195479 | Ga0501038_0195479_29_688 | 219 |
| 1087 | 3300049575 | Ga0501039_0083413 | Ga0501039_0083413_1580_2239 | 219 |
| 1088 | 3300049577 | Ga0501041_0042610 | Ga0501041_0042610_1945_2604 | 219 |
| 1089 | 3300049578 | Ga0501042_0075638 | Ga0501042_0075638_1486_2145 | 219 |
| 1090 | 3300049580 | Ga0501046_0055704 | Ga0501046_0055704_1445_2104 | 219 |
| 1091 | 3300049580 | Ga0501046_0242546 | Ga0501046_0242546_14_676 | 219 |
| 1092 | 3300049581 | Ga0501047_0009041 | Ga0501047_0009041_5710_6369 | 219 |
| 1093 | 3300049582 | Ga0501048_0064100 | Ga0501048_0064100_1450_2109 | 219 |
| 1094 | 3300049586 | Ga0501070_0133410 | Ga0501070_0133410_909_1568 | 219 |
| 1095 | 3300049588 | Ga0501072_0009444 | Ga0501072_0009444_2890_3549 | 219 |
| 1096 | 3300049588 | Ga0501072_0054312 | Ga0501072_0054312_1934_2593 | 219 |
| 1097 | 3300049589 | Ga0501073_0044779 | Ga0501073_0044779_2268_2927 | 219 |
| 1098 | 3300049589 | Ga0501073_0120098 | Ga0501073_0120098_1124_1783 | 219 |
| 1099 | 3300049590 | Ga0501074_0096018 | Ga0501074_0096018_172_831 | 219 |
| 1100 | 3300049590 | Ga0501074_0331483 | Ga0501074_0331483_44_703 | 219 |
| 1101 | 3300049590 | Ga0501074_0505059 | Ga0501074_0505059_159_818 | 219 |
| 1102 | 3300049591 | Ga0501075_0066655 | Ga0501075_0066655_654_1313 | 219 |
| 1103 | 3300049592 | Ga0501076_0003344 | Ga0501076_0003344_10359_11018 | 219 |
| 1104 | 3300049592 | Ga0501076_0041189 | Ga0501076_0041189_2439_3104 | 219 |
| 1105 | 3300049592 | Ga0501076_0152764 | Ga0501076_0152764_1015_1674 | 219 |
| 1106 | 3300049593 | Ga0501077_0013776 | Ga0501077_0013776_2063_2737 | 219 |
| 1107 | 3300049593 | Ga0501077_0032171 | Ga0501077_0032171_24_683 | 219 |
| 1108 | 3300049593 | Ga0501077_0120137 | Ga0501077_0120137_882_1541 | 219 |
| 1109 | 3300049741 | Ga0501079_0010485 | Ga0501079_0010485_3721_4395 | 219 |
| 1110 | 3300049741 | Ga0501079_0404163 | Ga0501079_0404163_334_993 | 219 |
| 1111 | 3300049742 | Ga0501080_0094204 | Ga0501080_0094204_1479_2138 | 219 |
| 1112 | 3300049742 | Ga0501080_0156207 | Ga0501080_0156207_837_1511 | 219 |
| 1113 | 3300049743 | Ga0501081_0023585 | Ga0501081_0023585_73_747 | 219 |
| 1114 | 3300049743 | Ga0501081_0078102 | Ga0501081_0078102_228_887 | 219 |
| 1115 | 3300049743 | Ga0501081_0204071 | Ga0501081_0204071_409_1068 | 219 |
| 1116 | 3300049744 | Ga0501083_0085608 | Ga0501083_0085608_74_778 | 219 |
| 1117 | 3300049744 | Ga0501083_0281151 | Ga0501083_0281151_327_986 | 219 |
| 1118 | 3300049823 | Ga0501044_0000222 | Ga0501044_0000222_54944_55603 | 219 |
| 1119 | 3300049824 | Ga0501045_0016710 | Ga0501045_0016710_3250_3918 | 219 |
| 1120 | 3300050490 | nmdc:mga03n38_85932_c1 | nmdc:mga03n38_85932_c1_702_1361 | 219 |
| 1121 | 3300050491 | nmdc:mga00v17_27387_c1 | nmdc:mga00v17_27387_c1_1920_2579 | 219 |
| 1122 | 3300050493 | nmdc:mga0k408_77654_c1 | nmdc:mga0k408_77654_c1_1115_1774 | 219 |
| 1123 | 3300050507 | nmdc:mga05p37_110601_c1 | nmdc:mga05p37_110601_c1_1932_2591 | 219 |
| 1124 | 3300050507 | nmdc:mga05p37_130341_c1 | nmdc:mga05p37_130341_c1_925_1584 | 219 |
