F491881

General Info

Members Datasets Scaffolds Average Seq Length
1223 319 1223 216

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100036446|Ga0070698_1000364464
Length 249
Sequence MKALPISDCQFRIGSQVAIFKSAIDNWQSTMINGIIGKKVGMTQLFASDGTVTPVTVIKAGPCVVVQKKSAGGKDGYDAVQVGLVEDRPIKLKNVNKPMRGHFEKTGGGIPPTRVLKEFRLEASDDSTNVGDKILVDQFSDGDIVDVVGKSKGRGFAGTIKRHNFNRGPETHGSMNVRAPGSIGASAFPSRVIKGNRSSGHMGDARVTIKQLTVARVDAENNLLMIRGAVPGANGSVVVVKKAARQAKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
197 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
227 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
235 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
265 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
266 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
267 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
268 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
269 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
270 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
281 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
282 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
283 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
284 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
285 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
286 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
287 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
288 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
289 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
290 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
291 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
292 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
293 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
294 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
300 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
301 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
302 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
303 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
304 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
305 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
306 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 1.64
Rhizosphere 97.47
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_946432 2162886007 Bacteria 3808
2 CNAas_1000871 3300000532 Bacteria 2841
3 LJQas_1000049 3300000549 Bacteria 19104
4 JGI24748J21848_1000039 3300002074 Bacteria 67539
5 JGI24034J26672_10000042 3300002239 Bacteria 67592
6 JGI24034J26672_10000043 3300002239 Bacteria 67568
7 JGI24751J29686_10000073 3300002459 Bacteria 56805
8 JGI25406J46586_10020426 3300003203 Bacteria 2679
9 JGI25406J46586_10024396 3300003203 Bacteria 2371
10 JGI25406J46586_10032380 3300003203 Bacteria 1943
11 Ga0065714_10064424 3300005288 Bacteria 236118
12 Ga0065714_10136350 3300005288 Bacteria 1201
13 Ga0065704_10001318 3300005289 Bacteria 10292
14 Ga0065704_10149336 3300005289 Bacteria 1438
15 Ga0065704_10291210 3300005289 Bacteria 903
16 Ga0065712_10000117 3300005290 Bacteria 235194
17 Ga0065712_10078309 3300005290 Bacteria 3366
18 Ga0065712_10252082 3300005290 Bacteria 957
19 Ga0065715_10090767 3300005293 Bacteria 6497
20 Ga0065715_10091345 3300005293 Bacteria 5862
21 Ga0065715_10122775 3300005293 Bacteria 2196
22 Ga0065715_10138456 3300005293 Bacteria 1891
23 Ga0065715_10183377 3300005293 Bacteria 1461
24 Ga0065715_10201628 3300005293 Bacteria 1358
25 Ga0065715_10462677 3300005293 Unclassified 814
26 Ga0065707_10001595 3300005295 Bacteria 6041
27 Ga0065707_10131928 3300005295 Unclassified 1894
28 Ga0065707_10205021 3300005295 Bacteria 1292
29 Ga0065707_10305991 3300005295 Bacteria 975
30 Ga0065707_10313852 3300005295 Bacteria 978
31 Ga0065707_10401362 3300005295 Unclassified 852
32 Ga0065707_10444701 3300005295 Bacteria 806
33 Ga0070658_10023722 3300005327 Bacteria 4920
34 Ga0070658_10427865 3300005327 Bacteria 1139
35 Ga0070676_10021773 3300005328 Bacteria 3591
36 Ga0070676_10034480 3300005328 Bacteria 2907
37 Ga0070676_10167117 3300005328 Bacteria 1420
38 Ga0070676_10313160 3300005328 Bacteria 1068
39 Ga0070683_100027144 3300005329 Bacteria 5161
40 Ga0070683_100439712 3300005329 Bacteria 1244
41 Ga0070690_100003298 3300005330 Bacteria 8811
42 Ga0070690_100003597 3300005330 Bacteria 8516
43 Ga0070690_100020366 3300005330 Bacteria 4040
44 Ga0070690_100064287 3300005330 Bacteria 2369
45 Ga0070690_100110106 3300005330 Bacteria 1836
46 Ga0070670_100002900 3300005331 Bacteria 14190
47 Ga0070670_100004316 3300005331 Bacteria 11902
48 Ga0070670_100013601 3300005331 Bacteria 6974
49 Ga0070670_100023179 3300005331 Bacteria 5343
50 Ga0070670_100079818 3300005331 Bacteria 2812
51 Ga0070670_100098450 3300005331 Bacteria 2516
52 Ga0070670_100131569 3300005331 Bacteria 2161
53 Ga0070670_100267255 3300005331 Bacteria 1492
54 Ga0070670_100897052 3300005331 Bacteria 803
55 Ga0070677_10108518 3300005333 Unclassified 1236
56 Ga0068869_100020479 3300005334 Bacteria 4535
57 Ga0068869_100060217 3300005334 Bacteria 2782
58 Ga0068869_100062596 3300005334 Bacteria 2731
59 Ga0068869_100090982 3300005334 Unclassified 2295
60 Ga0068869_100103118 3300005334 Bacteria 2161
61 Ga0068869_100212561 3300005334 Bacteria 1530
62 Ga0068869_100213205 3300005334 Bacteria 1528
63 Ga0068869_100330232 3300005334 Bacteria 1239
64 Ga0068869_100487988 3300005334 Bacteria 1027
65 Ga0068869_100501226 3300005334 Bacteria 1014
66 Ga0068869_100617044 3300005334 Bacteria 917
67 Ga0070666_10035485 3300005335 Bacteria 3307
68 Ga0070680_100004630 3300005336 Bacteria 10339
69 Ga0070680_100009331 3300005336 Bacteria 7536
70 Ga0070680_100382864 3300005336 Bacteria 1198
71 Ga0070680_100781622 3300005336 Bacteria 822
72 Ga0070682_100000254 3300005337 Bacteria 38669
73 Ga0070682_100080040 3300005337 Bacteria 2111
74 Ga0070682_100193320 3300005337 Bacteria 1430
75 Ga0068868_100020110 3300005338 Bacteria 5010
76 Ga0068868_100141311 3300005338 Bacteria 1976
77 Ga0068868_100151558 3300005338 Bacteria 1909
78 Ga0068868_100206075 3300005338 Bacteria 1641
79 Ga0068868_100404896 3300005338 Bacteria 1178
80 Ga0068868_100732311 3300005338 Bacteria 887
81 Ga0070660_100158608 3300005339 Unclassified 1822
82 Ga0070660_100836089 3300005339 Bacteria 775
83 Ga0070689_100090011 3300005340 Bacteria 2417
84 Ga0070689_100091891 3300005340 Bacteria 2393
85 Ga0070689_100132236 3300005340 Bacteria 2001
86 Ga0070689_100172554 3300005340 Bacteria 1753
87 Ga0070689_100206675 3300005340 Bacteria 1605
88 Ga0070687_100001280 3300005343 Bacteria 8769
89 Ga0070687_100005475 3300005343 Bacteria 5142
90 Ga0070687_100051453 3300005343 Bacteria 2132
91 Ga0070687_100076504 3300005343 Bacteria 1813
92 Ga0070661_100070069 3300005344 Bacteria 2578
93 Ga0070661_100621261 3300005344 Bacteria 875
94 Ga0070692_10013187 3300005345 Bacteria 3847
95 Ga0070692_10043003 3300005345 Bacteria 2322
96 Ga0070669_100044898 3300005353 Bacteria 3219
97 Ga0070669_100612684 3300005353 Bacteria 913
98 Ga0070669_100921940 3300005353 Bacteria 747
99 Ga0070675_100015185 3300005354 Bacteria 6081
100 Ga0070675_100079860 3300005354 Bacteria 2726
101 Ga0070675_100311143 3300005354 Bacteria 1390
102 Ga0070675_100482830 3300005354 Bacteria 1115
103 Ga0070675_100500273 3300005354 Bacteria 1095
104 Ga0070675_100754814 3300005354 Bacteria 888
105 Ga0070671_100003376 3300005355 Bacteria 12452
106 Ga0070671_100029236 3300005355 Bacteria 4543
107 Ga0070671_100043258 3300005355 Bacteria 3743
108 Ga0070671_100180606 3300005355 Bacteria 1786
109 Ga0070671_100234710 3300005355 Bacteria 1557
110 Ga0070671_100302241 3300005355 Bacteria 1362
111 Ga0070674_100062849 3300005356 Bacteria 2596
112 Ga0070674_100418321 3300005356 Bacteria 1099
113 Ga0070673_100019365 3300005364 Bacteria 4884
114 Ga0070673_100033578 3300005364 Bacteria 3876
115 Ga0070673_100115766 3300005364 Bacteria 2229
116 Ga0070673_100157650 3300005364 Bacteria 1928
117 Ga0070673_100259870 3300005364 Bacteria 1517
118 Ga0070673_100321589 3300005364 Bacteria 1367
119 Ga0070673_100743847 3300005364 Bacteria 902
120 Ga0070688_100025051 3300005365 Bacteria 3528
121 Ga0070688_100171027 3300005365 Bacteria 1500
122 Ga0070659_100006843 3300005366 Bacteria 8258
123 Ga0070659_100124171 3300005366 Bacteria 2093
124 Ga0070659_100200069 3300005366 Bacteria 1644
125 Ga0070659_100218616 3300005366 Bacteria 1572
126 Ga0070659_100289887 3300005366 Bacteria 1363
127 Ga0070667_100074535 3300005367 Bacteria 2895
128 Ga0070667_100099950 3300005367 Bacteria 2504
129 Ga0070667_100485117 3300005367 Bacteria 1132
130 Ga0070667_100492493 3300005367 Bacteria 1123
131 Ga0070703_10008541 3300005406 Bacteria 2880
132 Ga0070710_10148414 3300005437 Bacteria 1444
133 Ga0070701_10032660 3300005438 Bacteria 2594
134 Ga0070701_10066767 3300005438 Bacteria 1912
135 Ga0070701_10408688 3300005438 Bacteria 862
136 Ga0070705_100019989 3300005440 Bacteria 3534
137 Ga0070705_100081331 3300005440 Unclassified 1990
138 Ga0070705_100155304 3300005440 Bacteria 1523
139 Ga0070705_100333973 3300005440 Bacteria 1099
140 Ga0070705_100451403 3300005440 Bacteria 964
141 Ga0070700_100007662 3300005441 Bacteria 5843
142 Ga0070700_100026521 3300005441 Bacteria 3423
143 Ga0070700_100032963 3300005441 Bacteria 3118
144 Ga0070700_100047918 3300005441 Bacteria 2646
145 Ga0070700_100090225 3300005441 Bacteria 1998
146 Ga0070700_100139556 3300005441 Bacteria 1645
147 Ga0070700_100236363 3300005441 Bacteria 1303
148 Ga0070700_100421216 3300005441 Bacteria 1009
149 Ga0070700_100450087 3300005441 Unclassified 980
150 Ga0070694_100001132 3300005444 Bacteria 15284
151 Ga0070694_100025186 3300005444 Bacteria 3848
152 Ga0070694_100038084 3300005444 Bacteria 3193
153 Ga0070694_100040501 3300005444 Bacteria 3106
154 Ga0070694_100110406 3300005444 Bacteria 1958
155 Ga0070694_100209943 3300005444 Bacteria 1455
156 Ga0070694_100211416 3300005444 Bacteria 1451
157 Ga0070694_100256124 3300005444 Bacteria 1326
158 Ga0070694_100261540 3300005444 Unclassified 1313
159 Ga0070694_100338842 3300005444 Bacteria 1162
160 Ga0070694_100544160 3300005444 Unclassified 929
161 Ga0070694_100824463 3300005444 Bacteria 762
162 Ga0070708_100000800 3300005445 Bacteria 23758
163 Ga0070708_100030539 3300005445 Bacteria 4658
164 Ga0070708_100139947 3300005445 Bacteria 2244
165 Ga0070708_100318268 3300005445 Bacteria 1465
166 Ga0070708_100401403 3300005445 Bacteria 1293
167 Ga0070708_100702213 3300005445 Unclassified 952
168 Ga0070708_100738209 3300005445 Unclassified 926
169 Ga0070708_100785817 3300005445 Unclassified 895
170 Ga0070663_100071067 3300005455 Bacteria 2532
171 Ga0070663_100374527 3300005455 Bacteria 1158
172 Ga0070662_100124949 3300005457 Bacteria 1976
173 Ga0070662_100156967 3300005457 Bacteria 1777
174 Ga0070662_100277230 3300005457 Bacteria 1356
175 Ga0070662_100698744 3300005457 Unclassified 858
176 Ga0070681_10026109 3300005458 Bacteria 5873
177 Ga0070681_10037224 3300005458 Bacteria 4884
178 Ga0070681_10066843 3300005458 Bacteria 3563
179 Ga0070681_10181476 3300005458 Bacteria 2026
180 Ga0070681_10313725 3300005458 Bacteria 1477
181 Ga0070681_10675750 3300005458 Bacteria 948
182 Ga0068867_100025248 3300005459 Bacteria 4263
183 Ga0068867_100089965 3300005459 Bacteria 2328
184 Ga0068867_100142723 3300005459 Bacteria 1873
185 Ga0068867_100151879 3300005459 Bacteria 1820
186 Ga0068867_100350411 3300005459 Unclassified 1232
187 Ga0068867_100749125 3300005459 Bacteria 867
188 Ga0070685_10022524 3300005466 Bacteria 3435
189 Ga0070685_10022558 3300005466 Bacteria 3433
190 Ga0070685_10201879 3300005466 Bacteria 1293
191 Ga0070706_100014378 3300005467 Bacteria 7315
192 Ga0070706_100041097 3300005467 Bacteria 4269
193 Ga0070706_100087123 3300005467 Bacteria 2894
194 Ga0070706_100088897 3300005467 Bacteria 2864
195 Ga0070706_100210047 3300005467 Bacteria 1818
196 Ga0070706_100381991 3300005467 Bacteria 1312
197 Ga0070706_100584901 3300005467 Bacteria 1038
198 Ga0070707_100011823 3300005468 Bacteria 8151
199 Ga0070707_100022361 3300005468 Bacteria 5978
200 Ga0070707_100119489 3300005468 Bacteria 2558
201 Ga0070707_100145294 3300005468 Bacteria 2309
202 Ga0070707_100191556 3300005468 Bacteria 1994
203 Ga0070707_100471145 3300005468 Bacteria 1217
204 Ga0070707_100696456 3300005468 Bacteria 979
205 Ga0070707_101048845 3300005468 Bacteria 781
206 Ga0070698_100000084 3300005471 Bacteria 73239
207 Ga0070698_100029543 3300005471 Bacteria 5691
208 Ga0070698_100033968 3300005471 Bacteria 5283
209 Ga0070698_100036446 3300005471 Bacteria 5081
210 Ga0070698_100067661 3300005471 Bacteria 3591
211 Ga0070698_100112639 3300005471 Bacteria 2685
212 Ga0070698_100275736 3300005471 Bacteria 1613
213 Ga0070698_100282083 3300005471 Bacteria 1592
214 Ga0070699_100000199 3300005518 Bacteria 59210
215 Ga0070699_100018887 3300005518 Bacteria 5926
216 Ga0070699_100024447 3300005518 Bacteria 5206
217 Ga0070699_100183950 3300005518 Bacteria 1855
218 Ga0070699_100315730 3300005518 Bacteria 1404
219 Ga0070699_100495951 3300005518 Bacteria 1109
220 Ga0070699_100497649 3300005518 Unclassified 1107
221 Ga0070699_100564873 3300005518 Bacteria 1036
222 Ga0070679_100000395 3300005530 Bacteria 37043
223 Ga0070679_100002779 3300005530 Bacteria 15910
224 Ga0070679_100039011 3300005530 Bacteria 4722
225 Ga0070684_100133389 3300005535 Bacteria 2241
226 Ga0070684_100186391 3300005535 Bacteria 1887
227 Ga0070697_100000690 3300005536 Bacteria 25278
228 Ga0070697_100006353 3300005536 Bacteria 9146
229 Ga0070697_100033839 3300005536 Bacteria 4118
230 Ga0070697_100045159 3300005536 Bacteria 3570
231 Ga0070697_100074747 3300005536 Bacteria 2784
232 Ga0068853_100005447 3300005539 Bacteria 9977
233 Ga0068853_100014358 3300005539 Bacteria 6484
234 Ga0068853_100026578 3300005539 Bacteria 4861
235 Ga0068853_100090773 3300005539 Bacteria 2685
236 Ga0068853_100130592 3300005539 Bacteria 2248
237 Ga0068853_100416945 3300005539 Bacteria 1259
238 Ga0068853_100431723 3300005539 Bacteria 1237
239 Ga0068853_100446230 3300005539 Bacteria 1216
240 Ga0068853_100543374 3300005539 Bacteria 1100
241 Ga0068853_100649976 3300005539 Bacteria 1004
242 Ga0070672_100040031 3300005543 Bacteria 3594
243 Ga0070672_100090602 3300005543 Bacteria 2466
244 Ga0070672_100241078 3300005543 Bacteria 1521
245 Ga0070672_100270492 3300005543 Bacteria 1435
246 Ga0070672_100512022 3300005543 Unclassified 1039
247 Ga0070672_100868032 3300005543 Unclassified 796
248 Ga0070686_100015416 3300005544 Bacteria 4427
249 Ga0070686_100016099 3300005544 Bacteria 4344
250 Ga0070686_100134991 3300005544 Unclassified 1711
251 Ga0070686_100249980 3300005544 Bacteria 1295
252 Ga0070695_100047332 3300005545 Bacteria 2746
253 Ga0070695_100114424 3300005545 Bacteria 1836
254 Ga0070695_100126967 3300005545 Unclassified 1753
255 Ga0070695_100143470 3300005545 Bacteria 1659
256 Ga0070695_100204803 3300005545 Bacteria 1412
257 Ga0070695_100242958 3300005545 Bacteria 1307
258 Ga0070695_100274793 3300005545 Bacteria 1235
259 Ga0070695_100281100 3300005545 Unclassified 1223
260 Ga0070695_100318184 3300005545 Bacteria 1156
261 Ga0070695_100361312 3300005545 Bacteria 1090
262 Ga0070695_100403474 3300005545 Bacteria 1037
263 Ga0070696_100006539 3300005546 Bacteria 7784
264 Ga0070696_100101240 3300005546 Bacteria 2065
265 Ga0070696_100106168 3300005546 Bacteria 2018
266 Ga0070696_100114455 3300005546 Bacteria 1945
267 Ga0070696_100394667 3300005546 Bacteria 1081
268 Ga0070696_100452376 3300005546 Unclassified 1013
269 Ga0070693_100119333 3300005547 Bacteria 1633
270 Ga0070693_100226609 3300005547 Bacteria 1227
271 Ga0070693_100259089 3300005547 Bacteria 1156
272 Ga0070693_100279348 3300005547 Bacteria 1118
273 Ga0070693_100289769 3300005547 Bacteria 1099
274 Ga0070693_100395491 3300005547 Bacteria 957
275 Ga0070665_100028770 3300005548 Bacteria 5595
276 Ga0070665_100291112 3300005548 Bacteria 1635
277 Ga0070665_100502206 3300005548 Bacteria 1224
278 Ga0070704_100049741 3300005549 Bacteria 2942
279 Ga0070704_100092069 3300005549 Bacteria 2262
280 Ga0070704_100095102 3300005549 Bacteria 2231
281 Ga0070704_100191235 3300005549 Bacteria 1645
282 Ga0070704_100206935 3300005549 Bacteria 1587
283 Ga0070704_100333761 3300005549 Bacteria 1274
284 Ga0070704_100586013 3300005549 Bacteria 978
285 Ga0070704_100600142 3300005549 Bacteria 967
286 Ga0068855_100274349 3300005563 Bacteria 1874
287 Ga0068855_100819917 3300005563 Bacteria 988
288 Ga0070664_100093079 3300005564 Bacteria 2611
289 Ga0070664_100100737 3300005564 Bacteria 2511
290 Ga0070664_100155525 3300005564 Bacteria 2020
291 Ga0070664_100172743 3300005564 Unclassified 1918
292 Ga0070664_100264949 3300005564 Bacteria 1547
293 Ga0070664_100690997 3300005564 Bacteria 950
294 Ga0068857_100005330 3300005577 Bacteria 10953
295 Ga0068857_100099813 3300005577 Bacteria 2604
296 Ga0068857_100146475 3300005577 Bacteria 2137
297 Ga0068857_100282706 3300005577 Bacteria 1526
298 Ga0068857_100438832 3300005577 Bacteria 1219
299 Ga0068857_100481799 3300005577 Bacteria 1163
300 Ga0068857_100781173 3300005577 Bacteria 911
301 Ga0068854_100108284 3300005578 Bacteria 2092
302 Ga0068854_100126375 3300005578 Bacteria 1948
303 Ga0068854_100173245 3300005578 Bacteria 1680
