F491916

General Info

Members Datasets Scaffolds Average Seq Length
1225 453 1188 219

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0121492|Ga0436362_0121492_150_887
Length 245
Sequence MFPPGFYRFPATRRDGGGIATKGGHAMTLALGDTAPDFEAQATEGPVRFHEWIGDSWAVLFSHPKDFTPVCTTELGYMAKIKPEFDRRDVKIIGLSVDSTGDHERWVADIEETQGTAPNFPIIGDADFTVAKLYGMLPAATSGDAGTRTSADNQTVRNVFVVGPDKKIKLVLVYPMTTGRNFDEVLRVIDSLQMTAKHKVATPVNWKQGEDVIIAGSVSDDDAKKTYPQGWKSPKPYIRIVPQPR

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
6 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
7 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
8 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
9 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
10 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
11 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
12 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
13 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
14 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
15 2643221618 Ensifer sp. Root231 Isolate Unclassified
16 2643221626 Ensifer sp. Root31 Isolate Unclassified
17 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
18 2643221655 Ensifer sp. Root1252 Isolate Unclassified
19 2643221659 Ensifer sp. Root127 Isolate Unclassified
20 2643221698 Ensifer sp. Root142 Isolate Unclassified
21 2643221712 Ensifer sp. Root258 Isolate Unclassified
22 2738541293 Rhizobium sp. GV031 Isolate Unclassified
23 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
24 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
25 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
26 2844163670 Ensifer sp. 1H6 Isolate Unclassified
27 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
28 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
29 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
30 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
31 2996887358 Rhizobium sp. R711 Isolate Nodule
32 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
33 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
38 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
151 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
158 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
163 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
232 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
233 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
281 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
282 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
283 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
284 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
287 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
288 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
289 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
290 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
291 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
317 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
318 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
323 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
326 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
331 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
334 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
335 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
348 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
379 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
380 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
406 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
407 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
408 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
416 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
417 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
418 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
419 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
420 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
421 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
422 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
423 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
424 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
425 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
426 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
427 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
428 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
434 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
435 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
436 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
449 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
450 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
451 8005258706 Rhizobium sp. R693 Isolate Nodule
452 8005321885 Rhizobium sp. R72 Isolate Nodule
453 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 1.88
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 1.14
Rhizoplane 5.71
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001546 3300001904 Bacteria 4188
2 JGI24740J21852_10021331 3300001979 Bacteria 2247
3 JGI24737J22298_10049062 3300001990 Bacteria 1285
4 JGI24035J26624_1006303 3300002126 Bacteria 1142
5 Ga0007417J51691_1073041 3300003544 Bacteria 975
6 Ga0058860_11949334 3300004801 Bacteria 818
7 Ga0058862_10157652 3300004803 Bacteria 858
8 Ga0065712_10012833 3300005290 Bacteria 2220
9 Ga0065712_10032685 3300005290 Bacteria 970
10 Ga0065712_10151397 3300005290 Bacteria 1367
11 Ga0065715_10009372 3300005293 Bacteria 4356
12 Ga0065715_10055804 3300005293 Bacteria 962
13 Ga0065707_10227701 3300005295 Bacteria 1200
14 Ga0070658_10149875 3300005327 Bacteria 1952
15 Ga0070658_10158544 3300005327 Bacteria 1898
16 Ga0070676_10162115 3300005328 Bacteria 1440
17 Ga0070683_100020623 3300005329 Bacteria 5866
18 Ga0070683_100025751 3300005329 Bacteria 5288
19 Ga0070683_100034751 3300005329 Bacteria 4606
20 Ga0070683_100103425 3300005329 Bacteria 2684
21 Ga0070690_100176681 3300005330 Bacteria 1473
22 Ga0070680_100014149 3300005336 Bacteria 6231
23 Ga0070680_100257606 3300005336 Bacteria 1475
24 Ga0068868_100080096 3300005338 Bacteria 2617
25 Ga0070660_100002826 3300005339 Bacteria 11944
26 Ga0070660_100009935 3300005339 Bacteria 6714
27 Ga0070660_100498792 3300005339 Bacteria 1013
28 Ga0070691_10005642 3300005341 Bacteria 5704
29 Ga0070691_10216479 3300005341 Bacteria 1013
30 Ga0070661_100000041 3300005344 Bacteria 99916
31 Ga0070661_100042290 3300005344 Bacteria 3326
32 Ga0070661_100073409 3300005344 Bacteria 2519
33 Ga0070661_100144694 3300005344 Bacteria 1793
34 Ga0070692_10299253 3300005345 Bacteria 982
35 Ga0070668_100029391 3300005347 Bacteria 4175
36 Ga0070668_100093029 3300005347 Bacteria 2379
37 Ga0070668_100140883 3300005347 Bacteria 1943
38 Ga0070669_100051452 3300005353 Bacteria 3011
39 Ga0070669_100107050 3300005353 Bacteria 2118
40 Ga0070669_100236350 3300005353 Bacteria 1450
41 Ga0070671_100098474 3300005355 Bacteria 2453
42 Ga0070688_100067483 3300005365 Bacteria 2279
43 Ga0070688_100104790 3300005365 Bacteria 1871
44 Ga0070667_100017618 3300005367 Bacteria 5917
45 Ga0070667_100683478 3300005367 Bacteria 949
46 Ga0070709_10004332 3300005434 Bacteria 7649
47 Ga0070709_10019181 3300005434 Bacteria 3948
48 Ga0070714_100006242 3300005435 Bacteria 9178
49 Ga0070714_100010508 3300005435 Bacteria 7318
50 Ga0070714_100030048 3300005435 Bacteria 4521
51 Ga0070714_100059408 3300005435 Bacteria 3278
52 Ga0070714_100061341 3300005435 Bacteria 3229
53 Ga0070714_100187329 3300005435 Unclassified 1886
54 Ga0070714_100245371 3300005435 Bacteria 1654
55 Ga0070713_100000082 3300005436 Bacteria 59649
56 Ga0070713_100008049 3300005436 Bacteria 7447
57 Ga0070713_100014411 3300005436 Bacteria 5872
58 Ga0070713_100014989 3300005436 Bacteria 5773
59 Ga0070713_100041798 3300005436 Bacteria 3738
60 Ga0070713_100747518 3300005436 Bacteria 935
61 Ga0070710_10003513 3300005437 Bacteria 7426
62 Ga0070710_10078099 3300005437 Bacteria 1925
63 Ga0070710_10088215 3300005437 Bacteria 1825
64 Ga0070711_100005906 3300005439 Bacteria 7350
65 Ga0070711_100035041 3300005439 Bacteria 3352
66 Ga0070711_100057541 3300005439 Bacteria 2692
67 Ga0070711_100167351 3300005439 Bacteria 1672
68 Ga0070705_100199479 3300005440 Bacteria 1370
69 Ga0070705_100243743 3300005440 Bacteria 1258
70 Ga0070700_100189042 3300005441 Bacteria 1438
71 Ga0070694_100013180 3300005444 Bacteria 5160
72 Ga0070708_100000591 3300005445 Bacteria 27222
73 Ga0070708_100005942 3300005445 Bacteria 9705
74 Ga0070708_100024431 3300005445 Bacteria 5157
75 Ga0070708_100132297 3300005445 Bacteria 2309
76 Ga0070708_100179668 3300005445 Bacteria 1977
77 Ga0070708_100504208 3300005445 Bacteria 1142
78 Ga0070708_100639337 3300005445 Bacteria 1003
79 Ga0070663_100083200 3300005455 Bacteria 2356
80 Ga0070663_100120677 3300005455 Bacteria 1980
81 Ga0070678_100089382 3300005456 Bacteria 2357
82 Ga0070662_100485489 3300005457 Bacteria 1029
83 Ga0070662_100673803 3300005457 Bacteria 874
84 Ga0070681_10027219 3300005458 Bacteria 5749
85 Ga0070681_10041200 3300005458 Bacteria 4627
86 Ga0070681_10169066 3300005458 Bacteria 2108
87 Ga0070681_10334269 3300005458 Bacteria 1424
88 Ga0070706_100001102 3300005467 Bacteria 29219
89 Ga0070706_100007691 3300005467 Bacteria 10077
90 Ga0070706_100009021 3300005467 Bacteria 9286
91 Ga0070706_100026212 3300005467 Bacteria 5364
92 Ga0070706_100053581 3300005467 Bacteria 3723
93 Ga0070706_100149766 3300005467 Bacteria 2178
94 Ga0070706_100232846 3300005467 Bacteria 1719
95 Ga0070707_100002467 3300005468 Bacteria 17624
96 Ga0070707_100003569 3300005468 Bacteria 14676
97 Ga0070707_100006204 3300005468 Bacteria 11132
98 Ga0070707_100009048 3300005468 Bacteria 9237
99 Ga0070707_100019118 3300005468 Bacteria 6451
100 Ga0070707_100187051 3300005468 Bacteria 2019
101 Ga0070707_100196087 3300005468 Bacteria 1969
102 Ga0070707_100371521 3300005468 Bacteria 1389
103 Ga0070698_100001309 3300005471 Bacteria 27709
104 Ga0070698_100001661 3300005471 Bacteria 24810
105 Ga0070698_100001665 3300005471 Bacteria 24789
106 Ga0070698_100003182 3300005471 Bacteria 18095
107 Ga0070698_100005317 3300005471 Bacteria 14093
108 Ga0070698_100008526 3300005471 Bacteria 11064
109 Ga0070698_100009752 3300005471 Bacteria 10264
110 Ga0070698_100012150 3300005471 Bacteria 9125
111 Ga0070698_100023955 3300005471 Bacteria 6373
112 Ga0070698_100036344 3300005471 Bacteria 5089
113 Ga0070698_100355926 3300005471 Bacteria 1396
114 Ga0070699_100018447 3300005518 Bacteria 5994
115 Ga0070699_100276844 3300005518 Bacteria 1503
116 Ga0070699_100297810 3300005518 Bacteria 1447
117 Ga0070699_100836271 3300005518 Bacteria 843
118 Ga0070679_100023466 3300005530 Bacteria 6039
119 Ga0070679_100209681 3300005530 Bacteria 1912
120 Ga0070679_100241052 3300005530 Bacteria 1765
121 Ga0070679_100614799 3300005530 Bacteria 1030
122 Ga0070684_100041997 3300005535 Bacteria 3946
123 Ga0070684_100086154 3300005535 Bacteria 2787
124 Ga0070684_100105147 3300005535 Bacteria 2526
125 Ga0070697_100003592 3300005536 Bacteria 11923
126 Ga0070697_100036352 3300005536 Bacteria 3978
127 Ga0070697_100065932 3300005536 Bacteria 2959
128 Ga0070697_100068493 3300005536 Bacteria 2906
129 Ga0070697_100100669 3300005536 Bacteria 2400
130 Ga0070697_100715297 3300005536 Bacteria 884
131 Ga0068853_100059756 3300005539 Bacteria 3293
132 Ga0070695_100015384 3300005545 Bacteria 4621
133 Ga0070695_100113218 3300005545 Bacteria 1844
134 Ga0070696_100006691 3300005546 Bacteria 7700
135 Ga0070696_100051921 3300005546 Bacteria 2852
136 Ga0070696_100222347 3300005546 Bacteria 1417
137 Ga0070693_100024784 3300005547 Bacteria 3222
138 Ga0070665_100033882 3300005548 Bacteria 5137
139 Ga0070665_100054303 3300005548 Bacteria 4018
140 Ga0070665_101106780 3300005548 Bacteria 804
141 Ga0068855_100019205 3300005563 Bacteria 8214
142 Ga0068855_100040999 3300005563 Bacteria 5489
143 Ga0068855_100127377 3300005563 Bacteria 2910
144 Ga0068855_100157753 3300005563 Bacteria 2577
145 Ga0068855_100239215 3300005563 Bacteria 2029
146 Ga0068855_100338539 3300005563 Bacteria 1659
147 Ga0070664_100022364 3300005564 Bacteria 5213
148 Ga0068857_100218622 3300005577 Bacteria 1740
149 Ga0068854_100192610 3300005578 Bacteria 1598
150 Ga0068854_100663036 3300005578 Bacteria 897
151 Ga0068856_100089394 3300005614 Bacteria 3063
152 Ga0068856_100093010 3300005614 Bacteria 3001
153 Ga0070702_100067488 3300005615 Bacteria 2101
154 Ga0068852_100256473 3300005616 Bacteria 1677
155 Ga0068852_100320332 3300005616 Bacteria 1505
156 Ga0068852_100604052 3300005616 Bacteria 1101
157 Ga0068859_100046143 3300005617 Bacteria 4377
158 Ga0068864_100069399 3300005618 Bacteria 3064
159 Ga0068864_100117908 3300005618 Bacteria 2370
160 Ga0068864_100344065 3300005618 Bacteria 1406
161 Ga0068866_10378935 3300005718 Bacteria 907
162 Ga0068866_10532197 3300005718 Bacteria 783
163 Ga0068861_100075446 3300005719 Bacteria 2625
164 Ga0068851_10180533 3300005834 Bacteria 1169
165 Ga0068870_10331509 3300005840 Bacteria 970
166 Ga0068863_100011306 3300005841 Bacteria 8645
167 Ga0068863_100601007 3300005841 Bacteria 1089
168 Ga0068858_100920913 3300005842 Bacteria 855
169 Ga0068860_100415631 3300005843 Bacteria 1332
170 Ga0068862_100003797 3300005844 Bacteria 12871
171 Ga0068862_100024969 3300005844 Bacteria 5017
172 Ga0068862_100051631 3300005844 Bacteria 3517
173 Ga0068862_100206612 3300005844 Bacteria 1773
174 Ga0081455_10015272 3300005937 Bacteria 7466
175 Ga0081455_10123148 3300005937 Bacteria 2040
176 Ga0081455_10292865 3300005937 Bacteria 1171
177 Ga0081455_10331401 3300005937 Bacteria 1080
178 Ga0081539_10157753 3300005985 Bacteria 1085
179 Ga0070717_10007092 3300006028 Bacteria 8301
180 Ga0070717_10028432 3300006028 Bacteria 4476
181 Ga0070717_10053770 3300006028 Bacteria 3319
182 Ga0070717_10080610 3300006028 Bacteria 2731
183 Ga0070717_10126030 3300006028 Bacteria 2199
184 Ga0070717_10205681 3300006028 Bacteria 1726
185 Ga0075363_100216879 3300006048 Bacteria 1096
186 Ga0075432_10028966 3300006058 Bacteria 1911
187 Ga0070715_10001832 3300006163 Bacteria 6349
188 Ga0070715_10008237 3300006163 Bacteria 3626
189 Ga0070716_100022208 3300006173 Bacteria 3350
190 Ga0070716_100125681 3300006173 Bacteria 1613
191 Ga0070716_100139619 3300006173 Bacteria 1543
192 Ga0070712_100033486 3300006175 Bacteria 3477
193 Ga0070712_100058375 3300006175 Bacteria 2714
194 Ga0070712_100114211 3300006175 Bacteria 2021
195 Ga0070712_100245177 3300006175 Bacteria 1429
196 Ga0070712_100283796 3300006175 Bacteria 1334
197 Ga0070712_100364011 3300006175 Bacteria 1187
198 Ga0070712_100638582 3300006175 Bacteria 904
199 Ga0097621_100105899 3300006237 Bacteria 2372
200 Ga0068871_100116467 3300006358 Bacteria 2253
201 Ga0075428_100015027 3300006844 Bacteria 8600
202 Ga0075430_100000050 3300006846 Bacteria 61220
203 Ga0075430_100002824 3300006846 Bacteria 14529
204 Ga0075430_100038855 3300006846 Bacteria 4030
205 Ga0075430_100082906 3300006846 Bacteria 2687
206 Ga0075430_100097061 3300006846 Bacteria 2463
207 Ga0075431_100007688 3300006847 Bacteria 10733
208 Ga0075433_10001917 3300006852 Bacteria 15644
209 Ga0075433_10087741 3300006852 Bacteria 2747
210 Ga0075434_100012228 3300006871 Bacteria 8133
211 Ga0075434_100181026 3300006871 Bacteria 2128
212 Ga0075434_100409738 3300006871 Bacteria 1377
213 Ga0075434_101307536 3300006871 Bacteria 736
214 Ga0075429_100024107 3300006880 Bacteria 5277
215 Ga0075429_100055826 3300006880 Bacteria 3437
216 Ga0075429_100193489 3300006880 Bacteria 1782
217 Ga0075429_100610396 3300006880 Bacteria 956
218 Ga0068865_100061825 3300006881 Bacteria 2627
219 Ga0075436_100000262 3300006914 Bacteria 32984
220 Ga0097620_100046143 3300006931 Bacteria 4377
221 Ga0075435_100752619 3300007076 Bacteria 848
222 Ga0099794_10003354 3300007265 Bacteria 6097
223 Ga0099795_10135711 3300007788 Bacteria 997
224 Ga0105240_10066347 3300009093 Bacteria 4477
225 Ga0105240_10067377 3300009093 Bacteria 4437
226 Ga0111539_10367577 3300009094 Bacteria 1674
227 Ga0105245_10008241 3300009098 Bacteria 9109
228 Ga0105245_10069111 3300009098 Bacteria 3202
229 Ga0105245_10355423 3300009098 Bacteria 1453
230 Ga0105245_10498443 3300009098 Bacteria 1234
231 Ga0105245_10689161 3300009098 Bacteria 1054
232 Ga0114129_10019737 3300009147 Bacteria 9593
233 Ga0114129_10083228 3300009147 Bacteria 4446
234 Ga0114129_10084319 3300009147 Bacteria 4412
235 Ga0114129_10233255 3300009147 Bacteria 2478
236 Ga0114129_10284406 3300009147 Bacteria 2209
237 Ga0114129_10425114 3300009147 Bacteria 1747
238 Ga0114129_11686697 3300009147 Bacteria 774
239 Ga0105241_10105659 3300009174 Bacteria 2246
240 Ga0105241_10158884 3300009174 Bacteria 1856
241 Ga0105242_10251780 3300009176 Bacteria 1592
242 Ga0105242_10902046 3300009176 Bacteria 884
243 Ga0105248_10266395 3300009177 Bacteria 1929
244 Ga0105237_10517365 3300009545 Bacteria 1200
245 Ga0105237_10673846 3300009545 Bacteria 1041
246 Ga0105238_10085401 3300009551 Bacteria 3144
247 Ga0105249_10257461 3300009553 Bacteria 1733
248 Ga0105239_10184345 3300010375 Bacteria 2335
249 Ga0105239_10193763 3300010375 Bacteria 2275
250 Ga0105239_10225689 3300010375 Bacteria 2101
251 Ga0105239_10226695 3300010375 Bacteria 2096
252 Ga0105239_10230433 3300010375 Bacteria 2078
253 Ga0105246_10118557 3300011119 Bacteria 1957
254 Ga0105246_10225168 3300011119 Bacteria 1473
255 Ga0157373_10005491 3300013100 Bacteria 9514
256 Ga0157373_10125771 3300013100 Bacteria 1803
257 Ga0157371_10034859 3300013102 Bacteria 3608
258 Ga0157371_10517536 3300013102 Bacteria 882
259 Ga0157370_10014605 3300013104 Bacteria 8024
260 Ga0157369_10108960 3300013105 Bacteria 2945
261 Ga0157369_10396272 3300013105 Bacteria 1432
262 Ga0157369_10411519 3300013105 Bacteria 1402
263 Ga0157369_10622313 3300013105 Bacteria 1114
264 Ga0157374_10134360 3300013296 Bacteria 2397
265 Ga0157374_10248067 3300013296 Bacteria 1752
266 Ga0157374_10704275 3300013296 Unclassified 1023
267 Ga0157374_10928509 3300013296 Bacteria 888
268 Ga0157378_10013399 3300013297 Bacteria 7166
269 Ga0157378_10258498 3300013297 Bacteria 1670
270 Ga0163162_10246069 3300013306 Bacteria 1920
271 Ga0157372_10009012 3300013307 Bacteria 10605
272 Ga0157372_10523820 3300013307 Bacteria 1382
273 Ga0157372_10649493 3300013307 Bacteria 1228
274 Ga0157372_11543382 3300013307 Bacteria 765
275 Ga0157375_10043156 3300013308 Bacteria 4371
276 Ga0157375_10247379 3300013308 Bacteria 1944
277 Ga0163163_10455173 3300014325 Bacteria 1340
278 Ga0157377_10311164 3300014745 Bacteria 1043
279 Ga0157379_10427843 3300014968 Bacteria 1220
280 Ga0157376_10039722 3300014969 Bacteria 3840
281 Ga0157376_10732203 3300014969 Bacteria 997
282 Ga0163161_10087384 3300017792 Bacteria 2303
283 Ga0206356_11200080 3300020070 Bacteria 1188
284 Ga0206356_11401552 3300020070 Bacteria 796
285 Ga0206356_11423237 3300020070 Bacteria 4623
286 Ga0206355_1410940 3300020076 Bacteria 842
287 Ga0206355_1426974 3300020076 Bacteria 947
288 Ga0206351_10822550 3300020077 Bacteria 826
289 Ga0206352_10800806 3300020078 Bacteria 2116
290 Ga0206350_10616182 3300020080 Bacteria 774
291 Ga0206350_11571218 3300020080 Bacteria 872
292 Ga0206353_10948023 3300020082 Bacteria 890
293 Ga0206353_11285308 3300020082 Bacteria 858
294 Ga0213874_10000875 3300021377 Bacteria 6159
295 Ga0213876_10034717 3300021384 Bacteria 2660
296 Ga0213875_10030019 3300021388 Bacteria 2577
297 Ga0213875_10185488 3300021388 Bacteria 977
298 Ga0224712_10054936 3300022467 Bacteria 1565
299 Ga0207425_1000010 3300025245 Bacteria 572898
300 Ga0209129_1000034 3300025258 Bacteria 330950
301 Ga0209129_1016139 3300025258 Bacteria 1509
302 Ga0209673_1016968 3300025273 Bacteria 2699
303 Ga0207673_1007447 3300025290 Bacteria 1373
304 Ga0209025_1000022 3300025294 Bacteria 574487
305 Ga0209564_1017939 3300025295 Bacteria 2726
306 Ga0209758_1000080 3300025297 Bacteria 261472
307 Ga0209758_1065890 3300025297 Bacteria 1166
308 Ga0209051_1003299 3300025303 Bacteria 10694
309 Ga0207697_10061119 3300025315 Bacteria 1567
310 Ga0207697_10074480 3300025315 Bacteria 1426
311 Ga0207656_10058057 3300025321 Bacteria 1689
312 Ga0207682_10027486 3300025893 Bacteria 2266
313 Ga0207682_10092834 3300025893 Bacteria 1311
314 Ga0207692_10012797 3300025898 Bacteria 3616
315 Ga0207642_10397071 3300025899 Bacteria 824
316 Ga0207688_10121520 3300025901 Bacteria 1524
317 Ga0207680_10148066 3300025903 Bacteria 1563
318 Ga0207647_10006363 3300025904 Bacteria 8586
319 Ga0207685_10010235 3300025905 Bacteria 2760
320 Ga0207645_10051560 3300025907 Bacteria 2629
321 Ga0207645_10132124 3300025907 Bacteria 1625
322 Ga0207705_10000003 3300025909 Bacteria 709270
323 Ga0207705_10001112 3300025909 Bacteria 21864
324 Ga0207705_10059268 3300025909 Bacteria 2763
325 Ga0207705_10080866 3300025909 Bacteria 2368
326 Ga0207684_10000287 3300025910 Bacteria 72313
327 Ga0207684_10001612 3300025910 Bacteria 23951
328 Ga0207684_10003745 3300025910 Bacteria 14699
329 Ga0207684_10012300 3300025910 Bacteria 7450
330 Ga0207684_10016316 3300025910 Bacteria 6377
331 Ga0207684_10072963 3300025910 Bacteria 2915
332 Ga0207684_10137217 3300025910 Bacteria 2101
333 Ga0207684_10417763 3300025910 Bacteria 1153
334 Ga0207684_10536785 3300025910 Bacteria 1001
335 Ga0207707_10010851 3300025912 Bacteria 7918
336 Ga0207707_10029690 3300025912 Bacteria 4781
337 Ga0207707_10079930 3300025912 Bacteria 2855
338 Ga0207707_10435848 3300025912 Bacteria 1122
339 Ga0207695_10009282 3300025913 Bacteria 12181
340 Ga0207695_10034241 3300025913 Bacteria 5528
341 Ga0207695_10058643 3300025913 Bacteria 3995
342 Ga0207695_10315814 3300025913 Bacteria 1452
343 Ga0207671_10113745 3300025914 Bacteria 2062
344 Ga0207671_10275252 3300025914 Bacteria 1327
345 Ga0207693_10019972 3300025915 Bacteria 5328
346 Ga0207693_10050939 3300025915 Bacteria 3250
347 Ga0207693_10129786 3300025915 Bacteria 1981
348 Ga0207693_10203299 3300025915 Bacteria 1558
349 Ga0207693_10211232 3300025915 Bacteria 1525
350 Ga0207693_10232135 3300025915 Bacteria 1449
351 Ga0207663_10016574 3300025916 Bacteria 4089
352 Ga0207663_10033096 3300025916 Bacteria 3075
353 Ga0207663_10271893 3300025916 Bacteria 1255
354 Ga0207663_10293832 3300025916 Bacteria 1211
355 Ga0207660_10038806 3300025917 Bacteria 3326
356 Ga0207660_10051037 3300025917 Bacteria 2939
357 Ga0207660_10234018 3300025917 Bacteria 1445
358 Ga0207660_10875937 3300025917 Bacteria 733
359 Ga0207662_10093863 3300025918 Bacteria 1849
360 Ga0207657_10001151 3300025919 Bacteria 28127
361 Ga0207657_10010100 3300025919 Bacteria 9439
362 Ga0207657_10223985 3300025919 Bacteria 1506
363 Ga0207657_10330489 3300025919 Bacteria 1204
364 Ga0207649_10000437 3300025920 Bacteria 30058
365 Ga0207649_10001056 3300025920 Bacteria 16892
366 Ga0207649_10020766 3300025920 Bacteria 3770
367 Ga0207649_10120990 3300025920 Bacteria 1765
368 Ga0207652_10034811 3300025921 Bacteria 4247
369 Ga0207652_10126992 3300025921 Bacteria 2272
370 Ga0207652_10161585 3300025921 Bacteria 2008
371 Ga0207646_10002603 3300025922 Bacteria 21241
372 Ga0207646_10005499 3300025922 Bacteria 13319
373 Ga0207646_10018766 3300025922 Bacteria 6445
374 Ga0207646_10021584 3300025922 Bacteria 5945
375 Ga0207646_10022997 3300025922 Bacteria 5731
376 Ga0207646_10042075 3300025922 Bacteria 4105
377 Ga0207646_10146961 3300025922 Bacteria 2124
378 Ga0207681_10043337 3300025923 Bacteria 3011
379 Ga0207681_10060952 3300025923 Bacteria 2592
380 Ga0207694_10094522 3300025924 Bacteria 2362
381 Ga0207694_10114347 3300025924 Bacteria 2149
382 Ga0207694_10427815 3300025924 Bacteria 1103
383 Ga0207650_10140474 3300025925 Bacteria 1898
384 Ga0207650_10323710 3300025925 Bacteria 1263
385 Ga0207650_10346032 3300025925 Bacteria 1222
386 Ga0207659_10077899 3300025926 Bacteria 2441
387 Ga0207659_10165561 3300025926 Bacteria 1740
388 Ga0207659_10310614 3300025926 Bacteria 1298
389 Ga0207687_10016580 3300025927 Bacteria 4839
390 Ga0207687_10134787 3300025927 Bacteria 1866
391 Ga0207687_10176229 3300025927 Bacteria 1653
392 Ga0207687_10604615 3300025927 Bacteria 924
393 Ga0207700_10000495 3300025928 Bacteria 23059
394 Ga0207700_10001708 3300025928 Bacteria 12470
395 Ga0207700_10006711 3300025928 Bacteria 6985
396 Ga0207700_10021242 3300025928 Bacteria 4428
397 Ga0207700_10379976 3300025928 Bacteria 1235
398 Ga0207700_10448107 3300025928 Bacteria 1137
399 Ga0207664_10393164 3300025929 Bacteria 1232
400 Ga0207664_10456760 3300025929 Bacteria 1140
401 Ga0207664_10565907 3300025929 Bacteria 1020
402 Ga0207644_10058187 3300025931 Bacteria 2793
403 Ga0207644_10058907 3300025931 Bacteria 2777
404 Ga0207706_10432010 3300025933 Bacteria 1140
405 Ga0207686_10397204 3300025934 Bacteria 1049
406 Ga0207669_10019618 3300025937 Bacteria 3525
407 Ga0207669_10119530 3300025937 Bacteria 1785
408 Ga0207704_10395652 3300025938 Bacteria 1089
409 Ga0207665_10014600 3300025939 Bacteria 5170
410 Ga0207665_10026504 3300025939 Bacteria 3826
411 Ga0207665_10109420 3300025939 Bacteria 1939
412 Ga0207665_10487148 3300025939 Bacteria 951
413 Ga0207665_10689710 3300025939 Bacteria 802
414 Ga0207691_10008622 3300025940 Bacteria 9784
415 Ga0207691_10014130 3300025940 Bacteria 7616
416 Ga0207691_10400166 3300025940 Bacteria 1171
417 Ga0207691_10668477 3300025940 Bacteria 877
418 Ga0207711_10233587 3300025941 Bacteria 1685
419 Ga0207711_10621171 3300025941 Bacteria 1008
420 Ga0207661_10007338 3300025944 Bacteria 7843
421 Ga0207661_10126170 3300025944 Bacteria 2186
422 Ga0207661_10543124 3300025944 Bacteria 1064
423 Ga0207661_10614472 3300025944 Bacteria 998
424 Ga0207679_10038942 3300025945 Bacteria 3392
425 Ga0207667_10016318 3300025949 Bacteria 8393
426 Ga0207667_10039559 3300025949 Bacteria 5025
427 Ga0207667_10187034 3300025949 Bacteria 2126
428 Ga0207667_10212620 3300025949 Bacteria 1982
429 Ga0207667_10432725 3300025949 Bacteria 1338
430 Ga0207667_11015163 3300025949 Bacteria 816
431 Ga0207651_10035758 3300025960 Bacteria 3234
432 Ga0207651_10277536 3300025960 Bacteria 1383
433 Ga0207668_10036843 3300025972 Bacteria 3269
434 Ga0207668_10075504 3300025972 Bacteria 2423
435 Ga0207668_10170452 3300025972 Bacteria 1706
436 Ga0207658_10027001 3300025986 Bacteria 4030
437 Ga0207658_10599829 3300025986 Bacteria 989
438 Ga0207658_10817168 3300025986 Bacteria 847
439 Ga0207677_10034499 3300026023 Bacteria 3277
440 Ga0207677_10338269 3300026023 Bacteria 1257
441 Ga0207677_10356352 3300026023 Bacteria 1227
442 Ga0207677_10692469 3300026023 Bacteria 903
443 Ga0207703_10238303 3300026035 Bacteria 1634
444 Ga0207703_10701232 3300026035 Bacteria 963
445 Ga0207703_10938556 3300026035 Bacteria 829
446 Ga0207639_10024980 3300026041 Bacteria 4330
447 Ga0207678_10002001 3300026067 Bacteria 18558
448 Ga0207678_10002336 3300026067 Bacteria 17192
449 Ga0207678_10071991 3300026067 Bacteria 2962
450 Ga0207678_10199936 3300026067 Bacteria 1709
451 Ga0207708_10238797 3300026075 Bacteria 1461
452 Ga0207702_10026849 3300026078 Bacteria 4782
453 Ga0207702_10115195 3300026078 Bacteria 2397
454 Ga0207641_10082954 3300026088 Bacteria 2786
455 Ga0207648_10087664 3300026089 Bacteria 2716
456 Ga0207648_10287839 3300026089 Bacteria 1470
457 Ga0207676_10093139 3300026095 Bacteria 2480
458 Ga0207676_10434459 3300026095 Bacteria 1234
459 Ga0207674_10041150 3300026116 Bacteria 4780
460 Ga0207674_10051455 3300026116 Bacteria 4203
461 Ga0207675_100006106 3300026118 Bacteria 11460
462 Ga0207675_100076071 3300026118 Bacteria 3143
463 Ga0207675_100147270 3300026118 Bacteria 2240
464 Ga0207675_100286920 3300026118 Bacteria 1600
465 Ga0207675_100566513 3300026118 Bacteria 1136
466 Ga0207683_10050814 3300026121 Bacteria 3632
467 Ga0207683_10055241 3300026121 Bacteria 3482
468 Ga0207683_10123567 3300026121 Bacteria 2325
469 Ga0207683_10175152 3300026121 Bacteria 1944
470 Ga0207683_11028031 3300026121 Bacteria 765
471 Ga0207698_10021118 3300026142 Bacteria 4496
472 Ga0207698_10879645 3300026142 Bacteria 902
473 Ga0210000_1016667 3300027462 Bacteria 1111
474 Ga0209588_1004952 3300027671 Bacteria 3788
475 Ga0209588_1036169 3300027671 Bacteria 1588
476 Ga0209588_1069206 3300027671 Bacteria 1140
477 Ga0209974_10069386 3300027876 Bacteria 1200
478 Ga0207428_10081941 3300027907 Bacteria 2519
479 Ga0207428_10405189 3300027907 Bacteria 998
480 Ga0268266_10033616 3300028379 Bacteria 4359
481 Ga0268266_10033885 3300028379 Bacteria 4340
482 Ga0268266_10211834 3300028379 Bacteria 1777
483 Ga0268265_10010604 3300028380 Bacteria 6224
484 Ga0268265_10018341 3300028380 Bacteria 4847
485 Ga0268265_10123606 3300028380 Bacteria 2137
486 Ga0268265_10170194 3300028380 Bacteria 1861
487 Ga0268265_10232170 3300028380 Bacteria 1622
488 Ga0268264_10077185 3300028381 Bacteria 2837
489 Ga0268264_10795098 3300028381 Bacteria 945
490 Ga0268264_10835103 3300028381 Bacteria 922
491 Ga0265326_10095267 3300028558 Bacteria 844
492 Ga0265318_10053413 3300028577 Bacteria 1515
493 Ga0265332_10003112 3300031238 Bacteria 8088
494 Ga0265325_10082744 3300031241 Bacteria 1593
495 Ga0265340_10006253 3300031247 Bacteria 6561
496 Ga0265340_10046072 3300031247 Bacteria 2128
497 Ga0265339_10061653 3300031249 Bacteria 2017
498 Ga0265327_10005193 3300031251 Bacteria 11011
499 Ga0265327_10057916 3300031251 Bacteria 1991
500 Ga0265316_10129932 3300031344 Bacteria 1898
501 Ga0265342_10002150 3300031712 Bacteria 17367
502 Ga0307405_10001892 3300031731 Bacteria 8995
503 Ga0307412_10027123 3300031911 Bacteria 3568
504 Ga0307409_100214464 3300031995 Bacteria 1733
505 Ga0307409_100367408 3300031995 Bacteria 1363
506 Ga0307416_100043186 3300032002 Bacteria 3528
507 Ga0307415_100059084 3300032126 Bacteria 2643
508 Ga0307415_100509731 3300032126 Bacteria 1054
509 Ga0373926_0057098 3300035083 Bacteria 1417
510 Ga0373926_0074850 3300035083 Bacteria 1247
511 Ga0373928_0029574 3300035084 Bacteria 1205
512 Ga0373934_0005878 3300035086 Bacteria 4541
513 Ga0373934_0011767 3300035086 Bacteria 3296
514 Ga0373940_0045844 3300035088 Bacteria 1215
515 Ga0373944_0000572 3300035089 Bacteria 8715
516 Ga0373944_0172869 3300035089 Bacteria 771
517 Ga0373949_0073030 3300035090 Bacteria 902
518 Ga0373949_0100103 3300035090 Bacteria 793
519 Ga0373923_0001052 3300035111 Bacteria 7550
520 Ga0373936_0001677 3300035113 Bacteria 8121
521 Ga0373936_0001965 3300035113 Bacteria 7603
522 Ga0373936_0007547 3300035113 Bacteria 4089
523 Ga0373936_0016728 3300035113 Bacteria 2823
524 Ga0373936_0078679 3300035113 Bacteria 1369
525 Ga0373939_0011739 3300035114 Bacteria 2218
526 Ga0373945_0000063 3300035116 Bacteria 23921
527 Ga0373945_0004559 3300035116 Bacteria 4406
528 Ga0373945_0006120 3300035116 Bacteria 3869
529 Ga0373953_0003079 3300035117 Bacteria 5125
530 Ga0373953_0011879 3300035117 Bacteria 3068
531 Ga0373953_0065747 3300035117 Bacteria 1489
532 Ga0373954_0006435 3300035118 Bacteria 5122
533 Ga0373954_0067093 3300035118 Bacteria 1699
534 Ga0373954_0107949 3300035118 Bacteria 1345
535 Ga0373954_0149548 3300035118 Bacteria 1141
536 Ga0373954_0254508 3300035118 Bacteria 865
537 Ga0373956_0008798 3300035119 Bacteria 4090
538 Ga0373956_0027712 3300035119 Bacteria 2462
539 Ga0373957_0001538 3300035120 Bacteria 6279
540 Ga0373957_0030952 3300035120 Bacteria 1963
541 Ga0373943_0000622 3300035170 Bacteria 15355
542 Ga0373943_0004489 3300035170 Bacteria 6313
543 Ga0373943_0035951 3300035170 Bacteria 2370
544 Ga0373943_0235235 3300035170 Bacteria 1025
545 Ga0373946_0000960 3300035171 Bacteria 9878
546 Ga0373946_0016156 3300035171 Bacteria 2840
547 Ga0373946_0086188 3300035171 Bacteria 1384
548 Ga0373955_0000453 3300035172 Bacteria 17348
549 Ga0373955_0016314 3300035172 Bacteria 3654
550 Ga0373955_0025435 3300035172 Bacteria 3039
551 Ga0373955_0038075 3300035172 Bacteria 2561
552 Ga0373961_0009728 3300035241 Bacteria 2356
553 Ga0373924_0001176 3300035410 Bacteria 8411
554 Ga0373924_0002934 3300035410 Bacteria 5790
555 Ga0373924_0029532 3300035410 Bacteria 2192
556 Ga0373935_0000153 3300035692 Bacteria 31831
557 Ga0373935_0000853 3300035692 Bacteria 16426
558 Ga0373935_0013196 3300035692 Bacteria 4982
559 Ga0373935_0014512 3300035692 Bacteria 4754
560 Ga0373935_0143482 3300035692 Bacteria 1615
561 Ga0373927_0001934 3300035695 Bacteria 15296
562 Ga0373927_0010376 3300035695 Bacteria 6215
563 Ga0373927_0108336 3300035695 Bacteria 1810
564 Ga0373927_0256628 3300035695 Bacteria 1149
565 Ga0373927_0303279 3300035695 Bacteria 1051
566 Ga0373927_0650727 3300035695 Bacteria 696
567 Ga0373933_0008303 3300035724 Bacteria 5669
568 Ga0373933_0017656 3300035724 Bacteria 4002
569 Ga0373933_0026513 3300035724 Bacteria 3328
570 Ga0373933_0420628 3300035724 Bacteria 873
571 Ga0373933_0434075 3300035724 Bacteria 858
572 Ga0373947_0000700 3300035725 Bacteria 19956
573 Ga0373947_0000952 3300035725 Bacteria 17638
574 Ga0373947_0007146 3300035725 Bacteria 6474
575 Ga0373947_0023489 3300035725 Bacteria 3587
576 Ga0373947_0066694 3300035725 Bacteria 2197
577 Ga0373947_0397961 3300035725 Bacteria 929
578 Ga0373937_0000432 3300036401 Bacteria 39000
579 Ga0373937_0003993 3300036401 Bacteria 12483
580 Ga0373937_0012033 3300036401 Bacteria 7593
581 Ga0373937_0032444 3300036401 Bacteria 4737
582 Ga0373937_0049470 3300036401 Bacteria 3849
583 Ga0373937_0068681 3300036401 Bacteria 3267
584 Ga0373937_0263203 3300036401 Bacteria 1626
585 Ga0373925_0000084 3300037068 Bacteria 100945
586 Ga0373925_0001188 3300037068 Bacteria 22971
587 Ga0373925_0001533 3300037068 Bacteria 19714
588 Ga0373925_0007011 3300037068 Bacteria 8230
589 Ga0373925_0023535 3300037068 Bacteria 4494
590 Ga0373925_0108941 3300037068 Bacteria 2138
591 Ga0373925_0262048 3300037068 Bacteria 1389
592 Ga0373925_0378935 3300037068 Bacteria 1152
593 Ga0373925_0517020 3300037068 Bacteria 981
594 Ga0373925_0626554 3300037068 Bacteria 886
595 Ga0373925_0808488 3300037068 Bacteria 773
596 Ga0373925_0824933 3300037068 Bacteria 764
597 Ga0395899_0002594 3300037312 Bacteria 14563
598 Ga0395899_0004284 3300037312 Bacteria 11152
599 Ga0395899_0005207 3300037312 Bacteria 10115
600 Ga0395899_0013064 3300037312 Bacteria 6350
601 Ga0395899_0043707 3300037312 Bacteria 3341
602 Ga0395899_0087977 3300037312 Bacteria 2254
603 Ga0395899_0094522 3300037312 Bacteria 2163
604 Ga0395899_0222945 3300037312 Bacteria 1305
605 Ga0395899_0273927 3300037312 Bacteria 1150
606 Ga0395899_0524011 3300037312 Bacteria 765
607 Ga0395900_0002349 3300037418 Bacteria 20946
608 Ga0395900_0005752 3300037418 Bacteria 12955
609 Ga0395900_0025418 3300037418 Bacteria 6062
610 Ga0395900_0080270 3300037418 Bacteria 3352
611 Ga0395900_0177898 3300037418 Bacteria 2163
612 Ga0395900_0209011 3300037418 Bacteria 1971
613 Ga0395900_0210856 3300037418 Bacteria 1961
614 Ga0395900_0233809 3300037418 Bacteria 1847
615 Ga0395898_0000723 3300037466 Bacteria 58117
616 Ga0395898_0001505 3300037466 Bacteria 32177
617 Ga0395898_0006846 3300037466 Bacteria 12122
618 Ga0395898_0011006 3300037466 Bacteria 9426
619 Ga0395898_0015393 3300037466 Bacteria 7841
620 Ga0395898_0040585 3300037466 Bacteria 4601
621 Ga0395898_0045376 3300037466 Bacteria 4320
622 Ga0395898_0059173 3300037466 Bacteria 3728
623 Ga0395898_0073156 3300037466 Bacteria 3311
624 Ga0395898_0114505 3300037466 Bacteria 2584
625 Ga0395898_0137005 3300037466 Bacteria 2344
626 Ga0395898_0169129 3300037466 Bacteria 2089
627 Ga0395898_0435956 3300037466 Bacteria 1248
628 Ga0395898_0708221 3300037466 Bacteria 948
629 Ga0395905_0001654 3300037471 Bacteria 26354
630 Ga0395905_0005407 3300037471 Bacteria 13052
631 Ga0395905_0006660 3300037471 Bacteria 11582
632 Ga0395905_0016600 3300037471 Bacteria 6997
633 Ga0395905_0046735 3300037471 Bacteria 4059
634 Ga0395905_0066264 3300037471 Bacteria 3382
635 Ga0395905_0105078 3300037471 Bacteria 2651
636 Ga0395905_0251504 3300037471 Bacteria 1651
637 Ga0436364_0241003 3300037853 Bacteria 1388
638 Ga0436364_0477471 3300037853 Bacteria 3780
639 Ga0436364_0713202 3300037853 Bacteria 2266
640 Ga0436364_0746810 3300037853 Bacteria 2175
641 Ga0436364_0814406 3300037853 Bacteria 1231
642 Ga0436364_1093749 3300037853 Bacteria 5074
643 Ga0395901_0001895 3300038443 Bacteria 21606
644 Ga0395901_0006183 3300038443 Bacteria 12132
645 Ga0395901_0006836 3300038443 Bacteria 11523
646 Ga0395901_0008365 3300038443 Bacteria 10460
647 Ga0395901_0017842 3300038443 Bacteria 7244
648 Ga0395901_0017952 3300038443 Bacteria 7222
649 Ga0395901_0029170 3300038443 Bacteria 5678
650 Ga0395901_0036453 3300038443 Bacteria 5084
651 Ga0395901_0037977 3300038443 Bacteria 4980
652 Ga0395901_0068301 3300038443 Bacteria 3702
653 Ga0395901_0108335 3300038443 Bacteria 2916
654 Ga0395901_0204928 3300038443 Bacteria 2067
655 Ga0395901_0230163 3300038443 Bacteria 1935
656 Ga0395901_0375975 3300038443 Bacteria 1463
657 Ga0395901_0517071 3300038443 Bacteria 1213
658 Ga0436365_0281644 3300039437 Bacteria 1149
659 Ga0436365_0607389 3300039437 Bacteria 895
660 Ga0436365_0982568 3300039437 Bacteria 1042
661 Ga0436365_1143395 3300039437 Bacteria 12928
662 Ga0436365_1308626 3300039437 Bacteria 8989
663 Ga0436365_1423189 3300039437 Bacteria 984
664 Ga0436365_1588830 3300039437 Bacteria 3914
665 Ga0436361_0287188 3300039447 Bacteria 1676
666 Ga0436363_0055457 3300039450 Bacteria 1458
667 Ga0436363_0169393 3300039450 Bacteria 44740
668 Ga0436363_0556565 3300039450 Bacteria 2561
669 Ga0436363_0572802 3300039450 Bacteria 1920
670 Ga0436363_0846140 3300039450 Bacteria 1450
671 Ga0436363_0883032 3300039450 Bacteria 2519
672 Ga0436363_1148610 3300039450 Bacteria 836
673 Ga0436363_1548335 3300039450 Bacteria 1553
674 Ga0436362_0121492 3300039453 Bacteria 934
675 Ga0436362_0163841 3300039453 Bacteria 1350
676 Ga0436362_0488184 3300039453 Bacteria 793
677 Ga0436362_0719851 3300039453 Bacteria 806
678 Ga0451800_1069473 3300041459 Bacteria 1222
679 Ga0439433_0008716 3300041999 Bacteria 2202
680 Ga0439442_049845 3300042002 Bacteria 883
681 Ga0439443_008924 3300042003 Bacteria 1426
682 Ga0439443_038857 3300042003 Bacteria 807
683 Ga0439445_0009113 3300042004 Bacteria 2334
684 Ga0439449_0001825 3300042007 Bacteria 8377
685 Ga0439457_017883 3300042014 Bacteria 1573
686 Ga0439446_0016149 3300042156 Bacteria 2078
687 Ga0439458_0016417 3300042157 Bacteria 1684
688 Ga0439435_0004503 3300042436 Bacteria 3007
689 Ga0439444_0065734 3300042437 Bacteria 766
690 Ga0466965_0352817 3300044683 Bacteria 806
691 Ga0466966_0123662 3300044684 Bacteria 1588
692 Ga0466966_0134402 3300044684 Bacteria 1513
693 Ga0466966_0285728 3300044684 Bacteria 992
694 Ga0466961_0006650 3300044693 Bacteria 7353
695 Ga0466961_0019811 3300044693 Bacteria 4328
696 Ga0466961_0247945 3300044693 Bacteria 1094
697 Ga0466963_0037236 3300044694 Bacteria 3175
698 Ga0466963_0038829 3300044694 Bacteria 3116
699 Ga0466963_0072443 3300044694 Bacteria 2321
700 Ga0466963_0254890 3300044694 Bacteria 1231
701 Ga0466963_0485373 3300044694 Bacteria 872
702 Ga0466964_0033357 3300044706 Bacteria 2051
703 Ga0466964_0043162 3300044706 Bacteria 1829
704 Ga0466964_0070097 3300044706 Bacteria 1480
705 Ga0453684_0002923 3300044712 Bacteria 40048
706 Ga0466971_0088103 3300044719 Bacteria 1419
707 Ga0466970_0034219 3300044765 Bacteria 2689
708 Ga0466957_0026773 3300044842 Bacteria 3423
709 Ga0466957_0141990 3300044842 Bacteria 1548
710 Ga0466957_0242800 3300044842 Bacteria 1195
711 Ga0466957_0751384 3300044842 Bacteria 691
712 Ga0466960_0138646 3300044901 Bacteria 1290
713 Ga0466960_0239697 3300044901 Bacteria 1004
714 Ga0466959_0008855 3300045049 Bacteria 7136
715 Ga0466959_0102586 3300045049 Bacteria 2047
716 Ga0466959_0206963 3300045049 Bacteria 1364
717 Ga0451576_0080518 3300045051 Bacteria 3388
718 Ga0451576_0118215 3300045051 Bacteria 2760
719 Ga0466958_0026318 3300045836 Bacteria 3437
720 Ga0466958_0033488 3300045836 Bacteria 3061
721 Ga0466958_0168243 3300045836 Bacteria 1387
722 Ga0466958_0231418 3300045836 Bacteria 1180
723 Ga0466967_0094525 3300045976 Bacteria 2722
724 Ga0466967_0113782 3300045976 Bacteria 2490
725 Ga0466967_0114184 3300045976 Bacteria 2486
726 Ga0466967_0118255 3300045976 Bacteria 2444
727 Ga0466967_0130099 3300045976 Bacteria 2335
728 Ga0466967_0212043 3300045976 Bacteria 1837
729 Ga0466967_0441083 3300045976 Bacteria 1271
730 Ga0466967_0729485 3300045976 Bacteria 982
731 Ga0466967_0755429 3300045976 Bacteria 964
732 Ga0466967_1219800 3300045976 Bacteria 749
733 Ga0466967_1321174 3300045976 Bacteria 718
734 Ga0495592_0000026 3300046454 Bacteria 136204
735 Ga0495592_0015800 3300046454 Bacteria 5727
736 Ga0495592_0062898 3300046454 Bacteria 2723
737 Ga0495592_0392611 3300046454 Bacteria 880
738 Ga0495603_0214284 3300046455 Bacteria 1112
739 Ga0495629_0001876 3300046459 Bacteria 16411
740 Ga0495629_0003585 3300046459 Bacteria 11725
741 Ga0495629_0016858 3300046459 Bacteria 5243
742 Ga0495629_0231257 3300046459 Bacteria 1274
743 Ga0495629_0337578 3300046459 Bacteria 1029
744 Ga0495641_0001982 3300046461 Bacteria 16628
745 Ga0495641_0013375 3300046461 Bacteria 4514
746 Ga0495641_0016836 3300046461 Bacteria 3834
747 Ga0495641_0019613 3300046461 Bacteria 3453
748 Ga0495641_0214288 3300046461 Bacteria 863
749 Ga0495651_0001816 3300046462 Bacteria 16464
750 Ga0495651_0003038 3300046462 Bacteria 12943
751 Ga0495651_0007255 3300046462 Bacteria 8472
752 Ga0495651_0010663 3300046462 Bacteria 7070
753 Ga0495651_0037022 3300046462 Bacteria 3798
754 Ga0495651_0038208 3300046462 Bacteria 3738
755 Ga0495651_0581787 3300046462 Bacteria 708
756 Ga0495653_0000155 3300046463 Bacteria 56764
757 Ga0495653_0002608 3300046463 Bacteria 14343
758 Ga0495653_0006734 3300046463 Bacteria 9432
759 Ga0495653_0021100 3300046463 Bacteria 5279
760 Ga0495653_0164048 3300046463 Bacteria 1540
761 Ga0495580_0011599 3300046472 Bacteria 6817
762 Ga0495580_0163642 3300046472 Bacteria 1539
763 Ga0495582_0001032 3300046473 Bacteria 15593
764 Ga0495582_0002403 3300046473 Bacteria 10450
765 Ga0495582_0065678 3300046473 Bacteria 2005
766 Ga0495582_0074538 3300046473 Bacteria 1879
767 Ga0495582_0426708 3300046473 Bacteria 765
768 Ga0495639_0001826 3300046475 Bacteria 9433
769 Ga0495639_0012994 3300046475 Bacteria 3593
770 Ga0495639_0031004 3300046475 Bacteria 2378
771 Ga0495639_0102155 3300046475 Bacteria 1355
772 Ga0495639_0158736 3300046475 Bacteria 1094
773 Ga0495662_0002047 3300046476 Bacteria 10103
774 Ga0495662_0003915 3300046476 Bacteria 7510
775 Ga0495662_0007891 3300046476 Bacteria 5240
776 Ga0495662_0050799 3300046476 Bacteria 2001
777 Ga0495664_0000001 3300046477 Bacteria 757730
778 Ga0495664_0000220 3300046477 Bacteria 27274
779 Ga0495664_0002529 3300046477 Bacteria 9823
780 Ga0495664_0112835 3300046477 Bacteria 1641
781 Ga0495664_0177642 3300046477 Bacteria 1291
782 Ga0495664_0314088 3300046477 Bacteria 945
783 Ga0495594_0149699 3300046499 Bacteria 1325
784 Ga0495596_0145773 3300046500 Bacteria 919
785 Ga0495608_0000012 3300046511 Bacteria 242758
786 Ga0495608_0032894 3300046511 Bacteria 3506
787 Ga0495618_0000041 3300046514 Bacteria 96631
788 Ga0495618_0009095 3300046514 Bacteria 5996
789 Ga0495618_0018234 3300046514 Bacteria 4309
790 Ga0495618_0042860 3300046514 Bacteria 2854
791 Ga0495628_0000033 3300046516 Bacteria 118203
792 Ga0495628_0040793 3300046516 Bacteria 3707
793 Ga0495628_0079866 3300046516 Bacteria 2543
794 Ga0495628_0231894 3300046516 Bacteria 1384
795 Ga0495628_0386689 3300046516 Bacteria 1024
796 Ga0495628_0497627 3300046516 Bacteria 880
797 Ga0495630_0012136 3300046517 Bacteria 6247
798 Ga0495630_0022265 3300046517 Bacteria 4681
799 Ga0495630_0027669 3300046517 Bacteria 4209
800 Ga0495630_0300935 3300046517 Bacteria 1225
801 Ga0495630_0572363 3300046517 Bacteria 866
802 Ga0495666_0036847 3300046526 Bacteria 2381
803 Ga0495642_0013495 3300046528 Bacteria 3161
804 Ga0495642_0151624 3300046528 Bacteria 1003
805 Ga0495652_0000001 3300046529 Bacteria 1045081
806 Ga0495652_0004698 3300046529 Bacteria 13018
807 Ga0495652_0062473 3300046529 Bacteria 3140
808 Ga0495652_0148176 3300046529 Bacteria 1837
809 Ga0495654_0173106 3300046530 Bacteria 940
810 Ga0495665_0001683 3300046531 Bacteria 11870
811 Ga0495665_0004311 3300046531 Bacteria 7684
812 Ga0495665_0008753 3300046531 Bacteria 5495
813 Ga0495665_0174354 3300046531 Bacteria 1119
814 Ga0495640_0000010 3300046533 Bacteria 214167
815 Ga0495640_0002641 3300046533 Bacteria 14389
816 Ga0495640_0008984 3300046533 Bacteria 7802
817 Ga0495640_0018232 3300046533 Bacteria 5213
818 Ga0495640_0031590 3300046533 Bacteria 3777
819 Ga0495640_0032474 3300046533 Bacteria 3718
820 Ga0495640_0101304 3300046533 Bacteria 1890
821 Ga0495586_0003605 3300046535 Bacteria 8296
822 Ga0495586_0043597 3300046535 Bacteria 2416
823 Ga0495586_0050399 3300046535 Bacteria 2253
824 Ga0495586_0113973 3300046535 Bacteria 1506
825 Ga0495586_0198746 3300046535 Bacteria 1136
826 Ga0495587_0000003 3300046536 Bacteria 424188
827 Ga0495587_0007562 3300046536 Bacteria 7031
828 Ga0495587_0008658 3300046536 Bacteria 6537
829 Ga0495587_0045647 3300046536 Bacteria 2603
830 Ga0495598_0008068 3300046537 Bacteria 2441
831 Ga0495621_0008651 3300046539 Bacteria 3061
832 Ga0495645_0000026 3300046543 Bacteria 118737
833 Ga0495645_0047561 3300046543 Bacteria 3125
834 Ga0495645_0066433 3300046543 Bacteria 2606
835 Ga0495645_0071177 3300046543 Bacteria 2508
836 Ga0495645_0104989 3300046543 Bacteria 2005
837 Ga0495645_0129699 3300046543 Bacteria 1768
838 Ga0495645_0164328 3300046543 Bacteria 1532
839 Ga0495667_0000132 3300046559 Bacteria 52219
840 Ga0495667_0003797 3300046559 Bacteria 10145
841 Ga0495667_0004922 3300046559 Bacteria 9033
842 Ga0495667_0015481 3300046559 Bacteria 5153
843 Ga0495667_0017451 3300046559 Bacteria 4847
844 Ga0495667_0022160 3300046559 Bacteria 4280
845 Ga0495667_0026272 3300046559 Bacteria 3923
846 Ga0495656_0068202 3300046615 Bacteria 1572
847 Ga0495634_0000285 3300046642 Bacteria 48349
848 Ga0495634_0007957 3300046642 Bacteria 7909
849 Ga0495634_0009612 3300046642 Bacteria 7124
850 Ga0495634_0027295 3300046642 Bacteria 3973
851 Ga0495634_0041359 3300046642 Bacteria 3130
852 Ga0495634_0100485 3300046642 Bacteria 1869
853 Ga0495634_0223302 3300046642 Bacteria 1162
854 Ga0495635_0000113 3300046663 Bacteria 48231
855 Ga0495635_0001457 3300046663 Bacteria 15839
856 Ga0495635_0013023 3300046663 Bacteria 5822
857 Ga0495635_0031578 3300046663 Bacteria 3675
858 Ga0495635_0034738 3300046663 Bacteria 3497
859 Ga0495635_0110013 3300046663 Bacteria 1882
860 Ga0495635_0307270 3300046663 Bacteria 1063
861 Ga0495635_0395775 3300046663 Bacteria 918
862 Ga0495659_0110170 3300046664 Bacteria 1075
863 Ga0495657_0000258 3300046675 Bacteria 48270
864 Ga0495657_0008915 3300046675 Bacteria 7639
865 Ga0495657_0012718 3300046675 Bacteria 6241
866 Ga0495657_0174237 3300046675 Bacteria 1323
867 Ga0495657_0301447 3300046675 Bacteria 955
868 Ga0495599_0000070 3300046678 Bacteria 71413
869 Ga0495599_0009684 3300046678 Bacteria 5895
870 Ga0495599_0060391 3300046678 Bacteria 2370
871 Ga0495599_0070258 3300046678 Bacteria 2185
872 Ga0495599_0168426 3300046678 Bacteria 1352
873 Ga0495599_0178339 3300046678 Bacteria 1310
874 Ga0495623_0000003 3300046679 Bacteria 147316
875 Ga0495623_0012706 3300046679 Bacteria 5452
876 Ga0495623_0175327 3300046679 Bacteria 1249
877 Ga0495646_0000070 3300046680 Bacteria 47494
878 Ga0495646_0012319 3300046680 Bacteria 5438
879 Ga0495646_0044888 3300046680 Bacteria 2701
880 Ga0495647_0011297 3300046681 Bacteria 3059
881 Ga0495647_0012544 3300046681 Bacteria 2920
882 Ga0495658_0000863 3300046683 Bacteria 16308
883 Ga0495658_0014068 3300046683 Bacteria 4079
884 Ga0495658_0014130 3300046683 Bacteria 4072
885 Ga0495658_0076084 3300046683 Bacteria 1961
886 Ga0495658_0553662 3300046683 Bacteria 736
887 Ga0495669_0134178 3300046684 Bacteria 1167
888 Ga0495613_0004947 3300046689 Bacteria 10008
889 Ga0495613_0015917 3300046689 Bacteria 5599
890 Ga0495613_0091833 3300046689 Bacteria 2199
891 Ga0495613_0154256 3300046689 Bacteria 1637
892 Ga0495613_0210676 3300046689 Bacteria 1367
893 Ga0495613_0242681 3300046689 Bacteria 1259
894 Ga0495624_0006089 3300046690 Bacteria 8596
895 Ga0495624_0006919 3300046690 Bacteria 7999
896 Ga0495624_0020464 3300046690 Bacteria 4403
897 Ga0495624_0072914 3300046690 Bacteria 2135
898 Ga0495624_0229357 3300046690 Bacteria 1125
899 Ga0495671_0106647 3300046692 Bacteria 1368
900 Ga0495671_0195273 3300046692 Bacteria 982
901 Ga0495600_0000007 3300046809 Bacteria 150995
902 Ga0495600_0024425 3300046809 Bacteria 3889
903 Ga0495600_0111697 3300046809 Bacteria 1779
904 Ga0495581_0003231 3300047315 Bacteria 9341
905 Ga0495581_0004944 3300047315 Bacteria 7715
906 Ga0495581_0015110 3300047315 Bacteria 4482
907 Ga0495581_0021363 3300047315 Bacteria 3753
908 Ga0495581_0024853 3300047315 Bacteria 3471
909 Ga0495581_0100813 3300047315 Bacteria 1677
910 Ga0495604_0000010 3300047317 Bacteria 312236
911 Ga0495604_0001295 3300047317 Bacteria 20451
912 Ga0495604_0029640 3300047317 Bacteria 4354
913 Ga0495604_0062518 3300047317 Bacteria 2843
914 Ga0495674_0000013 3300047319 Bacteria 248475
915 Ga0495674_0003143 3300047319 Bacteria 16039
916 Ga0495674_0004127 3300047319 Bacteria 14021
917 Ga0495674_0010021 3300047319 Bacteria 8982
918 Ga0495674_0011758 3300047319 Bacteria 8255
919 Ga0495674_0058105 3300047319 Bacteria 3383
920 Ga0495672_0047694 3300047320 Bacteria 2546
921 Ga0495676_0001106 3300047321 Bacteria 22893
922 Ga0495676_0006015 3300047321 Bacteria 11149
923 Ga0495676_0051111 3300047321 Bacteria 3309
924 Ga0495676_0200526 3300047321 Bacteria 1387
925 Ga0495676_0267646 3300047321 Bacteria 1161
926 Ga0495680_0003074 3300047322 Bacteria 16634
927 Ga0495680_0003453 3300047322 Bacteria 15563
928 Ga0495680_0005738 3300047322 Bacteria 11624
929 Ga0495680_0014676 3300047322 Bacteria 6776
930 Ga0495680_0029339 3300047322 Bacteria 4505
931 Ga0495680_0034479 3300047322 Bacteria 4085
932 Ga0495680_0042583 3300047322 Bacteria 3601
933 Ga0495680_0068616 3300047322 Bacteria 2707
934 Ga0495683_0284350 3300047323 Bacteria 715
935 Ga0495675_0000253 3300047444 Bacteria 38594
936 Ga0495675_0058499 3300047444 Bacteria 2444
937 Ga0495685_108872 3300047447 Bacteria 913
938 Ga0495684_0000008 3300047471 Bacteria 201370
939 Ga0495684_0007003 3300047471 Bacteria 8756
940 Ga0495684_0008374 3300047471 Bacteria 8012
941 Ga0495684_0010160 3300047471 Bacteria 7280
942 Ga0495684_0011194 3300047471 Bacteria 6934
943 Ga0495684_0012423 3300047471 Bacteria 6568
944 Ga0495684_0461515 3300047471 Bacteria 880
945 Ga0495684_0492987 3300047471 Bacteria 844
946 Ga0495593_0000137 3300047673 Bacteria 35364
947 Ga0495593_0001564 3300047673 Bacteria 13500
948 Ga0495593_0007543 3300047673 Bacteria 6356
949 Ga0495593_0112778 3300047673 Bacteria 1387
950 Ga0495593_0234396 3300047673 Bacteria 920
951 Ga0495602_0000264 3300048088 Bacteria 48258
952 Ga0495602_0002962 3300048088 Bacteria 17410
953 Ga0495602_0029367 3300048088 Bacteria 5237
954 Ga0495602_0054854 3300048088 Bacteria 3515
955 Ga0495602_0059412 3300048088 Bacteria 3337
956 Ga0495602_0095371 3300048088 Bacteria 2456
957 Ga0495602_0118253 3300048088 Bacteria 2138
958 Ga0495614_0054957 3300048089 Bacteria 1708
959 Ga0495614_0241648 3300048089 Bacteria 824
960 Ga0496100_0015265 3300048903 Bacteria 4482
961 Ga0496100_0203372 3300048903 Bacteria 1445
962 Ga0496101_0087376 3300048904 Bacteria 2314
963 Ga0496101_0103881 3300048904 Bacteria 2130
964 Ga0496101_0151883 3300048904 Bacteria 1772
965 Ga0496101_0312080 3300048904 Bacteria 1233
966 Ga0496101_0330343 3300048904 Bacteria 1197
967 Ga0496102_0008851 3300048905 Bacteria 8638
968 Ga0496102_0034171 3300048905 Bacteria 4573
969 Ga0496102_0114872 3300048905 Bacteria 2512
970 Ga0496102_0250887 3300048905 Bacteria 1669
971 Ga0496103_0051990 3300048906 Bacteria 2537
972 Ga0496103_0073987 3300048906 Bacteria 2135
973 Ga0496103_0396739 3300048906 Bacteria 886
974 Ga0496104_0004620 3300048907 Bacteria 11999
975 Ga0496104_0026940 3300048907 Bacteria 5314
976 Ga0496104_0096681 3300048907 Bacteria 2826
977 Ga0496104_0394302 3300048907 Bacteria 1296
978 Ga0496104_0428175 3300048907 Bacteria 1235
979 Ga0496104_0605797 3300048907 Bacteria 1005
980 Ga0496104_0785421 3300048907 Bacteria 859
981 Ga0496105_0031670 3300048908 Bacteria 4336
982 Ga0496105_0102458 3300048908 Bacteria 2364
983 Ga0496105_0106800 3300048908 Bacteria 2311
984 Ga0496105_0108903 3300048908 Bacteria 2287
985 Ga0496105_0112560 3300048908 Bacteria 2246
986 Ga0496105_0280613 3300048908 Bacteria 1343
987 Ga0496105_0411425 3300048908 Bacteria 1072
988 Ga0496106_0000080 3300048909 Bacteria 76997
989 Ga0496106_0802828 3300048909 Bacteria 746
990 Ga0496107_0001928 3300048910 Bacteria 13160
991 Ga0496107_0317446 3300048910 Bacteria 1159
992 Ga0496107_0487376 3300048910 Bacteria 915
993 Ga0496108_0032356 3300048911 Bacteria 4345
994 Ga0496108_0095736 3300048911 Bacteria 2528
995 Ga0496108_0114095 3300048911 Bacteria 2313
996 Ga0496108_0429483 3300048911 Bacteria 1154
997 Ga0496108_0775645 3300048911 Bacteria 828
998 Ga0496109_0001577 3300048912 Bacteria 19030
999 Ga0496109_0115733 3300048912 Bacteria 2495
1000 Ga0496109_0362684 3300048912 Bacteria 1369
1001 Ga0496109_0446793 3300048912 Bacteria 1221
1002 Ga0496109_0547642 3300048912 Bacteria 1091
1003 Ga0496110_0025060 3300048913 Bacteria 5093
1004 Ga0496110_0084804 3300048913 Bacteria 2828
1005 Ga0496110_0258689 3300048913 Bacteria 1584
1006 Ga0496110_0789910 3300048913 Bacteria 853
1007 Ga0496111_0000600 3300048914 Bacteria 18996
1008 Ga0496111_0601557 3300048914 Bacteria 805
1009 Ga0496112_0012198 3300048915 Bacteria 7888
1010 Ga0496112_0097705 3300048915 Bacteria 2907
1011 Ga0496112_0105277 3300048915 Bacteria 2791
1012 Ga0496112_0126770 3300048915 Bacteria 2523
1013 Ga0496112_0228649 3300048915 Bacteria 1815
1014 Ga0496112_0947746 3300048915 Bacteria 782
1015 Ga0496113_0030702 3300048916 Bacteria 3892
1016 Ga0496113_0103015 3300048916 Bacteria 2213
1017 Ga0496113_0291029 3300048916 Bacteria 1307
1018 Ga0496113_0633391 3300048916 Bacteria 855
1019 Ga0496114_0008209 3300048917 Bacteria 8273
1020 Ga0496114_0033322 3300048917 Unclassified 4244
1021 Ga0496114_0043584 3300048917 Bacteria 3721
1022 Ga0496114_0219059 3300048917 Bacteria 1670
1023 Ga0496114_0253648 3300048917 Bacteria 1548
1024 Ga0496114_0723951 3300048917 Bacteria 871
1025 Ga0496115_0002965 3300048918 Bacteria 12203
1026 Ga0496115_0055305 3300048918 Bacteria 3188
1027 Ga0496115_0200274 3300048918 Bacteria 1649
1028 Ga0496115_0662796 3300048918 Bacteria 824
1029 Ga0496116_0004347 3300048919 Bacteria 13551
1030 Ga0496116_0018572 3300048919 Bacteria 5352
1031 Ga0496116_0047984 3300048919 Bacteria 2870
1032 Ga0496116_0147561 3300048919 Bacteria 1312
1033 Ga0496117_0021082 3300048920 Bacteria 5289
1034 Ga0496118_0007568 3300048921 Bacteria 11460
1035 Ga0496119_0234953 3300048922 Bacteria 931
1036 Ga0496121_0028239 3300048924 Bacteria 5227
1037 Ga0496121_0041108 3300048924 Bacteria 4046
1038 Ga0496122_0024068 3300048925 Bacteria 5340
1039 Ga0496123_0083889 3300048926 Bacteria 1924
1040 Ga0496124_0003625 3300048927 Bacteria 18745
1041 Ga0496124_0014196 3300048927 Bacteria 7717
1042 Ga0496124_0135254 3300048927 Bacteria 1952
1043 Ga0496125_0006540 3300048928 Bacteria 12561
1044 Ga0496126_0040560 3300048929 Bacteria 4315
1045 Ga0501031_0164817 3300049568 Bacteria 1449
1046 Ga0501032_0595240 3300049569 Bacteria 704
1047 Ga0501033_0331952 3300049570 Bacteria 1067
1048 Ga0501036_0079229 3300049572 Bacteria 2779
1049 Ga0501036_0174756 3300049572 Bacteria 1809
1050 Ga0501036_0370251 3300049572 Bacteria 1196
1051 Ga0501038_0027623 3300049574 Bacteria 5047
1052 Ga0501038_0195479 3300049574 Bacteria 1626
1053 Ga0501039_0083413 3300049575 Bacteria 2489
1054 Ga0501041_0042610 3300049577 Bacteria 2759
1055 Ga0501042_0075638 3300049578 Bacteria 2410
1056 Ga0501042_0351802 3300049578 Bacteria 1066
1057 Ga0501046_0055704 3300049580 Bacteria 3106
1058 Ga0501046_0242546 3300049580 Bacteria 1329
1059 Ga0501047_0009041 3300049581 Bacteria 9409
1060 Ga0501047_0076364 3300049581 Bacteria 3224
1061 Ga0501048_0064100 3300049582 Bacteria 2599
1062 Ga0501067_0007851 3300049583 Bacteria 5930
1063 Ga0501067_0018620 3300049583 Bacteria 3844
1064 Ga0501069_0005726 3300049585 Bacteria 6477
1065 Ga0501069_0022744 3300049585 Bacteria 3413
1066 Ga0501070_0037984 3300049586 Bacteria 4018
1067 Ga0501070_0133410 3300049586 Bacteria 2051
1068 Ga0501070_0212427 3300049586 Bacteria 1588
1069 Ga0501072_0009444 3300049588 Bacteria 7416
1070 Ga0501072_0054312 3300049588 Bacteria 3156
1071 Ga0501072_0096462 3300049588 Bacteria 2350
1072 Ga0501073_0044779 3300049589 Bacteria 3119
1073 Ga0501073_0120098 3300049589 Bacteria 1821
1074 Ga0501073_0650401 3300049589 Bacteria 728
1075 Ga0501074_0016085 3300049590 Bacteria 5437
1076 Ga0501074_0096018 3300049590 Bacteria 2123
1077 Ga0501074_0331483 3300049590 Bacteria 1080
1078 Ga0501074_0505059 3300049590 Bacteria 856
1079 Ga0501075_0066655 3300049591 Bacteria 2717
1080 Ga0501076_0003344 3300049592 Bacteria 11254
1081 Ga0501076_0041189 3300049592 Bacteria 3632
1082 Ga0501076_0152764 3300049592 Bacteria 1878
1083 Ga0501076_0578577 3300049592 Bacteria 926
1084 Ga0501077_0013776 3300049593 Bacteria 5071
1085 Ga0501077_0032171 3300049593 Bacteria 3339
1086 Ga0501077_0120137 3300049593 Bacteria 1665
1087 Ga0501219_005207 3300049703 Bacteria 925
1088 Ga0501079_0010485 3300049741 Bacteria 7046
1089 Ga0501079_0404163 3300049741 Bacteria 1071
1090 Ga0501080_0094204 3300049742 Bacteria 2781
1091 Ga0501080_0156207 3300049742 Bacteria 2107
1092 Ga0501080_0300785 3300049742 Bacteria 1455
1093 Ga0501080_0715976 3300049742 Bacteria 882
1094 Ga0501081_0023585 3300049743 Bacteria 4124
1095 Ga0501081_0078102 3300049743 Bacteria 2314
1096 Ga0501081_0204071 3300049743 Bacteria 1434
1097 Ga0501083_0085608 3300049744 Bacteria 2085
1098 Ga0501083_0281151 3300049744 Bacteria 1082
1099 Ga0501035_0054899 3300049822 Bacteria 3558
1100 Ga0501044_0000222 3300049823 Bacteria 71930
1101 Ga0501045_0016710 3300049824 Bacteria 5213
1102 nmdc:mga03n38_85932_c1 3300050490 Bacteria 1488
1103 nmdc:mga00v17_27387_c1 3300050491 Bacteria 3327
1104 nmdc:mga0k408_77654_c1 3300050493 Bacteria 1942
1105 nmdc:mga05p37_110601_c1 3300050507 Bacteria 3380
1106 nmdc:mga05p37_130341_c1 3300050507 Bacteria 3085
1107 nmdc:mga05p37_251403_c1 3300050507 Bacteria 2120
1108 nmdc:mga05p37_251953_c1 3300050507 Bacteria 2117
1109 nmdc:mga05p37_441882_c1 3300050507 Bacteria 1508
1110 nmdc:mga05p37_5066_c1 3300050507 Bacteria 15447
1111 nmdc:mga09592_4709_c1 3300050508 Bacteria 11049
1112 nmdc:mga09592_66292_c1 3300050508 Bacteria 3060
1113 nmdc:mga0qj67_111240_c1 3300050509 Bacteria 2211
1114 nmdc:mga0qj67_111501_c1 3300050509 Bacteria 2209
1115 nmdc:mga0qj67_168264_c1 3300050509 Bacteria 1780
1116 nmdc:mga0qj67_256242_c1 3300050509 Bacteria 1419
1117 nmdc:mga0qj67_45819_c1 3300050509 Bacteria 3450
1118 nmdc:mga06r32_123078_c1 3300050510 Bacteria 2560
1119 nmdc:mga06r32_361204_c1 3300050510 Bacteria 1436
1120 nmdc:mga08y16_1092714_c1 3300050511 Bacteria 773
1121 nmdc:mga08y16_715495_c1 3300050511 Bacteria 1000
1122 nmdc:mga08y16_7942_c1 3300050511 Bacteria 11106
1123 nmdc:mga08y16_96211_c1 3300050511 Bacteria 3084
1124 nmdc:mga0n895_1081549_c1 3300050512 Bacteria 780
1125 nmdc:mga0n895_232262_c1 3300050512 Bacteria 1872
1126 nmdc:mga0n895_293222_c1 3300050512 Unclassified 1649
1127 nmdc:mga0n895_523505_c1 3300050512 Bacteria 1193
1128 nmdc:mga0n895_633543_c1 3300050512 Bacteria 1069
1129 nmdc:mga0n895_969_c1 3300050512 Bacteria 13990
1130 nmdc:mga0rr50_559929_c1 3300050513 Bacteria 973
1131 nmdc:mga0rr50_59735_c1 3300050513 Bacteria 2864
1132 nmdc:mga0rr50_689068_c1 3300050513 Bacteria 872
1133 nmdc:mga08x19_258241_c1 3300050514 Bacteria 1204
1134 nmdc:mga08x19_453_c1 3300050514 Bacteria 27975
1135 nmdc:mga0a205_19407_c1 3300050515 Bacteria 6408
1136 nmdc:mga0a205_50550_c1 3300050515 Bacteria 4013
1137 nmdc:mga0a205_98346_c1 3300050515 Bacteria 2825
1138 nmdc:mga0sz30_111766_c1 3300050516 Bacteria 1198
1139 nmdc:mga0sz30_44143_c1 3300050516 Bacteria 1877
1140 Ga0495601_0000003 3300053077 Bacteria 493642
1141 Ga0495601_0002673 3300053077 Bacteria 10100
1142 Ga0495601_0009699 3300053077 Bacteria 5697
1143 Ga0495601_0137572 3300053077 Bacteria 1592
1144 Ga0495601_0444194 3300053077 Bacteria 839
1145 Ga0495612_0000009 3300053078 Bacteria 229858
1146 Ga0495612_0005512 3300053078 Bacteria 5231
1147 Ga0495612_0095485 3300053078 Bacteria 1262
1148 Ga0495612_0149167 3300053078 Bacteria 1017
1149 Ga0495595_0000075 3300053084 Bacteria 48300
1150 Ga0495595_0000640 3300053084 Bacteria 13290
1151 Ga0495595_0013680 3300053084 Bacteria 3431
1152 Ga0495595_0068086 3300053084 Bacteria 1679
1153 Ga0495595_0100821 3300053084 Bacteria 1393
1154 Ga0495619_0000039 3300053085 Bacteria 118681
1155 Ga0495619_0001034 3300053085 Bacteria 18264
1156 Ga0495619_0002157 3300053085 Bacteria 13040
1157 Ga0495619_0002259 3300053085 Bacteria 12728
1158 Ga0495619_0024111 3300053085 Bacteria 3901
1159 Ga0500641_0021543 3300053096 Bacteria 2459
1160 Ga0500654_094665 3300053099 Bacteria 1309
1161 Ga0500595_004295 3300053119 Bacteria 6422
1162 Ga0500618_003215 3300053125 Bacteria 5692
1163 Ga0500616_0042715 3300053153 Bacteria 2426
1164 Ga0500616_0047451 3300053153 Bacteria 2280
1165 Ga0500627_0174739 3300053158 Bacteria 967
1166 Ga0501084_0014155 3300054114 Bacteria 6605
1167 Ga0501084_0046021 3300054114 Bacteria 3654
1168 Ga0501084_0093516 3300054114 Bacteria 2524
1169 Ga0501084_0123741 3300054114 Bacteria 2175
1170 Ga0501084_0280819 3300054114 Bacteria 1406
1171 Ga0587066_020355 3300059490 Bacteria 1089
1172 Ga0587070_027916 3300059491 Bacteria 1003
1173 Ga0587070_055869 3300059491 Bacteria 802
1174 Ga0587073_0093273 3300059492 Bacteria 769
1175 Ga0587080_033368 3300059503 Bacteria 907
1176 Ga0587128_043366 3300059630 Bacteria 795
1177 Ga0587076_012844 3300059645 Bacteria 1259
1178 Ga0587114_038702 3300059655 Bacteria 763
1179 Ga0501082_0000371 3300060353 Bacteria 39631
1180 Ga0501082_0009046 3300060353 Bacteria 8591
1181 Ga0501082_0022842 3300060353 Bacteria 5388
1182 Ga0501082_0312034 3300060353 Bacteria 1370
1183 Ga0501082_0934797 3300060353 Bacteria 758
1184 Ga0466962_0042318 3300061719 Bacteria 2180
1185 Ga0530510_0052853 3300061734 Bacteria 2935
1186 Ga0530510_0078131 3300061734 Bacteria 2406
1187 Ga0530510_0127126 3300061734 Bacteria 1874
1188 Ga0530510_0198832 3300061734 Bacteria 1488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0102155 Ga0495639_0102155_705_1334 188
2 iso_pu_bacteria 3005452660 3005453847 196
3 3300035724 Ga0373933_0420628 Ga0373933_0420628_14_634 198
4 3300046692 Ga0495671_0106647 Ga0495671_0106647_44_664 198
5 3300048909 Ga0496106_0802828 Ga0496106_0802828_113_733 198
6 3300027462 Ga0210000_1016667 Ga0210000_10166672 200
7 3300005471 Ga0070698_100023955 Ga0070698_1000239554 204
8 3300059491 Ga0587070_027916 Ga0587070_027916_207_821 204
9 3300050512 nmdc:mga0n895_633543_c1 nmdc:mga0n895_633543_c1_75_734 211
10 3300035090 Ga0373949_0073030 Ga0373949_0073030_18_659 212
11 3300046533 Ga0495640_0101304 Ga0495640_0101304_356_997 212
12 3300025315 Ga0207697_10061119 Ga0207697_100611191 214
13 iso_pu_bacteria 2510917028 2511181980 214
14 iso_pu_bacteria 2513237088 2513598064 214
15 iso_pu_bacteria 2534681796 2535516092 214
16 iso_pu_bacteria 2582581294 2585199810 214
17 iso_pu_bacteria 2585427594 2585846636 214
18 iso_pu_bacteria 2738541293 2738799330 214
19 iso_pu_bacteria 2996887358 2996892345 214
20 iso_pu_bacteria 8005258706 8005259627 214
21 iso_pu_bacteria 8005321885 8005326872 214
22 iso_pu_bacteria 8005542996 8005544766 214
23 iso_pu_bacteria 2513237094 2513642656 215
24 iso_pu_bacteria 2513237144 2513911553 215
25 iso_pu_bacteria 2513237146 2513929070 215
26 iso_pu_bacteria 2582581299 2585232483 215
27 iso_pu_bacteria 2582581304 2585254284 215
28 iso_pu_bacteria 2582581306 2585266543 215
29 iso_pu_bacteria 2582581865 2585387559 215
30 iso_pu_bacteria 2582581866 2585394165 215
31 iso_pu_bacteria 2599185170 2599414717 215
32 iso_pu_bacteria 2643221643 2644239652 215
33 iso_pu_bacteria 2835312727 2835317752 215
34 iso_pu_bacteria 2838035591 2838039564 215
35 iso_pu_bacteria 2838661181 2838667959 215
36 iso_pu_bacteria 2844163670 2844168181 215
37 iso_pu_bacteria 2852387548 2852391441 215
38 iso_pu_bacteria 2933016740 2933017617 215
39 iso_pu_bacteria 2989771324 2989774115 215
40 iso_pu_bacteria 3005710791 3005716697 215
41 iso_pu_bacteria 643348564 643600467 215
42 3300032126 Ga0307415_100059084 Ga0307415_1000590841 216
43 3300046692 Ga0495671_0195273 Ga0495671_0195273_23_745 216
44 3300002126 JGI24035J26624_1006303 JGI24035J26624_10063031 217
45 3300003544 Ga0007417J51691_1073041 Ga0007417J51691_10730411 217
46 3300004803 Ga0058862_10157652 Ga0058862_101576521 217
47 3300005290 Ga0065712_10032685 Ga0065712_100326852 217
48 3300005290 Ga0065712_10151397 Ga0065712_101513971 217
49 3300005293 Ga0065715_10009372 Ga0065715_100093723 217
50 3300005293 Ga0065715_10055804 Ga0065715_100558042 217
51 3300005329 Ga0070683_100020623 Ga0070683_1000206233 217
52 3300005329 Ga0070683_100034751 Ga0070683_1000347513 217
53 3300005365 Ga0070688_100104790 Ga0070688_1001047902 217
54 3300005434 Ga0070709_10019181 Ga0070709_100191812 217
55 3300005435 Ga0070714_100030048 Ga0070714_1000300482 217
56 3300005435 Ga0070714_100187329 Ga0070714_1001873291 217
57 3300005436 Ga0070713_100014411 Ga0070713_1000144112 217
58 3300005436 Ga0070713_100747518 Ga0070713_1007475182 217
59 3300005437 Ga0070710_10088215 Ga0070710_100882152 217
60 3300005439 Ga0070711_100057541 Ga0070711_1000575413 217
61 3300005445 Ga0070708_100179668 Ga0070708_1001796681 217
62 3300005458 Ga0070681_10334269 Ga0070681_103342692 217
63 3300005467 Ga0070706_100007691 Ga0070706_1000076912 217
64 3300005468 Ga0070707_100003569 Ga0070707_10000356915 217
65 3300005471 Ga0070698_100005317 Ga0070698_10000531711 217
66 3300005530 Ga0070679_100241052 Ga0070679_1002410521 217
67 3300005535 Ga0070684_100086154 Ga0070684_1000861543 217
68 3300005536 Ga0070697_100036352 Ga0070697_1000363523 217
69 3300005536 Ga0070697_100100669 Ga0070697_1001006693 217
70 3300005545 Ga0070695_100015384 Ga0070695_1000153845 217
71 3300005546 Ga0070696_100006691 Ga0070696_1000066914 217
72 3300005546 Ga0070696_100051921 Ga0070696_1000519212 217
73 3300005548 Ga0070665_100054303 Ga0070665_1000543033 217
74 3300005564 Ga0070664_100022364 Ga0070664_1000223645 217
75 3300005578 Ga0068854_100663036 Ga0068854_1006630361 217
76 3300005614 Ga0068856_100093010 Ga0068856_1000930102 217
77 3300005618 Ga0068864_100344065 Ga0068864_1003440652 217
78 3300005840 Ga0068870_10331509 Ga0068870_103315092 217
79 3300005937 Ga0081455_10123148 Ga0081455_101231483 217
80 3300006028 Ga0070717_10053770 Ga0070717_100537703 217
81 3300006028 Ga0070717_10205681 Ga0070717_102056811 217
82 3300006163 Ga0070715_10008237 Ga0070715_100082372 217
83 3300006173 Ga0070716_100022208 Ga0070716_1000222082 217
84 3300006175 Ga0070712_100033486 Ga0070712_1000334863 217
85 3300006175 Ga0070712_100114211 Ga0070712_1001142112 217
86 3300006175 Ga0070712_100283796 Ga0070712_1002837962 217
87 3300006175 Ga0070712_100364011 Ga0070712_1003640112 217
88 3300006846 Ga0075430_100082906 Ga0075430_1000829062 217
89 3300006871 Ga0075434_100181026 Ga0075434_1001810263 217
90 3300006914 Ga0075436_100000262 Ga0075436_10000026212 217
91 3300009147 Ga0114129_10083228 Ga0114129_100832282 217
92 3300010375 Ga0105239_10226695 Ga0105239_102266952 217
93 3300011119 Ga0105246_10118557 Ga0105246_101185572 217
94 3300013296 Ga0157374_10248067 Ga0157374_102480672 217
95 3300013296 Ga0157374_10704275 Ga0157374_107042752 217
96 3300013296 Ga0157374_10928509 Ga0157374_109285091 217
97 3300013297 Ga0157378_10013399 Ga0157378_100133996 217
98 3300013307 Ga0157372_10523820 Ga0157372_105238202 217
99 3300014325 Ga0163163_10455173 Ga0163163_104551732 217
100 3300014745 Ga0157377_10311164 Ga0157377_103111641 217
101 3300014969 Ga0157376_10039722 Ga0157376_100397224 217
102 3300014969 Ga0157376_10732203 Ga0157376_107322031 217
103 3300025290 Ga0207673_1007447 Ga0207673_10074472 217
104 3300025315 Ga0207697_10074480 Ga0207697_100744802 217
105 3300025903 Ga0207680_10148066 Ga0207680_101480662 217
106 3300025905 Ga0207685_10010235 Ga0207685_100102352 217
107 3300025910 Ga0207684_10012300 Ga0207684_100123003 217
108 3300025915 Ga0207693_10019972 Ga0207693_100199723 217
109 3300025915 Ga0207693_10203299 Ga0207693_102032992 217
110 3300025915 Ga0207693_10211232 Ga0207693_102112322 217
111 3300025916 Ga0207663_10033096 Ga0207663_100330963 217
112 3300025922 Ga0207646_10021584 Ga0207646_100215843 217
113 3300025927 Ga0207687_10176229 Ga0207687_101762292 217
114 3300025928 Ga0207700_10001708 Ga0207700_100017085 217
115 3300025939 Ga0207665_10026504 Ga0207665_100265043 217
116 3300025939 Ga0207665_10487148 Ga0207665_104871481 217
117 3300025944 Ga0207661_10007338 Ga0207661_100073387 217
118 3300025986 Ga0207658_10817168 Ga0207658_108171681 217
119 3300026035 Ga0207703_10238303 Ga0207703_102383032 217
120 3300026067 Ga0207678_10002001 Ga0207678_100020012 217
121 3300026078 Ga0207702_10026849 Ga0207702_100268492 217
122 3300026121 Ga0207683_10050814 Ga0207683_100508142 217
123 3300027876 Ga0209974_10069386 Ga0209974_100693862 217
124 3300028379 Ga0268266_10033616 Ga0268266_100336162 217
125 3300028381 Ga0268264_10835103 Ga0268264_108351032 217
126 3300035113 Ga0373936_0007547 Ga0373936_0007547_491_1144 217
127 3300035119 Ga0373956_0008798 Ga0373956_0008798_1347_2000 217
128 3300035120 Ga0373957_0001538 Ga0373957_0001538_1005_1658 217
129 3300035692 Ga0373935_0014512 Ga0373935_0014512_1077_1730 217
130 3300035725 Ga0373947_0007146 Ga0373947_0007146_964_1617 217
131 3300036401 Ga0373937_0068681 Ga0373937_0068681_1547_2200 217
132 3300036401 Ga0373937_0263203 Ga0373937_0263203_920_1573 217
133 3300037068 Ga0373925_0517020 Ga0373925_0517020_146_799 217
134 3300037068 Ga0373925_0824933 Ga0373925_0824933_53_706 217
135 3300042157 Ga0439458_0016417 Ga0439458_0016417_385_1038 217
136 3300042436 Ga0439435_0004503 Ga0439435_0004503_83_736 217
137 3300042437 Ga0439444_0065734 Ga0439444_0065734_55_708 217
138 3300044684 Ga0466966_0285728 Ga0466966_0285728_49_702 217
139 3300044901 Ga0466960_0239697 Ga0466960_0239697_176_958 217
140 3300045051 Ga0451576_0080518 Ga0451576_0080518_1783_2436 217
141 3300046454 Ga0495592_0392611 Ga0495592_0392611_174_827 217
142 3300046455 Ga0495603_0214284 Ga0495603_0214284_206_859 217
143 3300046459 Ga0495629_0003585 Ga0495629_0003585_919_1572 217
144 3300046462 Ga0495651_0037022 Ga0495651_0037022_891_1544 217
145 3300046462 Ga0495651_0581787 Ga0495651_0581787_16_669 217
146 3300046472 Ga0495580_0163642 Ga0495580_0163642_648_1301 217
147 3300046473 Ga0495582_0002403 Ga0495582_0002403_1714_2367 217
148 3300046476 Ga0495662_0007891 Ga0495662_0007891_1517_2170 217
149 3300046514 Ga0495618_0018234 Ga0495618_0018234_2638_3291 217
150 3300046516 Ga0495628_0497627 Ga0495628_0497627_174_827 217
151 3300046517 Ga0495630_0300935 Ga0495630_0300935_519_1172 217
152 3300046526 Ga0495666_0036847 Ga0495666_0036847_1432_2085 217
153 3300046531 Ga0495665_0008753 Ga0495665_0008753_4669_5322 217
154 3300046533 Ga0495640_0018232 Ga0495640_0018232_2178_2831 217
155 3300046535 Ga0495586_0043597 Ga0495586_0043597_52_705 217
156 3300046536 Ga0495587_0008658 Ga0495587_0008658_4910_5563 217
157 3300046543 Ga0495645_0066433 Ga0495645_0066433_296_949 217
158 3300046559 Ga0495667_0022160 Ga0495667_0022160_2517_3170 217
159 3300046642 Ga0495634_0007957 Ga0495634_0007957_4501_5154 217
160 3300046642 Ga0495634_0223302 Ga0495634_0223302_361_1014 217
161 3300046663 Ga0495635_0395775 Ga0495635_0395775_88_741 217
162 3300046675 Ga0495657_0012718 Ga0495657_0012718_3370_4023 217
163 3300046679 Ga0495623_0175327 Ga0495623_0175327_301_954 217
164 3300046683 Ga0495658_0014068 Ga0495658_0014068_978_1631 217
165 3300046683 Ga0495658_0553662 Ga0495658_0553662_52_705 217
166 3300046689 Ga0495613_0015917 Ga0495613_0015917_301_954 217
167 3300046689 Ga0495613_0154256 Ga0495613_0154256_967_1620 217
168 3300046690 Ga0495624_0006919 Ga0495624_0006919_2908_3561 217
169 3300046690 Ga0495624_0229357 Ga0495624_0229357_320_973 217
170 3300046809 Ga0495600_0024425 Ga0495600_0024425_603_1256 217
171 3300047315 Ga0495581_0100813 Ga0495581_0100813_295_948 217
172 3300047321 Ga0495676_0267646 Ga0495676_0267646_189_842 217
173 3300047322 Ga0495680_0068616 Ga0495680_0068616_1019_1672 217
174 3300047471 Ga0495684_0008374 Ga0495684_0008374_4042_4695 217
175 3300047471 Ga0495684_0461515 Ga0495684_0461515_174_827 217
176 3300047673 Ga0495593_0007543 Ga0495593_0007543_4371_5024 217
177 3300047673 Ga0495593_0234396 Ga0495593_0234396_42_695 217
178 3300048088 Ga0495602_0059412 Ga0495602_0059412_302_955 217
179 3300048088 Ga0495602_0095371 Ga0495602_0095371_1483_2136 217
180 3300048905 Ga0496102_0250887 Ga0496102_0250887_960_1613 217
181 3300048907 Ga0496104_0026940 Ga0496104_0026940_3481_4134 217
182 3300048908 Ga0496105_0031670 Ga0496105_0031670_1513_2166 217
183 3300048908 Ga0496105_0106800 Ga0496105_0106800_50_703 217
184 3300048908 Ga0496105_0411425 Ga0496105_0411425_122_775 217
185 3300048911 Ga0496108_0429483 Ga0496108_0429483_22_675 217
186 3300048911 Ga0496108_0775645 Ga0496108_0775645_98_751 217
187 3300048912 Ga0496109_0115733 Ga0496109_0115733_1100_1753 217
188 3300048917 Ga0496114_0033322 Ga0496114_0033322_3460_4113 217
189 3300048918 Ga0496115_0055305 Ga0496115_0055305_2013_2666 217
190 3300049583 Ga0501067_0018620 Ga0501067_0018620_2329_2982 217
191 3300049585 Ga0501069_0005726 Ga0501069_0005726_2746_3399 217
192 3300050507 nmdc:mga05p37_251953_c1 nmdc:mga05p37_251953_c1_1350_2003 217
193 3300050512 nmdc:mga0n895_293222_c1 nmdc:mga0n895_293222_c1_19_672 217
194 3300050514 nmdc:mga08x19_453_c1 nmdc:mga08x19_453_c1_27021_27674 217
195 3300053077 Ga0495601_0137572 Ga0495601_0137572_891_1544 217
196 3300053077 Ga0495601_0444194 Ga0495601_0444194_174_827 217
197 3300053084 Ga0495595_0013680 Ga0495595_0013680_22_675 217
198 3300053084 Ga0495595_0068086 Ga0495595_0068086_642_1295 217
199 3300053085 Ga0495619_0024111 Ga0495619_0024111_2219_2872 217
200 3300005327 Ga0070658_10149875 Ga0070658_101498753 218
201 3300005327 Ga0070658_10158544 Ga0070658_101585442 218
202 3300005328 Ga0070676_10162115 Ga0070676_101621152 218
203 3300005329 Ga0070683_100025751 Ga0070683_1000257512 218
204 3300005329 Ga0070683_100103425 Ga0070683_1001034252 218
205 3300005336 Ga0070680_100014149 Ga0070680_1000141494 218
206 3300005336 Ga0070680_100257606 Ga0070680_1002576062 218
207 3300005339 Ga0070660_100002826 Ga0070660_10000282610 218
208 3300005339 Ga0070660_100498792 Ga0070660_1004987922 218
209 3300005344 Ga0070661_100073409 Ga0070661_1000734093 218
210 3300005344 Ga0070661_100144694 Ga0070661_1001446941 218
211 3300005345 Ga0070692_10299253 Ga0070692_102992531 218
212 3300005347 Ga0070668_100140883 Ga0070668_1001408832 218
213 3300005353 Ga0070669_100051452 Ga0070669_1000514523 218
214 3300005353 Ga0070669_100107050 Ga0070669_1001070501 218
215 3300005367 Ga0070667_100683478 Ga0070667_1006834782 218
216 3300005435 Ga0070714_100006242 Ga0070714_1000062422 218
217 3300005435 Ga0070714_100061341 Ga0070714_1000613413 218
218 3300005435 Ga0070714_100245371 Ga0070714_1002453712 218
219 3300005436 Ga0070713_100000082 Ga0070713_10000008240 218
220 3300005436 Ga0070713_100014989 Ga0070713_1000149893 218
221 3300005436 Ga0070713_100041798 Ga0070713_1000417982 218
222 3300005437 Ga0070710_10078099 Ga0070710_100780992 218
223 3300005439 Ga0070711_100005906 Ga0070711_1000059064 218
224 3300005439 Ga0070711_100167351 Ga0070711_1001673512 218
225 3300005440 Ga0070705_100199479 Ga0070705_1001994791 218
226 3300005441 Ga0070700_100189042 Ga0070700_1001890422 218
227 3300005444 Ga0070694_100013180 Ga0070694_1000131805 218
228 3300005445 Ga0070708_100000591 Ga0070708_10000059125 218
229 3300005445 Ga0070708_100005942 Ga0070708_1000059426 218
230 3300005445 Ga0070708_100024431 Ga0070708_1000244313 218
231 3300005445 Ga0070708_100639337 Ga0070708_1006393372 218
232 3300005457 Ga0070662_100673803 Ga0070662_1006738031 218
233 3300005458 Ga0070681_10027219 Ga0070681_100272194 218
234 3300005458 Ga0070681_10041200 Ga0070681_100412003 218
235 3300005467 Ga0070706_100009021 Ga0070706_1000090214 218
236 3300005467 Ga0070706_100026212 Ga0070706_1000262122 218
237 3300005467 Ga0070706_100053581 Ga0070706_1000535812 218
238 3300005468 Ga0070707_100006204 Ga0070707_1000062047 218
239 3300005468 Ga0070707_100019118 Ga0070707_1000191188 218
240 3300005468 Ga0070707_100196087 Ga0070707_1001960872 218
241 3300005471 Ga0070698_100001665 Ga0070698_10000166514 218
242 3300005471 Ga0070698_100003182 Ga0070698_1000031825 218
243 3300005471 Ga0070698_100009752 Ga0070698_1000097522 218
244 3300005471 Ga0070698_100012150 Ga0070698_1000121505 218
245 3300005518 Ga0070699_100276844 Ga0070699_1002768442 218
246 3300005518 Ga0070699_100297810 Ga0070699_1002978103 218
247 3300005530 Ga0070679_100023466 Ga0070679_1000234668 218
248 3300005530 Ga0070679_100614799 Ga0070679_1006147991 218
249 3300005535 Ga0070684_100041997 Ga0070684_1000419976 218
250 3300005536 Ga0070697_100065932 Ga0070697_1000659323 218
251 3300005545 Ga0070695_100113218 Ga0070695_1001132182 218
252 3300005547 Ga0070693_100024784 Ga0070693_1000247845 218
253 3300005548 Ga0070665_100033882 Ga0070665_1000338825 218
254 3300005563 Ga0068855_100019205 Ga0068855_1000192053 218
255 3300005563 Ga0068855_100040999 Ga0068855_1000409992 218
256 3300005563 Ga0068855_100157753 Ga0068855_1001577532 218
257 3300005563 Ga0068855_100239215 Ga0068855_1002392152 218
258 3300005563 Ga0068855_100338539 Ga0068855_1003385392 218
259 3300005615 Ga0070702_100067488 Ga0070702_1000674881 218
260 3300005616 Ga0068852_100320332 Ga0068852_1003203322 218
261 3300005618 Ga0068864_100069399 Ga0068864_1000693993 218
262 3300005718 Ga0068866_10378935 Ga0068866_103789352 218
263 3300005719 Ga0068861_100075446 Ga0068861_1000754462 218
264 3300005841 Ga0068863_100601007 Ga0068863_1006010072 218
265 3300005843 Ga0068860_100415631 Ga0068860_1004156312 218
266 3300005844 Ga0068862_100051631 Ga0068862_1000516312 218
267 3300005844 Ga0068862_100206612 Ga0068862_1002066122 218
268 3300005937 Ga0081455_10292865 Ga0081455_102928652 218
269 3300005985 Ga0081539_10157753 Ga0081539_101577532 218
270 3300006028 Ga0070717_10028432 Ga0070717_100284324 218
271 3300006028 Ga0070717_10080610 Ga0070717_100806103 218
272 3300006028 Ga0070717_10126030 Ga0070717_101260302 218
273 3300006048 Ga0075363_100216879 Ga0075363_1002168791 218
274 3300006175 Ga0070712_100058375 Ga0070712_1000583753 218
275 3300006175 Ga0070712_100245177 Ga0070712_1002451772 218
276 3300006175 Ga0070712_100638582 Ga0070712_1006385822 218
277 3300006852 Ga0075433_10001917 Ga0075433_1000191714 218
278 3300006871 Ga0075434_100409738 Ga0075434_1004097381 218
279 3300006871 Ga0075434_101307536 Ga0075434_1013075361 218
280 3300006880 Ga0075429_100193489 Ga0075429_1001934892 218
281 3300006881 Ga0068865_100061825 Ga0068865_1000618252 218
282 3300009093 Ga0105240_10066347 Ga0105240_100663471 218
283 3300009093 Ga0105240_10067377 Ga0105240_100673773 218
284 3300009098 Ga0105245_10355423 Ga0105245_103554232 218
285 3300009098 Ga0105245_10689161 Ga0105245_106891612 218
286 3300009147 Ga0114129_10084319 Ga0114129_100843194 218
287 3300009147 Ga0114129_10233255 Ga0114129_102332551 218
288 3300009147 Ga0114129_10284406 Ga0114129_102844063 218
289 3300009176 Ga0105242_10902046 Ga0105242_109020461 218
290 3300009545 Ga0105237_10517365 Ga0105237_105173652 218
291 3300009553 Ga0105249_10257461 Ga0105249_102574612 218
292 3300010375 Ga0105239_10184345 Ga0105239_101843452 218
293 3300010375 Ga0105239_10230433 Ga0105239_102304332 218
294 3300013102 Ga0157371_10517536 Ga0157371_105175361 218
295 3300013104 Ga0157370_10014605 Ga0157370_100146057 218
296 3300013105 Ga0157369_10108960 Ga0157369_101089602 218
297 3300013105 Ga0157369_10396272 Ga0157369_103962722 218
298 3300013105 Ga0157369_10411519 Ga0157369_104115193 218
299 3300013296 Ga0157374_10134360 Ga0157374_101343603 218
300 3300013297 Ga0157378_10258498 Ga0157378_102584982 218
301 3300013307 Ga0157372_11543382 Ga0157372_115433821 218
302 3300013308 Ga0157375_10247379 Ga0157375_102473794 218
303 3300014968 Ga0157379_10427843 Ga0157379_104278432 218
304 3300017792 Ga0163161_10087384 Ga0163161_100873842 218
305 3300020070 Ga0206356_11200080 Ga0206356_112000801 218
306 3300020070 Ga0206356_11423237 Ga0206356_114232375 218
307 3300020076 Ga0206355_1410940 Ga0206355_14109402 218
308 3300020077 Ga0206351_10822550 Ga0206351_108225501 218
309 3300020078 Ga0206352_10800806 Ga0206352_108008062 218
310 3300020080 Ga0206350_10616182 Ga0206350_106161821 218
311 3300020080 Ga0206350_11571218 Ga0206350_115712181 218
312 3300020082 Ga0206353_11285308 Ga0206353_112853081 218
313 3300021388 Ga0213875_10030019 Ga0213875_100300192 218
314 3300021388 Ga0213875_10185488 Ga0213875_101854882 218
315 3300022467 Ga0224712_10054936 Ga0224712_100549362 218
316 3300025245 Ga0207425_1000010 Ga0207425_1000010286 218
317 3300025258 Ga0209129_1000034 Ga0209129_100003455 218
318 3300025258 Ga0209129_1016139 Ga0209129_10161392 218
319 3300025273 Ga0209673_1016968 Ga0209673_10169681 218
320 3300025294 Ga0209025_1000022 Ga0209025_1000022296 218
321 3300025295 Ga0209564_1017939 Ga0209564_10179394 218
322 3300025297 Ga0209758_1000080 Ga0209758_1000080225 218
323 3300025303 Ga0209051_1003299 Ga0209051_100329910 218
324 3300025898 Ga0207692_10012797 Ga0207692_100127972 218
325 3300025899 Ga0207642_10397071 Ga0207642_103970711 218
326 3300025909 Ga0207705_10059268 Ga0207705_100592684 218
327 3300025909 Ga0207705_10080866 Ga0207705_100808662 218
328 3300025910 Ga0207684_10001612 Ga0207684_100016128 218
329 3300025910 Ga0207684_10003745 Ga0207684_1000374511 218
330 3300025910 Ga0207684_10016316 Ga0207684_100163162 218
331 3300025910 Ga0207684_10536785 Ga0207684_105367852 218
332 3300025912 Ga0207707_10029690 Ga0207707_100296902 218
333 3300025912 Ga0207707_10079930 Ga0207707_100799302 218
334 3300025913 Ga0207695_10058643 Ga0207695_100586432 218
335 3300025913 Ga0207695_10315814 Ga0207695_103158142 218
336 3300025915 Ga0207693_10129786 Ga0207693_101297862 218
337 3300025915 Ga0207693_10232135 Ga0207693_102321351 218
338 3300025916 Ga0207663_10016574 Ga0207663_100165741 218
339 3300025916 Ga0207663_10271893 Ga0207663_102718931 218
340 3300025916 Ga0207663_10293832 Ga0207663_102938321 218
341 3300025917 Ga0207660_10051037 Ga0207660_100510371 218
342 3300025917 Ga0207660_10234018 Ga0207660_102340182 218
343 3300025917 Ga0207660_10875937 Ga0207660_108759371 218
344 3300025919 Ga0207657_10001151 Ga0207657_100011513 218
345 3300025919 Ga0207657_10223985 Ga0207657_102239853 218
346 3300025919 Ga0207657_10330489 Ga0207657_103304892 218
347 3300025920 Ga0207649_10120990 Ga0207649_101209902 218
348 3300025921 Ga0207652_10034811 Ga0207652_100348115 218
349 3300025921 Ga0207652_10161585 Ga0207652_101615852 218
350 3300025922 Ga0207646_10002603 Ga0207646_1000260312 218
351 3300025922 Ga0207646_10005499 Ga0207646_100054994 218
352 3300025922 Ga0207646_10018766 Ga0207646_100187666 218
353 3300025923 Ga0207681_10043337 Ga0207681_100433373 218
354 3300025923 Ga0207681_10060952 Ga0207681_100609523 218
355 3300025926 Ga0207659_10310614 Ga0207659_103106142 218
356 3300025928 Ga0207700_10000495 Ga0207700_1000049516 218
357 3300025928 Ga0207700_10006711 Ga0207700_100067117 218
358 3300025928 Ga0207700_10021242 Ga0207700_100212423 218
359 3300025928 Ga0207700_10379976 Ga0207700_103799762 218
360 3300025928 Ga0207700_10448107 Ga0207700_104481072 218
361 3300025929 Ga0207664_10393164 Ga0207664_103931642 218
362 3300025929 Ga0207664_10565907 Ga0207664_105659071 218
363 3300025938 Ga0207704_10395652 Ga0207704_103956522 218
364 3300025939 Ga0207665_10014600 Ga0207665_100146005 218
365 3300025939 Ga0207665_10109420 Ga0207665_101094202 218
366 3300025940 Ga0207691_10400166 Ga0207691_104001662 218
367 3300025944 Ga0207661_10126170 Ga0207661_101261702 218
368 3300025949 Ga0207667_10187034 Ga0207667_101870342 218
369 3300025949 Ga0207667_10212620 Ga0207667_102126203 218
370 3300025949 Ga0207667_10432725 Ga0207667_104327252 218
371 3300025949 Ga0207667_11015163 Ga0207667_110151631 218
372 3300025972 Ga0207668_10036843 Ga0207668_100368433 218
373 3300025986 Ga0207658_10599829 Ga0207658_105998291 218
374 3300026023 Ga0207677_10338269 Ga0207677_103382692 218
375 3300026067 Ga0207678_10071991 Ga0207678_100719911 218
376 3300026075 Ga0207708_10238797 Ga0207708_102387972 218
377 3300026095 Ga0207676_10093139 Ga0207676_100931392 218
378 3300026118 Ga0207675_100147270 Ga0207675_1001472702 218
379 3300026121 Ga0207683_10175152 Ga0207683_101751522 218
380 3300028379 Ga0268266_10033885 Ga0268266_100338855 218
381 3300028379 Ga0268266_10211834 Ga0268266_102118342 218
382 3300028380 Ga0268265_10123606 Ga0268265_101236062 218
383 3300028381 Ga0268264_10077185 Ga0268264_100771852 218
384 3300028577 Ga0265318_10053413 Ga0265318_100534132 218
385 3300031247 Ga0265340_10046072 Ga0265340_100460721 218
386 3300031731 Ga0307405_10001892 Ga0307405_100018925 218
387 3300031911 Ga0307412_10027123 Ga0307412_100271233 218
388 3300031995 Ga0307409_100214464 Ga0307409_1002144641 218
389 3300032002 Ga0307416_100043186 Ga0307416_1000431862 218
390 3300035083 Ga0373926_0057098 Ga0373926_0057098_248_913 218
391 3300035086 Ga0373934_0005878 Ga0373934_0005878_1100_1756 218
392 3300035089 Ga0373944_0000572 Ga0373944_0000572_776_1441 218
393 3300035113 Ga0373936_0001965 Ga0373936_0001965_130_795 218
394 3300035113 Ga0373936_0016728 Ga0373936_0016728_246_902 218
395 3300035113 Ga0373936_0078679 Ga0373936_0078679_326_982 218
396 3300035116 Ga0373945_0000063 Ga0373945_0000063_13506_14171 218
397 3300035117 Ga0373953_0011879 Ga0373953_0011879_1437_2093 218
398 3300035118 Ga0373954_0254508 Ga0373954_0254508_187_843 218
399 3300035120 Ga0373957_0030952 Ga0373957_0030952_1074_1730 218
400 3300035170 Ga0373943_0004489 Ga0373943_0004489_4051_4707 218
401 3300035171 Ga0373946_0000960 Ga0373946_0000960_6914_7579 218
402 3300035171 Ga0373946_0086188 Ga0373946_0086188_396_1052 218
403 3300035172 Ga0373955_0025435 Ga0373955_0025435_1284_1940 218
404 3300035410 Ga0373924_0001176 Ga0373924_0001176_4097_4753 218
405 3300035410 Ga0373924_0029532 Ga0373924_0029532_517_1176 218
406 3300035692 Ga0373935_0000853 Ga0373935_0000853_13720_14385 218
407 3300035692 Ga0373935_0143482 Ga0373935_0143482_926_1582 218
408 3300035695 Ga0373927_0001934 Ga0373927_0001934_8879_9544 218
409 3300035695 Ga0373927_0303279 Ga0373927_0303279_167_823 218
410 3300035724 Ga0373933_0026513 Ga0373933_0026513_1573_2229 218
411 3300035725 Ga0373947_0000952 Ga0373947_0000952_10929_11594 218
412 3300035725 Ga0373947_0023489 Ga0373947_0023489_2380_3036 218
413 3300035725 Ga0373947_0397961 Ga0373947_0397961_186_860 218
414 3300036401 Ga0373937_0032444 Ga0373937_0032444_2982_3638 218
415 3300036401 Ga0373937_0049470 Ga0373937_0049470_50_730 218
416 3300037068 Ga0373925_0007011 Ga0373925_0007011_2667_3332 218
417 3300037068 Ga0373925_0023535 Ga0373925_0023535_3131_3787 218
418 3300037068 Ga0373925_0626554 Ga0373925_0626554_79_735 218
419 3300037312 Ga0395899_0002594 Ga0395899_0002594_7036_7692 218
420 3300037312 Ga0395899_0004284 Ga0395899_0004284_4307_4990 218
421 3300037312 Ga0395899_0005207 Ga0395899_0005207_3404_4060 218
422 3300037312 Ga0395899_0013064 Ga0395899_0013064_5468_6124 218
423 3300037312 Ga0395899_0043707 Ga0395899_0043707_2659_3315 218
424 3300037312 Ga0395899_0222945 Ga0395899_0222945_159_815 218
425 3300037312 Ga0395899_0524011 Ga0395899_0524011_23_679 218
426 3300037418 Ga0395900_0002349 Ga0395900_0002349_17263_17919 218
427 3300037418 Ga0395900_0005752 Ga0395900_0005752_7140_7796 218
428 3300037418 Ga0395900_0025418 Ga0395900_0025418_1793_2449 218
429 3300037418 Ga0395900_0177898 Ga0395900_0177898_1231_1887 218
430 3300037418 Ga0395900_0233809 Ga0395900_0233809_204_860 218
431 3300037466 Ga0395898_0000723 Ga0395898_0000723_4147_4803 218
432 3300037466 Ga0395898_0006846 Ga0395898_0006846_5196_5879 218
433 3300037466 Ga0395898_0015393 Ga0395898_0015393_1365_2021 218
434 3300037466 Ga0395898_0040585 Ga0395898_0040585_3500_4156 218
435 3300037466 Ga0395898_0045376 Ga0395898_0045376_2129_2785 218
436 3300037466 Ga0395898_0073156 Ga0395898_0073156_741_1397 218
437 3300037466 Ga0395898_0169129 Ga0395898_0169129_1287_1943 218
438 3300037466 Ga0395898_0435956 Ga0395898_0435956_384_1040 218
439 3300037466 Ga0395898_0708221 Ga0395898_0708221_34_708 218
440 3300037471 Ga0395905_0001654 Ga0395905_0001654_10106_10762 218
441 3300037471 Ga0395905_0006660 Ga0395905_0006660_7624_8280 218
442 3300037471 Ga0395905_0016600 Ga0395905_0016600_4649_5305 218
443 3300037471 Ga0395905_0046735 Ga0395905_0046735_239_928 218
444 3300037471 Ga0395905_0066264 Ga0395905_0066264_250_906 218
445 3300037853 Ga0436364_0241003 Ga0436364_0241003_209_865 218
446 3300037853 Ga0436364_0477471 Ga0436364_0477471_315_971 218
447 3300037853 Ga0436364_0746810 Ga0436364_0746810_1503_2159 218
448 3300037853 Ga0436364_0814406 Ga0436364_0814406_368_1024 218
449 3300037853 Ga0436364_1093749 Ga0436364_1093749_3990_4646 218
450 3300038443 Ga0395901_0001895 Ga0395901_0001895_3633_4289 218
451 3300038443 Ga0395901_0006183 Ga0395901_0006183_8449_9105 218
452 3300038443 Ga0395901_0017952 Ga0395901_0017952_3539_4195 218
453 3300038443 Ga0395901_0029170 Ga0395901_0029170_3314_3997 218
454 3300038443 Ga0395901_0036453 Ga0395901_0036453_1272_1928 218
455 3300038443 Ga0395901_0037977 Ga0395901_0037977_438_1094 218
456 3300038443 Ga0395901_0068301 Ga0395901_0068301_1507_2163 218
457 3300038443 Ga0395901_0108335 Ga0395901_0108335_1435_2091 218
458 3300038443 Ga0395901_0230163 Ga0395901_0230163_565_1254 218
459 3300038443 Ga0395901_0517071 Ga0395901_0517071_107_763 218
460 3300039437 Ga0436365_0607389 Ga0436365_0607389_170_826 218
461 3300039447 Ga0436361_0287188 Ga0436361_0287188_890_1546 218
462 3300039450 Ga0436363_0055457 Ga0436363_0055457_404_1060 218
463 3300039450 Ga0436363_0883032 Ga0436363_0883032_1192_1848 218
464 3300039450 Ga0436363_1548335 Ga0436363_1548335_805_1461 218
465 3300039453 Ga0436362_0488184 Ga0436362_0488184_121_780 218
466 3300041459 Ga0451800_1069473 Ga0451800_1069473_533_1207 218
467 3300041999 Ga0439433_0008716 Ga0439433_0008716_894_1550 218
468 3300042002 Ga0439442_049845 Ga0439442_049845_132_791 218
469 3300042003 Ga0439443_008924 Ga0439443_008924_692_1348 218
470 3300042007 Ga0439449_0001825 Ga0439449_0001825_1196_1852 218
471 3300042014 Ga0439457_017883 Ga0439457_017883_256_915 218
472 3300044683 Ga0466965_0352817 Ga0466965_0352817_72_728 218
473 3300044684 Ga0466966_0123662 Ga0466966_0123662_505_1161 218
474 3300044684 Ga0466966_0134402 Ga0466966_0134402_134_790 218
475 3300044693 Ga0466961_0006650 Ga0466961_0006650_2164_2820 218
476 3300044693 Ga0466961_0019811 Ga0466961_0019811_2508_3164 218
477 3300044693 Ga0466961_0247945 Ga0466961_0247945_244_927 218
478 3300044694 Ga0466963_0038829 Ga0466963_0038829_326_982 218
479 3300044694 Ga0466963_0485373 Ga0466963_0485373_204_860 218
480 3300044706 Ga0466964_0033357 Ga0466964_0033357_409_1065 218
481 3300044706 Ga0466964_0043162 Ga0466964_0043162_928_1602 218
482 3300044765 Ga0466970_0034219 Ga0466970_0034219_189_845 218
483 3300044842 Ga0466957_0141990 Ga0466957_0141990_123_782 218
484 3300044842 Ga0466957_0242800 Ga0466957_0242800_290_946 218
485 3300044842 Ga0466957_0751384 Ga0466957_0751384_23_679 218
486 3300044901 Ga0466960_0138646 Ga0466960_0138646_95_751 218
487 3300045049 Ga0466959_0008855 Ga0466959_0008855_198_854 218
488 3300045049 Ga0466959_0102586 Ga0466959_0102586_429_1085 218
489 3300045049 Ga0466959_0206963 Ga0466959_0206963_180_857 218
490 3300045836 Ga0466958_0026318 Ga0466958_0026318_202_858 218
491 3300045836 Ga0466958_0231418 Ga0466958_0231418_278_934 218
492 3300045976 Ga0466967_0094525 Ga0466967_0094525_1054_1710 218
493 3300045976 Ga0466967_0114184 Ga0466967_0114184_1088_1744 218
494 3300045976 Ga0466967_0118255 Ga0466967_0118255_1086_1742 218
495 3300045976 Ga0466967_0441083 Ga0466967_0441083_398_1054 218
496 3300045976 Ga0466967_0729485 Ga0466967_0729485_299_955 218
497 3300045976 Ga0466967_0755429 Ga0466967_0755429_89_763 218
498 3300046459 Ga0495629_0231257 Ga0495629_0231257_24_680 218
499 3300046459 Ga0495629_0337578 Ga0495629_0337578_218_874 218
500 3300046461 Ga0495641_0013375 Ga0495641_0013375_3365_4030 218
501 3300046461 Ga0495641_0016836 Ga0495641_0016836_1342_1998 218
502 3300046461 Ga0495641_0019613 Ga0495641_0019613_2151_2807 218
503 3300046462 Ga0495651_0007255 Ga0495651_0007255_6633_7313 218
504 3300046462 Ga0495651_0010663 Ga0495651_0010663_6041_6706 218
505 3300046463 Ga0495653_0002608 Ga0495653_0002608_11576_12241 218
506 3300046463 Ga0495653_0164048 Ga0495653_0164048_676_1356 218
507 3300046472 Ga0495580_0011599 Ga0495580_0011599_1832_2488 218
508 3300046473 Ga0495582_0074538 Ga0495582_0074538_912_1568 218
509 3300046473 Ga0495582_0426708 Ga0495582_0426708_26_682 218
510 3300046475 Ga0495639_0012994 Ga0495639_0012994_2233_2889 218
511 3300046475 Ga0495639_0031004 Ga0495639_0031004_1096_1761 218
512 3300046476 Ga0495662_0003915 Ga0495662_0003915_2574_3230 218
513 3300046477 Ga0495664_0000220 Ga0495664_0000220_7996_8661 218
514 3300046477 Ga0495664_0002529 Ga0495664_0002529_7248_7904 218
515 3300046477 Ga0495664_0177642 Ga0495664_0177642_327_983 218
516 3300046499 Ga0495594_0149699 Ga0495594_0149699_48_707 218
517 3300046511 Ga0495608_0032894 Ga0495608_0032894_1465_2121 218
518 3300046514 Ga0495618_0042860 Ga0495618_0042860_1437_2102 218
519 3300046516 Ga0495628_0040793 Ga0495628_0040793_256_912 218
520 3300046516 Ga0495628_0231894 Ga0495628_0231894_235_900 218
521 3300046517 Ga0495630_0012136 Ga0495630_0012136_4020_4685 218
522 3300046517 Ga0495630_0572363 Ga0495630_0572363_173_829 218
523 3300046528 Ga0495642_0013495 Ga0495642_0013495_1817_2473 218
524 3300046528 Ga0495642_0151624 Ga0495642_0151624_302_976 218
525 3300046529 Ga0495652_0148176 Ga0495652_0148176_401_1057 218
526 3300046530 Ga0495654_0173106 Ga0495654_0173106_46_729 218
527 3300046531 Ga0495665_0004311 Ga0495665_0004311_2160_2825 218
528 3300046531 Ga0495665_0174354 Ga0495665_0174354_428_1087 218
529 3300046533 Ga0495640_0031590 Ga0495640_0031590_114_770 218
530 3300046533 Ga0495640_0032474 Ga0495640_0032474_1038_1703 218
531 3300046535 Ga0495586_0003605 Ga0495586_0003605_944_1600 218
532 3300046535 Ga0495586_0050399 Ga0495586_0050399_284_940 218
533 3300046535 Ga0495586_0113973 Ga0495586_0113973_254_910 218
534 3300046535 Ga0495586_0198746 Ga0495586_0198746_396_1052 218
535 3300046536 Ga0495587_0045647 Ga0495587_0045647_1927_2583 218
536 3300046543 Ga0495645_0047561 Ga0495645_0047561_37_693 218
537 3300046543 Ga0495645_0071177 Ga0495645_0071177_563_1228 218
538 3300046543 Ga0495645_0164328 Ga0495645_0164328_242_898 218
539 3300046559 Ga0495667_0003797 Ga0495667_0003797_2043_2708 218
540 3300046559 Ga0495667_0017451 Ga0495667_0017451_1734_2390 218
541 3300046559 Ga0495667_0026272 Ga0495667_0026272_2468_3148 218
542 3300046615 Ga0495656_0068202 Ga0495656_0068202_447_1121 218
543 3300046642 Ga0495634_0009612 Ga0495634_0009612_5376_6032 218
544 3300046642 Ga0495634_0041359 Ga0495634_0041359_409_1074 218
545 3300046663 Ga0495635_0001457 Ga0495635_0001457_2129_2794 218
546 3300046663 Ga0495635_0031578 Ga0495635_0031578_1799_2455 218
547 3300046663 Ga0495635_0110013 Ga0495635_0110013_744_1400 218
548 3300046664 Ga0495659_0110170 Ga0495659_0110170_318_974 218
549 3300046675 Ga0495657_0008915 Ga0495657_0008915_3896_4561 218
550 3300046675 Ga0495657_0301447 Ga0495657_0301447_265_945 218
551 3300046678 Ga0495599_0009684 Ga0495599_0009684_2503_3159 218
552 3300046678 Ga0495599_0070258 Ga0495599_0070258_581_1246 218
553 3300046678 Ga0495599_0178339 Ga0495599_0178339_557_1255 218
554 3300046681 Ga0495647_0012544 Ga0495647_0012544_1829_2488 218
555 3300046683 Ga0495658_0014130 Ga0495658_0014130_2152_2808 218
556 3300046690 Ga0495624_0006089 Ga0495624_0006089_3689_4354 218
557 3300046690 Ga0495624_0020464 Ga0495624_0020464_624_1280 218
558 3300046809 Ga0495600_0111697 Ga0495600_0111697_426_1091 218
559 3300047315 Ga0495581_0015110 Ga0495581_0015110_3780_4436 218
560 3300047315 Ga0495581_0024853 Ga0495581_0024853_2352_3017 218
561 3300047317 Ga0495604_0062518 Ga0495604_0062518_1926_2582 218
562 3300047319 Ga0495674_0003143 Ga0495674_0003143_4868_5533 218
563 3300047319 Ga0495674_0010021 Ga0495674_0010021_3789_4445 218
564 3300047319 Ga0495674_0058105 Ga0495674_0058105_2313_2969 218
565 3300047320 Ga0495672_0047694 Ga0495672_0047694_1245_1904 218
566 3300047321 Ga0495676_0006015 Ga0495676_0006015_8067_8732 218
567 3300047322 Ga0495680_0014676 Ga0495680_0014676_3994_4659 218
568 3300047322 Ga0495680_0029339 Ga0495680_0029339_3155_3835 218
569 3300047322 Ga0495680_0034479 Ga0495680_0034479_1100_1756 218
570 3300047444 Ga0495675_0058499 Ga0495675_0058499_926_1606 218
571 3300047471 Ga0495684_0010160 Ga0495684_0010160_2937_3602 218
572 3300047471 Ga0495684_0492987 Ga0495684_0492987_76_732 218
573 3300047673 Ga0495593_0112778 Ga0495593_0112778_317_982 218
574 3300048088 Ga0495602_0029367 Ga0495602_0029367_3881_4561 218
575 3300048088 Ga0495602_0054854 Ga0495602_0054854_144_800 218
576 3300048089 Ga0495614_0241648 Ga0495614_0241648_81_737 218
577 3300048904 Ga0496101_0087376 Ga0496101_0087376_1264_1923 218
578 3300048904 Ga0496101_0151883 Ga0496101_0151883_32_688 218
579 3300048905 Ga0496102_0114872 Ga0496102_0114872_1313_1969 218
580 3300048906 Ga0496103_0073987 Ga0496103_0073987_895_1551 218
581 3300048906 Ga0496103_0396739 Ga0496103_0396739_176_832 218
582 3300048907 Ga0496104_0428175 Ga0496104_0428175_148_804 218
583 3300048907 Ga0496104_0785421 Ga0496104_0785421_127_783 218
584 3300048911 Ga0496108_0032356 Ga0496108_0032356_2590_3246 218
585 3300048913 Ga0496110_0084804 Ga0496110_0084804_679_1335 218
586 3300048913 Ga0496110_0258689 Ga0496110_0258689_168_824 218
587 3300048915 Ga0496112_0097705 Ga0496112_0097705_194_850 218
588 3300048915 Ga0496112_0105277 Ga0496112_0105277_1191_1847 218
589 3300048915 Ga0496112_0947746 Ga0496112_0947746_68_730 218
590 3300048916 Ga0496113_0291029 Ga0496113_0291029_596_1252 218
591 3300048918 Ga0496115_0002965 Ga0496115_0002965_9154_9810 218
592 3300048918 Ga0496115_0662796 Ga0496115_0662796_50_712 218
593 3300048919 Ga0496116_0004347 Ga0496116_0004347_10389_11048 218
594 3300048919 Ga0496116_0018572 Ga0496116_0018572_168_827 218
595 3300048919 Ga0496116_0047984 Ga0496116_0047984_156_815 218
596 3300048919 Ga0496116_0147561 Ga0496116_0147561_167_826 218
597 3300048920 Ga0496117_0021082 Ga0496117_0021082_2486_3145 218
598 3300048921 Ga0496118_0007568 Ga0496118_0007568_1522_2181 218
599 3300048922 Ga0496119_0234953 Ga0496119_0234953_75_734 218
600 3300048924 Ga0496121_0028239 Ga0496121_0028239_2469_3128 218
601 3300048924 Ga0496121_0041108 Ga0496121_0041108_1518_2177 218
602 3300048925 Ga0496122_0024068 Ga0496122_0024068_3330_3989 218
603 3300048926 Ga0496123_0083889 Ga0496123_0083889_1120_1779 218
604 3300048927 Ga0496124_0003625 Ga0496124_0003625_1705_2364 218
605 3300048927 Ga0496124_0014196 Ga0496124_0014196_6339_6998 218
606 3300048927 Ga0496124_0135254 Ga0496124_0135254_257_916 218
607 3300048928 Ga0496125_0006540 Ga0496125_0006540_681_1340 218
608 3300048929 Ga0496126_0040560 Ga0496126_0040560_127_786 218
609 3300049569 Ga0501032_0595240 Ga0501032_0595240_29_685 218
610 3300049578 Ga0501042_0351802 Ga0501042_0351802_268_942 218
611 3300049581 Ga0501047_0076364 Ga0501047_0076364_1243_1899 218
612 3300049583 Ga0501067_0007851 Ga0501067_0007851_3393_4049 218
613 3300049585 Ga0501069_0022744 Ga0501069_0022744_272_928 218
614 3300049586 Ga0501070_0037984 Ga0501070_0037984_1286_1942 218
615 3300049586 Ga0501070_0212427 Ga0501070_0212427_741_1397 218
616 3300049588 Ga0501072_0096462 Ga0501072_0096462_402_1064 218
617 3300049589 Ga0501073_0650401 Ga0501073_0650401_55_711 218
618 3300049590 Ga0501074_0016085 Ga0501074_0016085_1736_2392 218
619 3300049592 Ga0501076_0578577 Ga0501076_0578577_41_730 218
620 3300049703 Ga0501219_005207 Ga0501219_005207_182_838 218
621 3300049742 Ga0501080_0300785 Ga0501080_0300785_220_876 218
622 3300049742 Ga0501080_0715976 Ga0501080_0715976_66_722 218
623 3300049822 Ga0501035_0054899 Ga0501035_0054899_616_1272 218
624 3300050507 nmdc:mga05p37_251403_c1 nmdc:mga05p37_251403_c1_1067_1741 218
625 3300050512 nmdc:mga0n895_1081549_c1 nmdc:mga0n895_1081549_c1_69_725 218
626 3300050512 nmdc:mga0n895_523505_c1 nmdc:mga0n895_523505_c1_379_1035 218
627 3300050513 nmdc:mga0rr50_559929_c1 nmdc:mga0rr50_559929_c1_26_688 218
628 3300050514 nmdc:mga08x19_258241_c1 nmdc:mga08x19_258241_c1_68_724 218
629 3300050515 nmdc:mga0a205_98346_c1 nmdc:mga0a205_98346_c1_867_1523 218
630 3300050516 nmdc:mga0sz30_111766_c1 nmdc:mga0sz30_111766_c1_390_1049 218
631 3300053077 Ga0495601_0009699 Ga0495601_0009699_4115_4771 218
632 3300053078 Ga0495612_0095485 Ga0495612_0095485_354_1010 218
633 3300053078 Ga0495612_0149167 Ga0495612_0149167_68_733 218
634 3300053125 Ga0500618_003215 Ga0500618_003215_3164_3823 218
635 3300059490 Ga0587066_020355 Ga0587066_020355_76_732 218
636 3300059492 Ga0587073_0093273 Ga0587073_0093273_63_737 218
637 3300059630 Ga0587128_043366 Ga0587128_043366_78_752 218
638 3300059645 Ga0587076_012844 Ga0587076_012844_99_758 218
639 3300059655 Ga0587114_038702 Ga0587114_038702_78_752 218
640 3300061734 Ga0530510_0198832 Ga0530510_0198832_241_897 218
641 3300004801 Ga0058860_11949334 Ga0058860_119493341 219
642 3300005290 Ga0065712_10012833 Ga0065712_100128332 219
643 3300005295 Ga0065707_10227701 Ga0065707_102277011 219
644 3300005330 Ga0070690_100176681 Ga0070690_1001766812 219
645 3300005338 Ga0068868_100080096 Ga0068868_1000800962 219
646 3300005341 Ga0070691_10005642 Ga0070691_100056425 219
647 3300005341 Ga0070691_10216479 Ga0070691_102164791 219
648 3300005344 Ga0070661_100000041 Ga0070661_100000041105 219
649 3300005344 Ga0070661_100042290 Ga0070661_1000422902 219
650 3300005347 Ga0070668_100029391 Ga0070668_1000293911 219
651 3300005347 Ga0070668_100093029 Ga0070668_1000930293 219
652 3300005353 Ga0070669_100236350 Ga0070669_1002363502 219
653 3300005355 Ga0070671_100098474 Ga0070671_1000984744 219
654 3300005365 Ga0070688_100067483 Ga0070688_1000674833 219
655 3300005367 Ga0070667_100017618 Ga0070667_1000176185 219
656 3300005434 Ga0070709_10004332 Ga0070709_100043323 219
657 3300005435 Ga0070714_100010508 Ga0070714_1000105085 219
658 3300005435 Ga0070714_100059408 Ga0070714_1000594081 219
659 3300005436 Ga0070713_100008049 Ga0070713_1000080496 219
660 3300005437 Ga0070710_10003513 Ga0070710_1000351310 219
661 3300005439 Ga0070711_100035041 Ga0070711_1000350413 219
662 3300005445 Ga0070708_100132297 Ga0070708_1001322972 219
663 3300005445 Ga0070708_100504208 Ga0070708_1005042081 219
664 3300005455 Ga0070663_100120677 Ga0070663_1001206772 219
665 3300005456 Ga0070678_100089382 Ga0070678_1000893822 219
666 3300005457 Ga0070662_100485489 Ga0070662_1004854891 219
667 3300005458 Ga0070681_10169066 Ga0070681_101690661 219
668 3300005467 Ga0070706_100001102 Ga0070706_1000011023 219
669 3300005467 Ga0070706_100149766 Ga0070706_1001497662 219
670 3300005467 Ga0070706_100232846 Ga0070706_1002328462 219
671 3300005468 Ga0070707_100002467 Ga0070707_1000024679 219
672 3300005468 Ga0070707_100009048 Ga0070707_1000090487 219
673 3300005468 Ga0070707_100187051 Ga0070707_1001870512 219
674 3300005468 Ga0070707_100371521 Ga0070707_1003715211 219
675 3300005471 Ga0070698_100001309 Ga0070698_10000130919 219
676 3300005471 Ga0070698_100001661 Ga0070698_10000166116 219
677 3300005471 Ga0070698_100008526 Ga0070698_1000085268 219
678 3300005471 Ga0070698_100036344 Ga0070698_1000363445 219
679 3300005471 Ga0070698_100355926 Ga0070698_1003559262 219
680 3300005518 Ga0070699_100018447 Ga0070699_1000184477 219
681 3300005518 Ga0070699_100836271 Ga0070699_1008362711 219
682 3300005530 Ga0070679_100209681 Ga0070679_1002096812 219
683 3300005536 Ga0070697_100003592 Ga0070697_1000035928 219
684 3300005536 Ga0070697_100068493 Ga0070697_1000684932 219
685 3300005536 Ga0070697_100715297 Ga0070697_1007152971 219
686 3300005539 Ga0068853_100059756 Ga0068853_1000597563 219
687 3300005546 Ga0070696_100222347 Ga0070696_1002223472 219
688 3300005548 Ga0070665_101106780 Ga0070665_1011067801 219
689 3300005563 Ga0068855_100127377 Ga0068855_1001273773 219
690 3300005577 Ga0068857_100218622 Ga0068857_1002186222 219
691 3300005614 Ga0068856_100089394 Ga0068856_1000893942 219
692 3300005616 Ga0068852_100256473 Ga0068852_1002564732 219
693 3300005617 Ga0068859_100046143 Ga0068859_1000461436 219
694 3300005618 Ga0068864_100117908 Ga0068864_1001179082 219
695 3300005718 Ga0068866_10532197 Ga0068866_105321971 219
696 3300005834 Ga0068851_10180533 Ga0068851_101805332 219
697 3300005841 Ga0068863_100011306 Ga0068863_1000113068 219
698 3300005842 Ga0068858_100920913 Ga0068858_1009209131 219
699 3300005844 Ga0068862_100003797 Ga0068862_1000037974 219
700 3300005844 Ga0068862_100024969 Ga0068862_1000249693 219
701 3300005937 Ga0081455_10015272 Ga0081455_100152728 219
702 3300005937 Ga0081455_10331401 Ga0081455_103314012 219
703 3300006028 Ga0070717_10007092 Ga0070717_100070924 219
704 3300006058 Ga0075432_10028966 Ga0075432_100289662 219
705 3300006163 Ga0070715_10001832 Ga0070715_100018327 219
706 3300006173 Ga0070716_100125681 Ga0070716_1001256811 219
707 3300006173 Ga0070716_100139619 Ga0070716_1001396192 219
708 3300006237 Ga0097621_100105899 Ga0097621_1001058993 219
709 3300006358 Ga0068871_100116467 Ga0068871_1001164673 219
710 3300006844 Ga0075428_100015027 Ga0075428_1000150275 219
711 3300006846 Ga0075430_100000050 Ga0075430_10000005058 219
712 3300006846 Ga0075430_100002824 Ga0075430_1000028244 219
713 3300006846 Ga0075430_100038855 Ga0075430_1000388555 219
714 3300006846 Ga0075430_100097061 Ga0075430_1000970612 219
715 3300006847 Ga0075431_100007688 Ga0075431_1000076888 219
716 3300006852 Ga0075433_10087741 Ga0075433_100877413 219
717 3300006871 Ga0075434_100012228 Ga0075434_1000122288 219
718 3300006880 Ga0075429_100024107 Ga0075429_1000241073 219
719 3300006880 Ga0075429_100055826 Ga0075429_1000558262 219
720 3300006880 Ga0075429_100610396 Ga0075429_1006103961 219
721 3300006931 Ga0097620_100046143 Ga0097620_1000461436 219
722 3300007076 Ga0075435_100752619 Ga0075435_1007526191 219
723 3300007265 Ga0099794_10003354 Ga0099794_100033547 219
724 3300007788 Ga0099795_10135711 Ga0099795_101357112 219
725 3300009094 Ga0111539_10367577 Ga0111539_103675771 219
726 3300009098 Ga0105245_10008241 Ga0105245_100082412 219
727 3300009098 Ga0105245_10069111 Ga0105245_100691111 219
728 3300009098 Ga0105245_10498443 Ga0105245_104984432 219
729 3300009147 Ga0114129_10019737 Ga0114129_100197372 219
730 3300009147 Ga0114129_10425114 Ga0114129_104251142 219
731 3300009147 Ga0114129_11686697 Ga0114129_116866971 219
732 3300009174 Ga0105241_10105659 Ga0105241_101056592 219
733 3300009176 Ga0105242_10251780 Ga0105242_102517801 219
734 3300009177 Ga0105248_10266395 Ga0105248_102663952 219
735 3300009545 Ga0105237_10673846 Ga0105237_106738462 219
736 3300009551 Ga0105238_10085401 Ga0105238_100854013 219
737 3300010375 Ga0105239_10225689 Ga0105239_102256892 219
738 3300011119 Ga0105246_10225168 Ga0105246_102251682 219
739 3300013100 Ga0157373_10005491 Ga0157373_100054917 219
740 3300013105 Ga0157369_10622313 Ga0157369_106223132 219
741 3300013306 Ga0163162_10246069 Ga0163162_102460692 219
742 3300013308 Ga0157375_10043156 Ga0157375_100431564 219
743 3300020070 Ga0206356_11401552 Ga0206356_114015521 219
744 3300021377 Ga0213874_10000875 Ga0213874_100008754 219
745 3300021384 Ga0213876_10034717 Ga0213876_100347172 219
746 3300025297 Ga0209758_1065890 Ga0209758_10658902 219
747 3300025321 Ga0207656_10058057 Ga0207656_100580572 219
748 3300025893 Ga0207682_10027486 Ga0207682_100274864 219
749 3300025893 Ga0207682_10092834 Ga0207682_100928341 219
750 3300025901 Ga0207688_10121520 Ga0207688_101215202 219
751 3300025907 Ga0207645_10051560 Ga0207645_100515602 219
752 3300025907 Ga0207645_10132124 Ga0207645_101321242 219
753 3300025910 Ga0207684_10000287 Ga0207684_100002878 219
754 3300025910 Ga0207684_10072963 Ga0207684_100729632 219
755 3300025910 Ga0207684_10137217 Ga0207684_101372172 219
756 3300025910 Ga0207684_10417763 Ga0207684_104177631 219
757 3300025912 Ga0207707_10010851 Ga0207707_100108516 219
758 3300025912 Ga0207707_10435848 Ga0207707_104358481 219
759 3300025913 Ga0207695_10009282 Ga0207695_1000928210 219
760 3300025914 Ga0207671_10113745 Ga0207671_101137452 219
761 3300025914 Ga0207671_10275252 Ga0207671_102752521 219
762 3300025915 Ga0207693_10050939 Ga0207693_100509394 219
763 3300025917 Ga0207660_10038806 Ga0207660_100388065 219
764 3300025918 Ga0207662_10093863 Ga0207662_100938632 219
765 3300025920 Ga0207649_10000437 Ga0207649_1000043726 219
766 3300025920 Ga0207649_10020766 Ga0207649_100207663 219
767 3300025921 Ga0207652_10126992 Ga0207652_101269922 219
768 3300025922 Ga0207646_10022997 Ga0207646_100229974 219
769 3300025922 Ga0207646_10042075 Ga0207646_100420753 219
770 3300025922 Ga0207646_10146961 Ga0207646_101469612 219
771 3300025924 Ga0207694_10094522 Ga0207694_100945223 219
772 3300025924 Ga0207694_10114347 Ga0207694_101143473 219
773 3300025925 Ga0207650_10140474 Ga0207650_101404742 219
774 3300025925 Ga0207650_10323710 Ga0207650_103237101 219
775 3300025925 Ga0207650_10346032 Ga0207650_103460322 219
776 3300025926 Ga0207659_10077899 Ga0207659_100778993 219
777 3300025926 Ga0207659_10165561 Ga0207659_101655612 219
778 3300025927 Ga0207687_10016580 Ga0207687_100165802 219
779 3300025927 Ga0207687_10134787 Ga0207687_101347872 219
780 3300025927 Ga0207687_10604615 Ga0207687_106046151 219
781 3300025931 Ga0207644_10058187 Ga0207644_100581872 219
782 3300025931 Ga0207644_10058907 Ga0207644_100589071 219
783 3300025933 Ga0207706_10432010 Ga0207706_104320101 219
784 3300025934 Ga0207686_10397204 Ga0207686_103972042 219
785 3300025937 Ga0207669_10019618 Ga0207669_100196182 219
786 3300025937 Ga0207669_10119530 Ga0207669_101195301 219
787 3300025939 Ga0207665_10689710 Ga0207665_106897101 219
788 3300025940 Ga0207691_10008622 Ga0207691_1000862211 219
789 3300025940 Ga0207691_10014130 Ga0207691_100141303 219
790 3300025940 Ga0207691_10668477 Ga0207691_106684772 219
791 3300025941 Ga0207711_10233587 Ga0207711_102335872 219
792 3300025941 Ga0207711_10621171 Ga0207711_106211711 219
793 3300025944 Ga0207661_10543124 Ga0207661_105431242 219
794 3300025944 Ga0207661_10614472 Ga0207661_106144721 219
795 3300025949 Ga0207667_10016318 Ga0207667_100163187 219
796 3300025960 Ga0207651_10035758 Ga0207651_100357582 219
797 3300025960 Ga0207651_10277536 Ga0207651_102775362 219
798 3300025972 Ga0207668_10075504 Ga0207668_100755043 219
799 3300025972 Ga0207668_10170452 Ga0207668_101704522 219
800 3300025986 Ga0207658_10027001 Ga0207658_100270014 219
801 3300026023 Ga0207677_10034499 Ga0207677_100344992 219
802 3300026023 Ga0207677_10692469 Ga0207677_106924691 219
803 3300026035 Ga0207703_10701232 Ga0207703_107012321 219
804 3300026035 Ga0207703_10938556 Ga0207703_109385561 219
805 3300026041 Ga0207639_10024980 Ga0207639_100249804 219
806 3300026067 Ga0207678_10199936 Ga0207678_101999362 219
807 3300026078 Ga0207702_10115195 Ga0207702_101151951 219
808 3300026088 Ga0207641_10082954 Ga0207641_100829541 219
809 3300026089 Ga0207648_10087664 Ga0207648_100876643 219
810 3300026089 Ga0207648_10287839 Ga0207648_102878391 219
811 3300026095 Ga0207676_10434459 Ga0207676_104344591 219
812 3300026116 Ga0207674_10051455 Ga0207674_100514553 219
813 3300026118 Ga0207675_100006106 Ga0207675_10000610610 219
814 3300026118 Ga0207675_100076071 Ga0207675_1000760712 219
815 3300026118 Ga0207675_100286920 Ga0207675_1002869201 219
816 3300026118 Ga0207675_100566513 Ga0207675_1005665131 219
817 3300026121 Ga0207683_10055241 Ga0207683_100552412 219
818 3300026121 Ga0207683_10123567 Ga0207683_101235674 219
819 3300026121 Ga0207683_11028031 Ga0207683_110280311 219
820 3300026142 Ga0207698_10879645 Ga0207698_108796451 219
821 3300027671 Ga0209588_1004952 Ga0209588_10049523 219
822 3300027671 Ga0209588_1036169 Ga0209588_10361691 219
823 3300027671 Ga0209588_1069206 Ga0209588_10692062 219
824 3300027907 Ga0207428_10081941 Ga0207428_100819411 219
825 3300027907 Ga0207428_10405189 Ga0207428_104051891 219
826 3300028380 Ga0268265_10010604 Ga0268265_100106043 219
827 3300028380 Ga0268265_10018341 Ga0268265_100183416 219
828 3300028380 Ga0268265_10170194 Ga0268265_101701941 219
829 3300028380 Ga0268265_10232170 Ga0268265_102321702 219
830 3300028381 Ga0268264_10795098 Ga0268264_107950982 219
831 3300028558 Ga0265326_10095267 Ga0265326_100952671 219
832 3300031238 Ga0265332_10003112 Ga0265332_100031124 219
833 3300031241 Ga0265325_10082744 Ga0265325_100827442 219
834 3300031247 Ga0265340_10006253 Ga0265340_100062535 219
835 3300031249 Ga0265339_10061653 Ga0265339_100616533 219
836 3300031251 Ga0265327_10005193 Ga0265327_100051934 219
837 3300031251 Ga0265327_10057916 Ga0265327_100579163 219
838 3300031344 Ga0265316_10129932 Ga0265316_101299323 219
839 3300031712 Ga0265342_10002150 Ga0265342_100021504 219
840 3300031995 Ga0307409_100367408 Ga0307409_1003674082 219
841 3300032126 Ga0307415_100509731 Ga0307415_1005097311 219
842 3300035083 Ga0373926_0074850 Ga0373926_0074850_502_1161 219
843 3300035084 Ga0373928_0029574 Ga0373928_0029574_441_1103 219
844 3300035086 Ga0373934_0011767 Ga0373934_0011767_1582_2241 219
845 3300035088 Ga0373940_0045844 Ga0373940_0045844_461_1120 219
846 3300035089 Ga0373944_0172869 Ga0373944_0172869_10_669 219
847 3300035090 Ga0373949_0100103 Ga0373949_0100103_40_699 219
848 3300035111 Ga0373923_0001052 Ga0373923_0001052_240_899 219
849 3300035113 Ga0373936_0001677 Ga0373936_0001677_4307_4966 219
850 3300035114 Ga0373939_0011739 Ga0373939_0011739_178_840 219
851 3300035116 Ga0373945_0004559 Ga0373945_0004559_1186_1845 219
852 3300035116 Ga0373945_0006120 Ga0373945_0006120_57_716 219
853 3300035117 Ga0373953_0003079 Ga0373953_0003079_3110_3769 219
854 3300035117 Ga0373953_0065747 Ga0373953_0065747_186_845 219
855 3300035118 Ga0373954_0006435 Ga0373954_0006435_3643_4302 219
856 3300035118 Ga0373954_0067093 Ga0373954_0067093_53_712 219
857 3300035118 Ga0373954_0107949 Ga0373954_0107949_55_714 219
858 3300035118 Ga0373954_0149548 Ga0373954_0149548_436_1095 219
859 3300035119 Ga0373956_0027712 Ga0373956_0027712_612_1271 219
860 3300035170 Ga0373943_0000622 Ga0373943_0000622_8083_8742 219
861 3300035170 Ga0373943_0035951 Ga0373943_0035951_1675_2334 219
862 3300035170 Ga0373943_0235235 Ga0373943_0235235_217_876 219
863 3300035171 Ga0373946_0016156 Ga0373946_0016156_163_822 219
864 3300035172 Ga0373955_0000453 Ga0373955_0000453_14917_15576 219
865 3300035172 Ga0373955_0016314 Ga0373955_0016314_915_1574 219
866 3300035172 Ga0373955_0038075 Ga0373955_0038075_1802_2461 219
867 3300035241 Ga0373961_0009728 Ga0373961_0009728_1448_2110 219
868 3300035410 Ga0373924_0002934 Ga0373924_0002934_3696_4355 219
869 3300035692 Ga0373935_0000153 Ga0373935_0000153_806_1465 219
870 3300035692 Ga0373935_0013196 Ga0373935_0013196_2180_2839 219
871 3300035695 Ga0373927_0010376 Ga0373927_0010376_5049_5708 219
872 3300035695 Ga0373927_0108336 Ga0373927_0108336_573_1232 219
873 3300035695 Ga0373927_0256628 Ga0373927_0256628_435_1094 219
874 3300035695 Ga0373927_0650727 Ga0373927_0650727_13_672 219
875 3300035724 Ga0373933_0008303 Ga0373933_0008303_32_691 219
876 3300035724 Ga0373933_0017656 Ga0373933_0017656_1353_2012 219
877 3300035724 Ga0373933_0434075 Ga0373933_0434075_163_822 219
878 3300035725 Ga0373947_0000700 Ga0373947_0000700_14411_15070 219
879 3300035725 Ga0373947_0066694 Ga0373947_0066694_1205_1864 219
880 3300036401 Ga0373937_0000432 Ga0373937_0000432_36901_37560 219
881 3300036401 Ga0373937_0003993 Ga0373937_0003993_606_1265 219
882 3300036401 Ga0373937_0012033 Ga0373937_0012033_5867_6526 219
883 3300037068 Ga0373925_0000084 Ga0373925_0000084_56334_56993 219
884 3300037068 Ga0373925_0001188 Ga0373925_0001188_10193_10852 219
885 3300037068 Ga0373925_0001533 Ga0373925_0001533_2366_3025 219
886 3300037068 Ga0373925_0108941 Ga0373925_0108941_1030_1689 219
887 3300037068 Ga0373925_0262048 Ga0373925_0262048_489_1148 219
888 3300037068 Ga0373925_0378935 Ga0373925_0378935_307_966 219
889 3300037068 Ga0373925_0808488 Ga0373925_0808488_78_737 219
890 3300037312 Ga0395899_0087977 Ga0395899_0087977_671_1330 219
891 3300037312 Ga0395899_0273927 Ga0395899_0273927_189_848 219
892 3300037418 Ga0395900_0080270 Ga0395900_0080270_430_1089 219
893 3300037418 Ga0395900_0209011 Ga0395900_0209011_500_1159 219
894 3300037466 Ga0395898_0001505 Ga0395898_0001505_28047_28706 219
895 3300037466 Ga0395898_0059173 Ga0395898_0059173_513_1172 219
896 3300037466 Ga0395898_0114505 Ga0395898_0114505_1328_1987 219
897 3300037466 Ga0395898_0137005 Ga0395898_0137005_1323_1982 219
898 3300037471 Ga0395905_0005407 Ga0395905_0005407_976_1635 219
899 3300037471 Ga0395905_0105078 Ga0395905_0105078_816_1475 219
900 3300037853 Ga0436364_0713202 Ga0436364_0713202_794_1456 219
901 3300038443 Ga0395901_0006836 Ga0395901_0006836_1847_2506 219
902 3300038443 Ga0395901_0008365 Ga0395901_0008365_6897_7556 219
903 3300038443 Ga0395901_0017842 Ga0395901_0017842_5467_6126 219
904 3300038443 Ga0395901_0204928 Ga0395901_0204928_1190_1849 219
905 3300039437 Ga0436365_0281644 Ga0436365_0281644_73_732 219
906 3300039437 Ga0436365_0982568 Ga0436365_0982568_343_1017 219
907 3300039437 Ga0436365_1143395 Ga0436365_1143395_1287_1946 219
908 3300039437 Ga0436365_1308626 Ga0436365_1308626_3698_4357 219
909 3300039437 Ga0436365_1423189 Ga0436365_1423189_160_819 219
910 3300039437 Ga0436365_1588830 Ga0436365_1588830_1572_2231 219
911 3300039450 Ga0436363_0169393 Ga0436363_0169393_41675_42334 219
912 3300039450 Ga0436363_0556565 Ga0436363_0556565_672_1331 219
913 3300039450 Ga0436363_0572802 Ga0436363_0572802_520_1179 219
914 3300039450 Ga0436363_0846140 Ga0436363_0846140_378_1037 219
915 3300039453 Ga0436362_0121492 Ga0436362_0121492_150_887 219
916 3300039453 Ga0436362_0163841 Ga0436362_0163841_76_735 219
917 3300039453 Ga0436362_0719851 Ga0436362_0719851_84_743 219
918 3300042003 Ga0439443_038857 Ga0439443_038857_49_708 219
919 3300042004 Ga0439445_0009113 Ga0439445_0009113_1414_2073 219
920 3300042156 Ga0439446_0016149 Ga0439446_0016149_1187_1846 219
921 3300044694 Ga0466963_0037236 Ga0466963_0037236_2488_3150 219
922 3300044694 Ga0466963_0254890 Ga0466963_0254890_214_876 219
923 3300044706 Ga0466964_0070097 Ga0466964_0070097_772_1434 219
924 3300044712 Ga0453684_0002923 Ga0453684_0002923_37489_38169 219
925 3300044719 Ga0466971_0088103 Ga0466971_0088103_147_809 219
926 3300044842 Ga0466957_0026773 Ga0466957_0026773_2414_3073 219
927 3300045051 Ga0451576_0118215 Ga0451576_0118215_2086_2745 219
928 3300045836 Ga0466958_0033488 Ga0466958_0033488_376_1035 219
929 3300045836 Ga0466958_0168243 Ga0466958_0168243_114_776 219
930 3300045976 Ga0466967_0113782 Ga0466967_0113782_1134_1793 219
931 3300045976 Ga0466967_0130099 Ga0466967_0130099_1624_2286 219
932 3300045976 Ga0466967_0212043 Ga0466967_0212043_1147_1812 219
933 3300045976 Ga0466967_1219800 Ga0466967_1219800_72_731 219
934 3300045976 Ga0466967_1321174 Ga0466967_1321174_24_683 219
935 3300046454 Ga0495592_0000026 Ga0495592_0000026_97989_98648 219
936 3300046454 Ga0495592_0015800 Ga0495592_0015800_4994_5653 219
937 3300046454 Ga0495592_0062898 Ga0495592_0062898_1370_2029 219
938 3300046459 Ga0495629_0001876 Ga0495629_0001876_12585_13244 219
939 3300046459 Ga0495629_0016858 Ga0495629_0016858_2124_2783 219
940 3300046461 Ga0495641_0001982 Ga0495641_0001982_5102_5761 219
941 3300046461 Ga0495641_0214288 Ga0495641_0214288_13_672 219
942 3300046462 Ga0495651_0001816 Ga0495651_0001816_10682_11341 219
943 3300046462 Ga0495651_0003038 Ga0495651_0003038_8273_8932 219
944 3300046462 Ga0495651_0038208 Ga0495651_0038208_685_1344 219
945 3300046463 Ga0495653_0000155 Ga0495653_0000155_3731_4390 219
946 3300046463 Ga0495653_0006734 Ga0495653_0006734_4572_5231 219
947 3300046463 Ga0495653_0021100 Ga0495653_0021100_669_1328 219
948 3300046473 Ga0495582_0001032 Ga0495582_0001032_13513_14172 219
949 3300046473 Ga0495582_0065678 Ga0495582_0065678_962_1621 219
950 3300046475 Ga0495639_0001826 Ga0495639_0001826_1887_2546 219
951 3300046475 Ga0495639_0158736 Ga0495639_0158736_191_850 219
952 3300046476 Ga0495662_0002047 Ga0495662_0002047_4717_5376 219
953 3300046476 Ga0495662_0050799 Ga0495662_0050799_1277_1936 219
954 3300046477 Ga0495664_0000001 Ga0495664_0000001_713141_713800 219
955 3300046477 Ga0495664_0112835 Ga0495664_0112835_603_1262 219
956 3300046477 Ga0495664_0314088 Ga0495664_0314088_143_802 219
957 3300046500 Ga0495596_0145773 Ga0495596_0145773_209_898 219
958 3300046511 Ga0495608_0000012 Ga0495608_0000012_198171_198830 219
959 3300046514 Ga0495618_0000041 Ga0495618_0000041_52029_52688 219
960 3300046514 Ga0495618_0009095 Ga0495618_0009095_225_884 219
961 3300046516 Ga0495628_0000033 Ga0495628_0000033_3769_4428 219
962 3300046516 Ga0495628_0079866 Ga0495628_0079866_314_973 219
963 3300046516 Ga0495628_0386689 Ga0495628_0386689_283_942 219
964 3300046517 Ga0495630_0022265 Ga0495630_0022265_3498_4157 219
965 3300046517 Ga0495630_0027669 Ga0495630_0027669_2545_3204 219
966 3300046529 Ga0495652_0000001 Ga0495652_0000001_113277_113936 219
967 3300046529 Ga0495652_0004698 Ga0495652_0004698_10795_11454 219
968 3300046529 Ga0495652_0062473 Ga0495652_0062473_2304_2963 219
969 3300046531 Ga0495665_0001683 Ga0495665_0001683_7785_8444 219
970 3300046533 Ga0495640_0000010 Ga0495640_0000010_113455_114114 219
971 3300046533 Ga0495640_0002641 Ga0495640_0002641_8298_8957 219
972 3300046533 Ga0495640_0008984 Ga0495640_0008984_3466_4125 219
973 3300046536 Ga0495587_0000003 Ga0495587_0000003_379475_380134 219
974 3300046536 Ga0495587_0007562 Ga0495587_0007562_3851_4510 219
975 3300046537 Ga0495598_0008068 Ga0495598_0008068_1225_1884 219
976 3300046539 Ga0495621_0008651 Ga0495621_0008651_1197_1856 219
977 3300046543 Ga0495645_0000026 Ga0495645_0000026_74113_74772 219
978 3300046543 Ga0495645_0104989 Ga0495645_0104989_1249_1908 219
979 3300046543 Ga0495645_0129699 Ga0495645_0129699_302_961 219
980 3300046559 Ga0495667_0000132 Ga0495667_0000132_46324_46983 219
981 3300046559 Ga0495667_0004922 Ga0495667_0004922_5304_5963 219
982 3300046559 Ga0495667_0015481 Ga0495667_0015481_3894_4553 219
983 3300046642 Ga0495634_0000285 Ga0495634_0000285_43929_44588 219
984 3300046642 Ga0495634_0027295 Ga0495634_0027295_389_1048 219
985 3300046642 Ga0495634_0100485 Ga0495634_0100485_446_1105 219
986 3300046663 Ga0495635_0000113 Ga0495635_0000113_43915_44574 219
987 3300046663 Ga0495635_0013023 Ga0495635_0013023_546_1205 219
988 3300046663 Ga0495635_0034738 Ga0495635_0034738_138_797 219
989 3300046663 Ga0495635_0307270 Ga0495635_0307270_393_1052 219
990 3300046675 Ga0495657_0000258 Ga0495657_0000258_43940_44599 219
991 3300046675 Ga0495657_0174237 Ga0495657_0174237_620_1279 219
992 3300046678 Ga0495599_0000070 Ga0495599_0000070_43937_44596 219
993 3300046678 Ga0495599_0060391 Ga0495599_0060391_659_1318 219
994 3300046678 Ga0495599_0168426 Ga0495599_0168426_620_1279 219
995 3300046679 Ga0495623_0000003 Ga0495623_0000003_3734_4393 219
996 3300046679 Ga0495623_0012706 Ga0495623_0012706_2777_3436 219
997 3300046680 Ga0495646_0000070 Ga0495646_0000070_43920_44579 219
998 3300046680 Ga0495646_0012319 Ga0495646_0012319_3063_3722 219
999 3300046680 Ga0495646_0044888 Ga0495646_0044888_467_1126 219
1000 3300046681 Ga0495647_0011297 Ga0495647_0011297_852_1511 219
1001 3300046683 Ga0495658_0000863 Ga0495658_0000863_11363_12022 219
1002 3300046683 Ga0495658_0076084 Ga0495658_0076084_384_1043 219
1003 3300046689 Ga0495613_0004947 Ga0495613_0004947_4740_5399 219
1004 3300046689 Ga0495613_0091833 Ga0495613_0091833_440_1099 219
1005 3300046689 Ga0495613_0210676 Ga0495613_0210676_159_818 219
1006 3300046689 Ga0495613_0242681 Ga0495613_0242681_23_682 219
1007 3300046690 Ga0495624_0072914 Ga0495624_0072914_232_891 219
1008 3300046809 Ga0495600_0000007 Ga0495600_0000007_106401_107060 219
1009 3300047315 Ga0495581_0003231 Ga0495581_0003231_5643_6302 219
1010 3300047315 Ga0495581_0004944 Ga0495581_0004944_3790_4449 219
1011 3300047315 Ga0495581_0021363 Ga0495581_0021363_985_1644 219
1012 3300047317 Ga0495604_0000010 Ga0495604_0000010_198195_198854 219
1013 3300047317 Ga0495604_0001295 Ga0495604_0001295_11792_12451 219
1014 3300047317 Ga0495604_0029640 Ga0495604_0029640_3157_3816 219
1015 3300047319 Ga0495674_0000013 Ga0495674_0000013_113277_113936 219
1016 3300047319 Ga0495674_0004127 Ga0495674_0004127_5274_5933 219
1017 3300047319 Ga0495674_0011758 Ga0495674_0011758_5772_6431 219
1018 3300047321 Ga0495676_0001106 Ga0495676_0001106_7938_8597 219
1019 3300047321 Ga0495676_0051111 Ga0495676_0051111_248_907 219
1020 3300047321 Ga0495676_0200526 Ga0495676_0200526_455_1114 219
1021 3300047322 Ga0495680_0003074 Ga0495680_0003074_10768_11427 219
1022 3300047322 Ga0495680_0003453 Ga0495680_0003453_11910_12569 219
1023 3300047322 Ga0495680_0005738 Ga0495680_0005738_6646_7305 219
1024 3300047322 Ga0495680_0042583 Ga0495680_0042583_359_1018 219
1025 3300047323 Ga0495683_0284350 Ga0495683_0284350_21_683 219
1026 3300047444 Ga0495675_0000253 Ga0495675_0000253_20147_20806 219
1027 3300047447 Ga0495685_108872 Ga0495685_108872_187_846 219
1028 3300047471 Ga0495684_0000008 Ga0495684_0000008_113278_113937 219
1029 3300047471 Ga0495684_0007003 Ga0495684_0007003_1237_1896 219
1030 3300047471 Ga0495684_0011194 Ga0495684_0011194_2599_3258 219
1031 3300047471 Ga0495684_0012423 Ga0495684_0012423_226_885 219
1032 3300047673 Ga0495593_0000137 Ga0495593_0000137_23249_23908 219
1033 3300047673 Ga0495593_0001564 Ga0495593_0001564_6499_7158 219
1034 3300048088 Ga0495602_0000264 Ga0495602_0000264_3698_4357 219
1035 3300048088 Ga0495602_0002962 Ga0495602_0002962_5867_6526 219
1036 3300048088 Ga0495602_0118253 Ga0495602_0118253_128_787 219
1037 3300048089 Ga0495614_0054957 Ga0495614_0054957_391_1050 219
1038 3300048903 Ga0496100_0015265 Ga0496100_0015265_1065_1724 219
1039 3300048903 Ga0496100_0203372 Ga0496100_0203372_254_943 219
1040 3300048904 Ga0496101_0103881 Ga0496101_0103881_554_1213 219
1041 3300048904 Ga0496101_0312080 Ga0496101_0312080_66_725 219
1042 3300048904 Ga0496101_0330343 Ga0496101_0330343_272_931 219
1043 3300048905 Ga0496102_0008851 Ga0496102_0008851_3357_4016 219
1044 3300048905 Ga0496102_0034171 Ga0496102_0034171_1716_2375 219
1045 3300048906 Ga0496103_0051990 Ga0496103_0051990_1827_2486 219
1046 3300048907 Ga0496104_0004620 Ga0496104_0004620_11181_11840 219
1047 3300048907 Ga0496104_0096681 Ga0496104_0096681_619_1302 219
1048 3300048907 Ga0496104_0394302 Ga0496104_0394302_347_1006 219
1049 3300048907 Ga0496104_0605797 Ga0496104_0605797_294_983 219
1050 3300048908 Ga0496105_0102458 Ga0496105_0102458_994_1653 219
1051 3300048908 Ga0496105_0108903 Ga0496105_0108903_715_1374 219
1052 3300048908 Ga0496105_0112560 Ga0496105_0112560_1443_2102 219
1053 3300048908 Ga0496105_0280613 Ga0496105_0280613_283_942 219
1054 3300048909 Ga0496106_0000080 Ga0496106_0000080_27255_27914 219
1055 3300048910 Ga0496107_0001928 Ga0496107_0001928_3061_3720 219
1056 3300048910 Ga0496107_0317446 Ga0496107_0317446_40_699 219
1057 3300048910 Ga0496107_0487376 Ga0496107_0487376_229_888 219
1058 3300048911 Ga0496108_0095736 Ga0496108_0095736_1577_2236 219
1059 3300048911 Ga0496108_0114095 Ga0496108_0114095_1180_1839 219
1060 3300048912 Ga0496109_0001577 Ga0496109_0001577_5700_6359 219
1061 3300048912 Ga0496109_0362684 Ga0496109_0362684_311_970 219
1062 3300048912 Ga0496109_0446793 Ga0496109_0446793_215_874 219
1063 3300048912 Ga0496109_0547642 Ga0496109_0547642_314_973 219
1064 3300048913 Ga0496110_0025060 Ga0496110_0025060_1828_2487 219
1065 3300048913 Ga0496110_0789910 Ga0496110_0789910_151_810 219
1066 3300048914 Ga0496111_0000600 Ga0496111_0000600_13007_13666 219
1067 3300048914 Ga0496111_0601557 Ga0496111_0601557_29_688 219
1068 3300048915 Ga0496112_0012198 Ga0496112_0012198_4788_5447 219
1069 3300048915 Ga0496112_0126770 Ga0496112_0126770_994_1653 219
1070 3300048915 Ga0496112_0228649 Ga0496112_0228649_187_846 219
1071 3300048916 Ga0496113_0030702 Ga0496113_0030702_308_967 219
1072 3300048916 Ga0496113_0103015 Ga0496113_0103015_1001_1660 219
1073 3300048916 Ga0496113_0633391 Ga0496113_0633391_101_760 219
1074 3300048917 Ga0496114_0008209 Ga0496114_0008209_6375_7034 219
1075 3300048917 Ga0496114_0043584 Ga0496114_0043584_1954_2613 219
1076 3300048917 Ga0496114_0219059 Ga0496114_0219059_524_1183 219
1077 3300048917 Ga0496114_0253648 Ga0496114_0253648_653_1312 219
1078 3300048917 Ga0496114_0723951 Ga0496114_0723951_104_763 219
1079 3300048918 Ga0496115_0200274 Ga0496115_0200274_572_1231 219
1080 3300049568 Ga0501031_0164817 Ga0501031_0164817_269_928 219
1081 3300049570 Ga0501033_0331952 Ga0501033_0331952_279_938 219
1082 3300049572 Ga0501036_0079229 Ga0501036_0079229_1488_2147 219
1083 3300049572 Ga0501036_0174756 Ga0501036_0174756_1072_1731 219
1084 3300049572 Ga0501036_0370251 Ga0501036_0370251_276_938 219
1085 3300049574 Ga0501038_0027623 Ga0501038_0027623_2834_3493 219
1086 3300049574 Ga0501038_0195479 Ga0501038_0195479_29_688 219
1087 3300049575 Ga0501039_0083413 Ga0501039_0083413_1580_2239 219
1088 3300049577 Ga0501041_0042610 Ga0501041_0042610_1945_2604 219
1089 3300049578 Ga0501042_0075638 Ga0501042_0075638_1486_2145 219
1090 3300049580 Ga0501046_0055704 Ga0501046_0055704_1445_2104 219
1091 3300049580 Ga0501046_0242546 Ga0501046_0242546_14_676 219
1092 3300049581 Ga0501047_0009041 Ga0501047_0009041_5710_6369 219
1093 3300049582 Ga0501048_0064100 Ga0501048_0064100_1450_2109 219
1094 3300049586 Ga0501070_0133410 Ga0501070_0133410_909_1568 219
1095 3300049588 Ga0501072_0009444 Ga0501072_0009444_2890_3549 219
1096 3300049588 Ga0501072_0054312 Ga0501072_0054312_1934_2593 219
1097 3300049589 Ga0501073_0044779 Ga0501073_0044779_2268_2927 219
1098 3300049589 Ga0501073_0120098 Ga0501073_0120098_1124_1783 219
1099 3300049590 Ga0501074_0096018 Ga0501074_0096018_172_831 219
1100 3300049590 Ga0501074_0331483 Ga0501074_0331483_44_703 219
1101 3300049590 Ga0501074_0505059 Ga0501074_0505059_159_818 219
1102 3300049591 Ga0501075_0066655 Ga0501075_0066655_654_1313 219
1103 3300049592 Ga0501076_0003344 Ga0501076_0003344_10359_11018 219
1104 3300049592 Ga0501076_0041189 Ga0501076_0041189_2439_3104 219
1105 3300049592 Ga0501076_0152764 Ga0501076_0152764_1015_1674 219
1106 3300049593 Ga0501077_0013776 Ga0501077_0013776_2063_2737 219
1107 3300049593 Ga0501077_0032171 Ga0501077_0032171_24_683 219
1108 3300049593 Ga0501077_0120137 Ga0501077_0120137_882_1541 219
1109 3300049741 Ga0501079_0010485 Ga0501079_0010485_3721_4395 219
1110 3300049741 Ga0501079_0404163 Ga0501079_0404163_334_993 219
1111 3300049742 Ga0501080_0094204 Ga0501080_0094204_1479_2138 219
1112 3300049742 Ga0501080_0156207 Ga0501080_0156207_837_1511 219
1113 3300049743 Ga0501081_0023585 Ga0501081_0023585_73_747 219
1114 3300049743 Ga0501081_0078102 Ga0501081_0078102_228_887 219
1115 3300049743 Ga0501081_0204071 Ga0501081_0204071_409_1068 219
1116 3300049744 Ga0501083_0085608 Ga0501083_0085608_74_778 219
1117 3300049744 Ga0501083_0281151 Ga0501083_0281151_327_986 219
1118 3300049823 Ga0501044_0000222 Ga0501044_0000222_54944_55603 219
1119 3300049824 Ga0501045_0016710 Ga0501045_0016710_3250_3918 219
1120 3300050490 nmdc:mga03n38_85932_c1 nmdc:mga03n38_85932_c1_702_1361 219
1121 3300050491 nmdc:mga00v17_27387_c1 nmdc:mga00v17_27387_c1_1920_2579 219
1122 3300050493 nmdc:mga0k408_77654_c1 nmdc:mga0k408_77654_c1_1115_1774 219
1123 3300050507 nmdc:mga05p37_110601_c1 nmdc:mga05p37_110601_c1_1932_2591 219
1124 3300050507 nmdc:mga05p37_130341_c1 nmdc:mga05p37_130341_c1_925_1584 219
1125 3300050507 nmdc:mga05p37_441882_c1 nmdc:mga05p37_441882_c1_770_1429 219
1126 3300050507 nmdc:mga05p37_5066_c1 nmdc:mga05p37_5066_c1_13711_14370 219
1127 3300050508 nmdc:mga09592_4709_c1 nmdc:mga09592_4709_c1_8271_8930 219
1128 3300050508 nmdc:mga09592_66292_c1 nmdc:mga09592_66292_c1_642_1301 219
1129 3300050509 nmdc:mga0qj67_111240_c1 nmdc:mga0qj67_111240_c1_371_1030 219
1130 3300050509 nmdc:mga0qj67_111501_c1 nmdc:mga0qj67_111501_c1_691_1350 219
1131 3300050509 nmdc:mga0qj67_168264_c1 nmdc:mga0qj67_168264_c1_191_850 219
1132 3300050509 nmdc:mga0qj67_256242_c1 nmdc:mga0qj67_256242_c1_194_856 219
1133 3300050509 nmdc:mga0qj67_45819_c1 nmdc:mga0qj67_45819_c1_1062_1724 219
1134 3300050510 nmdc:mga06r32_123078_c1 nmdc:mga06r32_123078_c1_935_1594 219
1135 3300050510 nmdc:mga06r32_361204_c1 nmdc:mga06r32_361204_c1_275_934 219
1136 3300050511 nmdc:mga08y16_1092714_c1 nmdc:mga08y16_1092714_c1_70_729 219
1137 3300050511 nmdc:mga08y16_715495_c1 nmdc:mga08y16_715495_c1_63_722 219
1138 3300050511 nmdc:mga08y16_7942_c1 nmdc:mga08y16_7942_c1_6378_7037 219
1139 3300050511 nmdc:mga08y16_96211_c1 nmdc:mga08y16_96211_c1_2198_2857 219
1140 3300050512 nmdc:mga0n895_232262_c1 nmdc:mga0n895_232262_c1_647_1306 219
1141 3300050512 nmdc:mga0n895_969_c1 nmdc:mga0n895_969_c1_2550_3227 219
1142 3300050513 nmdc:mga0rr50_59735_c1 nmdc:mga0rr50_59735_c1_1909_2568 219
1143 3300050513 nmdc:mga0rr50_689068_c1 nmdc:mga0rr50_689068_c1_190_849 219
1144 3300050515 nmdc:mga0a205_19407_c1 nmdc:mga0a205_19407_c1_3099_3758 219
1145 3300050515 nmdc:mga0a205_50550_c1 nmdc:mga0a205_50550_c1_1484_2161 219
1146 3300050516 nmdc:mga0sz30_44143_c1 nmdc:mga0sz30_44143_c1_893_1552 219
1147 3300053077 Ga0495601_0000003 Ga0495601_0000003_113491_114150 219
1148 3300053077 Ga0495601_0002673 Ga0495601_0002673_4780_5439 219
1149 3300053078 Ga0495612_0000009 Ga0495612_0000009_43930_44589 219
1150 3300053078 Ga0495612_0005512 Ga0495612_0005512_4021_4680 219
1151 3300053084 Ga0495595_0000075 Ga0495595_0000075_3716_4375 219
1152 3300053084 Ga0495595_0000640 Ga0495595_0000640_4429_5088 219
1153 3300053084 Ga0495595_0100821 Ga0495595_0100821_48_710 219
1154 3300053085 Ga0495619_0000039 Ga0495619_0000039_74113_74772 219
1155 3300053085 Ga0495619_0001034 Ga0495619_0001034_3966_4625 219
1156 3300053085 Ga0495619_0002157 Ga0495619_0002157_5602_6261 219
1157 3300053085 Ga0495619_0002259 Ga0495619_0002259_4413_5072 219
1158 3300053096 Ga0500641_0021543 Ga0500641_0021543_928_1587 219
1159 3300053099 Ga0500654_094665 Ga0500654_094665_250_909 219
1160 3300053119 Ga0500595_004295 Ga0500595_004295_1229_1888 219
1161 3300053153 Ga0500616_0042715 Ga0500616_0042715_1572_2231 219
1162 3300053153 Ga0500616_0047451 Ga0500616_0047451_282_941 219
1163 3300053158 Ga0500627_0174739 Ga0500627_0174739_222_881 219
1164 3300054114 Ga0501084_0014155 Ga0501084_0014155_2051_2710 219
1165 3300054114 Ga0501084_0046021 Ga0501084_0046021_155_817 219
1166 3300054114 Ga0501084_0093516 Ga0501084_0093516_589_1263 219
1167 3300054114 Ga0501084_0123741 Ga0501084_0123741_635_1294 219
1168 3300054114 Ga0501084_0280819 Ga0501084_0280819_134_793 219
1169 3300059491 Ga0587070_055869 Ga0587070_055869_69_728 219
1170 3300059503 Ga0587080_033368 Ga0587080_033368_216_875 219
1171 3300060353 Ga0501082_0000371 Ga0501082_0000371_18621_19325 219
1172 3300060353 Ga0501082_0009046 Ga0501082_0009046_4361_5020 219
1173 3300060353 Ga0501082_0022842 Ga0501082_0022842_81_755 219
1174 3300060353 Ga0501082_0312034 Ga0501082_0312034_164_826 219
1175 3300060353 Ga0501082_0934797 Ga0501082_0934797_59_718 219
1176 3300061719 Ga0466962_0042318 Ga0466962_0042318_918_1580 219
1177 3300061734 Ga0530510_0052853 Ga0530510_0052853_461_1129 219
1178 3300061734 Ga0530510_0078131 Ga0530510_0078131_142_801 219
1179 3300061734 Ga0530510_0127126 Ga0530510_0127126_1033_1692 219
1180 iso_pu_bacteria 2643221618 2644107444 219
1181 iso_pu_bacteria 2643221626 2644146040 219
1182 iso_pu_bacteria 2643221655 2644308839 219
1183 iso_pu_bacteria 2643221659 2644332663 219
1184 iso_pu_bacteria 2643221698 2644540065 219
1185 iso_pu_bacteria 2643221712 2644614780 219
1186 iso_pu_bacteria 2941499720 2941502289 219
1187 3300001904 JGI24736J21556_1001546 JGI24736J21556_10015464 220
1188 3300001979 JGI24740J21852_10021331 JGI24740J21852_100213311 220
1189 3300001990 JGI24737J22298_10049062 JGI24737J22298_100490622 220
1190 3300005339 Ga0070660_100009935 Ga0070660_1000099354 220
1191 3300005440 Ga0070705_100243743 Ga0070705_1002437432 220
1192 3300005455 Ga0070663_100083200 Ga0070663_1000832003 220
1193 3300005535 Ga0070684_100105147 Ga0070684_1001051474 220
1194 3300005578 Ga0068854_100192610 Ga0068854_1001926102 220
1195 3300005616 Ga0068852_100604052 Ga0068852_1006040522 220
1196 3300009174 Ga0105241_10158884 Ga0105241_101588842 220
1197 3300010375 Ga0105239_10193763 Ga0105239_101937632 220
1198 3300013100 Ga0157373_10125771 Ga0157373_101257712 220
1199 3300013102 Ga0157371_10034859 Ga0157371_100348592 220
1200 3300013307 Ga0157372_10009012 Ga0157372_1000901210 220
1201 3300013307 Ga0157372_10649493 Ga0157372_106494932 220
1202 3300020076 Ga0206355_1426974 Ga0206355_14269741 220
1203 3300020082 Ga0206353_10948023 Ga0206353_109480231 220
1204 3300025904 Ga0207647_10006363 Ga0207647_100063639 220
1205 3300025909 Ga0207705_10000003 Ga0207705_10000003577 220
1206 3300025909 Ga0207705_10001112 Ga0207705_100011121 220
1207 3300025913 Ga0207695_10034241 Ga0207695_100342413 220
1208 3300025919 Ga0207657_10010100 Ga0207657_100101004 220
1209 3300025920 Ga0207649_10001056 Ga0207649_100010562 220
1210 3300025924 Ga0207694_10427815 Ga0207694_104278152 220
1211 3300025929 Ga0207664_10456760 Ga0207664_104567602 220
1212 3300025945 Ga0207679_10038942 Ga0207679_100389424 220
1213 3300025949 Ga0207667_10039559 Ga0207667_100395593 220
1214 3300026023 Ga0207677_10356352 Ga0207677_103563522 220
1215 3300026067 Ga0207678_10002336 Ga0207678_1000233611 220
1216 3300026116 Ga0207674_10041150 Ga0207674_100411502 220
1217 3300026142 Ga0207698_10021118 Ga0207698_100211183 220
1218 3300037312 Ga0395899_0094522 Ga0395899_0094522_230_892 220
1219 3300037418 Ga0395900_0210856 Ga0395900_0210856_263_925 220
1220 3300037466 Ga0395898_0011006 Ga0395898_0011006_155_823 220
1221 3300037471 Ga0395905_0251504 Ga0395905_0251504_331_999 220
1222 3300038443 Ga0395901_0375975 Ga0395901_0375975_122_784 220
1223 3300039450 Ga0436363_1148610 Ga0436363_1148610_45_710 220
1224 3300044694 Ga0466963_0072443 Ga0466963_0072443_947_1609 220
1225 3300046684 Ga0495669_0134178 Ga0495669_0134178_394_1080 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

31

171

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

191

230

0.96

PF08534

Redoxin

Redoxin

30

189

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9685 4 220
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9619 4 220
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.959 4 220
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9572 4 220
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9359 4 217
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9631 6 107 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9495 156 219 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9467 156 217 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9363 6 107 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9356 156 219 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A7C7WM65-F1-model_v4 Redoxin domain-containing protein 0.995 4 170 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9867 4 185 GO:0005829
GO:0045454
GO:0051920
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9843 1 107 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A258E9H3-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9832 4 112 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2V5ZNJ6-F1-model_v4 Peroxidase 0.9813 4 95 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
93.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map