| 1125 | 3300050507 | nmdc:mga05p37_441882_c1 | nmdc:mga05p37_441882_c1_770_1429 | 219 |
| 1126 | 3300050507 | nmdc:mga05p37_5066_c1 | nmdc:mga05p37_5066_c1_13711_14370 | 219 |
| 1127 | 3300050508 | nmdc:mga09592_4709_c1 | nmdc:mga09592_4709_c1_8271_8930 | 219 |
| 1128 | 3300050508 | nmdc:mga09592_66292_c1 | nmdc:mga09592_66292_c1_642_1301 | 219 |
| 1129 | 3300050509 | nmdc:mga0qj67_111240_c1 | nmdc:mga0qj67_111240_c1_371_1030 | 219 |
| 1130 | 3300050509 | nmdc:mga0qj67_111501_c1 | nmdc:mga0qj67_111501_c1_691_1350 | 219 |
| 1131 | 3300050509 | nmdc:mga0qj67_168264_c1 | nmdc:mga0qj67_168264_c1_191_850 | 219 |
| 1132 | 3300050509 | nmdc:mga0qj67_256242_c1 | nmdc:mga0qj67_256242_c1_194_856 | 219 |
| 1133 | 3300050509 | nmdc:mga0qj67_45819_c1 | nmdc:mga0qj67_45819_c1_1062_1724 | 219 |
| 1134 | 3300050510 | nmdc:mga06r32_123078_c1 | nmdc:mga06r32_123078_c1_935_1594 | 219 |
| 1135 | 3300050510 | nmdc:mga06r32_361204_c1 | nmdc:mga06r32_361204_c1_275_934 | 219 |
| 1136 | 3300050511 | nmdc:mga08y16_1092714_c1 | nmdc:mga08y16_1092714_c1_70_729 | 219 |
| 1137 | 3300050511 | nmdc:mga08y16_715495_c1 | nmdc:mga08y16_715495_c1_63_722 | 219 |
| 1138 | 3300050511 | nmdc:mga08y16_7942_c1 | nmdc:mga08y16_7942_c1_6378_7037 | 219 |
| 1139 | 3300050511 | nmdc:mga08y16_96211_c1 | nmdc:mga08y16_96211_c1_2198_2857 | 219 |
| 1140 | 3300050512 | nmdc:mga0n895_232262_c1 | nmdc:mga0n895_232262_c1_647_1306 | 219 |
| 1141 | 3300050512 | nmdc:mga0n895_969_c1 | nmdc:mga0n895_969_c1_2550_3227 | 219 |
| 1142 | 3300050513 | nmdc:mga0rr50_59735_c1 | nmdc:mga0rr50_59735_c1_1909_2568 | 219 |
| 1143 | 3300050513 | nmdc:mga0rr50_689068_c1 | nmdc:mga0rr50_689068_c1_190_849 | 219 |
| 1144 | 3300050515 | nmdc:mga0a205_19407_c1 | nmdc:mga0a205_19407_c1_3099_3758 | 219 |
| 1145 | 3300050515 | nmdc:mga0a205_50550_c1 | nmdc:mga0a205_50550_c1_1484_2161 | 219 |
| 1146 | 3300050516 | nmdc:mga0sz30_44143_c1 | nmdc:mga0sz30_44143_c1_893_1552 | 219 |
| 1147 | 3300053077 | Ga0495601_0000003 | Ga0495601_0000003_113491_114150 | 219 |
| 1148 | 3300053077 | Ga0495601_0002673 | Ga0495601_0002673_4780_5439 | 219 |
| 1149 | 3300053078 | Ga0495612_0000009 | Ga0495612_0000009_43930_44589 | 219 |
| 1150 | 3300053078 | Ga0495612_0005512 | Ga0495612_0005512_4021_4680 | 219 |
| 1151 | 3300053084 | Ga0495595_0000075 | Ga0495595_0000075_3716_4375 | 219 |
| 1152 | 3300053084 | Ga0495595_0000640 | Ga0495595_0000640_4429_5088 | 219 |
| 1153 | 3300053084 | Ga0495595_0100821 | Ga0495595_0100821_48_710 | 219 |
| 1154 | 3300053085 | Ga0495619_0000039 | Ga0495619_0000039_74113_74772 | 219 |
| 1155 | 3300053085 | Ga0495619_0001034 | Ga0495619_0001034_3966_4625 | 219 |
| 1156 | 3300053085 | Ga0495619_0002157 | Ga0495619_0002157_5602_6261 | 219 |
| 1157 | 3300053085 | Ga0495619_0002259 | Ga0495619_0002259_4413_5072 | 219 |
| 1158 | 3300053096 | Ga0500641_0021543 | Ga0500641_0021543_928_1587 | 219 |
| 1159 | 3300053099 | Ga0500654_094665 | Ga0500654_094665_250_909 | 219 |
| 1160 | 3300053119 | Ga0500595_004295 | Ga0500595_004295_1229_1888 | 219 |