304 Ga0068854_100185614 3300005578 Bacteria 1627
305 Ga0068854_100679899 3300005578 Bacteria 886
306 Ga0068856_100154286 3300005614 Bacteria 2306
307 Ga0068856_101019346 3300005614 Bacteria 846
308 Ga0070702_100016163 3300005615 Bacteria 3824
309 Ga0070702_100083258 3300005615 Bacteria 1921
310 Ga0070702_100563566 3300005615 Bacteria 848
311 Ga0070702_100594953 3300005615 Bacteria 828
312 Ga0068852_100061961 3300005616 Bacteria 3252
313 Ga0068852_100244093 3300005616 Bacteria 1718
314 Ga0068852_100282193 3300005616 Bacteria 1601
315 Ga0068852_100477208 3300005616 Bacteria 1239
316 Ga0068852_100634410 3300005616 Bacteria 1075
317 Ga0068852_100848353 3300005616 Bacteria 929
318 Ga0068852_100991423 3300005616 Bacteria 859
319 Ga0068859_100006290 3300005617 Bacteria 12041
320 Ga0068859_100062276 3300005617 Bacteria 3760
321 Ga0068859_100067027 3300005617 Bacteria 3624
322 Ga0068859_100135988 3300005617 Bacteria 2531
323 Ga0068859_100181361 3300005617 Bacteria 2188
324 Ga0068859_100204530 3300005617 Bacteria 2059
325 Ga0068859_100229006 3300005617 Bacteria 1946
326 Ga0068859_100291361 3300005617 Bacteria 1725
327 Ga0068859_100406466 3300005617 Bacteria 1457
328 Ga0068859_100522896 3300005617 Bacteria 1281
329 Ga0068859_100677527 3300005617 Bacteria 1122
330 Ga0068859_100677574 3300005617 Bacteria 1122
331 Ga0068864_100045153 3300005618 Bacteria 3779
332 Ga0068864_100122312 3300005618 Bacteria 2328
333 Ga0068864_100155649 3300005618 Bacteria 2074
334 Ga0068864_100168188 3300005618 Bacteria 1997
335 Ga0068864_100221321 3300005618 Bacteria 1746
336 Ga0068864_100283724 3300005618 Bacteria 1546
337 Ga0068864_100286456 3300005618 Bacteria 1539
338 Ga0068864_100423811 3300005618 Bacteria 1268
339 Ga0068864_100668582 3300005618 Bacteria 1012
340 Ga0068864_100718140 3300005618 Unclassified 977
341 Ga0068864_100729372 3300005618 Bacteria 970
342 Ga0068864_100765915 3300005618 Unclassified 947
343 Ga0068864_100782813 3300005618 Bacteria 936
344 Ga0068866_10000684 3300005718 Bacteria 15437
345 Ga0068866_10119034 3300005718 Bacteria 1485
346 Ga0068866_10263842 3300005718 Bacteria 1060
347 Ga0068861_100012289 3300005719 Bacteria 5972
348 Ga0068861_100023980 3300005719 Bacteria 4406
349 Ga0068861_100042290 3300005719 Bacteria 3414
350 Ga0068861_100108321 3300005719 Bacteria 2222
351 Ga0068861_100263934 3300005719 Bacteria 1475
352 Ga0068861_100511107 3300005719 Bacteria 1088
353 Ga0068861_100650667 3300005719 Bacteria 973
354 Ga0068861_100685149 3300005719 Bacteria 951
355 Ga0068851_10022997 3300005834 Bacteria 3043
356 Ga0068851_10327366 3300005834 Bacteria 887
357 Ga0068870_10012226 3300005840 Bacteria 4005
358 Ga0068870_10194235 3300005840 Bacteria 1227
359 Ga0068870_10316188 3300005840 Bacteria 991
360 Ga0068863_100049169 3300005841 Bacteria 3998
361 Ga0068863_100201185 3300005841 Bacteria 1916
362 Ga0068863_100215640 3300005841 Bacteria 1848
363 Ga0068863_100264555 3300005841 Bacteria 1663
364 Ga0068863_100368941 3300005841 Bacteria 1400
365 Ga0068863_100460793 3300005841 Bacteria 1248
366 Ga0068863_100476481 3300005841 Bacteria 1227
367 Ga0068863_100510457 3300005841 Bacteria 1184
368 Ga0068863_100761495 3300005841 Bacteria 964
369 Ga0068858_100001829 3300005842 Bacteria 21656
370 Ga0068858_100023347 3300005842 Bacteria 5762
371 Ga0068858_100047238 3300005842 Bacteria 3991
372 Ga0068858_100052368 3300005842 Bacteria 3776
373 Ga0068858_100079267 3300005842 Bacteria 3052
374 Ga0068858_100141300 3300005842 Bacteria 2260
375 Ga0068858_100184629 3300005842 Bacteria 1970
376 Ga0068858_100278856 3300005842 Bacteria 1591
377 Ga0068858_100280535 3300005842 Bacteria 1586
378 Ga0068858_100356345 3300005842 Bacteria 1402
379 Ga0068860_100109863 3300005843 Bacteria 2635
380 Ga0068860_100141285 3300005843 Bacteria 2314
381 Ga0068860_100240862 3300005843 Bacteria 1759
382 Ga0068860_100286306 3300005843 Bacteria 1611
383 Ga0068860_100530630 3300005843 Bacteria 1177
384 Ga0068860_100615243 3300005843 Bacteria 1092
385 Ga0068860_101066082 3300005843 Unclassified 827
386 Ga0068862_100053366 3300005844 Bacteria 3460
387 Ga0068862_100058564 3300005844 Bacteria 3304
388 Ga0068862_100113262 3300005844 Bacteria 2383
389 Ga0068862_100384460 3300005844 Bacteria 1310
390 Ga0081539_10000395 3300005985 Bacteria 93818
391 Ga0081539_10000660 3300005985 Bacteria 69312
392 Ga0081539_10005021 3300005985 Bacteria 13949
393 Ga0081539_10006228 3300005985 Bacteria 11565
394 Ga0081539_10041399 3300005985 Bacteria 2693
395 Ga0081539_10116699 3300005985 Bacteria 1333
396 Ga0070715_10000038 3300006163 Bacteria 67091
397 Ga0070716_100000006 3300006173 Bacteria 268067
398 Ga0070716_100067054 3300006173 Bacteria 2095
399 Ga0070716_100251189 3300006173 Bacteria 1205
400 Ga0097621_100012663 3300006237 Bacteria 6263
401 Ga0097621_100145217 3300006237 Bacteria 2030
402 Ga0097621_100159314 3300006237 Bacteria 1939
403 Ga0097621_100432868 3300006237 Bacteria 1182
404 Ga0068871_100028361 3300006358 Bacteria 4388
405 Ga0068871_100049076 3300006358 Bacteria 3410
406 Ga0068871_100058549 3300006358 Bacteria 3137
407 Ga0068871_100060888 3300006358 Bacteria 3080
408 Ga0068871_100136220 3300006358 Bacteria 2085
409 Ga0068871_100282090 3300006358 Bacteria 1453
410 Ga0075428_100804450 3300006844 Bacteria 999
411 Ga0075430_100146906 3300006846 Bacteria 1963
412 Ga0075430_100173419 3300006846 Bacteria 1794
413 Ga0075430_100472442 3300006846 Bacteria 1035
414 Ga0075433_10015163 3300006852 Bacteria 6314
415 Ga0075433_10021535 3300006852 Bacteria 5406
416 Ga0075433_10084674 3300006852 Bacteria 2798
417 Ga0075433_10090942 3300006852 Bacteria 2697
418 Ga0075433_10288832 3300006852 Bacteria 1453
419 Ga0075433_10648704 3300006852 Bacteria 926
420 Ga0075434_100065544 3300006871 Bacteria 3617
421 Ga0075434_100171653 3300006871 Bacteria 2188
422 Ga0075434_100181865 3300006871 Bacteria 2123
423 Ga0075434_100202941 3300006871 Bacteria 2003
424 Ga0075434_100506750 3300006871 Bacteria 1228
425 Ga0075429_100087817 3300006880 Bacteria 2710
426 Ga0075429_100263245 3300006880 Bacteria 1510
427 Ga0075429_100555821 3300006880 Bacteria 1006
428 Ga0075429_100608311 3300006880 Bacteria 958
429 Ga0068865_100007130 3300006881 Bacteria 6863
430 Ga0068865_100026984 3300006881 Bacteria 3790
431 Ga0068865_100072236 3300006881 Unclassified 2451
432 Ga0068865_100088290 3300006881 Bacteria 2243
433 Ga0068865_100396622 3300006881 Bacteria 1129
434 Ga0075436_100038627 3300006914 Bacteria 3294
435 Ga0075436_100168772 3300006914 Bacteria 1545
436 Ga0075436_100274138 3300006914 Bacteria 1205
437 Ga0097620_100006289 3300006931 Bacteria 12041
438 Ga0097620_100062277 3300006931 Bacteria 3760
439 Ga0097620_100067026 3300006931 Bacteria 3624
440 Ga0097620_100108345 3300006931 Bacteria 2839
441 Ga0097620_100135993 3300006931 Bacteria 2531
442 Ga0097620_100181364 3300006931 Bacteria 2188
443 Ga0097620_100204540 3300006931 Bacteria 2059
444 Ga0097620_100228990 3300006931 Bacteria 1946
445 Ga0097620_100291368 3300006931 Bacteria 1725
446 Ga0097620_100406500 3300006931 Bacteria 1457
447 Ga0097620_100522937 3300006931 Bacteria 1281
448 Ga0097620_100677509 3300006931 Bacteria 1122
449 Ga0097620_100677578 3300006931 Bacteria 1122
450 Ga0097620_100974804 3300006931 Bacteria 930
451 Ga0075435_100006806 3300007076 Bacteria 8112
452 Ga0075435_100473316 3300007076 Bacteria 1081
453 Ga0075435_100520056 3300007076 Bacteria 1029
454 Ga0099794_10006344 3300007265 Bacteria 4780
455 Ga0099794_10272141 3300007265 Bacteria 875
456 Ga0099795_10194472 3300007788 Unclassified 853
457 Ga0105251_10126508 3300009011 Bacteria 1160
458 Ga0105251_10282875 3300009011 Bacteria 750
459 Ga0105240_10048927 3300009093 Bacteria 5340
460 Ga0105240_10564982 3300009093 Bacteria 1257
461 Ga0105240_10634150 3300009093 Bacteria 1173
462 Ga0105240_10868833 3300009093 Bacteria 972
463 Ga0111539_10000296 3300009094 Bacteria 60206
464 Ga0111539_10005702 3300009094 Bacteria 16116
465 Ga0111539_10062111 3300009094 Bacteria 4424
466 Ga0111539_10381266 3300009094 Bacteria 1641
467 Ga0111539_10523149 3300009094 Unclassified 1382
468 Ga0105245_10129737 3300009098 Bacteria 2364
469 Ga0105245_10135760 3300009098 Unclassified 2312
470 Ga0105245_10218321 3300009098 Bacteria 1838
471 Ga0105245_10260765 3300009098 Bacteria 1687
472 Ga0105245_10556313 3300009098 Bacteria 1169
473 Ga0105247_10000052 3300009101 Bacteria 141465
474 Ga0105247_10002354 3300009101 Bacteria 12879
475 Ga0105247_10030046 3300009101 Bacteria 3294
476 Ga0114129_10006921 3300009147 Bacteria 16129
477 Ga0114129_10010378 3300009147 Bacteria 13281
478 Ga0114129_10051992 3300009147 Bacteria 5751
479 Ga0114129_10056168 3300009147 Bacteria 5515
480 Ga0114129_10157829 3300009147 Bacteria 3101
481 Ga0114129_10201062 3300009147 Bacteria 2698
482 Ga0114129_10208551 3300009147 Bacteria 2643
483 Ga0114129_10219335 3300009147 Bacteria 2567
484 Ga0114129_10396358 3300009147 Bacteria 1820
485 Ga0114129_10432486 3300009147 Bacteria 1729
486 Ga0114129_10621872 3300009147 Bacteria 1397
487 Ga0114129_10638507 3300009147 Bacteria 1375
488 Ga0114129_10713126 3300009147 Bacteria 1288
489 Ga0114129_11045002 3300009147 Bacteria 1026
490 Ga0105243_10000777 3300009148 Bacteria 30566
491 Ga0105243_10002279 3300009148 Bacteria 16094
492 Ga0105243_10017989 3300009148 Bacteria 5347
493 Ga0105243_10140096 3300009148 Bacteria 2062
494 Ga0105243_10178686 3300009148 Bacteria 1844
495 Ga0105243_10345288 3300009148 Bacteria 1365
496 Ga0105243_10426206 3300009148 Bacteria 1239
497 Ga0105243_10433178 3300009148 Bacteria 1229
498 Ga0105243_10749748 3300009148 Bacteria 957
499 Ga0105241_10005308 3300009174 Bacteria 9516
500 Ga0105241_10059797 3300009174 Bacteria 2931
501 Ga0105241_10182071 3300009174 Unclassified 1744
502 Ga0105242_10003416 3300009176 Bacteria 12345
503 Ga0105242_10023865 3300009176 Bacteria 4825
504 Ga0105242_10024022 3300009176 Bacteria 4811
505 Ga0105242_10261756 3300009176 Bacteria 1563
506 Ga0105242_10375667 3300009176 Bacteria 1320
507 Ga0105242_10496625 3300009176 Bacteria 1160
508 Ga0105242_10638105 3300009176 Bacteria 1034
509 Ga0105242_10893319 3300009176 Bacteria 888
510 Ga0105248_10063416 3300009177 Bacteria 4148
511 Ga0105248_10131100 3300009177 Bacteria 2828
512 Ga0105248_10142812 3300009177 Bacteria 2701
513 Ga0105248_10239650 3300009177 Bacteria 2042
514 Ga0105248_10242012 3300009177 Bacteria 2031
515 Ga0105248_10367558 3300009177 Bacteria 1619
516 Ga0105248_10402737 3300009177 Bacteria 1541
517 Ga0105248_10531913 3300009177 Bacteria 1326
518 Ga0105248_10702410 3300009177 Unclassified 1141
519 Ga0105248_10730459 3300009177 Bacteria 1117
520 Ga0105248_10804128 3300009177 Bacteria 1061
521 Ga0105248_11095236 3300009177 Bacteria 900
522 Ga0105237_10015988 3300009545 Bacteria 7802
523 Ga0105237_10109426 3300009545 Bacteria 2755
524 Ga0105237_10117393 3300009545 Bacteria 2655
525 Ga0105237_10343914 3300009545 Bacteria 1496
526 Ga0105237_10734699 3300009545 Unclassified 993
527 Ga0105237_10807441 3300009545 Bacteria 945
528 Ga0105238_10097349 3300009551 Bacteria 2928
529 Ga0105238_10310430 3300009551 Bacteria 1562
530 Ga0105249_10000118 3300009553 Bacteria 107887
531 Ga0105249_10007338 3300009553 Bacteria 9611
532 Ga0105249_10071455 3300009553 Bacteria 3206
533 Ga0105249_10166783 3300009553 Bacteria 2132
534 Ga0105249_10171374 3300009553 Bacteria 2105
535 Ga0105249_10322398 3300009553 Bacteria 1556
536 Ga0105249_10397565 3300009553 Bacteria 1408
537 Ga0105249_10463914 3300009553 Bacteria 1307
538 Ga0105249_10637283 3300009553 Bacteria 1123
539 Ga0105249_10874089 3300009553 Bacteria 965
540 Ga0099796_10054637 3300010159 Bacteria 1397
541 Ga0105239_10074765 3300010375 Bacteria 3725
542 Ga0105239_10219694 3300010375 Bacteria 2131
543 Ga0105239_10969326 3300010375 Bacteria 977
544 Ga0105246_10141578 3300011119 Bacteria 1809
545 Ga0105246_10237504 3300011119 Unclassified 1439
546 Ga0105246_10535390 3300011119 Bacteria 1001
547 Ga0157373_10049467 3300013100 Bacteria 2996
548 Ga0157373_10148750 3300013100 Bacteria 1648
549 Ga0157373_10346905 3300013100 Bacteria 1059
550 Ga0157371_10115682 3300013102 Bacteria 1905
551 Ga0157371_10288184 3300013102 Unclassified 1187
552 Ga0157371_10353787 3300013102 Bacteria 1069
553 Ga0157370_10029985 3300013104 Bacteria 5332
554 Ga0157370_10313270 3300013104 Bacteria 1448
555 Ga0157369_10065150 3300013105 Bacteria 3922
556 Ga0157374_10010383 3300013296 Bacteria 8009
557 Ga0157374_10049199 3300013296 Bacteria 3915
558 Ga0157374_10218071 3300013296 Bacteria 1872
559 Ga0157374_10243437 3300013296 Bacteria 1769
560 Ga0157374_10666031 3300013296 Bacteria 1053
561 Ga0157378_10006521 3300013297 Bacteria 10202
562 Ga0157378_10008509 3300013297 Bacteria 8930
563 Ga0157378_10009044 3300013297 Bacteria 8668
564 Ga0157378_10009557 3300013297 Bacteria 8445
565 Ga0157378_10023296 3300013297 Bacteria 5449
566 Ga0157378_10046017 3300013297 Bacteria 3879
567 Ga0157378_10131778 3300013297 Bacteria 2315
568 Ga0157378_10143743 3300013297 Bacteria 2217
569 Ga0157378_10146714 3300013297 Bacteria 2195
570 Ga0157378_10738858 3300013297 Bacteria 1006
571 Ga0157378_10890043 3300013297 Unclassified 920
572 Ga0157378_10901782 3300013297 Bacteria 915
573 Ga0163162_10000059 3300013306 Bacteria 107864
574 Ga0163162_10017503 3300013306 Bacteria 7011
575 Ga0163162_10097605 3300013306 Bacteria 3027
576 Ga0163162_10104208 3300013306 Bacteria 2931
577 Ga0163162_10122647 3300013306 Bacteria 2704
578 Ga0163162_10125215 3300013306 Bacteria 2675
579 Ga0163162_10131769 3300013306 Bacteria 2609
580 Ga0163162_10283531 3300013306 Bacteria 1788
581 Ga0163162_10536737 3300013306 Bacteria 1298
582 Ga0157372_10028946 3300013307 Bacteria 6045
583 Ga0157372_10029271 3300013307 Bacteria 6013
584 Ga0157372_10228784 3300013307 Bacteria 2155
585 Ga0157372_10382411 3300013307 Bacteria 1640
586 Ga0157372_10471752 3300013307 Bacteria 1463
587 Ga0157372_10555304 3300013307 Bacteria 1339
588 Ga0157372_11173470 3300013307 Unclassified 888
589 Ga0157372_11400383 3300013307 Bacteria 806
590 Ga0157375_10060122 3300013308 Bacteria 3767
591 Ga0157375_10074960 3300013308 Bacteria 3407
592 Ga0157375_10090937 3300013308 Bacteria 3112
593 Ga0157375_10141175 3300013308 Bacteria 2536
594 Ga0157375_10241617 3300013308 Bacteria 1965
595 Ga0157375_10304449 3300013308 Bacteria 1758
596 Ga0157375_10341776 3300013308 Bacteria 1662
597 Ga0157375_10379218 3300013308 Bacteria 1581
598 Ga0157375_10449587 3300013308 Bacteria 1454
599 Ga0157375_10450247 3300013308 Bacteria 1453
600 Ga0157375_10530476 3300013308 Bacteria 1340
601 Ga0157375_10569178 3300013308 Bacteria 1294
602 Ga0157375_10617410 3300013308 Bacteria 1242
603 Ga0163163_10034085 3300014325 Bacteria 4928
604 Ga0163163_10107898 3300014325 Bacteria 2811
605 Ga0163163_10130260 3300014325 Bacteria 2555
606 Ga0163163_10213696 3300014325 Bacteria 1978
607 Ga0163163_10221046 3300014325 Bacteria 1943
608 Ga0163163_10230231 3300014325 Bacteria 1902
609 Ga0163163_10266574 3300014325 Bacteria 1764
610 Ga0163163_10349412 3300014325 Bacteria 1535
611 Ga0163163_10366927 3300014325 Bacteria 1497
612 Ga0163163_10424801 3300014325 Bacteria 1388
613 Ga0163163_10426102 3300014325 Bacteria 1386
614 Ga0163163_10530717 3300014325 Bacteria 1239
615 Ga0163163_10546111 3300014325 Bacteria 1221
616 Ga0163163_10971324 3300014325 Unclassified 913
617 Ga0163163_10992859 3300014325 Unclassified 903
618 Ga0157380_10000784 3300014326 Bacteria 19929
619 Ga0157380_10020962 3300014326 Bacteria 4896
620 Ga0157380_10044946 3300014326 Bacteria 3464
621 Ga0157380_10075491 3300014326 Bacteria 2740
622 Ga0157380_10141550 3300014326 Unclassified 2067
623 Ga0157380_10179277 3300014326 Bacteria 1860
624 Ga0157380_10236319 3300014326 Bacteria 1645
625 Ga0157380_10239808 3300014326 Bacteria 1634
626 Ga0157380_10275714 3300014326 Bacteria 1536
627 Ga0157380_10364415 3300014326 Bacteria 1357
628 Ga0157380_11215299 3300014326 Unclassified 798
629 Ga0157377_10006911 3300014745 Bacteria 5444
630 Ga0157377_10158730 3300014745 Bacteria 1404
631 Ga0157377_10297232 3300014745 Bacteria 1064
632 Ga0157377_10364426 3300014745 Bacteria 974
633 Ga0157379_10028710 3300014968 Bacteria 4947
634 Ga0157376_10008779 3300014969 Bacteria 7310
635 Ga0157376_10132834 3300014969 Bacteria 2224
636 Ga0157376_10138777 3300014969 Bacteria 2178
637 Ga0157376_10210631 3300014969 Bacteria 1794
638 Ga0163161_10001314 3300017792 Bacteria 18504
639 Ga0163161_10007085 3300017792 Bacteria 7756
640 Ga0163161_10015560 3300017792 Bacteria 5304
641 Ga0163161_10034538 3300017792 Bacteria 3618
642 Ga0163161_10131529 3300017792 Bacteria 1888
643 Ga0163161_10362494 3300017792 Bacteria 1155
644 Ga0213876_10001455 3300021384 Bacteria 14730
645 Ga0213876_10019489 3300021384 Bacteria 3583
646 Ga0207672_1000732 3300025223 Bacteria 3653
647 Ga0207697_10061318 3300025315 Bacteria 1565
648 Ga0207697_10083586 3300025315 Bacteria 1347
649 Ga0207656_10004238 3300025321 Bacteria 4994
650 Ga0207656_10111037 3300025321 Bacteria 1267
651 Ga0207656_10176250 3300025321 Bacteria 1024
652 Ga0207653_10010210 3300025885 Bacteria 2929
653 Ga0207653_10021838 3300025885 Bacteria 2031
654 Ga0207653_10023747 3300025885 Bacteria 1955
655 Ga0207682_10080110 3300025893 Bacteria 1398
656 Ga0207642_10098002 3300025899 Bacteria 1465
657 Ga0207710_10000004 3300025900 Bacteria 846540
658 Ga0207710_10024628 3300025900 Bacteria 2594
659 Ga0207688_10039861 3300025901 Bacteria 2609
660 Ga0207680_10109296 3300025903 Bacteria 1790
661 Ga0207680_10122881 3300025903 Bacteria 1700
662 Ga0207680_10235213 3300025903 Bacteria 1260
663 Ga0207680_10334785 3300025903 Bacteria 1061
664 Ga0207685_10000051 3300025905 Bacteria 39503
665 Ga0207645_10019493 3300025907 Bacteria 4446
666 Ga0207645_10040599 3300025907 Bacteria 2980
667 Ga0207645_10138000 3300025907 Bacteria 1588
668 Ga0207645_10221167 3300025907 Bacteria 1248
669 Ga0207645_10225916 3300025907 Bacteria 1235
670 Ga0207645_10251011 3300025907 Bacteria 1170
671 Ga0207643_10001463 3300025908 Bacteria 13548
672 Ga0207643_10064968 3300025908 Bacteria 2089
673 Ga0207643_10088569 3300025908 Bacteria 1802
674 Ga0207643_10104165 3300025908 Bacteria 1666
675 Ga0207643_10119099 3300025908 Bacteria 1562
676 Ga0207705_10008577 3300025909 Bacteria 7451
677 Ga0207684_10001576 3300025910 Bacteria 24324
678 Ga0207684_10009774 3300025910 Bacteria 8461
679 Ga0207684_10028709 3300025910 Bacteria 4739
680 Ga0207684_10032500 3300025910 Bacteria 4437
681 Ga0207684_10093393 3300025910 Bacteria 2565
682 Ga0207684_10356292 3300025910 Bacteria 1259
683 Ga0207654_10100127 3300025911 Bacteria 1784
684 Ga0207654_10247607 3300025911 Bacteria 1193
685 Ga0207654_10450308 3300025911 Bacteria 903
686 Ga0207707_10000097 3300025912 Bacteria 88081
687 Ga0207707_10005688 3300025912 Bacteria 10908
688 Ga0207707_10028834 3300025912 Bacteria 4851
689 Ga0207707_10041693 3300025912 Bacteria 4008
690 Ga0207707_10337279 3300025912 Bacteria 1300
691 Ga0207707_10521294 3300025912 Bacteria 1012
692 Ga0207695_10298698 3300025913 Bacteria 1502
693 Ga0207695_10323063 3300025913 Unclassified 1433
694 Ga0207695_10599597 3300025913 Bacteria 983
695 Ga0207671_10019270 3300025914 Bacteria 5220
696 Ga0207671_10238895 3300025914 Bacteria 1427
697 Ga0207660_10030363 3300025917 Bacteria 3715
698 Ga0207660_10119403 3300025917 Bacteria 1995
699 Ga0207660_10367631 3300025917 Bacteria 1155
700 Ga0207660_10621486 3300025917 Bacteria 880
701 Ga0207662_10001023 3300025918 Bacteria 13097
702 Ga0207662_10001888 3300025918 Bacteria 10324
703 Ga0207662_10057188 3300025918 Bacteria 2330
704 Ga0207662_10187565 3300025918 Bacteria 1333
705 Ga0207662_10222627 3300025918 Bacteria 1229
706 Ga0207649_10522753 3300025920 Unclassified 905
707 Ga0207652_10000229 3300025921 Bacteria 58696
708 Ga0207652_10009158 3300025921 Bacteria 7968
709 Ga0207652_10031620 3300025921 Bacteria 4446
710 Ga0207652_10212441 3300025921 Bacteria 1742
711 Ga0207652_10269911 3300025921 Bacteria 1534
712 Ga0207646_10002486 3300025922 Bacteria 21767
713 Ga0207646_10044831 3300025922 Bacteria 3969
714 Ga0207646_10101585 3300025922 Bacteria 2578
715 Ga0207646_10108498 3300025922 Bacteria 2490
716 Ga0207646_10132369 3300025922 Bacteria 2245
717 Ga0207646_10158539 3300025922 Bacteria 2041
718 Ga0207646_10241551 3300025922 Bacteria 1631
719 Ga0207646_10361949 3300025922 Bacteria 1310
720 Ga0207681_10012129 3300025923 Bacteria 5312
721 Ga0207681_10049116 3300025923 Bacteria 2850
722 Ga0207681_10090081 3300025923 Bacteria 2189
723 Ga0207681_10114400 3300025923 Bacteria 1968
724 Ga0207681_10550509 3300025923 Bacteria 949
725 Ga0207694_10148212 3300025924 Bacteria 1890
726 Ga0207694_10927363 3300025924 Bacteria 736
727 Ga0207650_10000143 3300025925 Bacteria 87521
728 Ga0207650_10001512 3300025925 Bacteria 16613
729 Ga0207650_10042900 3300025925 Bacteria 3318
730 Ga0207650_10061705 3300025925 Bacteria 2799
731 Ga0207650_10099618 3300025925 Bacteria 2234
732 Ga0207650_10363105 3300025925 Bacteria 1193
733 Ga0207650_10708151 3300025925 Bacteria 851
734 Ga0207650_10740856 3300025925 Bacteria 831
735 Ga0207659_10135849 3300025926 Bacteria 1903
736 Ga0207659_10203799 3300025926 Bacteria 1581
737 Ga0207659_10699857 3300025926 Bacteria 868
738 Ga0207687_10035123 3300025927 Bacteria 3409
739 Ga0207687_10213382 3300025927 Bacteria 1515
740 Ga0207644_10000414 3300025931 Bacteria 27902
741 Ga0207644_10038017 3300025931 Bacteria 3388
742 Ga0207644_10067486 3300025931 Bacteria 2607
743 Ga0207644_10136457 3300025931 Bacteria 1884
744 Ga0207644_10254285 3300025931 Bacteria 1403
745 Ga0207644_10348784 3300025931 Bacteria 1201
746 Ga0207644_10375512 3300025931 Bacteria 1159
747 Ga0207690_10020005 3300025932 Bacteria 4129
748 Ga0207690_10087154 3300025932 Bacteria 2196
749 Ga0207690_10106528 3300025932 Bacteria 2012
750 Ga0207690_10463740 3300025932 Bacteria 1020
751 Ga0207706_10013896 3300025933 Bacteria 7301
752 Ga0207706_10151986 3300025933 Unclassified 2036
753 Ga0207706_10174781 3300025933 Bacteria 1887
754 Ga0207706_10277830 3300025933 Bacteria 1461
755 Ga0207686_10000005 3300025934 Bacteria 260873
756 Ga0207686_10036664 3300025934 Bacteria 2953
757 Ga0207686_10239182 3300025934 Bacteria 1320
758 Ga0207686_10383447 3300025934 Bacteria 1066
759 Ga0207686_10546198 3300025934 Unclassified 905
760 Ga0207709_10000133 3300025935 Bacteria 108698
761 Ga0207709_10009116 3300025935 Bacteria 5469
762 Ga0207709_10009548 3300025935 Bacteria 5339
763 Ga0207709_10086195 3300025935 Bacteria 2038
764 Ga0207709_10281380 3300025935 Bacteria 1229
765 Ga0207709_10289441 3300025935 Bacteria 1213
766 Ga0207709_10517171 3300025935 Bacteria 934
767 Ga0207709_10703312 3300025935 Unclassified 809
768 Ga0207670_10000655 3300025936 Bacteria 18353
769 Ga0207670_10253092 3300025936 Bacteria 1362
770 Ga0207670_10398701 3300025936 Bacteria 1099
771 Ga0207670_10554362 3300025936 Bacteria 939
772 Ga0207669_10223385 3300025937 Unclassified 1384
773 Ga0207669_10228227 3300025937 Bacteria 1372
774 Ga0207669_10257193 3300025937 Bacteria 1304
775 Ga0207704_10020784 3300025938 Bacteria 3482
776 Ga0207704_10069628 3300025938 Bacteria 2224
777 Ga0207704_10106062 3300025938 Bacteria 1886
778 Ga0207704_10162378 3300025938 Unclassified 1591
779 Ga0207665_10000005 3300025939 Bacteria 194919
780 Ga0207665_10064327 3300025939 Bacteria 2492
781 Ga0207691_10005231 3300025940 Bacteria 12520
782 Ga0207691_10072727 3300025940 Bacteria 3101
783 Ga0207691_10089118 3300025940 Bacteria 2767
784 Ga0207691_10095004 3300025940 Bacteria 2667
785 Ga0207691_10254623 3300025940 Bacteria 1514
786 Ga0207691_10337521 3300025940 Bacteria 1290
787 Ga0207711_10047901 3300025941 Bacteria 3656
788 Ga0207711_10052587 3300025941 Bacteria 3491
789 Ga0207711_10155505 3300025941 Bacteria 2066
790 Ga0207711_10176633 3300025941 Bacteria 1940
791 Ga0207711_10184558 3300025941 Bacteria 1898
792 Ga0207711_10256357 3300025941 Bacteria 1607
793 Ga0207711_10378836 3300025941 Unclassified 1313
794 Ga0207711_11064412 3300025941 Bacteria 749
795 Ga0207689_10004453 3300025942 Bacteria 12701
796 Ga0207689_10045310 3300025942 Bacteria 3638
797 Ga0207689_10143300 3300025942 Bacteria 1969
798 Ga0207689_10184719 3300025942 Bacteria 1720
799 Ga0207689_10262940 3300025942 Bacteria 1428
800 Ga0207689_10281028 3300025942 Bacteria 1378
801 Ga0207689_10405559 3300025942 Bacteria 1136
802 Ga0207689_10505238 3300025942 Bacteria 1013
803 Ga0207689_10560412 3300025942 Unclassified 960
804 Ga0207661_10215670 3300025944 Bacteria 1694
805 Ga0207661_10549680 3300025944 Bacteria 1058
806 Ga0207679_10020056 3300025945 Bacteria 4506
807 Ga0207679_10070497 3300025945 Bacteria 2634
808 Ga0207679_10077213 3300025945 Bacteria 2533
809 Ga0207679_10134893 3300025945 Bacteria 1986
810 Ga0207679_10165413 3300025945 Bacteria 1816
811 Ga0207679_10655455 3300025945 Bacteria 950
812 Ga0207679_10690212 3300025945 Unclassified 926
813 Ga0207667_10202582 3300025949 Bacteria 2035
814 Ga0207667_10207795 3300025949 Bacteria 2007
815 Ga0207651_10003298 3300025960 Bacteria 7907
816 Ga0207651_10027371 3300025960 Bacteria 3580
817 Ga0207651_10152795 3300025960 Bacteria 1799
818 Ga0207651_10342070 3300025960 Bacteria 1257
819 Ga0207651_10379715 3300025960 Bacteria 1197
820 Ga0207651_10488237 3300025960 Bacteria 1063
821 Ga0207651_10794280 3300025960 Bacteria 839
822 Ga0207712_10036610 3300025961 Bacteria 3344
823 Ga0207712_10058524 3300025961 Bacteria 2724
824 Ga0207712_10064684 3300025961 Bacteria 2609
825 Ga0207712_10115427 3300025961 Bacteria 2021
826 Ga0207712_10156595 3300025961 Bacteria 1765
827 Ga0207712_10241788 3300025961 Bacteria 1454
828 Ga0207712_10245435 3300025961 Bacteria 1445
829 Ga0207712_10382062 3300025961 Bacteria 1179
830 Ga0207712_10397836 3300025961 Bacteria 1157
831 Ga0207712_10553957 3300025961 Unclassified 989
832 Ga0207712_10867345 3300025961 Unclassified 796
833 Ga0207668_10165814 3300025972 Bacteria 1727
834 Ga0207668_10401378 3300025972 Bacteria 1159
835 Ga0207668_10619352 3300025972 Bacteria 944
836 Ga0207640_10084692 3300025981 Bacteria 2177
837 Ga0207640_10124332 3300025981 Bacteria 1855
838 Ga0207640_10171425 3300025981 Bacteria 1617
839 Ga0207640_10185038 3300025981 Bacteria 1565
840 Ga0207658_10421860 3300025986 Bacteria 1176
841 Ga0207658_10779662 3300025986 Bacteria 867
842 Ga0207677_10373005 3300026023 Bacteria 1202
843 Ga0207677_10550901 3300026023 Unclassified 1005
844 Ga0207677_10814908 3300026023 Bacteria 836
845 Ga0207703_10001442 3300026035 Bacteria 21704
846 Ga0207703_10024704 3300026035 Bacteria 4728
847 Ga0207703_10043128 3300026035 Bacteria 3619
848 Ga0207703_10098716 3300026035 Bacteria 2470
849 Ga0207703_10272214 3300026035 Bacteria 1535
850 Ga0207703_10519553 3300026035 Bacteria 1120
851 Ga0207639_10032541 3300026041 Bacteria 3839
852 Ga0207639_10041623 3300026041 Bacteria 3439
853 Ga0207639_10110407 3300026041 Bacteria 2240
854 Ga0207639_10148801 3300026041 Bacteria 1959
855 Ga0207639_10258625 3300026041 Bacteria 1521
856 Ga0207639_10413557 3300026041 Bacteria 1218
857 Ga0207639_10452453 3300026041 Bacteria 1166
858 Ga0207639_10558146 3300026041 Bacteria 1052
859 Ga0207639_10994639 3300026041 Bacteria 785
860 Ga0207678_10015509 3300026067 Bacteria 6699
861 Ga0207678_10285548 3300026067 Bacteria 1417
862 Ga0207708_10000254 3300026075 Bacteria 42011
863 Ga0207708_10020157 3300026075 Bacteria 5028
864 Ga0207708_10062762 3300026075 Bacteria 2838
865 Ga0207708_10064652 3300026075 Bacteria 2795
866 Ga0207708_10067820 3300026075 Bacteria 2730
867 Ga0207708_10086377 3300026075 Bacteria 2414
868 Ga0207708_10159054 3300026075 Bacteria 1783
869 Ga0207708_10254258 3300026075 Bacteria 1417
870 Ga0207708_10394201 3300026075 Bacteria 1144
871 Ga0207708_10464661 3300026075 Bacteria 1056
872 Ga0207702_11052731 3300026078 Bacteria 807
873 Ga0207641_10011476 3300026088 Bacteria 7272
874 Ga0207641_10045020 3300026088 Bacteria 3713
875 Ga0207641_10243929 3300026088 Bacteria 1675
876 Ga0207641_10244798 3300026088 Bacteria 1672
877 Ga0207641_10326602 3300026088 Bacteria 1456
878 Ga0207641_10701885 3300026088 Bacteria 996
879 Ga0207641_10804512 3300026088 Bacteria 930
880 Ga0207648_10008477 3300026089 Bacteria 9947
881 Ga0207648_10140765 3300026089 Bacteria 2126
882 Ga0207648_10145661 3300026089 Bacteria 2089
883 Ga0207648_10155463 3300026089 Bacteria 2019
884 Ga0207648_10160284 3300026089 Bacteria 1987
885 Ga0207648_10194689 3300026089 Bacteria 1797
886 Ga0207648_10441019 3300026089 Bacteria 1184
887 Ga0207648_11070200 3300026089 Bacteria 756
888 Ga0207676_10008932 3300026095 Bacteria 7130
889 Ga0207676_10080799 3300026095 Bacteria 2639
890 Ga0207676_10104354 3300026095 Bacteria 2357
891 Ga0207676_10137435 3300026095 Bacteria 2087
892 Ga0207676_10148375 3300026095 Bacteria 2017
893 Ga0207676_10370325 3300026095 Bacteria 1330
894 Ga0207676_10698137 3300026095 Bacteria 983
895 Ga0207674_10000129 3300026116 Bacteria 88458
896 Ga0207674_10054555 3300026116 Bacteria 4068
897 Ga0207674_10069293 3300026116 Bacteria 3548
898 Ga0207674_10179061 3300026116 Bacteria 2072
899 Ga0207674_10230873 3300026116 Bacteria 1798
900 Ga0207675_100001227 3300026118 Bacteria 25579
901 Ga0207675_100003424 3300026118 Bacteria 15494
902 Ga0207675_100061965 3300026118 Bacteria 3492
903 Ga0207675_100064333 3300026118 Bacteria 3428
904 Ga0207675_100123212 3300026118 Bacteria 2454
905 Ga0207675_100303132 3300026118 Bacteria 1556
906 Ga0207675_100397682 3300026118 Bacteria 1357
907 Ga0207675_100790521 3300026118 Bacteria 962
908 Ga0207675_100917274 3300026118 Bacteria 893
909 Ga0207683_10192082 3300026121 Bacteria 1854
910 Ga0207683_10346421 3300026121 Bacteria 1363
911 Ga0207698_10150592 3300026142 Bacteria 2018
912 Ga0207698_10199680 3300026142 Bacteria 1789
913 Ga0207698_10295457 3300026142 Bacteria 1506
914 Ga0207698_10354286 3300026142 Bacteria 1387
915 Ga0207698_10774193 3300026142 Bacteria 960
916 Ga0207698_10853677 3300026142 Bacteria 916
917 Ga0207698_10854872 3300026142 Bacteria 915
918 Ga0207698_11323396 3300026142 Bacteria 735
919 Ga0209588_1010605 3300027671 Bacteria 2774
920 Ga0209974_10058096 3300027876 Bacteria 1307
921 Ga0207428_10013155 3300027907 Bacteria 7244
922 Ga0207428_10022575 3300027907 Bacteria 5307
923 Ga0268266_10220542 3300028379 Bacteria 1743
924 Ga0268265_10048879 3300028380 Bacteria 3178
925 Ga0268265_10063139 3300028380 Bacteria 2848
926 Ga0268265_10074834 3300028380 Bacteria 2651
927 Ga0268265_10203403 3300028380 Bacteria 1720
928 Ga0268265_10347838 3300028380 Bacteria 1352
929 Ga0268265_10437692 3300028380 Bacteria 1218
930 Ga0268264_10040605 3300028381 Bacteria 3844
931 Ga0268264_10041856 3300028381 Bacteria 3790
932 Ga0268264_10114653 3300028381 Bacteria 2366
933 Ga0268264_10132055 3300028381 Bacteria 2215
934 Ga0268264_10274175 3300028381 Bacteria 1577
935 Ga0268264_10612057 3300028381 Unclassified 1074
936 Ga0316183_1120389 3300030742 Bacteria 1078
937 Ga0316182_1044663 3300030745 Bacteria 789
938 Ga0307513_10119701 3300031456 Bacteria 2604
939 Ga0307408_100010460 3300031548 Bacteria 6119
940 Ga0307408_100050839 3300031548 Bacteria 2982
941 Ga0307408_100064584 3300031548 Bacteria 2681
942 Ga0307408_100086200 3300031548 Bacteria 2360
943 Ga0307408_100110354 3300031548 Bacteria 2112
944 Ga0307408_100590877 3300031548 Bacteria 985
945 Ga0307516_10565335 3300031730 Bacteria 791
946 Ga0307405_10004715 3300031731 Bacteria 6488
947 Ga0307405_10010573 3300031731 Bacteria 4794
948 Ga0307405_10025311 3300031731 Bacteria 3405
949 Ga0307405_10032374 3300031731 Bacteria 3090
950 Ga0307405_10051623 3300031731 Bacteria 2552
951 Ga0307405_10094775 3300031731 Bacteria 1986
952 Ga0307405_10284202 3300031731 Bacteria 1247
953 Ga0307413_10000449 3300031824 Bacteria 13415
954 Ga0307413_10000852 3300031824 Bacteria 10735
955 Ga0307413_10005121 3300031824 Bacteria 5803
956 Ga0307413_10014279 3300031824 Bacteria 4027
957 Ga0307413_10018686 3300031824 Bacteria 3644
958 Ga0307413_10773741 3300031824 Bacteria 804
959 Ga0307413_10800737 3300031824 Bacteria 792
960 Ga0307410_10002806 3300031852 Bacteria 8542
961 Ga0307410_10009152 3300031852 Bacteria 5541
962 Ga0307410_10010917 3300031852 Bacteria 5172
963 Ga0307410_10067989 3300031852 Bacteria 2459
964 Ga0307410_10101577 3300031852 Bacteria 2062
965 Ga0307410_10140538 3300031852 Bacteria 1786
966 Ga0307410_10393507 3300031852 Bacteria 1118
967 Ga0307410_10430365 3300031852 Bacteria 1072
968 Ga0307410_10435275 3300031852 Bacteria 1067
969 Ga0307406_10011330 3300031901 Bacteria 5058
970 Ga0307406_10039674 3300031901 Bacteria 2923
971 Ga0307406_10083282 3300031901 Bacteria 2133
972 Ga0307406_10104045 3300031901 Bacteria 1940
973 Ga0307406_10116651 3300031901 Bacteria 1848
974 Ga0307406_10196529 3300031901 Bacteria 1481
975 Ga0307406_10198129 3300031901 Bacteria 1476
976 Ga0307406_10343263 3300031901 Bacteria 1164
977 Ga0307407_10006362 3300031903 Bacteria 5235
978 Ga0307407_10009813 3300031903 Bacteria 4479
979 Ga0307407_10034551 3300031903 Bacteria 2769
980 Ga0307407_10122426 3300031903 Bacteria 1651
981 Ga0307407_10134942 3300031903 Bacteria 1584
982 Ga0307407_10159319 3300031903 Bacteria 1475
983 Ga0307407_10400841 3300031903 Bacteria 984
984 Ga0307412_10014128 3300031911 Bacteria 4702
985 Ga0307412_10025492 3300031911 Bacteria 3664
986 Ga0307412_10026837 3300031911 Bacteria 3585
987 Ga0307412_10033799 3300031911 Bacteria 3253
988 Ga0307412_10107971 3300031911 Bacteria 1982
989 Ga0307412_10172990 3300031911 Bacteria 1616
990 Ga0307409_100003394 3300031995 Bacteria 8644
991 Ga0307409_100021033 3300031995 Bacteria 4463
992 Ga0307409_100255887 3300031995 Bacteria 1604
993 Ga0307409_100308528 3300031995 Bacteria 1475
994 Ga0307409_100395748 3300031995 Bacteria 1318
995 Ga0307409_100480548 3300031995 Bacteria 1205
996 Ga0307409_100752629 3300031995 Bacteria 978
997 Ga0307409_101239819 3300031995 Bacteria 770
998 Ga0307416_100024716 3300032002 Bacteria 4391
999 Ga0307416_100050635 3300032002 Bacteria 3312
1000 Ga0307416_100056621 3300032002 Bacteria 3165
1001 Ga0307416_100148701 3300032002 Bacteria 2144
1002 Ga0307416_100250715 3300032002 Bacteria 1723
1003 Ga0307416_100300320 3300032002 Bacteria 1595
1004 Ga0307416_100319753 3300032002 Bacteria 1553
1005 Ga0307416_100406196 3300032002 Bacteria 1401
1006 Ga0307416_101011524 3300032002 Bacteria 934
1007 Ga0307414_10010849 3300032004 Bacteria 5314
1008 Ga0307414_10023210 3300032004 Bacteria 3930
1009 Ga0307414_10107444 3300032004 Bacteria 2114
1010 Ga0307414_10245849 3300032004 Bacteria 1484
1011 Ga0307414_10316649 3300032004 Bacteria 1326
1012 Ga0307414_10490063 3300032004 Bacteria 1086
1013 Ga0307414_10646067 3300032004 Bacteria 953
1014 Ga0307414_10742382 3300032004 Bacteria 892
1015 Ga0307411_10001458 3300032005 Bacteria 9686
1016 Ga0307411_10036169 3300032005 Bacteria 3091
1017 Ga0307411_10128261 3300032005 Bacteria 1849
1018 Ga0307411_10134179 3300032005 Bacteria 1814
1019 Ga0307411_10149639 3300032005 Bacteria 1733
1020 Ga0307411_10170276 3300032005 Bacteria 1641
1021 Ga0307411_10189055 3300032005 Bacteria 1570
1022 Ga0307411_10265534 3300032005 Bacteria 1358
1023 Ga0307411_10295693 3300032005 Unclassified 1296
1024 Ga0307411_10301595 3300032005 Bacteria 1285
1025 Ga0307411_10398725 3300032005 Bacteria 1137
1026 Ga0307411_10527897 3300032005 Bacteria 1003
1027 Ga0307415_100033637 3300032126 Bacteria 3329
1028 Ga0307415_100047936 3300032126 Bacteria 2879
1029 Ga0307415_100189275 3300032126 Bacteria 1622
1030 Ga0307415_100198849 3300032126 Bacteria 1588
1031 Ga0307415_100231192 3300032126 Bacteria 1489
1032 Ga0307415_100243090 3300032126 Bacteria 1457
1033 Ga0307415_100367568 3300032126 Bacteria 1217
1034 Ga0373928_0092706 3300035084 Unclassified 778
1035 Ga0373949_0031153 3300035090 Bacteria 1271
1036 Ga0373951_0019909 3300035091 Bacteria 1533
1037 Ga0373941_0018504 3300035115 Bacteria 1926
1038 Ga0373960_0051902 3300035121 Bacteria 1220
1039 Ga0373943_0013623 3300035170 Bacteria 3675
1040 Ga0373942_0043259 3300035207 Bacteria 1237
1041 Ga0373962_0018553 3300035242 Bacteria 1811
1042 Ga0373937_0364488 3300036401 Bacteria 1370
1043 Ga0373937_0640058 3300036401 Bacteria 1009
1044 Ga0395900_0046229 3300037418 Bacteria 4483
1045 Ga0395900_0599654 3300037418 Bacteria 1042
1046 Ga0395898_0106379 3300037466 Bacteria 2691
1047 Ga0395898_0642136 3300037466 Bacteria 1004
1048 Ga0395905_0004072 3300037471 Bacteria 15323
1049 Ga0395905_0119915 3300037471 Bacteria 2472
1050 Ga0395905_0156516 3300037471 Bacteria 2143
1051 Ga0436364_0520887 3300037853 Bacteria 1898
1052 Ga0395901_0097048 3300038443 Bacteria 3089
1053 Ga0395901_0489783 3300038443 Bacteria 1253
1054 Ga0242422_00182 3300038699 Bacteria 3476
1055 Ga0242420_003462 3300038996 Bacteria 2330
1056 Ga0242420_003719 3300038996 Bacteria 2267
1057 Ga0436365_0691918 3300039437 Bacteria 3633
1058 Ga0436365_0806817 3300039437 Unclassified 823
1059 Ga0436365_1501396 3300039437 Bacteria 3521
1060 Ga0439461_0020068 3300041410 Bacteria 1321
1061 Ga0451791_0501240 3300041451 Bacteria 655
1062 Ga0451807_2670355 3300041486 Bacteria 1142
1063 Ga0451837_0871631 3300041494 Bacteria 2092
1064 Ga0439448_0058938 3300042005 Bacteria 1267
1065 Ga0439432_091491 3300042006 Bacteria 915
1066 Ga0439457_028932 3300042014 Bacteria 1227
1067 Ga0439446_0099793 3300042156 Unclassified 917
1068 Ga0439446_0135398 3300042156 Unclassified 802
1069 Ga0439458_0006664 3300042157 Bacteria 2574
1070 Ga0439434_0013536 3300042435 Bacteria 2422
1071 Ga0439434_0073287 3300042435 Bacteria 1080
1072 Ga0453684_0770243 3300044712 Bacteria 1040
1073 Ga0466957_0299149 3300044842 Bacteria 1081
1074 Ga0451576_0158724 3300045051 Bacteria 2359
1075 Ga0451576_0229433 3300045051 Bacteria 1939
1076 Ga0451576_0294441 3300045051 Bacteria 1697
1077 Ga0451576_0757217 3300045051 Bacteria 1020
1078 Ga0451576_1221104 3300045051 Bacteria 785
1079 Ga0495580_0137821 3300046472 Bacteria 1692
1080 Ga0495582_0117300 3300046473 Bacteria 1498
1081 Ga0495616_0053109 3300046513 Bacteria 2015
1082 Ga0495620_0087785 3300046515 Bacteria 1251
1083 Ga0495632_0041632 3300046519 Bacteria 2307
1084 Ga0495663_0000274 3300046525 Bacteria 19756
1085 Ga0495663_0094070 3300046525 Unclassified 980
1086 Ga0495598_0007547 3300046537 Bacteria 2500
1087 Ga0495598_0090898 3300046537 Unclassified 995
1088 Ga0495621_0002629 3300046539 Bacteria 4855
1089 Ga0495621_0003735 3300046539 Bacteria 4218
1090 Ga0495621_0070869 3300046539 Bacteria 1284
1091 Ga0495621_0103148 3300046539 Bacteria 1087
1092 Ga0495656_0129904 3300046615 Bacteria 1198
1093 Ga0495668_0002148 3300046616 Bacteria 16955
1094 Ga0495600_0040284 3300046809 Bacteria 3042
1095 Ga0496100_0136608 3300048903 Bacteria 1733
1096 Ga0496101_0235575 3300048904 Unclassified 1424
1097 Ga0496101_0276305 3300048904 Bacteria 1312
1098 Ga0496102_0151335 3300048905 Bacteria 2180
1099 Ga0496102_0571855 3300048905 Bacteria 1053
1100 Ga0496104_0051718 3300048907 Bacteria 3878
1101 Ga0496104_0252089 3300048907 Bacteria 1678
1102 Ga0496105_0117679 3300048908 Bacteria 2192
1103 Ga0496106_0004259 3300048909 Bacteria 10652
1104 Ga0496106_0260551 3300048909 Bacteria 1387
1105 Ga0496108_0105590 3300048911 Bacteria 2405
1106 Ga0496108_0344147 3300048911 Bacteria 1301
1107 Ga0496108_0432980 3300048911 Bacteria 1149
1108 Ga0496109_0942717 3300048912 Bacteria 801
1109 Ga0496112_0119209 3300048915 Bacteria 2609
1110 Ga0496113_0136849 3300048916 Bacteria 1925
1111 Ga0496113_0287191 3300048916 Bacteria 1316
1112 Ga0496113_0834039 3300048916 Unclassified 731
1113 Ga0501306_023574 3300049127 Bacteria 875
1114 Ga0501293_004698 3300049516 Bacteria 1081
1115 Ga0501296_002801 3300049519 Bacteria 1843
1116 Ga0501296_004566 3300049519 Unclassified 1515
1117 Ga0501296_006143 3300049519 Bacteria 1355
1118 Ga0501298_000513 3300049521 Bacteria 5244
1119 Ga0501298_016216 3300049521 Bacteria 1348
1120 Ga0501299_024096 3300049522 Bacteria 1134
1121 Ga0501300_010486 3300049523 Bacteria 1352
1122 Ga0501302_004515 3300049525 Bacteria 848
1123 Ga0501311_007735 3300049527 Bacteria 1244
1124 Ga0501311_021860 3300049527 Unclassified 875
1125 Ga0501315_021545 3300049531 Bacteria 873
1126 Ga0501316_024908 3300049532 Unclassified 775
1127 Ga0501317_033535 3300049533 Unclassified 756
1128 Ga0501317_036502 3300049533 Bacteria 735
1129 Ga0501038_0003393 3300049574 Bacteria 14851
1130 Ga0501040_0255343 3300049576 Bacteria 1251
1131 Ga0501048_0037126 3300049582 Bacteria 3499
1132 Ga0501048_0722820 3300049582 Bacteria 715
1133 Ga0501072_0001823 3300049588 Bacteria 15857
1134 Ga0501075_0485775 3300049591 Bacteria 942
1135 Ga0501076_0488290 3300049592 Bacteria 1015
1136 Ga0501076_0865346 3300049592 Bacteria 745
1137 Ga0501208_007296 3300049655 Bacteria 1445
1138 Ga0501208_042179 3300049655 Bacteria 847
1139 Ga0501216_004975 3300049660 Bacteria 1989
1140 Ga0501216_006050 3300049660 Bacteria 1844
1141 Ga0501216_008273 3300049660 Bacteria 1634
1142 Ga0501216_009937 3300049660 Bacteria 1524
1143 Ga0501216_010607 3300049660 Bacteria 1484
1144 Ga0501217_040417 3300049661 Bacteria 1185
1145 Ga0501223_005619 3300049663 Bacteria 2626
1146 Ga0501223_011700 3300049663 Bacteria 1761
1147 Ga0501224_008996 3300049664 Bacteria 1460
1148 Ga0501227_005457 3300049665 Bacteria 2722
1149 Ga0501227_056279 3300049665 Bacteria 1001
1150 Ga0501235_077322 3300049669 Unclassified 792
1151 Ga0501240_006146 3300049673 Bacteria 1468
1152 Ga0501243_005242 3300049675 Bacteria 1949
1153 Ga0501243_018778 3300049675 Bacteria 1129
1154 Ga0501247_004187 3300049677 Bacteria 1568
1155 Ga0501248_009826 3300049678 Unclassified 840
1156 Ga0501249_015410 3300049679 Bacteria 1634
1157 Ga0501253_019120 3300049683 Bacteria 1178
1158 Ga0501259_005655 3300049688 Bacteria 1985
1159 Ga0501259_104052 3300049688 Bacteria 655
1160 Ga0501261_003132 3300049690 Bacteria 2031
1161 Ga0501221_023356 3300049704 Bacteria 1232
1162 Ga0501221_082652 3300049704 Bacteria 775
1163 Ga0501225_0011434 3300049705 Bacteria 2496
1164 Ga0501225_0014332 3300049705 Bacteria 2215
1165 Ga0501225_0017430 3300049705 Bacteria 1993
1166 Ga0501225_0028345 3300049705 Bacteria 1539
1167 Ga0501225_0042753 3300049705 Bacteria 1252
1168 Ga0501245_019653 3300049708 Bacteria 1048
1169 Ga0501079_0313918 3300049741 Bacteria 1227
1170 Ga0501241_038588 3300049758 Bacteria 920
1171 Ga0501263_005201 3300049760 Bacteria 1461
1172 Ga0501265_017106 3300049762 Bacteria 946
1173 Ga0501266_063830 3300049763 Bacteria 594
1174 Ga0501268_006345 3300049765 Bacteria 1731
1175 Ga0501273_002047 3300049770 Unclassified 2015
1176 Ga0501283_002459 3300049779 Bacteria 2407
1177 Ga0501283_006684 3300049779 Bacteria 1622
1178 Ga0501283_021503 3300049779 Bacteria 1035
1179 Ga0501212_030713 3300049851 Unclassified 865
1180 nmdc:mga05p37_1029176_c1 3300050507 Bacteria 871
1181 nmdc:mga05p37_120804_c1 3300050507 Bacteria 3218
1182 nmdc:mga05p37_1275396_c1 3300050507 Bacteria 751
1183 nmdc:mga05p37_179626_c1 3300050507 Bacteria 2576
1184 nmdc:mga05p37_209547_c1 3300050507 Bacteria 2357
1185 nmdc:mga05p37_293377_c1 3300050507 Bacteria 1935
1186 nmdc:mga05p37_616039_c1 3300050507 Bacteria 1222
1187 nmdc:mga05p37_743074_c1 3300050507 Bacteria 1083
1188 nmdc:mga05p37_75055_c1 3300050507 Bacteria 4162
1189 nmdc:mga05p37_84881_c1 3300050507 Bacteria 3901
1190 nmdc:mga09592_149740_c1 3300050508 Bacteria 2013
1191 nmdc:mga09592_244496_c1 3300050508 Bacteria 1555
1192 nmdc:mga0qj67_60903_c1 3300050509 Bacteria 2996
1193 nmdc:mga0qj67_74171_c1 3300050509 Bacteria 2719
1194 nmdc:mga06r32_128770_c1 3300050510 Bacteria 2501
1195 nmdc:mga06r32_141592_c1 3300050510 Bacteria 2381
1196 nmdc:mga06r32_318846_c1 3300050510 Bacteria 1540
1197 nmdc:mga08y16_23449_c1 3300050511 Bacteria 6520
1198 nmdc:mga08y16_235871_c1 3300050511 Bacteria 1892
1199 nmdc:mga08y16_471333_c1 3300050511 Bacteria 1278
1200 nmdc:mga08y16_5130_c1 3300050511 Bacteria 13690
1201 nmdc:mga08y16_887556_c1 3300050511 Unclassified 879
1202 nmdc:mga0n895_104188_c1 3300050512 Bacteria 2849
1203 nmdc:mga0n895_219004_c1 3300050512 Bacteria 1933
1204 nmdc:mga0n895_290239_c1 3300050512 Bacteria 1658
1205 nmdc:mga0n895_319975_c1 3300050512 Bacteria 1572
1206 nmdc:mga0n895_419241_c1 3300050512 Bacteria 1353
1207 nmdc:mga0n895_46880_c1 3300050512 Bacteria 4224
1208 nmdc:mga0n895_471901_c1 3300050512 Bacteria 1266
1209 nmdc:mga0n895_794072_c1 3300050512 Unclassified 937
1210 nmdc:mga0rr50_116_c1 3300050513 Bacteria 44002
1211 nmdc:mga0rr50_257571_c1 3300050513 Bacteria 1451
1212 nmdc:mga0rr50_311309_c1 3300050513 Bacteria 1319
1213 nmdc:mga08x19_40_c1 3300050514 Bacteria 154170
1214 nmdc:mga0a205_115501_c1 3300050515 Bacteria 2583
1215 nmdc:mga0a205_115731_c1 3300050515 Bacteria 2580
1216 nmdc:mga0a205_136018_c1 3300050515 Bacteria 2358
1217 nmdc:mga0a205_304876_c1 3300050515 Bacteria 1465
1218 nmdc:mga0a205_400880_c1 3300050515 Bacteria 1236
1219 nmdc:mga0a205_97677_c1 3300050515 Bacteria 2836
1220 Ga0495655_0005983 3300053083 Bacteria 2183
1221 Ga0500577_0010694 3300053142 Bacteria 2712
1222 Ga0500616_0000478 3300053153 Bacteria 51881
1223 Ga0501084_0202327 3300054114 Bacteria 1676

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049533 Ga0501317_036502 Ga0501317_036502_102_644 176
2 3300049763 Ga0501266_063830 Ga0501266_063830_18_584 188
3 3300005327 Ga0070658_10023722 Ga0070658_100237222 199
4 3300005331 Ga0070670_100131569 Ga0070670_1001315692 199
5 3300005355 Ga0070671_100234710 Ga0070671_1002347102 199
6 3300005539 Ga0068853_100416945 Ga0068853_1004169452 199
7 3300005616 Ga0068852_100244093 Ga0068852_1002440932 199
8 3300009093 Ga0105240_10564982 Ga0105240_105649822 199
9 3300013308 Ga0157375_10304449 Ga0157375_103044492 199
10 3300014325 Ga0163163_10266574 Ga0163163_102665742 199
11 3300025909 Ga0207705_10008577 Ga0207705_100085772 199
12 3300025931 Ga0207644_10254285 Ga0207644_102542852 199
13 3300026142 Ga0207698_10354286 Ga0207698_103542861 199
14 3300026142 Ga0207698_10854872 Ga0207698_108548721 199
15 3300005338 Ga0068868_100020110 Ga0068868_1000201107 201
16 3300005367 Ga0070667_100485117 Ga0070667_1004851171 201
17 3300005459 Ga0068867_100151879 Ga0068867_1001518792 201
18 3300005547 Ga0070693_100259089 Ga0070693_1002590892 201
19 3300006844 Ga0075428_100804450 Ga0075428_1008044502 201
20 3300009098 Ga0105245_10129737 Ga0105245_101297373 201
21 3300011119 Ga0105246_10141578 Ga0105246_101415783 201
22 3300013100 Ga0157373_10346905 Ga0157373_103469052 201
23 3300013306 Ga0163162_10125215 Ga0163162_101252152 201
24 3300013308 Ga0157375_10341776 Ga0157375_103417763 201
25 3300013308 Ga0157375_10449587 Ga0157375_104495872 201
26 3300025972 Ga0207668_10619352 Ga0207668_106193521 201
27 3300026089 Ga0207648_10194689 Ga0207648_101946892 201
28 3300031548 Ga0307408_100050839 Ga0307408_1000508393 201
29 3300031548 Ga0307408_100590877 Ga0307408_1005908772 201
30 3300031731 Ga0307405_10032374 Ga0307405_100323743 201
31 3300031731 Ga0307405_10284202 Ga0307405_102842022 201
32 3300031824 Ga0307413_10000852 Ga0307413_1000085219 201
33 3300031852 Ga0307410_10002806 Ga0307410_100028063 201
34 3300031852 Ga0307410_10393507 Ga0307410_103935072 201
35 3300031903 Ga0307407_10006362 Ga0307407_100063628 201
36 3300031995 Ga0307409_100003394 Ga0307409_1000033943 201
37 3300031995 Ga0307409_100752629 Ga0307409_1007526291 201
38 3300032002 Ga0307416_101011524 Ga0307416_1010115241 201
39 3300032004 Ga0307414_10107444 Ga0307414_101074443 201
40 3300032005 Ga0307411_10001458 Ga0307411_1000145817 201
41 3300032126 Ga0307415_100189275 Ga0307415_1001892753 201
42 3300041451 Ga0451791_0501240 Ga0451791_0501240_18_623 201
43 3300041486 Ga0451807_2670355 Ga0451807_2670355_491_1096 201
44 3300042006 Ga0439432_091491 Ga0439432_091491_70_675 201
45 3300048912 Ga0496109_0942717 Ga0496109_0942717_170_775 201
46 3300049532 Ga0501316_024908 Ga0501316_024908_31_636 201
47 3300049588 Ga0501072_0001823 Ga0501072_0001823_724_1329 201
48 3300049688 Ga0501259_104052 Ga0501259_104052_13_618 201
49 3300046537 Ga0495598_0090898 Ga0495598_0090898_136_744 202
50 3300013297 Ga0157378_10901782 Ga0157378_109017822 204
51 3300005330 Ga0070690_100110106 Ga0070690_1001101062 205
52 3300005548 Ga0070665_100291112 Ga0070665_1002911123 205
53 3300048911 Ga0496108_0432980 Ga0496108_0432980_10_627 205
54 3300050511 nmdc:mga08y16_471333_c1 nmdc:mga08y16_471333_c1_10_627 205
55 3300005543 Ga0070672_100512022 Ga0070672_1005120222 206
56 3300005844 Ga0068862_100384460 Ga0068862_1003844602 206
57 3300049531 Ga0501315_021545 Ga0501315_021545_234_854 206
58 3300049758 Ga0501241_038588 Ga0501241_038588_11_631 206
59 3300005354 Ga0070675_100500273 Ga0070675_1005002732 207
60 3300005445 Ga0070708_100000800 Ga0070708_10000080037 207
61 3300005445 Ga0070708_100785817 Ga0070708_1007858171 207
62 3300005467 Ga0070706_100584901 Ga0070706_1005849012 207
63 3300005471 Ga0070698_100033968 Ga0070698_1000339682 207
64 3300005471 Ga0070698_100067661 Ga0070698_1000676614 207
65 3300005518 Ga0070699_100000199 Ga0070699_10000019957 207
66 3300005536 Ga0070697_100045159 Ga0070697_1000451595 207
67 3300005536 Ga0070697_100074747 Ga0070697_1000747472 207
68 3300005539 Ga0068853_100026578 Ga0068853_1000265787 207
69 3300005618 Ga0068864_100718140 Ga0068864_1007181401 207
70 3300028380 Ga0268265_10437692 Ga0268265_104376922 207
71 3300045051 Ga0451576_1221104 Ga0451576_1221104_26_652 207
72 3300050513 nmdc:mga0rr50_311309_c1 nmdc:mga0rr50_311309_c1_667_1293 207
73 3300005545 Ga0070695_100126967 Ga0070695_1001269672 208
74 3300013306 Ga0163162_10104208 Ga0163162_101042084 208
75 3300026075 Ga0207708_10254258 Ga0207708_102542581 208
76 3300005539 Ga0068853_100005447 Ga0068853_1000054473 210
77 3300005546 Ga0070696_100394667 Ga0070696_1003946672 210
78 3300005616 Ga0068852_100848353 Ga0068852_1008483531 210
79 3300025913 Ga0207695_10298698 Ga0207695_102986982 210
80 3300025927 Ga0207687_10213382 Ga0207687_102133822 210
81 3300026041 Ga0207639_10041623 Ga0207639_100416235 210
82 3300005293 Ga0065715_10138456 Ga0065715_101384562 212
83 3300005293 Ga0065715_10201628 Ga0065715_102016282 212
84 3300005327 Ga0070658_10427865 Ga0070658_104278651 212
85 3300005328 Ga0070676_10167117 Ga0070676_101671172 212
86 3300005329 Ga0070683_100027144 Ga0070683_1000271448 212
87 3300005329 Ga0070683_100439712 Ga0070683_1004397121 212
88 3300005330 Ga0070690_100003597 Ga0070690_1000035975 212
89 3300005331 Ga0070670_100004316 Ga0070670_10000431620 212
90 3300005331 Ga0070670_100079818 Ga0070670_1000798184 212
91 3300005331 Ga0070670_100897052 Ga0070670_1008970521 212
92 3300005334 Ga0068869_100213205 Ga0068869_1002132052 212
93 3300005335 Ga0070666_10035485 Ga0070666_100354856 212
94 3300005336 Ga0070680_100382864 Ga0070680_1003828642 212
95 3300005336 Ga0070680_100781622 Ga0070680_1007816221 212
96 3300005338 Ga0068868_100404896 Ga0068868_1004048962 212
97 3300005338 Ga0068868_100732311 Ga0068868_1007323111 212
98 3300005340 Ga0070689_100090011 Ga0070689_1000900113 212
99 3300005344 Ga0070661_100070069 Ga0070661_1000700692 212
100 3300005344 Ga0070661_100621261 Ga0070661_1006212611 212
101 3300005353 Ga0070669_100612684 Ga0070669_1006126841 212
102 3300005353 Ga0070669_100921940 Ga0070669_1009219401 212
103 3300005354 Ga0070675_100079860 Ga0070675_1000798602 212
104 3300005354 Ga0070675_100311143 Ga0070675_1003111432 212
105 3300005355 Ga0070671_100029236 Ga0070671_1000292363 212
106 3300005355 Ga0070671_100302241 Ga0070671_1003022413 212
107 3300005356 Ga0070674_100418321 Ga0070674_1004183212 212
108 3300005364 Ga0070673_100321589 Ga0070673_1003215892 212
109 3300005365 Ga0070688_100171027 Ga0070688_1001710272 212
110 3300005366 Ga0070659_100200069 Ga0070659_1002000692 212
111 3300005366 Ga0070659_100289887 Ga0070659_1002898873 212
112 3300005367 Ga0070667_100099950 Ga0070667_1000999502 212
113 3300005367 Ga0070667_100492493 Ga0070667_1004924932 212
114 3300005444 Ga0070694_100544160 Ga0070694_1005441601 212
115 3300005455 Ga0070663_100071067 Ga0070663_1000710674 212
116 3300005455 Ga0070663_100374527 Ga0070663_1003745271 212
117 3300005457 Ga0070662_100124949 Ga0070662_1001249492 212
118 3300005457 Ga0070662_100277230 Ga0070662_1002772302 212
119 3300005458 Ga0070681_10037224 Ga0070681_100372247 212
120 3300005458 Ga0070681_10181476 Ga0070681_101814762 212
121 3300005466 Ga0070685_10022524 Ga0070685_100225244 212
122 3300005468 Ga0070707_100471145 Ga0070707_1004711452 212
123 3300005530 Ga0070679_100039011 Ga0070679_1000390112 212
124 3300005535 Ga0070684_100133389 Ga0070684_1001333892 212
125 3300005535 Ga0070684_100186391 Ga0070684_1001863912 212
126 3300005539 Ga0068853_100014358 Ga0068853_1000143588 212
127 3300005539 Ga0068853_100090773 Ga0068853_1000907732 212
128 3300005539 Ga0068853_100431723 Ga0068853_1004317232 212
129 3300005539 Ga0068853_100446230 Ga0068853_1004462301 212
130 3300005539 Ga0068853_100543374 Ga0068853_1005433741 212
131 3300005543 Ga0070672_100868032 Ga0070672_1008680321 212
132 3300005545 Ga0070695_100242958 Ga0070695_1002429582 212
133 3300005547 Ga0070693_100279348 Ga0070693_1002793481 212
134 3300005548 Ga0070665_100502206 Ga0070665_1005022062 212
135 3300005549 Ga0070704_100049741 Ga0070704_1000497413 212
136 3300005563 Ga0068855_100274349 Ga0068855_1002743493 212
137 3300005563 Ga0068855_100819917 Ga0068855_1008199172 212
138 3300005564 Ga0070664_100100737 Ga0070664_1001007374 212
139 3300005564 Ga0070664_100155525 Ga0070664_1001555253 212
140 3300005577 Ga0068857_100099813 Ga0068857_1000998134 212
141 3300005577 Ga0068857_100146475 Ga0068857_1001464752 212
142 3300005577 Ga0068857_100781173 Ga0068857_1007811731 212
143 3300005578 Ga0068854_100173245 Ga0068854_1001732453 212
144 3300005578 Ga0068854_100679899 Ga0068854_1006798991 212
145 3300005614 Ga0068856_101019346 Ga0068856_1010193461 212
146 3300005615 Ga0070702_100594953 Ga0070702_1005949531 212
147 3300005616 Ga0068852_100061961 Ga0068852_1000619614 212
148 3300005616 Ga0068852_100282193 Ga0068852_1002821932 212
149 3300005616 Ga0068852_100634410 Ga0068852_1006344102 212
150 3300005617 Ga0068859_100006290 Ga0068859_1000062903 212
151 3300005617 Ga0068859_100067027 Ga0068859_1000670274 212
152 3300005617 Ga0068859_100181361 Ga0068859_1001813612 212
153 3300005617 Ga0068859_100229006 Ga0068859_1002290062 212
154 3300005618 Ga0068864_100155649 Ga0068864_1001556493 212
155 3300005618 Ga0068864_100168188 Ga0068864_1001681883 212
156 3300005618 Ga0068864_100283724 Ga0068864_1002837242 212
157 3300005718 Ga0068866_10119034 Ga0068866_101190342 212
158 3300005719 Ga0068861_100685149 Ga0068861_1006851492 212
159 3300005834 Ga0068851_10327366 Ga0068851_103273661 212
160 3300005841 Ga0068863_100201185 Ga0068863_1002011853 212
161 3300005841 Ga0068863_100510457 Ga0068863_1005104573 212
162 3300005842 Ga0068858_100052368 Ga0068858_1000523683 212
163 3300005842 Ga0068858_100184629 Ga0068858_1001846293 212
164 3300005842 Ga0068858_100280535 Ga0068858_1002805353 212
165 3300005843 Ga0068860_100141285 Ga0068860_1001412853 212
166 3300005843 Ga0068860_100286306 Ga0068860_1002863061 212
167 3300005843 Ga0068860_100530630 Ga0068860_1005306302 212
168 3300005844 Ga0068862_100113262 Ga0068862_1001132622 212
169 3300006237 Ga0097621_100432868 Ga0097621_1004328683 212
170 3300006358 Ga0068871_100028361 Ga0068871_1000283613 212
171 3300006358 Ga0068871_100136220 Ga0068871_1001362203 212
172 3300006881 Ga0068865_100026984 Ga0068865_1000269844 212
173 3300006931 Ga0097620_100006289 Ga0097620_1000062893 212
174 3300006931 Ga0097620_100067026 Ga0097620_1000670264 212
175 3300006931 Ga0097620_100181364 Ga0097620_1001813642 212
176 3300006931 Ga0097620_100228990 Ga0097620_1002289902 212
177 3300009011 Ga0105251_10126508 Ga0105251_101265083 212
178 3300009093 Ga0105240_10048927 Ga0105240_100489273 212
179 3300009101 Ga0105247_10002354 Ga0105247_100023543 212
180 3300009101 Ga0105247_10030046 Ga0105247_100300462 212
181 3300009148 Ga0105243_10433178 Ga0105243_104331781 212
182 3300009174 Ga0105241_10005308 Ga0105241_100053082 212
183 3300009174 Ga0105241_10059797 Ga0105241_100597973 212
184 3300009176 Ga0105242_10024022 Ga0105242_100240223 212
185 3300009176 Ga0105242_10638105 Ga0105242_106381052 212
186 3300009176 Ga0105242_10893319 Ga0105242_108933192 212
187 3300009177 Ga0105248_10242012 Ga0105248_102420123 212
188 3300009177 Ga0105248_10402737 Ga0105248_104027372 212
189 3300009545 Ga0105237_10109426 Ga0105237_101094264 212
190 3300009551 Ga0105238_10310430 Ga0105238_103104303 212
191 3300009553 Ga0105249_10071455 Ga0105249_100714553 212
192 3300009553 Ga0105249_10322398 Ga0105249_103223982 212
193 3300009553 Ga0105249_10637283 Ga0105249_106372832 212
194 3300010375 Ga0105239_10219694 Ga0105239_102196943 212
195 3300013102 Ga0157371_10115682 Ga0157371_101156822 212
196 3300013104 Ga0157370_10029985 Ga0157370_100299853 212
197 3300013104 Ga0157370_10313270 Ga0157370_103132702 212
198 3300013105 Ga0157369_10065150 Ga0157369_100651504 212
199 3300013296 Ga0157374_10010383 Ga0157374_100103833 212
200 3300013296 Ga0157374_10049199 Ga0157374_100491993 212
201 3300013296 Ga0157374_10666031 Ga0157374_106660312 212
202 3300013306 Ga0163162_10131769 Ga0163162_101317694 212
203 3300013306 Ga0163162_10283531 Ga0163162_102835312 212
204 3300013307 Ga0157372_10029271 Ga0157372_100292719 212
205 3300013307 Ga0157372_10228784 Ga0157372_102287843 212
206 3300013307 Ga0157372_10471752 Ga0157372_104717523 212
207 3300013307 Ga0157372_11400383 Ga0157372_114003831 212
208 3300013308 Ga0157375_10074960 Ga0157375_100749604 212
209 3300014325 Ga0163163_10213696 Ga0163163_102136962 212
210 3300014325 Ga0163163_10349412 Ga0163163_103494122 212
211 3300014325 Ga0163163_10424801 Ga0163163_104248011 212
212 3300014325 Ga0163163_10426102 Ga0163163_104261022 212
213 3300014326 Ga0157380_10179277 Ga0157380_101792773 212
214 3300014326 Ga0157380_10275714 Ga0157380_102757142 212
215 3300014326 Ga0157380_10364415 Ga0157380_103644152 212
216 3300014326 Ga0157380_11215299 Ga0157380_112152991 212
217 3300014745 Ga0157377_10297232 Ga0157377_102972322 212
218 3300014968 Ga0157379_10028710 Ga0157379_100287108 212
219 3300014969 Ga0157376_10138777 Ga0157376_101387773 212
220 3300014969 Ga0157376_10210631 Ga0157376_102106312 212
221 3300017792 Ga0163161_10001314 Ga0163161_100013143 212
222 3300017792 Ga0163161_10007085 Ga0163161_100070853 212
223 3300025321 Ga0207656_10176250 Ga0207656_101762502 212
224 3300025893 Ga0207682_10080110 Ga0207682_100801103 212
225 3300025900 Ga0207710_10024628 Ga0207710_100246283 212
226 3300025903 Ga0207680_10235213 Ga0207680_102352133 212
227 3300025907 Ga0207645_10251011 Ga0207645_102510113 212
228 3300025908 Ga0207643_10064968 Ga0207643_100649683 212
229 3300025911 Ga0207654_10100127 Ga0207654_101001273 212
230 3300025912 Ga0207707_10005688 Ga0207707_100056886 212
231 3300025912 Ga0207707_10337279 Ga0207707_103372792 212
232 3300025913 Ga0207695_10599597 Ga0207695_105995971 212
233 3300025914 Ga0207671_10238895 Ga0207671_102388952 212
234 3300025917 Ga0207660_10367631 Ga0207660_103676312 212
235 3300025917 Ga0207660_10621486 Ga0207660_106214861 212
236 3300025918 Ga0207662_10187565 Ga0207662_101875652 212
237 3300025921 Ga0207652_10031620 Ga0207652_100316203 212
238 3300025921 Ga0207652_10212441 Ga0207652_102124412 212
239 3300025924 Ga0207694_10927363 Ga0207694_109273631 212
240 3300025925 Ga0207650_10042900 Ga0207650_100429003 212
241 3300025925 Ga0207650_10061705 Ga0207650_100617054 212
242 3300025926 Ga0207659_10135849 Ga0207659_101358493 212
243 3300025931 Ga0207644_10067486 Ga0207644_100674863 212
244 3300025931 Ga0207644_10136457 Ga0207644_101364573 212
245 3300025932 Ga0207690_10020005 Ga0207690_100200052 212
246 3300025933 Ga0207706_10013896 Ga0207706_1001389612 212
247 3300025933 Ga0207706_10151986 Ga0207706_101519863 212
248 3300025936 Ga0207670_10253092 Ga0207670_102530922 212
249 3300025937 Ga0207669_10257193 Ga0207669_102571932 212
250 3300025938 Ga0207704_10020784 Ga0207704_100207844 212
251 3300025940 Ga0207691_10072727 Ga0207691_100727271 212
252 3300025940 Ga0207691_10089118 Ga0207691_100891184 212
253 3300025942 Ga0207689_10262940 Ga0207689_102629402 212
254 3300025942 Ga0207689_10281028 Ga0207689_102810283 212
255 3300025942 Ga0207689_10560412 Ga0207689_105604121 212
256 3300025944 Ga0207661_10215670 Ga0207661_102156702 212
257 3300025944 Ga0207661_10549680 Ga0207661_105496802 212
258 3300025945 Ga0207679_10077213 Ga0207679_100772133 212
259 3300025945 Ga0207679_10134893 Ga0207679_101348931 212
260 3300025949 Ga0207667_10207795 Ga0207667_102077953 212
261 3300025960 Ga0207651_10342070 Ga0207651_103420701 212
262 3300025960 Ga0207651_10379715 Ga0207651_103797152 212
263 3300025961 Ga0207712_10058524 Ga0207712_100585244 212
264 3300025961 Ga0207712_10115427 Ga0207712_101154272 212
265 3300025961 Ga0207712_10156595 Ga0207712_101565953 212
266 3300025972 Ga0207668_10401378 Ga0207668_104013782 212
267 3300025981 Ga0207640_10171425 Ga0207640_101714253 212
268 3300025986 Ga0207658_10421860 Ga0207658_104218602 212
269 3300025986 Ga0207658_10779662 Ga0207658_107796622 212
270 3300026023 Ga0207677_10550901 Ga0207677_105509012 212
271 3300026035 Ga0207703_10043128 Ga0207703_100431282 212
272 3300026041 Ga0207639_10032541 Ga0207639_100325415 212
273 3300026041 Ga0207639_10110407 Ga0207639_101104073 212
274 3300026041 Ga0207639_10258625 Ga0207639_102586252 212
275 3300026041 Ga0207639_10413557 Ga0207639_104135571 212
276 3300026041 Ga0207639_10994639 Ga0207639_109946391 212
277 3300026067 Ga0207678_10015509 Ga0207678_100155091 212
278 3300026078 Ga0207702_11052731 Ga0207702_110527311 212
279 3300026088 Ga0207641_10011476 Ga0207641_1001147610 212
280 3300026088 Ga0207641_10244798 Ga0207641_102447982 212
281 3300026095 Ga0207676_10137435 Ga0207676_101374351 212
282 3300026095 Ga0207676_10370325 Ga0207676_103703252 212
283 3300026095 Ga0207676_10698137 Ga0207676_106981372 212
284 3300026116 Ga0207674_10054555 Ga0207674_100545554 212
285 3300026116 Ga0207674_10069293 Ga0207674_100692935 212
286 3300026118 Ga0207675_100790521 Ga0207675_1007905212 212
287 3300026121 Ga0207683_10192082 Ga0207683_101920822 212
288 3300026142 Ga0207698_10295457 Ga0207698_102954571 212
289 3300026142 Ga0207698_11323396 Ga0207698_113233961 212
290 3300027876 Ga0209974_10058096 Ga0209974_100580962 212
291 3300028380 Ga0268265_10074834 Ga0268265_100748344 212
292 3300028380 Ga0268265_10203403 Ga0268265_102034033 212
293 3300028381 Ga0268264_10040605 Ga0268264_100406054 212
294 3300028381 Ga0268264_10041856 Ga0268264_100418565 212
295 3300031730 Ga0307516_10565335 Ga0307516_105653351 212
296 3300031731 Ga0307405_10010573 Ga0307405_100105732 212
297 3300031731 Ga0307405_10025311 Ga0307405_100253114 212
298 3300031731 Ga0307405_10051623 Ga0307405_100516233 212
299 3300031731 Ga0307405_10094775 Ga0307405_100947752 212
300 3300031824 Ga0307413_10000449 Ga0307413_100004493 212
301 3300031824 Ga0307413_10005121 Ga0307413_100051214 212
302 3300031824 Ga0307413_10014279 Ga0307413_100142792 212
303 3300031824 Ga0307413_10018686 Ga0307413_100186865 212
304 3300031824 Ga0307413_10773741 Ga0307413_107737411 212
305 3300031852 Ga0307410_10009152 Ga0307410_100091528 212
306 3300031852 Ga0307410_10010917 Ga0307410_100109173 212
307 3300031852 Ga0307410_10067989 Ga0307410_100679891 212
308 3300031852 Ga0307410_10101577 Ga0307410_101015772 212
309 3300031901 Ga0307406_10011330 Ga0307406_100113305 212
310 3300031901 Ga0307406_10083282 Ga0307406_100832821 212
311 3300031901 Ga0307406_10104045 Ga0307406_101040452 212
312 3300031901 Ga0307406_10116651 Ga0307406_101166512 212
313 3300031901 Ga0307406_10198129 Ga0307406_101981292 212
314 3300031903 Ga0307407_10009813 Ga0307407_100098137 212
315 3300031903 Ga0307407_10034551 Ga0307407_100345513 212
316 3300031903 Ga0307407_10122426 Ga0307407_101224263 212
317 3300031903 Ga0307407_10134942 Ga0307407_101349422 212
318 3300031903 Ga0307407_10400841 Ga0307407_104008412 212
319 3300031911 Ga0307412_10026837 Ga0307412_100268372 212
320 3300031911 Ga0307412_10033799 Ga0307412_100337993 212
321 3300031911 Ga0307412_10107971 Ga0307412_101079712 212
322 3300031995 Ga0307409_100021033 Ga0307409_1000210332 212
323 3300031995 Ga0307409_100255887 Ga0307409_1002558872 212
324 3300031995 Ga0307409_100308528 Ga0307409_1003085283 212
325 3300031995 Ga0307409_100395748 Ga0307409_1003957482 212
326 3300031995 Ga0307409_101239819 Ga0307409_1012398191 212
327 3300032002 Ga0307416_100024716 Ga0307416_1000247164 212
328 3300032002 Ga0307416_100050635 Ga0307416_1000506353 212
329 3300032002 Ga0307416_100056621 Ga0307416_1000566214 212
330 3300032002 Ga0307416_100148701 Ga0307416_1001487011 212
331 3300032002 Ga0307416_100406196 Ga0307416_1004061962 212
332 3300032004 Ga0307414_10023210 Ga0307414_100232106 212
333 3300032004 Ga0307414_10490063 Ga0307414_104900632 212
334 3300032004 Ga0307414_10742382 Ga0307414_107423821 212
335 3300032005 Ga0307411_10134179 Ga0307411_101341792 212
336 3300032005 Ga0307411_10170276 Ga0307411_101702763 212
337 3300032005 Ga0307411_10189055 Ga0307411_101890552 212
338 3300032005 Ga0307411_10265534 Ga0307411_102655342 212
339 3300032005 Ga0307411_10301595 Ga0307411_103015951 212
340 3300032005 Ga0307411_10527897 Ga0307411_105278972 212
341 3300032126 Ga0307415_100033637 Ga0307415_1000336374 212
342 3300032126 Ga0307415_100047936 Ga0307415_1000479364 212
343 3300032126 Ga0307415_100243090 Ga0307415_1002430903 212
344 3300036401 Ga0373937_0364488 Ga0373937_0364488_406_1044 212
345 3300037418 Ga0395900_0046229 Ga0395900_0046229_631_1269 212
346 3300037471 Ga0395905_0119915 Ga0395905_0119915_996_1634 212
347 3300041494 Ga0451837_0871631 Ga0451837_0871631_889_1527 212
348 3300046539 Ga0495621_0070869 Ga0495621_0070869_548_1186 212
349 3300048904 Ga0496101_0276305 Ga0496101_0276305_314_952 212
350 3300048908 Ga0496105_0117679 Ga0496105_0117679_146_784 212
351 3300049127 Ga0501306_023574 Ga0501306_023574_197_835 212
352 3300049527 Ga0501311_007735 Ga0501311_007735_407_1045 212
353 3300049677 Ga0501247_004187 Ga0501247_004187_766_1404 212
354 3300049678 Ga0501248_009826 Ga0501248_009826_86_724 212
355 3300049705 Ga0501225_0011434 Ga0501225_0011434_1322_1960 212
356 3300049705 Ga0501225_0042753 Ga0501225_0042753_565_1203 212
357 3300049760 Ga0501263_005201 Ga0501263_005201_162_800 212
358 3300049765 Ga0501268_006345 Ga0501268_006345_725_1363 212
359 3300005441 Ga0070700_100236363 Ga0070700_1002363631 213
360 3300005985 Ga0081539_10041399 Ga0081539_100413993 213
361 3300013297 Ga0157378_10046017 Ga0157378_100460175 213
362 3300025910 Ga0207684_10093393 Ga0207684_100933934 213
363 3300025925 Ga0207650_10708151 Ga0207650_107081512 213
364 3300031852 Ga0307410_10435275 Ga0307410_104352751 213
365 3300032002 Ga0307416_100250715 Ga0307416_1002507152 213
366 3300032004 Ga0307414_10316649 Ga0307414_103166492 213
367 3300032005 Ga0307411_10149639 Ga0307411_101496393 213
368 3300035170 Ga0373943_0013623 Ga0373943_0013623_503_1156 213
369 3300046513 Ga0495616_0053109 Ga0495616_0053109_1025_1669 213
370 3300053142 Ga0500577_0010694 Ga0500577_0010694_575_1219 213
371 3300000549 LJQas_1000049 LJQas_10000493 214
372 3300003203 JGI25406J46586_10020426 JGI25406J46586_100204263 214
373 3300005330 Ga0070690_100020366 Ga0070690_1000203661 214
374 3300005441 Ga0070700_100421216 Ga0070700_1004212161 214
375 3300005985 Ga0081539_10006228 Ga0081539_1000622820 214
376 3300014326 Ga0157380_10044946 Ga0157380_100449463 214
377 3300026075 Ga0207708_10394201 Ga0207708_103942012 214
378 3300030745 Ga0316182_1044663 Ga0316182_10446632 214
379 3300031903 Ga0307407_10159319 Ga0307407_101593191 214
380 3300032005 Ga0307411_10295693 Ga0307411_102956931 214
381 3300046519 Ga0495632_0041632 Ga0495632_0041632_1178_1822 214
382 3300046616 Ga0495668_0002148 Ga0495668_0002148_15530_16177 214
383 3300005295 Ga0065707_10313852 Ga0065707_103138521 215
384 3300005331 Ga0070670_100023179 Ga0070670_1000231794 215
385 3300005334 Ga0068869_100487988 Ga0068869_1004879881 215
386 3300005354 Ga0070675_100754814 Ga0070675_1007548141 215
387 3300005364 Ga0070673_100019365 Ga0070673_1000193653 215
388 3300005459 Ga0068867_100142723 Ga0068867_1001427233 215
389 3300005543 Ga0070672_100270492 Ga0070672_1002704921 215
390 3300005841 Ga0068863_100761495 Ga0068863_1007614952 215
391 3300009177 Ga0105248_11095236 Ga0105248_110952361 215
392 3300009553 Ga0105249_10397565 Ga0105249_103975652 215
393 3300017792 Ga0163161_10131529 Ga0163161_101315291 215
394 3300021384 Ga0213876_10001455 Ga0213876_1000145524 215
395 3300025923 Ga0207681_10550509 Ga0207681_105505092 215
396 3300025925 Ga0207650_10099618 Ga0207650_100996182 215
397 3300025940 Ga0207691_10254623 Ga0207691_102546233 215
398 3300025941 Ga0207711_11064412 Ga0207711_110644121 215
399 3300025942 Ga0207689_10143300 Ga0207689_101433002 215
400 3300025960 Ga0207651_10027371 Ga0207651_100273715 215
401 3300025961 Ga0207712_10245435 Ga0207712_102454352 215
402 3300026075 Ga0207708_10086377 Ga0207708_100863773 215
403 3300026142 Ga0207698_10199680 Ga0207698_101996802 215
404 3300031852 Ga0307410_10140538 Ga0307410_101405382 215
405 3300031852 Ga0307410_10430365 Ga0307410_104303651 215
406 3300031901 Ga0307406_10039674 Ga0307406_100396744 215
407 3300032005 Ga0307411_10128261 Ga0307411_101282613 215
408 3300032005 Ga0307411_10398725 Ga0307411_103987252 215
409 3300032126 Ga0307415_100231192 Ga0307415_1002311923 215
410 3300035090 Ga0373949_0031153 Ga0373949_0031153_500_1147 215
411 3300035242 Ga0373962_0018553 Ga0373962_0018553_293_940 215
412 3300037471 Ga0395905_0004072 Ga0395905_0004072_7783_8430 215
413 3300039437 Ga0436365_1501396 Ga0436365_1501396_2245_2892 215
414 3300044842 Ga0466957_0299149 Ga0466957_0299149_59_706 215
415 3300049582 Ga0501048_0037126 Ga0501048_0037126_2187_2900 215
416 3300053153 Ga0500616_0000478 Ga0500616_0000478_50515_51162 215
417 3300002459 JGI24751J29686_10000073 JGI24751J29686_100000733 216
418 3300005290 Ga0065712_10078309 Ga0065712_100783094 216
419 3300005293 Ga0065715_10090767 Ga0065715_1009076712 216
420 3300005293 Ga0065715_10091345 Ga0065715_100913456 216
421 3300005293 Ga0065715_10462677 Ga0065715_104626771 216
422 3300005295 Ga0065707_10131928 Ga0065707_101319282 216
423 3300005328 Ga0070676_10021773 Ga0070676_100217734 216
424 3300005330 Ga0070690_100003298 Ga0070690_1000032981 216
425 3300005331 Ga0070670_100013601 Ga0070670_10001360111 216
426 3300005333 Ga0070677_10108518 Ga0070677_101085181 216
427 3300005334 Ga0068869_100062596 Ga0068869_1000625962 216
428 3300005334 Ga0068869_100090982 Ga0068869_1000909822 216
429 3300005334 Ga0068869_100103118 Ga0068869_1001031182 216
430 3300005334 Ga0068869_100330232 Ga0068869_1003302322 216
431 3300005336 Ga0070680_100004630 Ga0070680_1000046302 216
432 3300005338 Ga0068868_100141311 Ga0068868_1001413113 216
433 3300005338 Ga0068868_100151558 Ga0068868_1001515581 216
434 3300005339 Ga0070660_100836089 Ga0070660_1008360891 216
435 3300005340 Ga0070689_100132236 Ga0070689_1001322363 216
436 3300005343 Ga0070687_100001280 Ga0070687_1000012803 216
437 3300005343 Ga0070687_100005475 Ga0070687_1000054756 216
438 3300005354 Ga0070675_100015185 Ga0070675_1000151853 216
439 3300005355 Ga0070671_100003376 Ga0070671_1000033762 216
440 3300005355 Ga0070671_100043258 Ga0070671_1000432582 216
441 3300005364 Ga0070673_100115766 Ga0070673_1001157663 216
442 3300005365 Ga0070688_100025051 Ga0070688_1000250515 216
443 3300005367 Ga0070667_100074535 Ga0070667_1000745354 216
444 3300005438 Ga0070701_10408688 Ga0070701_104086881 216
445 3300005441 Ga0070700_100026521 Ga0070700_1000265212 216
446 3300005444 Ga0070694_100256124 Ga0070694_1002561242 216
447 3300005444 Ga0070694_100261540 Ga0070694_1002615402 216
448 3300005457 Ga0070662_100156967 Ga0070662_1001569672 216
449 3300005458 Ga0070681_10066843 Ga0070681_100668433 216
450 3300005459 Ga0068867_100025248 Ga0068867_1000252483 216
451 3300005459 Ga0068867_100350411 Ga0068867_1003504111 216
452 3300005466 Ga0070685_10022558 Ga0070685_100225582 216
453 3300005471 Ga0070698_100112639 Ga0070698_1001126394 216
454 3300005518 Ga0070699_100018887 Ga0070699_10001888711 216
455 3300005518 Ga0070699_100495951 Ga0070699_1004959511 216
456 3300005530 Ga0070679_100000395 Ga0070679_10000039550 216
457 3300005539 Ga0068853_100130592 Ga0068853_1001305921 216
458 3300005539 Ga0068853_100649976 Ga0068853_1006499761 216
459 3300005543 Ga0070672_100040031 Ga0070672_1000400318 216
460 3300005543 Ga0070672_100241078 Ga0070672_1002410782 216
461 3300005544 Ga0070686_100016099 Ga0070686_1000160997 216
462 3300005544 Ga0070686_100134991 Ga0070686_1001349912 216
463 3300005545 Ga0070695_100114424 Ga0070695_1001144242 216
464 3300005545 Ga0070695_100318184 Ga0070695_1003181841 216
465 3300005545 Ga0070695_100361312 Ga0070695_1003613121 216
466 3300005546 Ga0070696_100452376 Ga0070696_1004523762 216
467 3300005547 Ga0070693_100119333 Ga0070693_1001193332 216
468 3300005548 Ga0070665_100028770 Ga0070665_1000287705 216
469 3300005564 Ga0070664_100172743 Ga0070664_1001727432 216
470 3300005564 Ga0070664_100264949 Ga0070664_1002649492 216
471 3300005578 Ga0068854_100185614 Ga0068854_1001856142 216
472 3300005614 Ga0068856_100154286 Ga0068856_1001542862 216
473 3300005615 Ga0070702_100016163 Ga0070702_1000161634 216
474 3300005617 Ga0068859_100135988 Ga0068859_1001359881 216
475 3300005617 Ga0068859_100291361 Ga0068859_1002913613 216
476 3300005618 Ga0068864_100045153 Ga0068864_1000451536 216
477 3300005718 Ga0068866_10263842 Ga0068866_102638422 216
478 3300005719 Ga0068861_100023980 Ga0068861_1000239806 216
479 3300005841 Ga0068863_100049169 Ga0068863_1000491692 216
480 3300005842 Ga0068858_100047238 Ga0068858_1000472386 216
481 3300005842 Ga0068858_100079267 Ga0068858_1000792672 216
482 3300005843 Ga0068860_100109863 Ga0068860_1001098634 216
483 3300005843 Ga0068860_101066082 Ga0068860_1010660821 216
484 3300006237 Ga0097621_100012663 Ga0097621_1000126633 216
485 3300006237 Ga0097621_100159314 Ga0097621_1001593142 216
486 3300006358 Ga0068871_100049076 Ga0068871_1000490766 216
487 3300006358 Ga0068871_100058549 Ga0068871_1000585494 216
488 3300006852 Ga0075433_10015163 Ga0075433_100151632 216
489 3300006852 Ga0075433_10021535 Ga0075433_100215357 216
490 3300006881 Ga0068865_100007130 Ga0068865_1000071302 216
491 3300006881 Ga0068865_100072236 Ga0068865_1000722364 216
492 3300006931 Ga0097620_100135993 Ga0097620_1001359931 216
493 3300006931 Ga0097620_100291368 Ga0097620_1002913682 216
494 3300007076 Ga0075435_100473316 Ga0075435_1004733162 216
495 3300007076 Ga0075435_100520056 Ga0075435_1005200562 216
496 3300009011 Ga0105251_10282875 Ga0105251_102828751 216
497 3300009093 Ga0105240_10868833 Ga0105240_108688331 216
498 3300009098 Ga0105245_10135760 Ga0105245_101357602 216
499 3300009098 Ga0105245_10218321 Ga0105245_102183213 216
500 3300009147 Ga0114129_10396358 Ga0114129_103963582 216
501 3300009148 Ga0105243_10002279 Ga0105243_100022792 216
502 3300009174 Ga0105241_10182071 Ga0105241_101820712 216
503 3300009176 Ga0105242_10023865 Ga0105242_100238656 216
504 3300009176 Ga0105242_10496625 Ga0105242_104966251 216
505 3300009177 Ga0105248_10063416 Ga0105248_100634163 216
506 3300009177 Ga0105248_10804128 Ga0105248_108041282 216
507 3300009545 Ga0105237_10117393 Ga0105237_101173934 216
508 3300009553 Ga0105249_10166783 Ga0105249_101667833 216
509 3300013100 Ga0157373_10148750 Ga0157373_101487502 216
510 3300013102 Ga0157371_10288184 Ga0157371_102881842 216
511 3300013296 Ga0157374_10218071 Ga0157374_102180712 216
512 3300013296 Ga0157374_10243437 Ga0157374_102434372 216
513 3300013297 Ga0157378_10008509 Ga0157378_100085093 216
514 3300013297 Ga0157378_10009044 Ga0157378_1000904414 216
515 3300013297 Ga0157378_10131778 Ga0157378_101317783 216
516 3300013297 Ga0157378_10890043 Ga0157378_108900431 216
517 3300013306 Ga0163162_10017503 Ga0163162_1001750312 216
518 3300013307 Ga0157372_10555304 Ga0157372_105553043 216
519 3300013308 Ga0157375_10090937 Ga0157375_100909372 216
520 3300013308 Ga0157375_10530476 Ga0157375_105304761 216
521 3300014325 Ga0163163_10221046 Ga0163163_102210463 216
522 3300014325 Ga0163163_10530717 Ga0163163_105307171 216
523 3300014325 Ga0163163_10971324 Ga0163163_109713241 216
524 3300014325 Ga0163163_10992859 Ga0163163_109928591 216
525 3300014326 Ga0157380_10075491 Ga0157380_100754915 216
526 3300014745 Ga0157377_10006911 Ga0157377_100069118 216
527 3300014969 Ga0157376_10008779 Ga0157376_100087793 216
528 3300014969 Ga0157376_10132834 Ga0157376_101328344 216
529 3300017792 Ga0163161_10034538 Ga0163161_100345383 216
530 3300021384 Ga0213876_10019489 Ga0213876_100194895 216
531 3300025315 Ga0207697_10083586 Ga0207697_100835862 216
532 3300025903 Ga0207680_10109296 Ga0207680_101092962 216
533 3300025903 Ga0207680_10334785 Ga0207680_103347852 216
534 3300025907 Ga0207645_10138000 Ga0207645_101380002 216
535 3300025907 Ga0207645_10221167 Ga0207645_102211672 216
536 3300025911 Ga0207654_10247607 Ga0207654_102476071 216
537 3300025912 Ga0207707_10000097 Ga0207707_1000009794 216
538 3300025917 Ga0207660_10030363 Ga0207660_100303635 216
539 3300025918 Ga0207662_10001023 Ga0207662_1000102311 216
540 3300025918 Ga0207662_10001888 Ga0207662_100018883 216
541 3300025921 Ga0207652_10000229 Ga0207652_1000022964 216
542 3300025922 Ga0207646_10132369 Ga0207646_101323692 216
543 3300025923 Ga0207681_10090081 Ga0207681_100900812 216
544 3300025925 Ga0207650_10000143 Ga0207650_1000014396 216
545 3300025926 Ga0207659_10203799 Ga0207659_102037992 216
546 3300025927 Ga0207687_10035123 Ga0207687_100351235 216
547 3300025931 Ga0207644_10038017 Ga0207644_100380173 216
548 3300025931 Ga0207644_10348784 Ga0207644_103487842 216
549 3300025933 Ga0207706_10277830 Ga0207706_102778302 216
550 3300025934 Ga0207686_10036664 Ga0207686_100366643 216
551 3300025935 Ga0207709_10281380 Ga0207709_102813801 216
552 3300025935 Ga0207709_10703312 Ga0207709_107033121 216
553 3300025936 Ga0207670_10398701 Ga0207670_103987012 216
554 3300025937 Ga0207669_10223385 Ga0207669_102233852 216
555 3300025938 Ga0207704_10162378 Ga0207704_101623782 216
556 3300025940 Ga0207691_10005231 Ga0207691_100052313 216
557 3300025940 Ga0207691_10337521 Ga0207691_103375212 216
558 3300025941 Ga0207711_10176633 Ga0207711_101766332 216
559 3300025942 Ga0207689_10004453 Ga0207689_100044533 216
560 3300025942 Ga0207689_10405559 Ga0207689_104055592 216
561 3300025945 Ga0207679_10020056 Ga0207679_100200563 216
562 3300025945 Ga0207679_10165413 Ga0207679_101654132 216
563 3300025949 Ga0207667_10202582 Ga0207667_102025822 216
564 3300025960 Ga0207651_10152795 Ga0207651_101527952 216
565 3300025961 Ga0207712_10064684 Ga0207712_100646841 216
566 3300025972 Ga0207668_10165814 Ga0207668_101658142 216
567 3300025981 Ga0207640_10084692 Ga0207640_100846922 216
568 3300026023 Ga0207677_10814908 Ga0207677_108149082 216
569 3300026035 Ga0207703_10098716 Ga0207703_100987164 216
570 3300026041 Ga0207639_10452453 Ga0207639_104524532 216
571 3300026075 Ga0207708_10020157 Ga0207708_100201575 216
572 3300026088 Ga0207641_10804512 Ga0207641_108045121 216
573 3300026089 Ga0207648_10008477 Ga0207648_1000847718 216
574 3300026089 Ga0207648_10441019 Ga0207648_104410192 216
575 3300026089 Ga0207648_11070200 Ga0207648_110702001 216
576 3300026095 Ga0207676_10080799 Ga0207676_100807994 216
577 3300026095 Ga0207676_10104354 Ga0207676_101043543 216
578 3300026118 Ga0207675_100003424 Ga0207675_1000034243 216
579 3300026118 Ga0207675_100917274 Ga0207675_1009172742 216
580 3300026121 Ga0207683_10346421 Ga0207683_103464212 216
581 3300026142 Ga0207698_10853677 Ga0207698_108536772 216
582 3300028379 Ga0268266_10220542 Ga0268266_102205422 216
583 3300028380 Ga0268265_10063139 Ga0268265_100631392 216
584 3300028381 Ga0268264_10114653 Ga0268264_101146533 216
585 3300030742 Ga0316183_1120389 Ga0316183_11203892 216
586 3300031548 Ga0307408_100010460 Ga0307408_1000104604 216
587 3300031731 Ga0307405_10004715 Ga0307405_100047153 216
588 3300031901 Ga0307406_10196529 Ga0307406_101965292 216
589 3300031911 Ga0307412_10014128 Ga0307412_100141283 216
590 3300031995 Ga0307409_100480548 Ga0307409_1004805481 216
591 3300032002 Ga0307416_100300320 Ga0307416_1003003202 216
592 3300032004 Ga0307414_10646067 Ga0307414_106460672 216
593 3300032005 Ga0307411_10036169 Ga0307411_100361693 216
594 3300032126 Ga0307415_100198849 Ga0307415_1001988492 216
595 3300035084 Ga0373928_0092706 Ga0373928_0092706_34_684 216
596 3300036401 Ga0373937_0640058 Ga0373937_0640058_62_712 216
597 3300037418 Ga0395900_0599654 Ga0395900_0599654_378_1028 216
598 3300039437 Ga0436365_0691918 Ga0436365_0691918_2286_2939 216
599 3300046472 Ga0495580_0137821 Ga0495580_0137821_612_1274 216
600 3300046473 Ga0495582_0117300 Ga0495582_0117300_359_1021 216
601 3300048905 Ga0496102_0151335 Ga0496102_0151335_68_718 216
602 3300048907 Ga0496104_0051718 Ga0496104_0051718_543_1193 216
603 3300048907 Ga0496104_0252089 Ga0496104_0252089_986_1648 216
604 3300049519 Ga0501296_006143 Ga0501296_006143_91_741 216
605 3300049521 Ga0501298_000513 Ga0501298_000513_2886_3536 216
606 3300049592 Ga0501076_0865346 Ga0501076_0865346_23_673 216
607 3300049655 Ga0501208_042179 Ga0501208_042179_41_691 216
608 3300049660 Ga0501216_004975 Ga0501216_004975_113_763 216
609 3300049663 Ga0501223_011700 Ga0501223_011700_326_976 216
610 3300049675 Ga0501243_005242 Ga0501243_005242_949_1599 216
611 3300049690 Ga0501261_003132 Ga0501261_003132_431_1081 216
612 3300049704 Ga0501221_023356 Ga0501221_023356_307_957 216
613 3300049770 Ga0501273_002047 Ga0501273_002047_1265_1915 216
614 3300049779 Ga0501283_021503 Ga0501283_021503_319_969 216
615 3300050507 nmdc:mga05p37_293377_c1 nmdc:mga05p37_293377_c1_632_1282 216
616 3300050512 nmdc:mga0n895_471901_c1 nmdc:mga0n895_471901_c1_337_987 216
617 3300050515 nmdc:mga0a205_97677_c1 nmdc:mga0a205_97677_c1_1349_1999 216
618 3300003203 JGI25406J46586_10032380 JGI25406J46586_100323802 217
619 3300005288 Ga0065714_10136350 Ga0065714_101363502 217
620 3300005290 Ga0065712_10252082 Ga0065712_102520821 217
621 3300005295 Ga0065707_10205021 Ga0065707_102050212 217
622 3300005331 Ga0070670_100002900 Ga0070670_10000290023 217
623 3300005331 Ga0070670_100098450 Ga0070670_1000984503 217
624 3300005334 Ga0068869_100212561 Ga0068869_1002125612 217
625 3300005337 Ga0070682_100080040 Ga0070682_1000800403 217
626 3300005340 Ga0070689_100091891 Ga0070689_1000918913 217
627 3300005343 Ga0070687_100076504 Ga0070687_1000765043 217
628 3300005353 Ga0070669_100044898 Ga0070669_1000448981 217
629 3300005364 Ga0070673_100157650 Ga0070673_1001576503 217
630 3300005364 Ga0070673_100259870 Ga0070673_1002598701 217
631 3300005364 Ga0070673_100743847 Ga0070673_1007438471 217
632 3300005366 Ga0070659_100124171 Ga0070659_1001241712 217
633 3300005440 Ga0070705_100333973 Ga0070705_1003339732 217
634 3300005441 Ga0070700_100047918 Ga0070700_1000479181 217
635 3300005444 Ga0070694_100209943 Ga0070694_1002099432 217
636 3300005445 Ga0070708_100139947 Ga0070708_1001399474 217
637 3300005466 Ga0070685_10201879 Ga0070685_102018791 217
638 3300005468 Ga0070707_101048845 Ga0070707_1010488451 217
639 3300005518 Ga0070699_100183950 Ga0070699_1001839503 217
640 3300005545 Ga0070695_100204803 Ga0070695_1002048031 217
641 3300005545 Ga0070695_100274793 Ga0070695_1002747932 217
642 3300005547 Ga0070693_100226609 Ga0070693_1002266092 217
643 3300005547 Ga0070693_100289769 Ga0070693_1002897692 217
644 3300005549 Ga0070704_100206935 Ga0070704_1002069352 217
645 3300005549 Ga0070704_100600142 Ga0070704_1006001422 217
646 3300005577 Ga0068857_100282706 Ga0068857_1002827063 217
647 3300005577 Ga0068857_100481799 Ga0068857_1004817992 217
648 3300005617 Ga0068859_100062276 Ga0068859_1000622763 217
649 3300005617 Ga0068859_100677527 Ga0068859_1006775272 217
650 3300005617 Ga0068859_100677574 Ga0068859_1006775742 217
651 3300005618 Ga0068864_100286456 Ga0068864_1002864562 217
652 3300005618 Ga0068864_100782813 Ga0068864_1007828131 217
653 3300005719 Ga0068861_100108321 Ga0068861_1001083212 217
654 3300005840 Ga0068870_10316188 Ga0068870_103161881 217
655 3300005841 Ga0068863_100264555 Ga0068863_1002645553 217
656 3300005841 Ga0068863_100476481 Ga0068863_1004764812 217
657 3300005842 Ga0068858_100278856 Ga0068858_1002788562 217
658 3300005985 Ga0081539_10000395 Ga0081539_1000039550 217
659 3300005985 Ga0081539_10005021 Ga0081539_100050213 217
660 3300006358 Ga0068871_100282090 Ga0068871_1002820902 217
661 3300006846 Ga0075430_100472442 Ga0075430_1004724421 217
662 3300006852 Ga0075433_10084674 Ga0075433_100846744 217
663 3300006852 Ga0075433_10648704 Ga0075433_106487042 217
664 3300006871 Ga0075434_100065544 Ga0075434_1000655446 217
665 3300006871 Ga0075434_100506750 Ga0075434_1005067502 217
666 3300006881 Ga0068865_100396622 Ga0068865_1003966221 217
667 3300006931 Ga0097620_100062277 Ga0097620_1000622776 217
668 3300006931 Ga0097620_100677509 Ga0097620_1006775092 217
669 3300006931 Ga0097620_100677578 Ga0097620_1006775782 217
670 3300009093 Ga0105240_10634150 Ga0105240_106341501 217
671 3300009098 Ga0105245_10260765 Ga0105245_102607652 217
672 3300009147 Ga0114129_10201062 Ga0114129_102010624 217
673 3300009147 Ga0114129_10432486 Ga0114129_104324863 217
674 3300009147 Ga0114129_10713126 Ga0114129_107131262 217
675 3300009148 Ga0105243_10140096 Ga0105243_101400963 217
676 3300009148 Ga0105243_10178686 Ga0105243_101786862 217
677 3300009176 Ga0105242_10261756 Ga0105242_102617563 217
678 3300009177 Ga0105248_10239650 Ga0105248_102396503 217
679 3300009177 Ga0105248_10702410 Ga0105248_107024102 217
680 3300009177 Ga0105248_10730459 Ga0105248_107304592 217
681 3300009545 Ga0105237_10343914 Ga0105237_103439141 217
682 3300009545 Ga0105237_10807441 Ga0105237_108074412 217
683 3300009553 Ga0105249_10000118 Ga0105249_100001183 217
684 3300009553 Ga0105249_10463914 Ga0105249_104639142 217
685 3300010375 Ga0105239_10969326 Ga0105239_109693262 217
686 3300011119 Ga0105246_10237504 Ga0105246_102375042 217
687 3300013306 Ga0163162_10000059 Ga0163162_10000059107 217
688 3300013307 Ga0157372_11173470 Ga0157372_111734701 217
689 3300013308 Ga0157375_10379218 Ga0157375_103792182 217
690 3300013308 Ga0157375_10450247 Ga0157375_104502473 217
691 3300013308 Ga0157375_10569178 Ga0157375_105691782 217
692 3300014325 Ga0163163_10107898 Ga0163163_101078982 217
693 3300014326 Ga0157380_10239808 Ga0157380_102398082 217
694 3300017792 Ga0163161_10015560 Ga0163161_100155607 217
695 3300025315 Ga0207697_10061318 Ga0207697_100613182 217
696 3300025899 Ga0207642_10098002 Ga0207642_100980022 217
697 3300025903 Ga0207680_10122881 Ga0207680_101228813 217
698 3300025908 Ga0207643_10001463 Ga0207643_100014633 217
699 3300025908 Ga0207643_10104165 Ga0207643_101041653 217
700 3300025911 Ga0207654_10450308 Ga0207654_104503082 217
701 3300025913 Ga0207695_10323063 Ga0207695_103230632 217
702 3300025921 Ga0207652_10269911 Ga0207652_102699112 217
703 3300025923 Ga0207681_10049116 Ga0207681_100491163 217
704 3300025924 Ga0207694_10148212 Ga0207694_101482121 217
705 3300025925 Ga0207650_10001512 Ga0207650_1000151227 217
706 3300025925 Ga0207650_10740856 Ga0207650_107408561 217
707 3300025932 Ga0207690_10106528 Ga0207690_101065282 217
708 3300025933 Ga0207706_10174781 Ga0207706_101747812 217
709 3300025934 Ga0207686_10383447 Ga0207686_103834472 217
710 3300025934 Ga0207686_10546198 Ga0207686_105461982 217
711 3300025935 Ga0207709_10086195 Ga0207709_100861953 217
712 3300025935 Ga0207709_10289441 Ga0207709_102894412 217
713 3300025935 Ga0207709_10517171 Ga0207709_105171711 217
714 3300025936 Ga0207670_10000655 Ga0207670_1000065517 217
715 3300025937 Ga0207669_10228227 Ga0207669_102282272 217
716 3300025938 Ga0207704_10106062 Ga0207704_101060623 217
717 3300025941 Ga0207711_10155505 Ga0207711_101555053 217
718 3300025942 Ga0207689_10184719 Ga0207689_101847192 217
719 3300025942 Ga0207689_10505238 Ga0207689_105052382 217
720 3300025960 Ga0207651_10488237 Ga0207651_104882372 217
721 3300025961 Ga0207712_10241788 Ga0207712_102417883 217
722 3300025961 Ga0207712_10382062 Ga0207712_103820622 217
723 3300026041 Ga0207639_10558146 Ga0207639_105581461 217
724 3300026067 Ga0207678_10285548 Ga0207678_102855483 217
725 3300026075 Ga0207708_10064652 Ga0207708_100646522 217
726 3300026075 Ga0207708_10464661 Ga0207708_104646612 217
727 3300026088 Ga0207641_10045020 Ga0207641_100450203 217
728 3300026088 Ga0207641_10243929 Ga0207641_102439293 217
729 3300026089 Ga0207648_10155463 Ga0207648_101554633 217
730 3300026089 Ga0207648_10160284 Ga0207648_101602842 217
731 3300026095 Ga0207676_10148375 Ga0207676_101483752 217
732 3300026116 Ga0207674_10230873 Ga0207674_102308733 217
733 3300026118 Ga0207675_100064333 Ga0207675_1000643333 217
734 3300028381 Ga0268264_10132055 Ga0268264_101320552 217
735 3300028381 Ga0268264_10274175 Ga0268264_102741753 217
736 3300031456 Ga0307513_10119701 Ga0307513_101197013 217
737 3300031548 Ga0307408_100064584 Ga0307408_1000645843 217
738 3300031911 Ga0307412_10025492 Ga0307412_100254923 217
739 3300032004 Ga0307414_10010849 Ga0307414_100108493 217
740 3300032004 Ga0307414_10245849 Ga0307414_102458493 217
741 3300035115 Ga0373941_0018504 Ga0373941_0018504_621_1274 217
742 3300035121 Ga0373960_0051902 Ga0373960_0051902_464_1117 217
743 3300035207 Ga0373942_0043259 Ga0373942_0043259_506_1159 217
744 3300046539 Ga0495621_0103148 Ga0495621_0103148_50_703 217
745 3300048909 Ga0496106_0260551 Ga0496106_0260551_480_1133 217
746 3300048911 Ga0496108_0105590 Ga0496108_0105590_459_1112 217
747 3300048911 Ga0496108_0344147 Ga0496108_0344147_611_1264 217
748 3300048915 Ga0496112_0119209 Ga0496112_0119209_960_1613 217
749 3300048916 Ga0496113_0136849 Ga0496113_0136849_560_1213 217
750 3300048916 Ga0496113_0287191 Ga0496113_0287191_450_1103 217
751 3300048916 Ga0496113_0834039 Ga0496113_0834039_47_700 217
752 3300049516 Ga0501293_004698 Ga0501293_004698_394_1047 217
753 3300049519 Ga0501296_002801 Ga0501296_002801_500_1153 217
754 3300049519 Ga0501296_004566 Ga0501296_004566_146_799 217
755 3300049521 Ga0501298_016216 Ga0501298_016216_98_751 217
756 3300049522 Ga0501299_024096 Ga0501299_024096_188_841 217
757 3300049523 Ga0501300_010486 Ga0501300_010486_269_922 217
758 3300049525 Ga0501302_004515 Ga0501302_004515_85_738 217
759 3300049527 Ga0501311_021860 Ga0501311_021860_119_772 217
760 3300049574 Ga0501038_0003393 Ga0501038_0003393_5403_6056 217
761 3300049576 Ga0501040_0255343 Ga0501040_0255343_249_902 217
762 3300049582 Ga0501048_0722820 Ga0501048_0722820_47_700 217
763 3300049591 Ga0501075_0485775 Ga0501075_0485775_182_919 217
764 3300049592 Ga0501076_0488290 Ga0501076_0488290_47_784 217
765 3300049655 Ga0501208_007296 Ga0501208_007296_512_1165 217
766 3300049660 Ga0501216_006050 Ga0501216_006050_390_1043 217
767 3300049660 Ga0501216_010607 Ga0501216_010607_522_1175 217
768 3300049661 Ga0501217_040417 Ga0501217_040417_371_1024 217
769 3300049663 Ga0501223_005619 Ga0501223_005619_812_1465 217
770 3300049664 Ga0501224_008996 Ga0501224_008996_538_1191 217
771 3300049665 Ga0501227_005457 Ga0501227_005457_1553_2206 217
772 3300049669 Ga0501235_077322 Ga0501235_077322_115_768 217
773 3300049675 Ga0501243_018778 Ga0501243_018778_415_1068 217
774 3300049679 Ga0501249_015410 Ga0501249_015410_592_1245 217
775 3300049683 Ga0501253_019120 Ga0501253_019120_486_1139 217
776 3300049688 Ga0501259_005655 Ga0501259_005655_134_787 217
777 3300049704 Ga0501221_082652 Ga0501221_082652_100_753 217
778 3300049705 Ga0501225_0014332 Ga0501225_0014332_308_961 217
779 3300049705 Ga0501225_0017430 Ga0501225_0017430_1027_1680 217
780 3300049708 Ga0501245_019653 Ga0501245_019653_379_1032 217
781 3300049741 Ga0501079_0313918 Ga0501079_0313918_359_1021 217
782 3300049762 Ga0501265_017106 Ga0501265_017106_122_775 217
783 3300049779 Ga0501283_002459 Ga0501283_002459_527_1180 217
784 3300049779 Ga0501283_006684 Ga0501283_006684_515_1168 217
785 3300049851 Ga0501212_030713 Ga0501212_030713_26_679 217
786 3300050507 nmdc:mga05p37_1275396_c1 nmdc:mga05p37_1275396_c1_35_688 217
787 3300050512 nmdc:mga0n895_419241_c1 nmdc:mga0n895_419241_c1_201_854 217
788 3300050515 nmdc:mga0a205_400880_c1 nmdc:mga0a205_400880_c1_279_932 217
789 3300054114 Ga0501084_0202327 Ga0501084_0202327_676_1329 217
790 2162886007 SwRhRL2b_contig_946432 SwRhRL2b_0619.00000770 218
791 3300000532 CNAas_1000871 CNAas_10008713 218
792 3300002074 JGI24748J21848_1000039 JGI24748J21848_100003978 218
793 3300002239 JGI24034J26672_10000042 JGI24034J26672_1000004278 218
794 3300002239 JGI24034J26672_10000043 JGI24034J26672_1000004378 218
795 3300003203 JGI25406J46586_10024396 JGI25406J46586_100243962 218
796 3300005288 Ga0065714_10064424 Ga0065714_10064424223 218
797 3300005289 Ga0065704_10001318 Ga0065704_100013183 218
798 3300005289 Ga0065704_10149336 Ga0065704_101493362 218
799 3300005289 Ga0065704_10291210 Ga0065704_102912101 218
800 3300005290 Ga0065712_10000117 Ga0065712_10000117223 218
801 3300005293 Ga0065715_10122775 Ga0065715_101227752 218
802 3300005293 Ga0065715_10183377 Ga0065715_101833772 218
803 3300005295 Ga0065707_10001595 Ga0065707_100015953 218
804 3300005295 Ga0065707_10305991 Ga0065707_103059911 218
805 3300005295 Ga0065707_10401362 Ga0065707_104013621 218
806 3300005295 Ga0065707_10444701 Ga0065707_104447011 218
807 3300005328 Ga0070676_10034480 Ga0070676_100344804 218
808 3300005328 Ga0070676_10313160 Ga0070676_103131601 218
809 3300005330 Ga0070690_100064287 Ga0070690_1000642874 218
810 3300005331 Ga0070670_100267255 Ga0070670_1002672552 218
811 3300005334 Ga0068869_100020479 Ga0068869_1000204797 218
812 3300005334 Ga0068869_100060217 Ga0068869_1000602174 218
813 3300005334 Ga0068869_100501226 Ga0068869_1005012261 218
814 3300005334 Ga0068869_100617044 Ga0068869_1006170441 218
815 3300005336 Ga0070680_100009331 Ga0070680_10000933114 218
816 3300005337 Ga0070682_100000254 Ga0070682_10000025450 218
817 3300005337 Ga0070682_100193320 Ga0070682_1001933202 218
818 3300005338 Ga0068868_100206075 Ga0068868_1002060752 218
819 3300005339 Ga0070660_100158608 Ga0070660_1001586081 218
820 3300005340 Ga0070689_100172554 Ga0070689_1001725543 218
821 3300005340 Ga0070689_100206675 Ga0070689_1002066752 218
822 3300005343 Ga0070687_100051453 Ga0070687_1000514533 218
823 3300005345 Ga0070692_10013187 Ga0070692_100131876 218
824 3300005345 Ga0070692_10043003 Ga0070692_100430034 218
825 3300005354 Ga0070675_100482830 Ga0070675_1004828301 218
826 3300005355 Ga0070671_100180606 Ga0070671_1001806063 218
827 3300005356 Ga0070674_100062849 Ga0070674_1000628492 218
828 3300005364 Ga0070673_100033578 Ga0070673_1000335784 218
829 3300005366 Ga0070659_100006843 Ga0070659_10000684314 218
830 3300005366 Ga0070659_100218616 Ga0070659_1002186162 218
831 3300005406 Ga0070703_10008541 Ga0070703_100085414 218
832 3300005437 Ga0070710_10148414 Ga0070710_101484141 218
833 3300005438 Ga0070701_10032660 Ga0070701_100326603 218
834 3300005438 Ga0070701_10066767 Ga0070701_100667673 218
835 3300005440 Ga0070705_100019989 Ga0070705_1000199893 218
836 3300005440 Ga0070705_100081331 Ga0070705_1000813311 218
837 3300005440 Ga0070705_100155304 Ga0070705_1001553042 218
838 3300005440 Ga0070705_100451403 Ga0070705_1004514032 218
839 3300005441 Ga0070700_100007662 Ga0070700_1000076624 218
840 3300005441 Ga0070700_100032963 Ga0070700_1000329632 218
841 3300005441 Ga0070700_100090225 Ga0070700_1000902252 218
842 3300005441 Ga0070700_100139556 Ga0070700_1001395561 218
843 3300005441 Ga0070700_100450087 Ga0070700_1004500871 218
844 3300005444 Ga0070694_100001132 Ga0070694_1000011323 218
845 3300005444 Ga0070694_100025186 Ga0070694_1000251862 218
846 3300005444 Ga0070694_100038084 Ga0070694_1000380845 218
847 3300005444 Ga0070694_100040501 Ga0070694_1000405012 218
848 3300005444 Ga0070694_100110406 Ga0070694_1001104062 218
849 3300005444 Ga0070694_100211416 Ga0070694_1002114161 218
850 3300005444 Ga0070694_100338842 Ga0070694_1003388421 218
851 3300005444 Ga0070694_100824463 Ga0070694_1008244631 218
852 3300005445 Ga0070708_100030539 Ga0070708_1000305393 218
853 3300005445 Ga0070708_100318268 Ga0070708_1003182683 218
854 3300005445 Ga0070708_100401403 Ga0070708_1004014031 218
855 3300005445 Ga0070708_100702213 Ga0070708_1007022132 218
856 3300005445 Ga0070708_100738209 Ga0070708_1007382091 218
857 3300005457 Ga0070662_100698744 Ga0070662_1006987441 218
858 3300005458 Ga0070681_10026109 Ga0070681_100261099 218
859 3300005458 Ga0070681_10313725 Ga0070681_103137253 218
860 3300005458 Ga0070681_10675750 Ga0070681_106757501 218
861 3300005459 Ga0068867_100089965 Ga0068867_1000899653 218
862 3300005459 Ga0068867_100749125 Ga0068867_1007491251 218
863 3300005467 Ga0070706_100014378 Ga0070706_1000143782 218
864 3300005467 Ga0070706_100041097 Ga0070706_1000410976 218
865 3300005467 Ga0070706_100087123 Ga0070706_1000871231 218
866 3300005467 Ga0070706_100088897 Ga0070706_1000888973 218
867 3300005467 Ga0070706_100210047 Ga0070706_1002100472 218
868 3300005467 Ga0070706_100381991 Ga0070706_1003819912 218
869 3300005468 Ga0070707_100011823 Ga0070707_1000118233 218
870 3300005468 Ga0070707_100022361 Ga0070707_1000223613 218
871 3300005468 Ga0070707_100119489 Ga0070707_1001194894 218
872 3300005468 Ga0070707_100145294 Ga0070707_1001452944 218
873 3300005468 Ga0070707_100191556 Ga0070707_1001915563 218
874 3300005468 Ga0070707_100696456 Ga0070707_1006964562 218
875 3300005471 Ga0070698_100000084 Ga0070698_10000008481 218
876 3300005471 Ga0070698_100029543 Ga0070698_1000295434 218
877 3300005471 Ga0070698_100036446 Ga0070698_1000364464 218
878 3300005471 Ga0070698_100275736 Ga0070698_1002757363 218
879 3300005471 Ga0070698_100282083 Ga0070698_1002820832 218
880 3300005518 Ga0070699_100024447 Ga0070699_1000244478 218
881 3300005518 Ga0070699_100315730 Ga0070699_1003157301 218
882 3300005518 Ga0070699_100497649 Ga0070699_1004976492 218
883 3300005518 Ga0070699_100564873 Ga0070699_1005648732 218
884 3300005530 Ga0070679_100002779 Ga0070679_1000027797 218
885 3300005536 Ga0070697_100000690 Ga0070697_1000006902 218
886 3300005536 Ga0070697_100006353 Ga0070697_1000063533 218
887 3300005536 Ga0070697_100033839 Ga0070697_1000338393 218
888 3300005543 Ga0070672_100090602 Ga0070672_1000906022 218
889 3300005544 Ga0070686_100015416 Ga0070686_1000154162 218
890 3300005544 Ga0070686_100249980 Ga0070686_1002499802 218
891 3300005545 Ga0070695_100047332 Ga0070695_1000473323 218
892 3300005545 Ga0070695_100143470 Ga0070695_1001434702 218
893 3300005545 Ga0070695_100281100 Ga0070695_1002811002 218
894 3300005545 Ga0070695_100403474 Ga0070695_1004034742 218
895 3300005546 Ga0070696_100006539 Ga0070696_10000653912 218
896 3300005546 Ga0070696_100101240 Ga0070696_1001012402 218
897 3300005546 Ga0070696_100106168 Ga0070696_1001061682 218
898 3300005546 Ga0070696_100114455 Ga0070696_1001144553 218
899 3300005547 Ga0070693_100395491 Ga0070693_1003954911 218
900 3300005549 Ga0070704_100092069 Ga0070704_1000920693 218
901 3300005549 Ga0070704_100095102 Ga0070704_1000951022 218
902 3300005549 Ga0070704_100191235 Ga0070704_1001912352 218
903 3300005549 Ga0070704_100333761 Ga0070704_1003337613 218
904 3300005549 Ga0070704_100586013 Ga0070704_1005860131 218
905 3300005564 Ga0070664_100093079 Ga0070664_1000930794 218
906 3300005564 Ga0070664_100690997 Ga0070664_1006909972 218
907 3300005577 Ga0068857_100005330 Ga0068857_1000053303 218
908 3300005577 Ga0068857_100438832 Ga0068857_1004388322 218
909 3300005578 Ga0068854_100108284 Ga0068854_1001082842 218
910 3300005578 Ga0068854_100126375 Ga0068854_1001263752 218
911 3300005615 Ga0070702_100083258 Ga0070702_1000832583 218
912 3300005615 Ga0070702_100563566 Ga0070702_1005635661 218
913 3300005616 Ga0068852_100477208 Ga0068852_1004772082 218
914 3300005616 Ga0068852_100991423 Ga0068852_1009914231 218
915 3300005617 Ga0068859_100204530 Ga0068859_1002045303 218
916 3300005617 Ga0068859_100406466 Ga0068859_1004064663 218
917 3300005617 Ga0068859_100522896 Ga0068859_1005228962 218
918 3300005618 Ga0068864_100122312 Ga0068864_1001223122 218
919 3300005618 Ga0068864_100221321 Ga0068864_1002213212 218
920 3300005618 Ga0068864_100423811 Ga0068864_1004238111 218
921 3300005618 Ga0068864_100668582 Ga0068864_1006685822 218
922 3300005618 Ga0068864_100729372 Ga0068864_1007293721 218
923 3300005618 Ga0068864_100765915 Ga0068864_1007659152 218
924 3300005718 Ga0068866_10000684 Ga0068866_1000068416 218
925 3300005719 Ga0068861_100012289 Ga0068861_1000122893 218
926 3300005719 Ga0068861_100042290 Ga0068861_1000422905 218
927 3300005719 Ga0068861_100263934 Ga0068861_1002639343 218
928 3300005719 Ga0068861_100511107 Ga0068861_1005111072 218
929 3300005719 Ga0068861_100650667 Ga0068861_1006506671 218
930 3300005834 Ga0068851_10022997 Ga0068851_100229972 218
931 3300005840 Ga0068870_10012226 Ga0068870_100122264 218
932 3300005840 Ga0068870_10194235 Ga0068870_101942352 218
933 3300005841 Ga0068863_100215640 Ga0068863_1002156402 218
934 3300005841 Ga0068863_100368941 Ga0068863_1003689412 218
935 3300005841 Ga0068863_100460793 Ga0068863_1004607932 218
936 3300005842 Ga0068858_100001829 Ga0068858_1000018293 218
937 3300005842 Ga0068858_100023347 Ga0068858_1000233477 218
938 3300005842 Ga0068858_100141300 Ga0068858_1001413003 218
939 3300005842 Ga0068858_100356345 Ga0068858_1003563452 218
940 3300005843 Ga0068860_100240862 Ga0068860_1002408623 218
941 3300005843 Ga0068860_100615243 Ga0068860_1006152432 218
942 3300005844 Ga0068862_100053366 Ga0068862_1000533662 218
943 3300005844 Ga0068862_100058564 Ga0068862_1000585644 218
944 3300005985 Ga0081539_10000660 Ga0081539_100006603 218
945 3300005985 Ga0081539_10116699 Ga0081539_101166992 218
946 3300006163 Ga0070715_10000038 Ga0070715_1000003876 218
947 3300006173 Ga0070716_100000006 Ga0070716_100000006252 218
948 3300006173 Ga0070716_100067054 Ga0070716_1000670541 218
949 3300006173 Ga0070716_100251189 Ga0070716_1002511892 218
950 3300006237 Ga0097621_100145217 Ga0097621_1001452173 218
951 3300006358 Ga0068871_100060888 Ga0068871_1000608884 218
952 3300006846 Ga0075430_100146906 Ga0075430_1001469063 218
953 3300006846 Ga0075430_100173419 Ga0075430_1001734193 218
954 3300006852 Ga0075433_10090942 Ga0075433_100909424 218
955 3300006852 Ga0075433_10288832 Ga0075433_102888322 218
956 3300006871 Ga0075434_100171653 Ga0075434_1001716532 218
957 3300006871 Ga0075434_100181865 Ga0075434_1001818654 218
958 3300006871 Ga0075434_100202941 Ga0075434_1002029413 218
959 3300006880 Ga0075429_100087817 Ga0075429_1000878173 218
960 3300006880 Ga0075429_100263245 Ga0075429_1002632452 218
961 3300006880 Ga0075429_100555821 Ga0075429_1005558212 218
962 3300006880 Ga0075429_100608311 Ga0075429_1006083112 218
963 3300006881 Ga0068865_100088290 Ga0068865_1000882903 218
964 3300006914 Ga0075436_100038627 Ga0075436_1000386274 218
965 3300006914 Ga0075436_100168772 Ga0075436_1001687722 218
966 3300006914 Ga0075436_100274138 Ga0075436_1002741382 218
967 3300006931 Ga0097620_100108345 Ga0097620_1001083454 218
968 3300006931 Ga0097620_100204540 Ga0097620_1002045402 218
969 3300006931 Ga0097620_100406500 Ga0097620_1004065001 218
970 3300006931 Ga0097620_100522937 Ga0097620_1005229372 218
971 3300006931 Ga0097620_100974804 Ga0097620_1009748041 218
972 3300007076 Ga0075435_100006806 Ga0075435_1000068063 218
973 3300007265 Ga0099794_10006344 Ga0099794_100063443 218
974 3300007265 Ga0099794_10272141 Ga0099794_102721411 218
975 3300007788 Ga0099795_10194472 Ga0099795_101944721 218
976 3300009094 Ga0111539_10000296 Ga0111539_1000029637 218
977 3300009094 Ga0111539_10005702 Ga0111539_100057023 218
978 3300009094 Ga0111539_10062111 Ga0111539_100621113 218
979 3300009094 Ga0111539_10381266 Ga0111539_103812661 218
980 3300009094 Ga0111539_10523149 Ga0111539_105231492 218
981 3300009098 Ga0105245_10556313 Ga0105245_105563132 218
982 3300009101 Ga0105247_10000052 Ga0105247_10000052146 218
983 3300009147 Ga0114129_10006921 Ga0114129_100069213 218
984 3300009147 Ga0114129_10010378 Ga0114129_1001037823 218
985 3300009147 Ga0114129_10051992 Ga0114129_100519924 218
986 3300009147 Ga0114129_10056168 Ga0114129_100561683 218
987 3300009147 Ga0114129_10157829 Ga0114129_101578293 218
988 3300009147 Ga0114129_10208551 Ga0114129_102085512 218
989 3300009147 Ga0114129_10219335 Ga0114129_102193353 218
990 3300009147 Ga0114129_10621872 Ga0114129_106218722 218
991 3300009147 Ga0114129_10638507 Ga0114129_106385072 218
992 3300009147 Ga0114129_11045002 Ga0114129_110450022 218
993 3300009148 Ga0105243_10000777 Ga0105243_1000077745 218
994 3300009148 Ga0105243_10017989 Ga0105243_100179898 218
995 3300009148 Ga0105243_10345288 Ga0105243_103452881 218
996 3300009148 Ga0105243_10426206 Ga0105243_104262062 218
997 3300009148 Ga0105243_10749748 Ga0105243_107497482 218
998 3300009176 Ga0105242_10003416 Ga0105242_1000341620 218
999 3300009176 Ga0105242_10375667 Ga0105242_103756671 218
1000 3300009177 Ga0105248_10131100 Ga0105248_101311003 218
1001 3300009177 Ga0105248_10142812 Ga0105248_101428122 218
1002 3300009177 Ga0105248_10367558 Ga0105248_103675583 218
1003 3300009177 Ga0105248_10531913 Ga0105248_105319132 218
1004 3300009545 Ga0105237_10015988 Ga0105237_1001598814 218
1005 3300009545 Ga0105237_10734699 Ga0105237_107346991 218
1006 3300009551 Ga0105238_10097349 Ga0105238_100973492 218
1007 3300009553 Ga0105249_10007338 Ga0105249_1000733816 218
1008 3300009553 Ga0105249_10171374 Ga0105249_101713742 218
1009 3300009553 Ga0105249_10874089 Ga0105249_108740892 218
1010 3300010159 Ga0099796_10054637 Ga0099796_100546372 218
1011 3300010375 Ga0105239_10074765 Ga0105239_100747653 218
1012 3300011119 Ga0105246_10535390 Ga0105246_105353902 218
1013 3300013100 Ga0157373_10049467 Ga0157373_100494674 218
1014 3300013102 Ga0157371_10353787 Ga0157371_103537872 218
1015 3300013297 Ga0157378_10006521 Ga0157378_100065212 218
1016 3300013297 Ga0157378_10009557 Ga0157378_1000955714 218
1017 3300013297 Ga0157378_10023296 Ga0157378_100232963 218
1018 3300013297 Ga0157378_10143743 Ga0157378_101437433 218
1019 3300013297 Ga0157378_10146714 Ga0157378_101467143 218
1020 3300013297 Ga0157378_10738858 Ga0157378_107388582 218
1021 3300013306 Ga0163162_10097605 Ga0163162_100976053 218
1022 3300013306 Ga0163162_10122647 Ga0163162_101226473 218
1023 3300013306 Ga0163162_10536737 Ga0163162_105367373 218
1024 3300013307 Ga0157372_10028946 Ga0157372_1002894611 218
1025 3300013307 Ga0157372_10382411 Ga0157372_103824112 218
1026 3300013308 Ga0157375_10060122 Ga0157375_100601226 218
1027 3300013308 Ga0157375_10141175 Ga0157375_101411753 218
1028 3300013308 Ga0157375_10241617 Ga0157375_102416172 218
1029 3300013308 Ga0157375_10617410 Ga0157375_106174101 218
1030 3300014325 Ga0163163_10034085 Ga0163163_100340852 218
1031 3300014325 Ga0163163_10130260 Ga0163163_101302603 218
1032 3300014325 Ga0163163_10230231 Ga0163163_102302312 218
1033 3300014325 Ga0163163_10366927 Ga0163163_103669273 218
1034 3300014325 Ga0163163_10546111 Ga0163163_105461111 218
1035 3300014326 Ga0157380_10000784 Ga0157380_100007849 218
1036 3300014326 Ga0157380_10020962 Ga0157380_100209623 218
1037 3300014326 Ga0157380_10141550 Ga0157380_101415504 218
1038 3300014326 Ga0157380_10236319 Ga0157380_102363192 218
1039 3300014745 Ga0157377_10158730 Ga0157377_101587302 218
1040 3300014745 Ga0157377_10364426 Ga0157377_103644262 218
1041 3300017792 Ga0163161_10362494 Ga0163161_103624941 218
1042 3300025223 Ga0207672_1000732 Ga0207672_10007323 218
1043 3300025321 Ga0207656_10004238 Ga0207656_100042383 218
1044 3300025321 Ga0207656_10111037 Ga0207656_101110372 218
1045 3300025885 Ga0207653_10010210 Ga0207653_100102103 218
1046 3300025885 Ga0207653_10021838 Ga0207653_100218383 218
1047 3300025885 Ga0207653_10023747 Ga0207653_100237472 218
1048 3300025900 Ga0207710_10000004 Ga0207710_10000004360 218
1049 3300025901 Ga0207688_10039861 Ga0207688_100398613 218
1050 3300025905 Ga0207685_10000051 Ga0207685_1000005152 218
1051 3300025907 Ga0207645_10019493 Ga0207645_100194934 218
1052 3300025907 Ga0207645_10040599 Ga0207645_100405993 218
1053 3300025907 Ga0207645_10225916 Ga0207645_102259162 218
1054 3300025908 Ga0207643_10088569 Ga0207643_100885693 218
1055 3300025908 Ga0207643_10119099 Ga0207643_101190991 218
1056 3300025910 Ga0207684_10001576 Ga0207684_1000157639 218
1057 3300025910 Ga0207684_10009774 Ga0207684_100097742 218
1058 3300025910 Ga0207684_10028709 Ga0207684_100287097 218
1059 3300025910 Ga0207684_10032500 Ga0207684_100325003 218
1060 3300025910 Ga0207684_10356292 Ga0207684_103562922 218
1061 3300025912 Ga0207707_10028834 Ga0207707_100288349 218
1062 3300025912 Ga0207707_10041693 Ga0207707_100416936 218
1063 3300025912 Ga0207707_10521294 Ga0207707_105212942 218
1064 3300025914 Ga0207671_10019270 Ga0207671_100192703 218
1065 3300025917 Ga0207660_10119403 Ga0207660_101194033 218
1066 3300025918 Ga0207662_10057188 Ga0207662_100571882 218
1067 3300025918 Ga0207662_10222627 Ga0207662_102226272 218
1068 3300025920 Ga0207649_10522753 Ga0207649_105227531 218
1069 3300025921 Ga0207652_10009158 Ga0207652_100091589 218
1070 3300025922 Ga0207646_10002486 Ga0207646_1000248634 218
1071 3300025922 Ga0207646_10044831 Ga0207646_100448313 218
1072 3300025922 Ga0207646_10101585 Ga0207646_101015854 218
1073 3300025922 Ga0207646_10108498 Ga0207646_101084983 218
1074 3300025922 Ga0207646_10158539 Ga0207646_101585392 218
1075 3300025922 Ga0207646_10241551 Ga0207646_102415512 218
1076 3300025922 Ga0207646_10361949 Ga0207646_103619491 218
1077 3300025923 Ga0207681_10012129 Ga0207681_100121298 218
1078 3300025923 Ga0207681_10114400 Ga0207681_101144003 218
1079 3300025925 Ga0207650_10363105 Ga0207650_103631052 218
1080 3300025926 Ga0207659_10699857 Ga0207659_106998571 218
1081 3300025931 Ga0207644_10000414 Ga0207644_100004143 218
1082 3300025931 Ga0207644_10375512 Ga0207644_103755121 218
1083 3300025932 Ga0207690_10087154 Ga0207690_100871543 218
1084 3300025932 Ga0207690_10463740 Ga0207690_104637401 218
1085 3300025934 Ga0207686_10000005 Ga0207686_100000053 218
1086 3300025934 Ga0207686_10239182 Ga0207686_102391823 218
1087 3300025935 Ga0207709_10000133 Ga0207709_100001333 218
1088 3300025935 Ga0207709_10009116 Ga0207709_100091167 218
1089 3300025935 Ga0207709_10009548 Ga0207709_100095487 218
1090 3300025936 Ga0207670_10554362 Ga0207670_105543621 218
1091 3300025938 Ga0207704_10069628 Ga0207704_100696282 218
1092 3300025939 Ga0207665_10000005 Ga0207665_10000005177 218
1093 3300025939 Ga0207665_10064327 Ga0207665_100643273 218
1094 3300025940 Ga0207691_10095004 Ga0207691_100950044 218
1095 3300025941 Ga0207711_10047901 Ga0207711_100479012 218
1096 3300025941 Ga0207711_10052587 Ga0207711_100525874 218
1097 3300025941 Ga0207711_10184558 Ga0207711_101845582 218
1098 3300025941 Ga0207711_10256357 Ga0207711_102563573 218
1099 3300025941 Ga0207711_10378836 Ga0207711_103788362 218
1100 3300025942 Ga0207689_10045310 Ga0207689_100453103 218
1101 3300025945 Ga0207679_10070497 Ga0207679_100704974 218
1102 3300025945 Ga0207679_10655455 Ga0207679_106554552 218
1103 3300025945 Ga0207679_10690212 Ga0207679_106902121 218
1104 3300025960 Ga0207651_10003298 Ga0207651_100032982 218
1105 3300025960 Ga0207651_10794280 Ga0207651_107942801 218
1106 3300025961 Ga0207712_10036610 Ga0207712_100366103 218
1107 3300025961 Ga0207712_10397836 Ga0207712_103978362 218
1108 3300025961 Ga0207712_10553957 Ga0207712_105539572 218
1109 3300025961 Ga0207712_10867345 Ga0207712_108673452 218
1110 3300025981 Ga0207640_10124332 Ga0207640_101243322 218
1111 3300025981 Ga0207640_10185038 Ga0207640_101850381 218
1112 3300026023 Ga0207677_10373005 Ga0207677_103730052 218
1113 3300026035 Ga0207703_10001442 Ga0207703_100014423 218
1114 3300026035 Ga0207703_10024704 Ga0207703_100247047 218
1115 3300026035 Ga0207703_10272214 Ga0207703_102722142 218
1116 3300026035 Ga0207703_10519553 Ga0207703_105195531 218
1117 3300026041 Ga0207639_10148801 Ga0207639_101488013 218
1118 3300026075 Ga0207708_10000254 Ga0207708_1000025456 218
1119 3300026075 Ga0207708_10062762 Ga0207708_100627621 218
1120 3300026075 Ga0207708_10067820 Ga0207708_100678203 218
1121 3300026075 Ga0207708_10159054 Ga0207708_101590542 218
1122 3300026088 Ga0207641_10326602 Ga0207641_103266023 218
1123 3300026088 Ga0207641_10701885 Ga0207641_107018852 218
1124 3300026089 Ga0207648_10140765 Ga0207648_101407652 218
1125 3300026089 Ga0207648_10145661 Ga0207648_101456612 218
1126 3300026095 Ga0207676_10008932 Ga0207676_100089324 218
1127 3300026116 Ga0207674_10000129 Ga0207674_1000012992 218
1128 3300026116 Ga0207674_10179061 Ga0207674_101790612 218
1129 3300026118 Ga0207675_100001227 Ga0207675_10000122740 218
1130 3300026118 Ga0207675_100061965 Ga0207675_1000619653 218
1131 3300026118 Ga0207675_100123212 Ga0207675_1001232124 218
1132 3300026118 Ga0207675_100303132 Ga0207675_1003031322 218
1133 3300026118 Ga0207675_100397682 Ga0207675_1003976822 218
1134 3300026142 Ga0207698_10150592 Ga0207698_101505922 218
1135 3300026142 Ga0207698_10774193 Ga0207698_107741931 218
1136 3300027671 Ga0209588_1010605 Ga0209588_10106054 218
1137 3300027907 Ga0207428_10013155 Ga0207428_100131553 218
1138 3300027907 Ga0207428_10022575 Ga0207428_100225756 218
1139 3300028380 Ga0268265_10048879 Ga0268265_100488792 218
1140 3300028380 Ga0268265_10347838 Ga0268265_103478383 218
1141 3300028381 Ga0268264_10612057 Ga0268264_106120571 218
1142 3300031548 Ga0307408_100086200 Ga0307408_1000862003 218
1143 3300031548 Ga0307408_100110354 Ga0307408_1001103542 218
1144 3300031824 Ga0307413_10800737 Ga0307413_108007371 218
1145 3300031901 Ga0307406_10343263 Ga0307406_103432632 218
1146 3300031911 Ga0307412_10172990 Ga0307412_101729902 218
1147 3300032002 Ga0307416_100319753 Ga0307416_1003197532 218
1148 3300032126 Ga0307415_100367568 Ga0307415_1003675682 218
1149 3300035091 Ga0373951_0019909 Ga0373951_0019909_154_810 218
1150 3300037466 Ga0395898_0106379 Ga0395898_0106379_233_898 218
1151 3300037466 Ga0395898_0642136 Ga0395898_0642136_251_919 218
1152 3300037471 Ga0395905_0156516 Ga0395905_0156516_345_1004 218
1153 3300037853 Ga0436364_0520887 Ga0436364_0520887_701_1357 218
1154 3300038443 Ga0395901_0097048 Ga0395901_0097048_859_1515 218
1155 3300038443 Ga0395901_0489783 Ga0395901_0489783_371_1030 218
1156 3300038699 Ga0242422_00182 Ga0242422_00182_1247_1918 218
1157 3300038996 Ga0242420_003462 Ga0242420_003462_12_668 218
1158 3300038996 Ga0242420_003719 Ga0242420_003719_1165_1836 218
1159 3300039437 Ga0436365_0806817 Ga0436365_0806817_23_679 218
1160 3300041410 Ga0439461_0020068 Ga0439461_0020068_184_849 218
1161 3300042005 Ga0439448_0058938 Ga0439448_0058938_442_1098 218
1162 3300042014 Ga0439457_028932 Ga0439457_028932_259_921 218
1163 3300042156 Ga0439446_0099793 Ga0439446_0099793_22_684 218
1164 3300042156 Ga0439446_0135398 Ga0439446_0135398_25_690 218
1165 3300042157 Ga0439458_0006664 Ga0439458_0006664_1582_2238 218
1166 3300042435 Ga0439434_0013536 Ga0439434_0013536_1311_1976 218
1167 3300042435 Ga0439434_0073287 Ga0439434_0073287_17_676 218
1168 3300044712 Ga0453684_0770243 Ga0453684_0770243_157_813 218
1169 3300045051 Ga0451576_0158724 Ga0451576_0158724_941_1597 218
1170 3300045051 Ga0451576_0229433 Ga0451576_0229433_477_1133 218
1171 3300045051 Ga0451576_0294441 Ga0451576_0294441_803_1474 218
1172 3300045051 Ga0451576_0757217 Ga0451576_0757217_176_913 218
1173 3300046515 Ga0495620_0087785 Ga0495620_0087785_193_849 218
1174 3300046525 Ga0495663_0000274 Ga0495663_0000274_1136_1792 218
1175 3300046525 Ga0495663_0094070 Ga0495663_0094070_300_956 218
1176 3300046537 Ga0495598_0007547 Ga0495598_0007547_1020_1679 218
1177 3300046539 Ga0495621_0002629 Ga0495621_0002629_1313_1999 218
1178 3300046539 Ga0495621_0003735 Ga0495621_0003735_1344_2000 218
1179 3300046615 Ga0495656_0129904 Ga0495656_0129904_262_921 218
1180 3300046809 Ga0495600_0040284 Ga0495600_0040284_662_1318 218
1181 3300048903 Ga0496100_0136608 Ga0496100_0136608_513_1169 218
1182 3300048904 Ga0496101_0235575 Ga0496101_0235575_586_1242 218
1183 3300048905 Ga0496102_0571855 Ga0496102_0571855_142_810 218
1184 3300048909 Ga0496106_0004259 Ga0496106_0004259_8707_9363 218
1185 3300049533 Ga0501317_033535 Ga0501317_033535_60_728 218
1186 3300049660 Ga0501216_008273 Ga0501216_008273_951_1619 218
1187 3300049660 Ga0501216_009937 Ga0501216_009937_634_1290 218
1188 3300049665 Ga0501227_056279 Ga0501227_056279_184_840 218
1189 3300049673 Ga0501240_006146 Ga0501240_006146_23_679 218
1190 3300049705 Ga0501225_0028345 Ga0501225_0028345_401_1057 218
1191 3300050507 nmdc:mga05p37_1029176_c1 nmdc:mga05p37_1029176_c1_104_760 218
1192 3300050507 nmdc:mga05p37_120804_c1 nmdc:mga05p37_120804_c1_2260_2928 218
1193 3300050507 nmdc:mga05p37_179626_c1 nmdc:mga05p37_179626_c1_559_1221 218
1194 3300050507 nmdc:mga05p37_209547_c1 nmdc:mga05p37_209547_c1_126_782 218
1195 3300050507 nmdc:mga05p37_616039_c1 nmdc:mga05p37_616039_c1_88_744 218
1196 3300050507 nmdc:mga05p37_743074_c1 nmdc:mga05p37_743074_c1_149_805 218
1197 3300050507 nmdc:mga05p37_75055_c1 nmdc:mga05p37_75055_c1_1167_1835 218
1198 3300050507 nmdc:mga05p37_84881_c1 nmdc:mga05p37_84881_c1_592_1251 218
1199 3300050508 nmdc:mga09592_149740_c1 nmdc:mga09592_149740_c1_1293_1949 218
1200 3300050508 nmdc:mga09592_244496_c1 nmdc:mga09592_244496_c1_430_1104 218
1201 3300050509 nmdc:mga0qj67_60903_c1 nmdc:mga0qj67_60903_c1_2071_2745 218
1202 3300050509 nmdc:mga0qj67_74171_c1 nmdc:mga0qj67_74171_c1_1998_2654 218
1203 3300050510 nmdc:mga06r32_128770_c1 nmdc:mga06r32_128770_c1_410_1066 218
1204 3300050510 nmdc:mga06r32_141592_c1 nmdc:mga06r32_141592_c1_447_1109 218
1205 3300050510 nmdc:mga06r32_318846_c1 nmdc:mga06r32_318846_c1_686_1360 218
1206 3300050511 nmdc:mga08y16_23449_c1 nmdc:mga08y16_23449_c1_4674_5330 218
1207 3300050511 nmdc:mga08y16_235871_c1 nmdc:mga08y16_235871_c1_737_1396 218
1208 3300050511 nmdc:mga08y16_5130_c1 nmdc:mga08y16_5130_c1_12042_12701 218
1209 3300050511 nmdc:mga08y16_887556_c1 nmdc:mga08y16_887556_c1_184_846 218
1210 3300050512 nmdc:mga0n895_104188_c1 nmdc:mga0n895_104188_c1_69_728 218
1211 3300050512 nmdc:mga0n895_219004_c1 nmdc:mga0n895_219004_c1_675_1331 218
1212 3300050512 nmdc:mga0n895_290239_c1 nmdc:mga0n895_290239_c1_23_682 218
1213 3300050512 nmdc:mga0n895_319975_c1 nmdc:mga0n895_319975_c1_122_778 218
1214 3300050512 nmdc:mga0n895_46880_c1 nmdc:mga0n895_46880_c1_113_769 218
1215 3300050512 nmdc:mga0n895_794072_c1 nmdc:mga0n895_794072_c1_256_927 218
1216 3300050513 nmdc:mga0rr50_116_c1 nmdc:mga0rr50_116_c1_1357_2016 218
1217 3300050513 nmdc:mga0rr50_257571_c1 nmdc:mga0rr50_257571_c1_274_936 218
1218 3300050514 nmdc:mga08x19_40_c1 nmdc:mga08x19_40_c1_153301_153960 218
1219 3300050515 nmdc:mga0a205_115501_c1 nmdc:mga0a205_115501_c1_497_1153 218
1220 3300050515 nmdc:mga0a205_115731_c1 nmdc:mga0a205_115731_c1_1670_2326 218
1221 3300050515 nmdc:mga0a205_136018_c1 nmdc:mga0a205_136018_c1_162_818 218
1222 3300050515 nmdc:mga0a205_304876_c1 nmdc:mga0a205_304876_c1_413_1069 218
1223 3300053083 Ga0495655_0005983 Ga0495655_0005983_1027_1689 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

118

249

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8514 4 215
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8508 1 215
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8413 1 215
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8368 4 215
6hix-assembly1.cif.gz_AE cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8292 5 212
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8862 4 217 2.40.30.10
af_Q54NG9_128_410_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.7361 8 29 3.30.360.10
af_A0A0P0XT53_109_185_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6818 4 29 2.40.50.140
af_A0A1D8PDU3_27_145_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6788 3 29 2.40.50.140
af_O62484_193_308_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6719 7 29 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A1F6SN05-F1-model_v4 50S ribosomal protein L3 0.7273 4 213 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F8F7Q6-F1-model_v4 50S ribosomal protein L3 0.7246 4 213 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A847XKF5-F1-model_v4 Large ribosomal subunit protein uL3 0.7201 4 215 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1F6SN05-F1-model_v4 50S ribosomal protein L3 0.7161 4 213 GO:0003735
GO:0006412
GO:0022625
AF-A0A357F218-F1-model_v4 Large ribosomal subunit protein uL3 0.7139 1 213 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
69.13 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map