| 1161 | 3300053153 | Ga0500616_0042715 | Ga0500616_0042715_1572_2231 | 219 |
| 1162 | 3300053153 | Ga0500616_0047451 | Ga0500616_0047451_282_941 | 219 |
| 1163 | 3300053158 | Ga0500627_0174739 | Ga0500627_0174739_222_881 | 219 |
| 1164 | 3300054114 | Ga0501084_0014155 | Ga0501084_0014155_2051_2710 | 219 |
| 1165 | 3300054114 | Ga0501084_0046021 | Ga0501084_0046021_155_817 | 219 |
| 1166 | 3300054114 | Ga0501084_0093516 | Ga0501084_0093516_589_1263 | 219 |
| 1167 | 3300054114 | Ga0501084_0123741 | Ga0501084_0123741_635_1294 | 219 |
| 1168 | 3300054114 | Ga0501084_0280819 | Ga0501084_0280819_134_793 | 219 |
| 1169 | 3300059491 | Ga0587070_055869 | Ga0587070_055869_69_728 | 219 |
| 1170 | 3300059503 | Ga0587080_033368 | Ga0587080_033368_216_875 | 219 |
| 1171 | 3300060353 | Ga0501082_0000371 | Ga0501082_0000371_18621_19325 | 219 |
| 1172 | 3300060353 | Ga0501082_0009046 | Ga0501082_0009046_4361_5020 | 219 |
| 1173 | 3300060353 | Ga0501082_0022842 | Ga0501082_0022842_81_755 | 219 |
| 1174 | 3300060353 | Ga0501082_0312034 | Ga0501082_0312034_164_826 | 219 |
| 1175 | 3300060353 | Ga0501082_0934797 | Ga0501082_0934797_59_718 | 219 |
| 1176 | 3300061719 | Ga0466962_0042318 | Ga0466962_0042318_918_1580 | 219 |
| 1177 | 3300061734 | Ga0530510_0052853 | Ga0530510_0052853_461_1129 | 219 |
| 1178 | 3300061734 | Ga0530510_0078131 | Ga0530510_0078131_142_801 | 219 |
| 1179 | 3300061734 | Ga0530510_0127126 | Ga0530510_0127126_1033_1692 | 219 |
| 1180 | iso_pu_bacteria | 2643221618 | 2644107444 | 219 |
| 1181 | iso_pu_bacteria | 2643221626 | 2644146040 | 219 |
| 1182 | iso_pu_bacteria | 2643221655 | 2644308839 | 219 |
| 1183 | iso_pu_bacteria | 2643221659 | 2644332663 | 219 |
| 1184 | iso_pu_bacteria | 2643221698 | 2644540065 | 219 |
| 1185 | iso_pu_bacteria | 2643221712 | 2644614780 | 219 |
| 1186 | iso_pu_bacteria | 2941499720 | 2941502289 | 219 |
| 1187 | 3300001904 | JGI24736J21556_1001546 | JGI24736J21556_10015464 | 220 |
| 1188 | 3300001979 | JGI24740J21852_10021331 | JGI24740J21852_100213311 | 220 |
| 1189 | 3300001990 | JGI24737J22298_10049062 | JGI24737J22298_100490622 | 220 |
| 1190 | 3300005339 | Ga0070660_100009935 | Ga0070660_1000099354 | 220 |
| 1191 | 3300005440 | Ga0070705_100243743 | Ga0070705_1002437432 | 220 |
| 1192 | 3300005455 | Ga0070663_100083200 | Ga0070663_1000832003 | 220 |
| 1193 | 3300005535 | Ga0070684_100105147 | Ga0070684_1001051474 | 220 |
| 1194 | 3300005578 | Ga0068854_100192610 | Ga0068854_1001926102 | 220 |
| 1195 | 3300005616 | Ga0068852_100604052 | Ga0068852_1006040522 | 220 |
| 1196 | 3300009174 | Ga0105241_10158884 | Ga0105241_101588842 | 220 |
| 1197 | 3300010375 | Ga0105239_10193763 | Ga0105239_101937632 | 220 |
| 1198 | 3300013100 | Ga0157373_10125771 | Ga0157373_101257712 | 220 |
| 1199 | 3300013102 | Ga0157371_10034859 | Ga0157371_100348592 | 220 |
| 1200 | 3300013307 | Ga0157372_10009012 | Ga0157372_1000901210 | 220 |
| 1201 | 3300013307 | Ga0157372_10649493 | Ga0157372_106494932 | 220 |
| 1202 | 3300020076 | Ga0206355_1426974 | Ga0206355_14269741 | 220 |
| 1203 | 3300020082 | Ga0206353_10948023 | Ga0206353_109480231 | 220 |
| 1204 | 3300025904 | Ga0207647_10006363 | Ga0207647_100063639 | 220 |
| 1205 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003577 | 220 |
| 1206 | 3300025909 | Ga0207705_10001112 | Ga0207705_100011121 | 220 |
| 1207 | 3300025913 | Ga0207695_10034241 | Ga0207695_100342413 | 220 |
| 1208 | 3300025919 | Ga0207657_10010100 | Ga0207657_100101004 | 220 |
| 1209 | 3300025920 | Ga0207649_10001056 | Ga0207649_100010562 | 220 |
| 1210 | 3300025924 | Ga0207694_10427815 | Ga0207694_104278152 | 220 |
| 1211 | 3300025929 | Ga0207664_10456760 | Ga0207664_104567602 | 220 |
| 1212 | 3300025945 | Ga0207679_10038942 | Ga0207679_100389424 | 220 |
| 1213 | 3300025949 | Ga0207667_10039559 | Ga0207667_100395593 | 220 |
| 1214 | 3300026023 | Ga0207677_10356352 | Ga0207677_103563522 | 220 |
| 1215 | 3300026067 | Ga0207678_10002336 | Ga0207678_1000233611 | 220 |
| 1216 | 3300026116 | Ga0207674_10041150 | Ga0207674_100411502 | 220 |
| 1217 | 3300026142 | Ga0207698_10021118 | Ga0207698_100211183 | 220 |
| 1218 | 3300037312 | Ga0395899_0094522 | Ga0395899_0094522_230_892 | 220 |
| 1219 | 3300037418 | Ga0395900_0210856 | Ga0395900_0210856_263_925 | 220 |
| 1220 | 3300037466 | Ga0395898_0011006 | Ga0395898_0011006_155_823 | 220 |
| 1221 | 3300037471 | Ga0395905_0251504 | Ga0395905_0251504_331_999 | 220 |
| 1222 | 3300038443 | Ga0395901_0375975 | Ga0395901_0375975_122_784 | 220 |
| 1223 | 3300039450 | Ga0436363_1148610 | Ga0436363_1148610_45_710 | 220 |
| 1224 | 3300044694 | Ga0466963_0072443 | Ga0466963_0072443_947_1609 | 220 |
| 1225 | 3300046684 | Ga0495669_0134178 | Ga0495669_0134178_394_1080 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9685 | 4 | 220 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9619 | 4 | 220 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.959 | 4 | 220 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9572 | 4 | 220 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.9359 | 4 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9631 | 6 | 107 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9495 | 156 | 219 | 3.30.1020.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9467 | 156 | 217 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9363 | 6 | 107 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9356 | 156 | 219 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7WM65-F1-model_v4 | Redoxin domain-containing protein | 0.995 | 4 | 170 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A534YD48-F1-model_v4 | Peroxiredoxin | 0.9867 | 4 | 185 |
GO:0005829
GO:0045454 GO:0051920 |
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.9843 | 1 | 107 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A258E9H3-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9832 | 4 | 112 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A2V5ZNJ6-F1-model_v4 | Peroxidase | 0.9813 | 4 | 95 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar