F491775

General Info

Members Datasets Scaffolds Average Seq Length
1214 281 2428 113

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0907619|Ga0501084_0907619_145_555
Length 136
Sequence VLASPPNRHPGGFPVEVDREEASMGTWRLYTGNDGQSHVEKIDWEKQADWTKGIPTTDIKFGHWPVGRFMDWHPAPRRQFVIILSGQLEIGCGDGSKHLFGPGDARLVEDTTGKGHTTRQVGPEPCVTATIPLANQ

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
187 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
208 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
212 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
234 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.58
Rhizosphere 98.76
Stem 0
Stem Tuber 0
Unclassified 18.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0907619 3300054114 Bacteria 741
2 JGI24741J21665_1023992 3300001915 Unclassified 939
3 JGI25406J46586_10015974 3300003203 Bacteria 3146
4 JGI25406J46586_10065332 3300003203 Bacteria 1160
5 JGI25406J46586_10081419 3300003203 Unclassified 992
6 JGI25406J46586_10142270 3300003203 Unclassified 701
7 JGI26128J50194_1010636 3300003347 Unclassified 579
8 JGI26145J50221_1002117 3300003371 Bacteria 1561
9 JGI25405J52794_10004720 3300003911 Bacteria 2440
10 Ga0058859_10037472 3300004798 Unclassified 2053
11 Ga0058859_10768951 3300004798 Unclassified 527
12 Ga0058859_11391544 3300004798 Bacteria 740
13 Ga0058859_11732724 3300004798 Bacteria 1506
14 Ga0058861_10477873 3300004800 Unclassified 521
15 Ga0058860_10876418 3300004801 Unclassified 670
16 Ga0058860_11679250 3300004801 Bacteria 572
17 Ga0058860_12106589 3300004801 Unclassified 2326
18 Ga0058860_12170436 3300004801 Bacteria 3063
19 Ga0058862_12377746 3300004803 Unclassified 1252
20 Ga0065704_10031781 3300005289 Unclassified 1310
21 Ga0065715_10562705 3300005293 Bacteria 733
22 Ga0065707_10016615 3300005295 Bacteria 1658
23 Ga0065707_10285750 3300005295 Bacteria 1035
24 Ga0065707_10311258 3300005295 Bacteria 956
25 Ga0065707_10350567 3300005295 Bacteria 919
26 Ga0065707_10402663 3300005295 Bacteria 851
27 Ga0065707_10553988 3300005295 Bacteria 719
28 Ga0065707_10558055 3300005295 Bacteria 716
29 Ga0065707_11162912 3300005295 Bacteria 502
30 Ga0070676_10001923 3300005328 Bacteria 10559
31 Ga0070676_10051948 3300005328 Bacteria 2408
32 Ga0070676_11286300 3300005328 Unclassified 558
33 Ga0070690_100075396 3300005330 Bacteria 2199
34 Ga0070690_100700809 3300005330 Unclassified 778
35 Ga0070670_100859021 3300005331 Bacteria 821
36 Ga0070670_100883191 3300005331 Unclassified 810
37 Ga0068869_100000334 3300005334 Bacteria 25121
38 Ga0068869_100049437 3300005334 Bacteria 3044
39 Ga0068869_101391491 3300005334 Bacteria 621
40 Ga0070680_100014161 3300005336 Bacteria 6229
41 Ga0070680_100089536 3300005336 Bacteria 2546
42 Ga0070680_100301356 3300005336 Bacteria 1359
43 Ga0070680_100962446 3300005336 Bacteria 737
44 Ga0070689_100052388 3300005340 Bacteria 3156
45 Ga0070689_100070990 3300005340 Bacteria 2720
46 Ga0070689_101377873 3300005340 Bacteria 637
47 Ga0070691_10019467 3300005341 Bacteria 3133
48 Ga0070691_10045540 3300005341 Bacteria 2082
49 Ga0070691_10301199 3300005341 Bacteria 876
50 Ga0070692_10141383 3300005345 Bacteria 1362
51 Ga0070669_100104750 3300005353 Bacteria 2139
52 Ga0070669_100116043 3300005353 Bacteria 2037
53 Ga0070669_100302428 3300005353 Bacteria 1287
54 Ga0070671_101328713 3300005355 Unclassified 634
55 Ga0070671_101578801 3300005355 Unclassified 581
56 Ga0070674_100173260 3300005356 Bacteria 1647
57 Ga0070688_100144754 3300005365 Bacteria 1618
58 Ga0070688_101208199 3300005365 Unclassified 608
59 Ga0070688_101811686 3300005365 Bacteria 501
60 Ga0070659_100000322 3300005366 Bacteria 36690
61 Ga0070667_101889438 3300005367 Unclassified 562
62 Ga0070703_10006125 3300005406 Bacteria 3366
63 Ga0070703_10028057 3300005406 Bacteria 1681
64 Ga0070703_10065515 3300005406 Bacteria 1200
65 Ga0070709_10029454 3300005434 Bacteria 3284
66 Ga0070709_10104135 3300005434 Bacteria 1896
67 Ga0070701_10036232 3300005438 Bacteria 2485
68 Ga0070701_10036494 3300005438 Bacteria 2477
69 Ga0070701_10187032 3300005438 Bacteria 1216
70 Ga0070701_10305114 3300005438 Unclassified 980
71 Ga0070701_10492082 3300005438 Bacteria 795
72 Ga0070701_10722042 3300005438 Bacteria 672
73 Ga0070701_11268607 3300005438 Unclassified 525
74 Ga0070711_100022583 3300005439 Bacteria 4080
75 Ga0070711_102073594 3300005439 Bacteria 501
76 Ga0070705_100020861 3300005440 Bacteria 3477
77 Ga0070705_100021124 3300005440 Bacteria 3458
78 Ga0070705_100069587 3300005440 Bacteria 2122
79 Ga0070705_100193146 3300005440 Bacteria 1389
80 Ga0070705_100324041 3300005440 Bacteria 1113
81 Ga0070705_100539213 3300005440 Archaea 892
82 Ga0070705_101848785 3300005440 Bacteria 513
83 Ga0070700_100050887 3300005441 Bacteria 2577
84 Ga0070700_100185166 3300005441 Bacteria 1452
85 Ga0070700_100669202 3300005441 Unclassified 822
86 Ga0070694_100038085 3300005444 Bacteria 3193
87 Ga0070694_100237880 3300005444 Bacteria 1372
88 Ga0070694_100297029 3300005444 Bacteria 1236
89 Ga0070694_100388625 3300005444 Bacteria 1090
90 Ga0070694_100494077 3300005444 Bacteria 973
91 Ga0070694_100593866 3300005444 Bacteria 891
92 Ga0070694_100812869 3300005444 Bacteria 767
93 Ga0070694_100935640 3300005444 Unclassified 717
94 Ga0070694_101348941 3300005444 Bacteria 601
95 Ga0070694_101642185 3300005444 Unclassified 546
96 Ga0070708_100032836 3300005445 Bacteria 4505
97 Ga0070708_100053892 3300005445 Bacteria 3571
98 Ga0070708_100079838 3300005445 Unclassified 2960
99 Ga0070708_100081247 3300005445 Bacteria 2934
100 Ga0070708_100135531 3300005445 Bacteria 2281
101 Ga0070708_100284779 3300005445 Bacteria 1556
102 Ga0070708_100381582 3300005445 Bacteria 1329
103 Ga0070708_100423040 3300005445 Bacteria 1256
104 Ga0070708_100423041 3300005445 Bacteria 1256
105 Ga0070708_100457172 3300005445 Bacteria 1204
106 Ga0070708_100488380 3300005445 Bacteria 1161
107 Ga0070708_100518276 3300005445 Bacteria 1124
108 Ga0070708_100527075 3300005445 Bacteria 1114
109 Ga0070708_100533289 3300005445 Bacteria 1107
110 Ga0070708_100533721 3300005445 Bacteria 1107
111 Ga0070708_100555901 3300005445 Bacteria 1082
112 Ga0070662_100028042 3300005457 Bacteria 3916
113 Ga0070681_10244267 3300005458 Bacteria 1708
114 Ga0068867_100166681 3300005459 Bacteria 1741
115 Ga0068867_101780190 3300005459 Unclassified 579
116 Ga0068867_102144540 3300005459 Unclassified 530
117 Ga0070685_10128319 3300005466 Bacteria 1583
118 Ga0070685_11038909 3300005466 Unclassified 616
119 Ga0070706_100014993 3300005467 Bacteria 7156
120 Ga0070706_100046579 3300005467 Unclassified 4003
121 Ga0070706_100084670 3300005467 Bacteria 2937
122 Ga0070706_100100610 3300005467 Bacteria 2686
123 Ga0070706_100203897 3300005467 Bacteria 1847
124 Ga0070706_100223772 3300005467 Bacteria 1756
125 Ga0070706_100238354 3300005467 Bacteria 1698
126 Ga0070706_100371264 3300005467 Bacteria 1333
127 Ga0070706_100653166 3300005467 Bacteria 976
128 Ga0070706_100699029 3300005467 Bacteria 940
129 Ga0070706_100925814 3300005467 Bacteria 805
130 Ga0070706_101020707 3300005467 Bacteria 762
131 Ga0070706_101966398 3300005467 Unclassified 530
132 Ga0070706_101982410 3300005467 Unclassified 527
133 Ga0070707_100013537 3300005468 Bacteria 7634
134 Ga0070707_100028869 3300005468 Bacteria 5279
135 Ga0070707_100033928 3300005468 Bacteria 4867
136 Ga0070707_100129381 3300005468 Bacteria 2454
137 Ga0070707_100256321 3300005468 Bacteria 1702
138 Ga0070707_100482336 3300005468 Bacteria 1201
139 Ga0070707_100562254 3300005468 Bacteria 1103
140 Ga0070707_100704161 3300005468 Unclassified 973
141 Ga0070707_100743378 3300005468 Bacteria 944
142 Ga0070707_100884667 3300005468 Bacteria 857
143 Ga0070707_101015459 3300005468 Unclassified 795
144 Ga0070707_101329939 3300005468 Bacteria 685
145 Ga0070707_101545458 3300005468 Bacteria 630
146 Ga0070707_101783354 3300005468 Bacteria 583
147 Ga0070707_102007936 3300005468 Unclassified 546
148 Ga0070698_100024909 3300005471 Bacteria 6237
149 Ga0070698_100030245 3300005471 Bacteria 5616
150 Ga0070698_100063832 3300005471 Bacteria 3713
151 Ga0070698_100103161 3300005471 Bacteria 2822
152 Ga0070698_100277816 3300005471 Bacteria 1606
153 Ga0070698_100330904 3300005471 Bacteria 1454
154 Ga0070698_100391629 3300005471 Bacteria 1322
155 Ga0070698_100484864 3300005471 Bacteria 1173
156 Ga0070698_100493587 3300005471 Unclassified 1162
157 Ga0070698_100502150 3300005471 Bacteria 1151
158 Ga0070698_100514055 3300005471 Bacteria 1136
159 Ga0070698_100755238 3300005471 Unclassified 916
160 Ga0070698_101229474 3300005471 Bacteria 698
161 Ga0070698_101315336 3300005471 Bacteria 673
162 Ga0070699_100015968 3300005518 Bacteria 6447
163 Ga0070699_100026413 3300005518 Bacteria 5007
164 Ga0070699_100027923 3300005518 Bacteria 4867
165 Ga0070699_100036833 3300005518 Bacteria 4232
166 Ga0070699_100090597 3300005518 Bacteria 2673
167 Ga0070699_100141101 3300005518 Unclassified 2128
168 Ga0070699_100169131 3300005518 Bacteria 1936
169 Ga0070699_100256918 3300005518 Bacteria 1562
170 Ga0070699_100324142 3300005518 Bacteria 1385
171 Ga0070699_100340512 3300005518 Bacteria 1350
172 Ga0070699_100362695 3300005518 Bacteria 1306
173 Ga0070699_100385746 3300005518 Bacteria 1265
174 Ga0070699_100410261 3300005518 Bacteria 1225
175 Ga0070699_100629964 3300005518 Unclassified 978
176 Ga0070699_100858654 3300005518 Bacteria 831
177 Ga0070699_101194462 3300005518 Unclassified 698
178 Ga0070699_101353940 3300005518 Bacteria 653
179 Ga0070699_101646263 3300005518 Unclassified 588
180 Ga0070679_100633469 3300005530 Bacteria 1012
181 Ga0070684_100188934 3300005535 Bacteria 1874
182 Ga0070697_100002001 3300005536 Bacteria 15617
183 Ga0070697_100002329 3300005536 Bacteria 14598
184 Ga0070697_100007571 3300005536 Bacteria 8458
185 Ga0070697_100100330 3300005536 Bacteria 2404
186 Ga0070697_100162253 3300005536 Bacteria 1888
187 Ga0070697_100210323 3300005536 Bacteria 1656
188 Ga0070697_100218691 3300005536 Bacteria 1623
189 Ga0070697_100236014 3300005536 Bacteria 1561
190 Ga0070697_100248193 3300005536 Bacteria 1522
191 Ga0070697_100610952 3300005536 Bacteria 959
192 Ga0070697_100612024 3300005536 Bacteria 958
193 Ga0070697_100731861 3300005536 Bacteria 874
194 Ga0070697_100930804 3300005536 Bacteria 771
195 Ga0070697_101457695 3300005536 Bacteria 611
196 Ga0070697_102014792 3300005536 Bacteria 517
197 Ga0068853_102121921 3300005539 Unclassified 545
198 Ga0070672_100078055 3300005543 Bacteria 2649
199 Ga0070672_101816681 3300005543 Bacteria 548
200 Ga0070695_100006290 3300005545 Bacteria 7016
201 Ga0070695_100006368 3300005545 Bacteria 6976
202 Ga0070695_100020952 3300005545 Bacteria 3996
203 Ga0070695_100023186 3300005545 Bacteria 3811
204 Ga0070695_100044183 3300005545 Bacteria 2835
205 Ga0070695_100399784 3300005545 Bacteria 1041
206 Ga0070696_100005955 3300005546 Bacteria 8140
207 Ga0070696_100010264 3300005546 Bacteria 6267
208 Ga0070696_100100169 3300005546 Bacteria 2075
209 Ga0070696_100189848 3300005546 Bacteria 1529
210 Ga0070696_100260746 3300005546 Bacteria 1314
211 Ga0070696_100295415 3300005546 Bacteria 1239
212 Ga0070696_100449093 3300005546 Bacteria 1017
213 Ga0070696_100524567 3300005546 Bacteria 945
214 Ga0070696_101760659 3300005546 Bacteria 535
215 Ga0070693_100035214 3300005547 Bacteria 2775
216 Ga0070693_100124583 3300005547 Bacteria 1602
217 Ga0070693_100211406 3300005547 Unclassified 1266
218 Ga0070693_100746451 3300005547 Bacteria 721
219 Ga0070693_101526237 3300005547 Unclassified 523
220 Ga0070704_100026326 3300005549 Bacteria 3842
221 Ga0070704_100076784 3300005549 Bacteria 2444
222 Ga0070704_100092351 3300005549 Bacteria 2259
223 Ga0070704_100226480 3300005549 Bacteria 1523
224 Ga0070704_100413300 3300005549 Bacteria 1154
225 Ga0070704_100633338 3300005549 Bacteria 943
226 Ga0070704_100789200 3300005549 Bacteria 848
227 Ga0070704_100841855 3300005549 Archaea 822
228 Ga0070704_101605529 3300005549 Bacteria 600
229 Ga0068855_101168026 3300005563 Unclassified 802
230 Ga0070664_101135791 3300005564 Unclassified 736
231 Ga0068857_100082144 3300005577 Bacteria 2878
232 Ga0068857_100415893 3300005577 Unclassified 1253
233 Ga0068857_100654978 3300005577 Bacteria 995
234 Ga0068854_100738170 3300005578 Unclassified 853
235 Ga0070702_100145400 3300005615 Bacteria 1515
236 Ga0070702_100360774 3300005615 Bacteria 1027
237 Ga0068852_100658631 3300005616 Bacteria 1055
238 Ga0068859_100043002 3300005617 Bacteria 4540
239 Ga0068859_100137350 3300005617 Bacteria 2518
240 Ga0068859_100478458 3300005617 Bacteria 1341
241 Ga0068859_100487835 3300005617 Bacteria 1327
242 Ga0068859_100532157 3300005617 Bacteria 1270
243 Ga0068859_100664112 3300005617 Bacteria 1134
244 Ga0068859_100804701 3300005617 Bacteria 1027
245 Ga0068859_101325754 3300005617 Bacteria 793
246 Ga0068866_10191693 3300005718 Bacteria 1215
247 Ga0068866_11314064 3300005718 Bacteria 526
248 Ga0068861_100213449 3300005719 Bacteria 1627
249 Ga0068861_100258332 3300005719 Bacteria 1490
250 Ga0068861_100267524 3300005719 Bacteria 1466
251 Ga0068861_100640112 3300005719 Unclassified 981
252 Ga0068861_100829508 3300005719 Bacteria 870
253 Ga0068870_10000479 3300005840 Bacteria 15167
254 Ga0068870_11158496 3300005840 Bacteria 558
255 Ga0068870_11202351 3300005840 Unclassified 549
256 Ga0068863_100058489 3300005841 Bacteria 3647
257 Ga0068863_100325206 3300005841 Bacteria 1494
258 Ga0068863_100915148 3300005841 Bacteria 878
259 Ga0068863_102203784 3300005841 Bacteria 561
260 Ga0068858_100361958 3300005842 Bacteria 1390
261 Ga0068858_100497511 3300005842 Unclassified 1177
262 Ga0068860_100202881 3300005843 Bacteria 1922
263 Ga0068860_100227490 3300005843 Unclassified 1812
264 Ga0068860_100427555 3300005843 Bacteria 1314
265 Ga0068860_100468100 3300005843 Bacteria 1255
266 Ga0068860_100547209 3300005843 Bacteria 1159
267 Ga0068860_100720769 3300005843 Bacteria 1008
268 Ga0068860_100803526 3300005843 Bacteria 954
269 Ga0068860_100932783 3300005843 Bacteria 885
270 Ga0068860_101715855 3300005843 Unclassified 650
271 Ga0068862_100003646 3300005844 Bacteria 13174
272 Ga0068862_100044850 3300005844 Bacteria 3771
273 Ga0068862_100318117 3300005844 Unclassified 1436
274 Ga0068862_100320095 3300005844 Unclassified 1431
275 Ga0068862_100480680 3300005844 Unclassified 1176
276 Ga0068862_100550967 3300005844 Bacteria 1101
277 Ga0068862_100605410 3300005844 Unclassified 1052
278 Ga0081455_10001120 3300005937 Bacteria 33487
279 Ga0081455_10004905 3300005937 Bacteria 14829
280 Ga0081455_10295174 3300005937 Bacteria 1165
281 Ga0081455_10308343 3300005937 Bacteria 1132
282 Ga0081538_10005259 3300005981 Bacteria 11686
283 Ga0081538_10045831 3300005981 Bacteria 2705
284 Ga0081538_10046485 3300005981 Unclassified 2676
285 Ga0081538_10055970 3300005981 Unclassified 2316
286 Ga0081538_10066023 3300005981 Bacteria 2032
287 Ga0081538_10381163 3300005981 Unclassified 508
288 Ga0081540_1082094 3300005983 Bacteria 1447
289 Ga0081540_1135920 3300005983 Bacteria 995
290 Ga0081539_10000259 3300005985 Bacteria 121997
291 Ga0081539_10000841 3300005985 Bacteria 58811
292 Ga0081539_10006865 3300005985 Bacteria 10633
293 Ga0081539_10010137 3300005985 Bacteria 7724
294 Ga0081539_10149888 3300005985 Bacteria 1123
295 Ga0081539_10164832 3300005985 Unclassified 1053
296 Ga0081539_10254463 3300005985 Bacteria 778
297 Ga0070717_11732925 3300006028 Unclassified 565
298 Ga0075432_10594147 3300006058 Bacteria 505
299 Ga0070715_11019284 3300006163 Bacteria 517
300 Ga0070716_100012253 3300006173 Bacteria 4342
301 Ga0070712_100003108 3300006175 Bacteria 10238
302 Ga0070712_100498250 3300006175 Bacteria 1021
303 Ga0075427_10038029 3300006194 Bacteria 805
304 Ga0068871_100880885 3300006358 Unclassified 829
305 Ga0068871_101396904 3300006358 Bacteria 660
306 Ga0075428_100001502 3300006844 Bacteria 24964
307 Ga0075428_100002009 3300006844 Bacteria 21936
308 Ga0075428_100026534 3300006844 Bacteria 6412
309 Ga0075428_100041452 3300006844 Bacteria 5064
310 Ga0075428_100115759 3300006844 Bacteria 2920
311 Ga0075428_100142724 3300006844 Bacteria 2603
312 Ga0075428_100210223 3300006844 Bacteria 2102
313 Ga0075428_100316931 3300006844 Bacteria 1676
314 Ga0075428_100349207 3300006844 Bacteria 1588
315 Ga0075428_100360396 3300006844 Bacteria 1560
316 Ga0075428_100401493 3300006844 Bacteria 1469
317 Ga0075428_100486615 3300006844 Bacteria 1320
318 Ga0075428_100533008 3300006844 Unclassified 1256
319 Ga0075428_101510925 3300006844 Unclassified 703
320 Ga0075428_102096018 3300006844 Unclassified 585
321 Ga0075430_100002189 3300006846 Bacteria 16184
322 Ga0075430_100003206 3300006846 Bacteria 13695
323 Ga0075430_100017625 3300006846 Bacteria 6081
324 Ga0075430_100032764 3300006846 Bacteria 4410
325 Ga0075430_100073903 3300006846 Bacteria 2858
326 Ga0075430_100148907 3300006846 Bacteria 1949
327 Ga0075430_100156811 3300006846 Bacteria 1895
328 Ga0075430_100177539 3300006846 Bacteria 1772
329 Ga0075430_100270821 3300006846 Bacteria 1405
330 Ga0075430_100479217 3300006846 Bacteria 1027
331 Ga0075430_100637374 3300006846 Unclassified 879
332 Ga0075430_100762620 3300006846 Archaea 797
333 Ga0075430_100965925 3300006846 Bacteria 702
334 Ga0075430_101461119 3300006846 Bacteria 562
335 Ga0075430_101488046 3300006846 Unclassified 556
336 Ga0075430_101494151 3300006846 Unclassified 555
337 Ga0075431_100000176 3300006847 Bacteria 45497
338 Ga0075431_100000454 3300006847 Bacteria 33687
339 Ga0075431_100005244 3300006847 Bacteria 12761
340 Ga0075431_100007148 3300006847 Bacteria 11096
341 Ga0075431_100008987 3300006847 Bacteria 10014
342 Ga0075431_100014992 3300006847 Bacteria 7846
343 Ga0075431_100021484 3300006847 Bacteria 6601
344 Ga0075431_100029934 3300006847 Bacteria 5606
345 Ga0075431_100083755 3300006847 Bacteria 3292
346 Ga0075431_100184495 3300006847 Unclassified 2140
347 Ga0075431_100194700 3300006847 Bacteria 2076
348 Ga0075431_100212443 3300006847 Bacteria 1976
349 Ga0075431_100239773 3300006847 Bacteria 1845
350 Ga0075431_100292451 3300006847 Unclassified 1647
351 Ga0075431_100322170 3300006847 Bacteria 1558
352 Ga0075431_100462617 3300006847 Bacteria 1263
353 Ga0075431_100608758 3300006847 Bacteria 1076
354 Ga0075431_100707369 3300006847 Unclassified 985
355 Ga0075431_101439767 3300006847 Bacteria 648
356 Ga0075431_102077154 3300006847 Unclassified 523
357 Ga0075433_10002079 3300006852 Bacteria 15143
358 Ga0075433_10012666 3300006852 Bacteria 6823
359 Ga0075433_10014926 3300006852 Bacteria 6358
360 Ga0075433_10017004 3300006852 Bacteria 6012
361 Ga0075433_10057274 3300006852 Bacteria 3407
362 Ga0075433_10057868 3300006852 Bacteria 3389
363 Ga0075433_10075818 3300006852 Bacteria 2960
364 Ga0075433_10119494 3300006852 Bacteria 2339
365 Ga0075433_10127732 3300006852 Bacteria 2258
366 Ga0075433_10203565 3300006852 Bacteria 1760
367 Ga0075433_10213143 3300006852 Bacteria 1716
368 Ga0075433_10287774 3300006852 Unclassified 1455
369 Ga0075433_10328910 3300006852 Unclassified 1351
370 Ga0075433_10396083 3300006852 Bacteria 1218
371 Ga0075433_10551017 3300006852 Bacteria 1014
372 Ga0075433_10580247 3300006852 Bacteria 985
373 Ga0075433_10880295 3300006852 Bacteria 781
374 Ga0075433_11199886 3300006852 Unclassified 659
375 Ga0075434_100001605 3300006871 Bacteria 19193
376 Ga0075434_100007481 3300006871 Bacteria 10106
377 Ga0075434_100025554 3300006871 Bacteria 5778
378 Ga0075434_100034888 3300006871 Bacteria 4971
379 Ga0075434_100057348 3300006871 Bacteria 3870
380 Ga0075434_100077328 3300006871 Bacteria 3323
381 Ga0075434_100094066 3300006871 Bacteria 3001
382 Ga0075434_100125498 3300006871 Bacteria 2584
383 Ga0075434_100131465 3300006871 Bacteria 2522
384 Ga0075434_100144204 3300006871 Bacteria 2402
385 Ga0075434_100277505 3300006871 Unclassified 1695
386 Ga0075434_100523162 3300006871 Bacteria 1206
387 Ga0075434_100715273 3300006871 Bacteria 1019
388 Ga0075434_100766332 3300006871 Bacteria 982
389 Ga0075434_101016579 3300006871 Unclassified 843
390 Ga0075434_101190247 3300006871 Unclassified 774
391 Ga0075434_102610215 3300006871 Bacteria 506
392 Ga0075429_100000055 3300006880 Bacteria 55152
393 Ga0075429_100007890 3300006880 Bacteria 9247
394 Ga0075429_100022608 3300006880 Bacteria 5451
395 Ga0075429_100028515 3300006880 Bacteria 4847
396 Ga0075429_100056122 3300006880 Bacteria 3428
397 Ga0075429_100072646 3300006880 Bacteria 2996
398 Ga0075429_100222919 3300006880 Bacteria 1651
399 Ga0075429_100254177 3300006880 Bacteria 1539
400 Ga0075429_100300019 3300006880 Bacteria 1406
401 Ga0075429_100339680 3300006880 Bacteria 1314
402 Ga0075429_100396344 3300006880 Bacteria 1209
403 Ga0075429_100406714 3300006880 Unclassified 1192
404 Ga0075429_100646519 3300006880 Bacteria 927
405 Ga0075429_100803691 3300006880 Unclassified 824
406 Ga0075429_100995396 3300006880 Unclassified 733
407 Ga0075429_101178267 3300006880 Bacteria 669
408 Ga0075429_101489652 3300006880 Bacteria 589
409 Ga0075429_101565412 3300006880 Bacteria 573
410 Ga0068865_100161425 3300006881 Bacteria 1710
411 Ga0068865_100604613 3300006881 Bacteria 927
412 Ga0068865_100950178 3300006881 Bacteria 750
413 Ga0075436_100044560 3300006914 Bacteria 3059
414 Ga0075436_100270512 3300006914 Bacteria 1213
415 Ga0075436_100391039 3300006914 Bacteria 1007
416 Ga0075436_100422956 3300006914 Bacteria 967
417 Ga0075436_100733931 3300006914 Unclassified 733
418 Ga0075436_100746503 3300006914 Bacteria 727
419 Ga0097620_100043002 3300006931 Bacteria 4540
420 Ga0097620_100137352 3300006931 Bacteria 2518
421 Ga0097620_100478466 3300006931 Bacteria 1341
422 Ga0097620_100487867 3300006931 Bacteria 1327
423 Ga0097620_100532249 3300006931 Bacteria 1270
424 Ga0097620_100664144 3300006931 Bacteria 1134
425 Ga0097620_100804702 3300006931 Bacteria 1027
426 Ga0097620_101325610 3300006931 Bacteria 793
427 Ga0097620_102159380 3300006931 Unclassified 615
428 Ga0075435_100018364 3300007076 Bacteria 5317
429 Ga0075435_100032123 3300007076 Bacteria 4143
430 Ga0075435_100043154 3300007076 Bacteria 3609
431 Ga0075435_100045716 3300007076 Bacteria 3511
432 Ga0075435_100076147 3300007076 Bacteria 2749
433 Ga0075435_100076755 3300007076 Bacteria 2738
434 Ga0075435_100088292 3300007076 Bacteria 2555
435 Ga0075435_100118725 3300007076 Bacteria 2205
436 Ga0075435_100151111 3300007076 Bacteria 1952
437 Ga0075435_100283061 3300007076 Bacteria 1416
438 Ga0075435_100323116 3300007076 Unclassified 1321
439 Ga0075435_100349277 3300007076 Bacteria 1268
440 Ga0075435_100370291 3300007076 Bacteria 1230
441 Ga0075435_100876189 3300007076 Bacteria 783
442 Ga0075435_101096777 3300007076 Unclassified 696
443 Ga0099794_10006037 3300007265 Bacteria 4891
444 Ga0099794_10023163 3300007265 Bacteria 2838
445 Ga0099794_10146926 3300007265 Bacteria 1196
446 Ga0099794_10191730 3300007265 Bacteria 1045
447 Ga0099794_10230289 3300007265 Unclassified 953
448 Ga0099794_10362193 3300007265 Bacteria 755
449 Ga0099794_10426923 3300007265 Bacteria 694
450 Ga0099795_10341141 3300007788 Bacteria 668
451 Ga0105240_12284995 3300009093 Unclassified 560
452 Ga0111539_10000988 3300009094 Bacteria 37262
453 Ga0111539_10003789 3300009094 Bacteria 19896
454 Ga0111539_10006645 3300009094 Bacteria 14895
455 Ga0111539_10045721 3300009094 Bacteria 5240
456 Ga0111539_10086616 3300009094 Unclassified 3681
457 Ga0111539_10201876 3300009094 Bacteria 2318
458 Ga0111539_10316459 3300009094 Bacteria 1816
459 Ga0111539_10415838 3300009094 Bacteria 1566
460 Ga0111539_10914019 3300009094 Bacteria 1021
461 Ga0111539_10974854 3300009094 Bacteria 986
462 Ga0111539_11927611 3300009094 Bacteria 685
463 Ga0111539_12503783 3300009094 Unclassified 598
464 Ga0111539_12614628 3300009094 Unclassified 585
465 Ga0111539_13235363 3300009094 Unclassified 525
466 Ga0111539_13510825 3300009094 Bacteria 503
467 Ga0105245_10049483 3300009098 Bacteria 3764
468 Ga0105247_10050757 3300009101 Bacteria 2553
469 Ga0105247_10341310 3300009101 Bacteria 1051
470 Ga0105247_11009974 3300009101 Bacteria 650
471 Ga0105247_11377224 3300009101 Unclassified 570
472 Ga0114129_10000065 3300009147 Bacteria 94355
473 Ga0114129_10001130 3300009147 Bacteria 35244
474 Ga0114129_10001403 3300009147 Bacteria 32497
475 Ga0114129_10001601 3300009147 Bacteria 30764
476 Ga0114129_10007826 3300009147 Bacteria 15204
477 Ga0114129_10015668 3300009147 Bacteria 10779
478 Ga0114129_10033268 3300009147 Bacteria 7286
479 Ga0114129_10037554 3300009147 Bacteria 6838
480 Ga0114129_10044048 3300009147 Bacteria 6278
481 Ga0114129_10096552 3300009147 Bacteria 4091
482 Ga0114129_10121705 3300009147 Bacteria 3591
483 Ga0114129_10164507 3300009147 Bacteria 3028
484 Ga0114129_10180641 3300009147 Bacteria 2871
485 Ga0114129_10180666 3300009147 Unclassified 2871
486 Ga0114129_10183077 3300009147 Bacteria 2849
487 Ga0114129_10216436 3300009147 Bacteria 2587
488 Ga0114129_10238739 3300009147 Bacteria 2444
489 Ga0114129_10297194 3300009147 Bacteria 2153
490 Ga0114129_10315764 3300009147 Bacteria 2078
491 Ga0114129_10344159 3300009147 Bacteria 1977
492 Ga0114129_10363519 3300009147 Bacteria 1914
493 Ga0114129_10372306 3300009147 Bacteria 1888
494 Ga0114129_10472947 3300009147 Bacteria 1641
495 Ga0114129_10523536 3300009147 Unclassified 1545
496 Ga0114129_10721768 3300009147 Bacteria 1279
497 Ga0114129_10862026 3300009147 Bacteria 1150
498 Ga0114129_10922765 3300009147 Bacteria 1105
499 Ga0114129_10955877 3300009147 Unclassified 1082
500 Ga0114129_11005383 3300009147 Bacteria 1050
501 Ga0114129_11316454 3300009147 Bacteria 895
502 Ga0114129_11377910 3300009147 Bacteria 871
503 Ga0114129_11489283 3300009147 Unclassified 832
504 Ga0114129_12117230 3300009147 Unclassified 678
505 Ga0105243_10044580 3300009148 Bacteria 3480
506 Ga0105243_10428911 3300009148 Bacteria 1235
507 Ga0105243_10545355 3300009148 Bacteria 1107
508 Ga0105243_11009294 3300009148 Unclassified 835
509 Ga0105243_11215541 3300009148 Bacteria 767
510 Ga0105243_12316140 3300009148 Bacteria 575
511 Ga0105241_10058914 3300009174 Bacteria 2950
512 Ga0105241_10497807 3300009174 Bacteria 1086
513 Ga0105241_11189491 3300009174 Unclassified 722
514 Ga0105241_11623554 3300009174 Bacteria 626
515 Ga0105242_10076521 3300009176 Bacteria 2790
516 Ga0105242_10370767 3300009176 Bacteria 1328
517 Ga0105242_10438781 3300009176 Bacteria 1228
518 Ga0105242_11120737 3300009176 Unclassified 802
519 Ga0105242_13160908 3300009176 Unclassified 511
520 Ga0105248_10100073 3300009177 Bacteria 3266
521 Ga0105237_12301482 3300009545 Bacteria 549
522 Ga0105249_10057295 3300009553 Bacteria 3569
523 Ga0105249_10094642 3300009553 Bacteria 2800
524 Ga0105249_10172525 3300009553 Bacteria 2098
525 Ga0105249_10273859 3300009553 Bacteria 1683
526 Ga0105249_10439413 3300009553 Bacteria 1342
527 Ga0105249_10788667 3300009553 Bacteria 1014
528 Ga0105239_11916496 3300010375 Unclassified 687
529 Ga0105246_10041648 3300011119 Bacteria 3106
530 Ga0105246_10611326 3300011119 Unclassified 943
531 Ga0105246_11201682 3300011119 Unclassified 698
532 Ga0105246_11940083 3300011119 Bacteria 566
533 Ga0157371_10801924 3300013102 Bacteria 710
534 Ga0157378_10027876 3300013297 Bacteria 4981
535 Ga0157378_10637049 3300013297 Bacteria 1080
536 Ga0163162_10044756 3300013306 Bacteria 4434
537 Ga0163162_10070927 3300013306 Bacteria 3536
538 Ga0163162_10386526 3300013306 Bacteria 1532
539 Ga0163162_10410611 3300013306 Bacteria 1487
540 Ga0163162_11186867 3300013306 Unclassified 866
541 Ga0157372_10050672 3300013307 Bacteria 4617
542 Ga0157375_10473871 3300013308 Bacteria 1417
543 Ga0157375_11137438 3300013308 Bacteria 915
544 Ga0163163_13244224 3300014325 Unclassified 507
545 Ga0157380_10197471 3300014326 Bacteria 1782
546 Ga0157380_10441541 3300014326 Bacteria 1247
547 Ga0157380_10576821 3300014326 Bacteria 1108
548 Ga0157380_11688098 3300014326 Unclassified 691
549 Ga0157380_12702228 3300014326 Unclassified 563
550 Ga0157377_10286814 3300014745 Bacteria 1081
551 Ga0157377_10616853 3300014745 Bacteria 776
552 Ga0157377_10889241 3300014745 Bacteria 665
553 Ga0157379_12424182 3300014968 Unclassified 524
554 Ga0157376_10460104 3300014969 Unclassified 1243
555 Ga0163161_10392199 3300017792 Bacteria 1112
556 Ga0163161_11027598 3300017792 Bacteria 705
557 Ga0163161_11163210 3300017792 Unclassified 665
558 Ga0163161_11703623 3300017792 Unclassified 558
559 Ga0206354_10623338 3300020081 Unclassified 900
560 Ga0207653_10015422 3300025885 Bacteria 2398
561 Ga0207653_10015830 3300025885 Bacteria 2367
562 Ga0207682_10044511 3300025893 Unclassified 1820
563 Ga0207642_10806738 3300025899 Bacteria 597
564 Ga0207710_10281677 3300025900 Bacteria 837
565 Ga0207688_10023247 3300025901 Bacteria 3393
566 Ga0207647_10085460 3300025904 Bacteria 1887
567 Ga0207699_10090609 3300025906 Bacteria 1919
568 Ga0207645_10073602 3300025907 Bacteria 2187
569 Ga0207643_10362041 3300025908 Unclassified 912
570 Ga0207643_10428574 3300025908 Archaea 839
571 Ga0207684_10017845 3300025910 Bacteria 6085
572 Ga0207684_10046875 3300025910 Bacteria 3666
573 Ga0207684_10066643 3300025910 Bacteria 3058
574 Ga0207684_10076849 3300025910 Bacteria 2838
575 Ga0207684_10115401 3300025910 Bacteria 2300
576 Ga0207684_10146063 3300025910 Bacteria 2034
577 Ga0207684_10186113 3300025910 Bacteria 1791
578 Ga0207684_10220979 3300025910 Unclassified 1635
579 Ga0207684_10228288 3300025910 Bacteria 1606
580 Ga0207684_10230747 3300025910 Unclassified 1597
581 Ga0207684_10243789 3300025910 Bacteria 1550
582 Ga0207684_10286987 3300025910 Bacteria 1419
583 Ga0207684_10309994 3300025910 Bacteria 1361
584 Ga0207684_10626529 3300025910 Unclassified 917
585 Ga0207684_11056955 3300025910 Unclassified 677
586 Ga0207684_11547467 3300025910 Bacteria 538
587 Ga0207654_10014739 3300025911 Bacteria 4043
588 Ga0207654_10095525 3300025911 Bacteria 1821
589 Ga0207707_10832802 3300025912 Bacteria 767
590 Ga0207695_11038225 3300025913 Unclassified 699
591 Ga0207693_10023774 3300025915 Bacteria 4863
592 Ga0207693_10207779 3300025915 Bacteria 1539
593 Ga0207663_11284334 3300025916 Bacteria 589
594 Ga0207660_10017368 3300025917 Bacteria 4779
595 Ga0207660_10530675 3300025917 Unclassified 956
596 Ga0207646_10003306 3300025922 Bacteria 18339
597 Ga0207646_10012150 3300025922 Bacteria 8285
598 Ga0207646_10056835 3300025922 Bacteria 3497
599 Ga0207646_10124179 3300025922 Bacteria 2320
600 Ga0207646_10153048 3300025922 Bacteria 2080
601 Ga0207646_10254690 3300025922 Bacteria 1586
602 Ga0207646_10311914 3300025922 Bacteria 1421
603 Ga0207646_10570958 3300025922 Bacteria 1016
604 Ga0207646_10996886 3300025922 Unclassified 740
605 Ga0207681_10054002 3300025923 Bacteria 2730
606 Ga0207687_10141402 3300025927 Bacteria 1826
607 Ga0207706_10105657 3300025933 Bacteria 2477
608 Ga0207686_10042900 3300025934 Bacteria 2768
609 Ga0207709_10102591 3300025935 Bacteria 1894
610 Ga0207709_10163604 3300025935 Bacteria 1554
611 Ga0207709_10298418 3300025935 Bacteria 1197
612 Ga0207709_11464781 3300025935 Unclassified 566
613 Ga0207670_10074680 3300025936 Bacteria 2354
614 Ga0207670_10116184 3300025936 Bacteria 1937
615 Ga0207670_10398600 3300025936 Bacteria 1100
616 Ga0207670_10405725 3300025936 Unclassified 1090
617 Ga0207670_11334967 3300025936 Bacteria 608
618 Ga0207669_10146448 3300025937 Bacteria 1648
619 Ga0207704_10806510 3300025938 Unclassified 784
620 Ga0207704_11112353 3300025938 Unclassified 672
621 Ga0207665_10009574 3300025939 Bacteria 6362
622 Ga0207665_10081619 3300025939 Bacteria 2227
623 Ga0207691_11166589 3300025940 Bacteria 639
624 Ga0207711_11247224 3300025941 Unclassified 685
625 Ga0207689_10022473 3300025942 Bacteria 5303
626 Ga0207689_10057202 3300025942 Bacteria 3208
627 Ga0207689_10135414 3300025942 Bacteria 2028
628 Ga0207712_10056636 3300025961 Bacteria 2762
629 Ga0207712_10150526 3300025961 Bacteria 1797
630 Ga0207712_10189338 3300025961 Bacteria 1623
631 Ga0207712_10198724 3300025961 Bacteria 1588
632 Ga0207712_10291617 3300025961 Bacteria 1335
633 Ga0207712_10403047 3300025961 Bacteria 1150
634 Ga0207712_10447246 3300025961 Bacteria 1095
635 Ga0207668_12014260 3300025972 Unclassified 520
636 Ga0207640_10562098 3300025981 Bacteria 960
637 Ga0207658_11178932 3300025986 Bacteria 700
638 Ga0207677_10154677 3300026023 Bacteria 1774
639 Ga0207703_10235825 3300026035 Unclassified 1642
640 Ga0207703_10243304 3300026035 Bacteria 1618
641 Ga0207703_10926119 3300026035 Bacteria 835
642 Ga0207639_10557621 3300026041 Unclassified 1052
643 Ga0207678_10005772 3300026067 Bacteria 11035
644 Ga0207678_10619576 3300026067 Bacteria 949
645 Ga0207708_10150904 3300026075 Unclassified 1829
646 Ga0207708_10606692 3300026075 Unclassified 928
647 Ga0207708_11025117 3300026075 Unclassified 718
648 Ga0207708_11261945 3300026075 Unclassified 647
649 Ga0207641_10049562 3300026088 Bacteria 3549
650 Ga0207641_10256382 3300026088 Bacteria 1636
651 Ga0207641_10799444 3300026088 Bacteria 933
652 Ga0207641_11265018 3300026088 Bacteria 738
653 Ga0207648_10027052 3300026089 Bacteria 5094
654 Ga0207648_10093158 3300026089 Bacteria 2635
655 Ga0207676_10261193 3300026095 Bacteria 1564
656 Ga0207674_10027557 3300026116 Bacteria 6008
657 Ga0207674_10485084 3300026116 Bacteria 1195
658 Ga0207674_10540800 3300026116 Bacteria 1125
659 Ga0207675_100021298 3300026118 Bacteria 6038
660 Ga0207675_100064080 3300026118 Bacteria 3434
661 Ga0207675_100084386 3300026118 Bacteria 2980
662 Ga0207675_100144218 3300026118 Unclassified 2264
663 Ga0207675_100148087 3300026118 Bacteria 2233
664 Ga0207675_100253256 3300026118 Bacteria 1704
665 Ga0207675_100926301 3300026118 Bacteria 888
666 Ga0207675_101402014 3300026118 Bacteria 719
667 Ga0207698_12283391 3300026142 Bacteria 553
668 Ga0209969_1000979 3300027360 Bacteria 3874
669 Ga0209981_1003308 3300027378 Bacteria 2089
670 Ga0209996_1024155 3300027395 Bacteria 865
671 Ga0209995_1000523 3300027471 Bacteria 5818
672 Ga0209968_1000756 3300027526 Bacteria 4984
673 Ga0209982_1005681 3300027552 Bacteria 1803
674 Ga0209970_1000820 3300027614 Bacteria 5456
675 Ga0210002_1003031 3300027617 Bacteria 2466
676 Ga0209983_1012841 3300027665 Bacteria 1720
677 Ga0209588_1073278 3300027671 Bacteria 1106
678 Ga0209588_1116201 3300027671 Unclassified 858
679 Ga0209588_1279518 3300027671 Unclassified 505
680 Ga0209971_1001462 3300027682 Bacteria 5868
681 Ga0209966_1000550 3300027695 Bacteria 9434
682 Ga0209966_1053854 3300027695 Bacteria 860
683 Ga0209998_10000002 3300027717 Bacteria 126355
684 Ga0209974_10004164 3300027876 Bacteria 5173
685 Ga0209974_10052101 3300027876 Bacteria 1377
686 Ga0207428_10000029 3300027907 Bacteria 241338
687 Ga0207428_10015779 3300027907 Bacteria 6519
688 Ga0207428_10287237 3300027907 Unclassified 1220
689 Ga0207428_10692084 3300027907 Bacteria 729
690 Ga0207428_10692209 3300027907 Bacteria 729
691 Ga0207428_10758120 3300027907 Bacteria 691
692 Ga0207428_10822465 3300027907 Unclassified 659
693 Ga0207428_10887603 3300027907 Bacteria 630
694 Ga0268265_10005030 3300028380 Bacteria 9073
695 Ga0268265_10135224 3300028380 Bacteria 2055
696 Ga0268265_10342345 3300028380 Unclassified 1362
697 Ga0268265_10343145 3300028380 Bacteria 1361
698 Ga0268265_10387402 3300028380 Bacteria 1288
699 Ga0268265_10486832 3300028380 Unclassified 1160
700 Ga0268265_10527343 3300028380 Bacteria 1117
701 Ga0268265_10788705 3300028380 Unclassified 925
702 Ga0268264_10048001 3300028381 Bacteria 3551
703 Ga0268264_10135951 3300028381 Bacteria 2185
704 Ga0268264_10359884 3300028381 Viruses 1387
705 Ga0268264_10390947 3300028381 Bacteria 1334
706 Ga0268264_10944780 3300028381 Unclassified 867
707 Ga0268264_11709622 3300028381 Bacteria 640
708 Ga0268264_11870514 3300028381 Unclassified 610
709 Ga0307408_100083906 3300031548 Bacteria 2388
710 Ga0307408_100287144 3300031548 Bacteria 1372
711 Ga0307408_100402043 3300031548 Bacteria 1176
712 Ga0307408_100687521 3300031548 Viruses 918
713 Ga0307408_102320681 3300031548 Bacteria 520
714 Ga0307410_10099053 3300031852 Bacteria 2086
715 Ga0307410_10237006 3300031852 Bacteria 1412
716 Ga0307406_10174566 3300031901 Bacteria 1559
717 Ga0307406_10344045 3300031901 Bacteria 1163
718 Ga0307406_10691324 3300031901 Bacteria 851
719 Ga0307406_10763837 3300031901 Bacteria 813
720 Ga0307407_10207759 3300031903 Unclassified 1316
721 Ga0307412_10711212 3300031911 Bacteria 863
722 Ga0307409_100072890 3300031995 Bacteria 2737
723 Ga0307409_100326957 3300031995 Bacteria 1437
724 Ga0307409_100767158 3300031995 Bacteria 969
725 Ga0307409_101911448 3300031995 Bacteria 623
726 Ga0307409_102314454 3300031995 Unclassified 566
727 Ga0307416_100263272 3300032002 Bacteria 1687
728 Ga0307416_100403013 3300032002 Bacteria 1406
729 Ga0307416_100590797 3300032002 Bacteria 1189
730 Ga0307416_101639222 3300032002 Unclassified 748
731 Ga0307414_10365478 3300032004 Bacteria 1243
732 Ga0307411_11531950 3300032005 Unclassified 613
733 Ga0307415_100173508 3300032126 Unclassified 1684
734 Ga0373930_0029175 3300034816 Unclassified 1126
735 Ga0373930_0201732 3300034816 Bacteria 518
736 Ga0373948_0006218 3300034817 Bacteria 1967
737 Ga0373948_0090028 3300034817 Unclassified 711
738 Ga0373948_0187837 3300034817 Bacteria 533
739 Ga0373958_0075085 3300034819 Bacteria 757
740 Ga0373959_0093981 3300034820 Bacteria 706
741 Ga0373928_0046790 3300035084 Unclassified 1010
742 Ga0373940_0014722 3300035088 Bacteria 1913
743 Ga0373940_0068784 3300035088 Bacteria 1027
744 Ga0373940_0152528 3300035088 Bacteria 737
745 Ga0373949_0056010 3300035090 Bacteria 1004
746 Ga0373949_0088066 3300035090 Unclassified 836
747 Ga0373951_0003011 3300035091 Bacteria 4177
748 Ga0373952_0071648 3300035092 Bacteria 868
749 Ga0373952_0184455 3300035092 Unclassified 603
750 Ga0373932_0040503 3300035112 Bacteria 1342
751 Ga0373932_0046584 3300035112 Bacteria 1272
752 Ga0373932_0099869 3300035112 Bacteria 943
753 Ga0373939_0356843 3300035114 Bacteria 596
754 Ga0373942_0037285 3300035207 Bacteria 1313
755 Ga0373942_0039101 3300035207 Bacteria 1289
756 Ga0373942_0082600 3300035207 Bacteria 956
757 Ga0373961_0010679 3300035241 Bacteria 2266
758 Ga0373962_0004535 3300035242 Bacteria 3360
759 Ga0373931_0018968 3300035691 Bacteria 3427
760 Ga0373931_0730945 3300035691 Bacteria 656
761 Ga0373947_0921908 3300035725 Unclassified 596
762 Ga0395899_0005874 3300037312 Bacteria 9526
763 Ga0395900_0058126 3300037418 Bacteria 3981
764 Ga0395900_0060598 3300037418 Bacteria 3894
765 Ga0395900_1014230 3300037418 Unclassified 749
766 Ga0395898_0011090 3300037466 Bacteria 9384
767 Ga0395898_0388532 3300037466 Bacteria 1331
768 Ga0395898_0879210 3300037466 Unclassified 835
769 Ga0395905_0114390 3300037471 Bacteria 2535
770 Ga0395901_0001902 3300038443 Bacteria 21558
771 Ga0395901_0056556 3300038443 Bacteria 4081
772 Ga0242420_065434 3300038996 Unclassified 731
773 Ga0439441_104801 3300042001 Unclassified 637
774 Ga0439448_0005397 3300042005 Bacteria 3644
775 Ga0439448_0163148 3300042005 Unclassified 776
776 Ga0439450_036349 3300042008 Unclassified 1127
777 Ga0439450_042938 3300042008 Bacteria 1055
778 Ga0439463_038456 3300042016 Unclassified 1214
779 Ga0450892_005987 3300042130 Unclassified 1008
780 Ga0450892_019228 3300042130 Bacteria 661
781 Ga0439434_0300633 3300042435 Unclassified 555
782 Ga0439464_0004479 3300042439 Unclassified 3575
783 Ga0439460_0003445 3300042461 Bacteria 3825
784 Ga0439460_0120389 3300042461 Bacteria 858
785 Ga0451577_0005116 3300042876 Bacteria 13513
786 Ga0451577_0134166 3300042876 Bacteria 2222
787 Ga0451577_0210834 3300042876 Bacteria 1755
788 Ga0451577_0223371 3300042876 Bacteria 1702
789 Ga0451577_0575003 3300042876 Bacteria 1023
790 Ga0453683_0003298 3300044673 Bacteria 11958
791 Ga0453683_0010733 3300044673 Bacteria 6065
792 Ga0453683_0036593 3300044673 Bacteria 3089
793 Ga0453683_0082681 3300044673 Bacteria 2012
794 Ga0453683_0120282 3300044673 Bacteria 1653
795 Ga0453683_0319344 3300044673 Bacteria 995
796 Ga0453683_0383627 3300044673 Bacteria 905
797 Ga0453683_0953772 3300044673 Unclassified 568
798 Ga0453684_0053477 3300044712 Bacteria 5270
799 Ga0453684_0066225 3300044712 Bacteria 4601
800 Ga0453684_0538781 3300044712 Unclassified 1287
801 Ga0453684_1280163 3300044712 Bacteria 766
802 Ga0451576_0015014 3300045051 Bacteria 8604
803 Ga0451576_0019925 3300045051 Bacteria 7311
804 Ga0451576_0054060 3300045051 Bacteria 4204
805 Ga0451576_0092411 3300045051 Bacteria 3147
806 Ga0451576_0167119 3300045051 Bacteria 2296
807 Ga0451576_0183565 3300045051 Bacteria 2184
808 Ga0451576_0312728 3300045051 Bacteria 1643
809 Ga0451576_0495161 3300045051 Bacteria 1284
810 Ga0451576_0862233 3300045051 Bacteria 950
811 Ga0495603_0210317 3300046455 Bacteria 1123
812 Ga0495580_0116499 3300046472 Bacteria 1855
813 Ga0495580_0513138 3300046472 Bacteria 799
814 Ga0495584_0208753 3300046491 Bacteria 993
815 Ga0495642_0196532 3300046528 Bacteria 879
816 Ga0495598_0338081 3300046537 Bacteria 577
817 Ga0495609_0425393 3300046538 Bacteria 530
818 Ga0495656_0025609 3300046615 Bacteria 2341
819 Ga0495656_0230705 3300046615 Bacteria 929
820 Ga0495658_0598189 3300046683 Unclassified 707
821 Ga0496102_0021070 3300048905 Bacteria 5765
822 Ga0496102_0184054 3300048905 Bacteria 1968
823 Ga0496102_0347881 3300048905 Bacteria 1396
824 Ga0496106_0313507 3300048909 Bacteria 1259
825 Ga0496110_0715956 3300048913 Unclassified 903
826 Ga0496113_0202685 3300048916 Bacteria 1577
827 Ga0496115_0988944 3300048918 Bacteria 644
828 Ga0501298_064113 3300049521 Unclassified 783
829 Ga0501312_089265 3300049528 Unclassified 567
830 Ga0501031_0133156 3300049568 Bacteria 1624
831 Ga0501031_0445964 3300049568 Bacteria 836
832 Ga0501031_0517476 3300049568 Bacteria 769
833 Ga0501032_0651797 3300049569 Archaea 669
834 Ga0501033_0081589 3300049570 Bacteria 2372
835 Ga0501033_0173736 3300049570 Bacteria 1547
836 Ga0501033_0199207 3300049570 Bacteria 1431
837 Ga0501033_0210334 3300049570 Bacteria 1387
838 Ga0501033_0598405 3300049570 Bacteria 756
839 Ga0501034_0227225 3300049571 Unclassified 1817
840 Ga0501034_1133471 3300049571 Bacteria 662
841 Ga0501036_0076928 3300049572 Bacteria 2823
842 Ga0501036_0093665 3300049572 Bacteria 2538
843 Ga0501036_0113050 3300049572 Bacteria 2295
844 Ga0501036_0141929 3300049572 Bacteria 2027
845 Ga0501036_0323099 3300049572 Bacteria 1289
846 Ga0501036_0478492 3300049572 Unclassified 1037
847 Ga0501036_0878415 3300049572 Unclassified 736
848 Ga0501036_1222567 3300049572 Bacteria 612
849 Ga0501037_0133885 3300049573 Bacteria 1776
850 Ga0501037_0314221 3300049573 Bacteria 1086
851 Ga0501037_0326650 3300049573 Bacteria 1061
852 Ga0501038_0093693 3300049574 Bacteria 2512
853 Ga0501038_0109268 3300049574 Bacteria 2292
854 Ga0501038_0151302 3300049574 Bacteria 1892
855 Ga0501038_0163670 3300049574 Unclassified 1806
856 Ga0501038_0321594 3300049574 Bacteria 1210
857 Ga0501039_0032404 3300049575 Bacteria 4029
858 Ga0501039_0060402 3300049575 Bacteria 2936
859 Ga0501039_0062807 3300049575 Unclassified 2878
860 Ga0501039_0092931 3300049575 Bacteria 2351
861 Ga0501039_0280055 3300049575 Bacteria 1311
862 Ga0501039_0661061 3300049575 Unclassified 818
863 Ga0501039_0841713 3300049575 Archaea 715
864 Ga0501040_0004023 3300049576 Bacteria 9549
865 Ga0501040_0007035 3300049576 Bacteria 7292
866 Ga0501040_0027124 3300049576 Bacteria 3855
867 Ga0501040_0131582 3300049576 Bacteria 1759
868 Ga0501040_0135854 3300049576 Bacteria 1731
869 Ga0501040_0263644 3300049576 Bacteria 1230
870 Ga0501040_0295877 3300049576 Bacteria 1157
871 Ga0501040_0618960 3300049576 Unclassified 782
872 Ga0501040_1278501 3300049576 Bacteria 532
873 Ga0501041_0008676 3300049577 Bacteria 5987
874 Ga0501041_0031209 3300049577 Bacteria 3218
875 Ga0501041_0039706 3300049577 Bacteria 2856
876 Ga0501041_0057523 3300049577 Bacteria 2378
877 Ga0501041_0326076 3300049577 Bacteria 969
878 Ga0501041_0480567 3300049577 Unclassified 790
879 Ga0501041_0510507 3300049577 Bacteria 765
880 Ga0501041_0583688 3300049577 Bacteria 713
881 Ga0501041_0651584 3300049577 Bacteria 673
882 Ga0501041_0805304 3300049577 Bacteria 602
883 Ga0501042_0042455 3300049578 Bacteria 3237
884 Ga0501042_0046947 3300049578 Bacteria 3079
885 Ga0501042_0072132 3300049578 Bacteria 2471
886 Ga0501042_0194622 3300049578 Bacteria 1462
887 Ga0501042_0279949 3300049578 Bacteria 1204
888 Ga0501042_0365701 3300049578 Bacteria 1044
889 Ga0501042_0458972 3300049578 Bacteria 924
890 Ga0501042_0480736 3300049578 Bacteria 901
891 Ga0501042_0701790 3300049578 Unclassified 736
892 Ga0501043_0366694 3300049579 Unclassified 1092
893 Ga0501043_0804040 3300049579 Unclassified 680
894 Ga0501043_0818233 3300049579 Unclassified 673
895 Ga0501046_0001412 3300049580 Bacteria 23105
896 Ga0501046_0053261 3300049580 Bacteria 3187
897 Ga0501046_0067845 3300049580 Bacteria 2777
898 Ga0501046_0118122 3300049580 Bacteria 2020
899 Ga0501046_0191423 3300049580 Bacteria 1526
900 Ga0501046_0615268 3300049580 Unclassified 770
901 Ga0501047_0096018 3300049581 Bacteria 2843
902 Ga0501048_0018086 3300049582 Bacteria 5186
903 Ga0501048_0032371 3300049582 Bacteria 3779
904 Ga0501048_0137305 3300049582 Bacteria 1728
905 Ga0501048_0980705 3300049582 Bacteria 608
906 Ga0501048_1178235 3300049582 Unclassified 551
907 Ga0501067_0052498 3300049583 Bacteria 2259
908 Ga0501067_0068020 3300049583 Bacteria 1972
909 Ga0501067_0203095 3300049583 Bacteria 1104
910 Ga0501067_0328445 3300049583 Bacteria 852
911 Ga0501068_0012505 3300049584 Bacteria 4816
912 Ga0501068_0028353 3300049584 Bacteria 3311
913 Ga0501068_0106831 3300049584 Bacteria 1738
914 Ga0501068_0306817 3300049584 Unclassified 1016
915 Ga0501069_0149453 3300049585 Bacteria 1342
916 Ga0501069_0338606 3300049585 Bacteria 886
917 Ga0501069_0513203 3300049585 Bacteria 716
918 Ga0501070_0465116 3300049586 Bacteria 1019
919 Ga0501070_0602614 3300049586 Bacteria 875
920 Ga0501070_0616319 3300049586 Unclassified 864
921 Ga0501071_0025805 3300049587 Bacteria 4119
922 Ga0501071_0064858 3300049587 Bacteria 2651
923 Ga0501071_0420778 3300049587 Unclassified 1021
924 Ga0501071_0440965 3300049587 Bacteria 996
925 Ga0501071_0597981 3300049587 Bacteria 848
926 Ga0501071_0677279 3300049587 Unclassified 794
927 Ga0501071_0958676 3300049587 Bacteria 660
928 Ga0501072_0002745 3300049588 Bacteria 13219
929 Ga0501072_0076464 3300049588 Bacteria 2649
930 Ga0501072_0092542 3300049588 Bacteria 2401
931 Ga0501072_0094874 3300049588 Bacteria 2371
932 Ga0501072_0122515 3300049588 Bacteria 2071
933 Ga0501072_0132086 3300049588 Bacteria 1990
934 Ga0501072_0135984 3300049588 Bacteria 1959
935 Ga0501072_0145582 3300049588 Bacteria 1889
936 Ga0501072_0148893 3300049588 Bacteria 1866
937 Ga0501072_0268164 3300049588 Unclassified 1358
938 Ga0501072_0270102 3300049588 Bacteria 1353
939 Ga0501072_0329255 3300049588 Unclassified 1214
940 Ga0501072_0582170 3300049588 Bacteria 883
941 Ga0501072_1306143 3300049588 Bacteria 562
942 Ga0501073_0159577 3300049589 Bacteria 1563
943 Ga0501073_1273070 3300049589 Bacteria 504
944 Ga0501074_0040360 3300049590 Bacteria 3381
945 Ga0501074_0086047 3300049590 Bacteria 2252
946 Ga0501074_0092770 3300049590 Bacteria 2162
947 Ga0501074_0165237 3300049590 Bacteria 1580
948 Ga0501074_0443923 3300049590 Bacteria 920
949 Ga0501074_0774874 3300049590 Bacteria 676
950 Ga0501074_1115173 3300049590 Unclassified 554
951 Ga0501075_0021502 3300049591 Bacteria 4705
952 Ga0501075_0047481 3300049591 Bacteria 3226
953 Ga0501075_0084079 3300049591 Bacteria 2410
954 Ga0501075_0090646 3300049591 Bacteria 2319
955 Ga0501075_0100519 3300049591 Bacteria 2196
956 Ga0501075_0116652 3300049591 Bacteria 2030
957 Ga0501075_0142078 3300049591 Bacteria 1829
958 Ga0501075_0194009 3300049591 Unclassified 1549
959 Ga0501075_0235573 3300049591 Bacteria 1396
960 Ga0501076_0004216 3300049592 Bacteria 10175
961 Ga0501076_0004618 3300049592 Bacteria 9804
962 Ga0501076_0014054 3300049592 Bacteria 6017
963 Ga0501076_0036531 3300049592 Bacteria 3850
964 Ga0501076_0037970 3300049592 Bacteria 3779
965 Ga0501076_0064866 3300049592 Bacteria 2911
966 Ga0501076_0093057 3300049592 Bacteria 2425
967 Ga0501076_0100713 3300049592 Bacteria 2328
968 Ga0501076_0127968 3300049592 Bacteria 2059
969 Ga0501076_0236400 3300049592 Bacteria 1494
970 Ga0501076_0266243 3300049592 Bacteria 1403
971 Ga0501076_0526365 3300049592 Unclassified 975
972 Ga0501076_0627479 3300049592 Bacteria 887
973 Ga0501077_0006892 3300049593 Bacteria 6996
974 Ga0501077_0010491 3300049593 Bacteria 5767
975 Ga0501077_0045422 3300049593 Bacteria 2791
976 Ga0501077_0062536 3300049593 Bacteria 2361
977 Ga0501077_0072963 3300049593 Bacteria 2174
978 Ga0501077_0076492 3300049593 Bacteria 2120
979 Ga0501077_0190366 3300049593 Bacteria 1303
980 Ga0501077_0218529 3300049593 Bacteria 1211
981 Ga0501077_0523112 3300049593 Bacteria 761
982 Ga0501077_0600529 3300049593 Bacteria 707
983 Ga0501079_0001422 3300049741 Bacteria 16893
984 Ga0501079_0013655 3300049741 Bacteria 6194
985 Ga0501079_0023059 3300049741 Bacteria 4778
986 Ga0501079_0032782 3300049741 Bacteria 3995
987 Ga0501079_0040925 3300049741 Bacteria 3576
988 Ga0501079_0097512 3300049741 Bacteria 2279
989 Ga0501079_0298050 3300049741 Bacteria 1261
990 Ga0501079_0488187 3300049741 Bacteria 968
991 Ga0501079_0560255 3300049741 Bacteria 899
992 Ga0501079_0585144 3300049741 Unclassified 878
993 Ga0501079_0842389 3300049741 Bacteria 722
994 Ga0501079_1598340 3300049741 Unclassified 513
995 Ga0501080_0029771 3300049742 Bacteria 5082
996 Ga0501080_0049896 3300049742 Bacteria 3895
997 Ga0501080_0065631 3300049742 Bacteria 3376
998 Ga0501080_0158464 3300049742 Bacteria 2091
999 Ga0501080_0226355 3300049742 Bacteria 1710
1000 Ga0501080_0686539 3300049742 Bacteria 904
1001 Ga0501081_0002905 3300049743 Bacteria 10870
1002 Ga0501081_0006389 3300049743 Bacteria 7646
1003 Ga0501081_0006586 3300049743 Bacteria 7547
1004 Ga0501081_0018986 3300049743 Bacteria 4571
1005 Ga0501081_0096106 3300049743 Bacteria 2089
1006 Ga0501081_0122935 3300049743 Bacteria 1850
1007 Ga0501081_0437225 3300049743 Bacteria 971
1008 Ga0501081_0602178 3300049743 Unclassified 823
1009 Ga0501081_0603727 3300049743 Bacteria 822
1010 Ga0501081_0605834 3300049743 Bacteria 820
1011 Ga0501081_0656585 3300049743 Bacteria 786
1012 Ga0501081_0697739 3300049743 Bacteria 762
1013 Ga0501081_0892874 3300049743 Unclassified 670
1014 Ga0501081_0899504 3300049743 Bacteria 667
1015 Ga0501083_0055749 3300049744 Bacteria 2649
1016 Ga0501083_0058318 3300049744 Bacteria 2583
1017 Ga0501083_0061119 3300049744 Bacteria 2516
1018 Ga0501083_0808914 3300049744 Bacteria 610
1019 Ga0501083_0911123 3300049744 Bacteria 572
1020 Ga0501278_020062 3300049774 Unclassified 611
1021 Ga0501283_051576 3300049779 Bacteria 730
1022 Ga0501035_0136696 3300049822 Bacteria 2134
1023 Ga0501035_0280317 3300049822 Bacteria 1409
1024 Ga0501035_0436113 3300049822 Bacteria 1086
1025 Ga0501035_0758203 3300049822 Bacteria 778
1026 Ga0501035_0895137 3300049822 Bacteria 703
1027 Ga0501044_0269548 3300049823 Bacteria 1639
1028 Ga0501045_0010104 3300049824 Bacteria 6605
1029 Ga0501045_0068872 3300049824 Bacteria 2600
1030 Ga0501045_0079383 3300049824 Bacteria 2419
1031 Ga0501045_0101139 3300049824 Bacteria 2134
1032 Ga0501045_0147647 3300049824 Bacteria 1749
1033 Ga0501045_0149372 3300049824 Bacteria 1738
1034 Ga0501045_0362199 3300049824 Bacteria 1079
1035 Ga0501045_0460770 3300049824 Unclassified 945
1036 Ga0501045_0575716 3300049824 Bacteria 834
1037 Ga0501045_1141112 3300049824 Bacteria 569
1038 Ga0501045_1222943 3300049824 Unclassified 548
1039 Ga0501045_1379253 3300049824 Bacteria 512
1040 nmdc:mga05p37_1100326_c1 3300050507 Bacteria 832
1041 nmdc:mga05p37_110352_c1 3300050507 Bacteria 2692
1042 nmdc:mga05p37_1132819_c1 3300050507 Unclassified 816
1043 nmdc:mga05p37_1180363_c1 3300050507 Bacteria 793
1044 nmdc:mga05p37_1258469_c1 3300050507 Bacteria 758
1045 nmdc:mga05p37_155527_c1 3300050507 Bacteria 2795
1046 nmdc:mga05p37_15726_c1 3300050507 Bacteria 9097
1047 nmdc:mga05p37_211497_c1 3300050507 Bacteria 2344
1048 nmdc:mga05p37_21826_c1 3300050507 Bacteria 7756
1049 nmdc:mga05p37_2251_c1 3300050507 Bacteria 22477
1050 nmdc:mga05p37_238943_c1 3300050507 Bacteria 2186
1051 nmdc:mga05p37_244871_c1 3300050507 Bacteria 2153
1052 nmdc:mga05p37_248985_c1 3300050507 Unclassified 2132
1053 nmdc:mga05p37_253510_c1 3300050507 Bacteria 2110
1054 nmdc:mga05p37_267068_c1 3300050507 Bacteria 2046
1055 nmdc:mga05p37_26908_c1 3300050507 Bacteria 6998
1056 nmdc:mga05p37_283869_c1 3300050507 Bacteria 1973
1057 nmdc:mga05p37_28806_c1 3300050507 Bacteria 6775
1058 nmdc:mga05p37_32462_c1 3300050507 Bacteria 6384
1059 nmdc:mga05p37_33645_c1 3300050507 Bacteria 6278
1060 nmdc:mga05p37_37967_c1 3300050507 Bacteria 5907
1061 nmdc:mga05p37_42690_c1 3300050507 Bacteria 5574
1062 nmdc:mga05p37_435145_c1 3300050507 Bacteria 1523
1063 nmdc:mga05p37_679336_c1 3300050507 Bacteria 1148
1064 nmdc:mga05p37_679661_c1 3300050507 Bacteria 1147
1065 nmdc:mga05p37_699980_c1 3300050507 Bacteria 1126
1066 nmdc:mga05p37_884_c1 3300050507 Bacteria 33781
1067 nmdc:mga09592_131544_c1 3300050508 Bacteria 2153
1068 nmdc:mga09592_1448248_c1 3300050508 Bacteria 560
1069 nmdc:mga09592_1777_c1 3300050508 Bacteria 17321
1070 nmdc:mga09592_249354_c1 3300050508 Bacteria 1539
1071 nmdc:mga09592_29903_c1 3300050508 Bacteria 4531
1072 nmdc:mga09592_356872_c1 3300050508 Bacteria 1265
1073 nmdc:mga09592_51707_c1 3300050508 Bacteria 3467
1074 nmdc:mga09592_5306_c1 3300050508 Bacteria 10473
1075 nmdc:mga09592_54032_c1 3300050508 Bacteria 3393
1076 nmdc:mga09592_561458_c1 3300050508 Bacteria 980
1077 nmdc:mga09592_562764_c1 3300050508 Bacteria 979
1078 nmdc:mga09592_67410_c1 3300050508 Bacteria 3035
1079 nmdc:mga09592_67810_c1 3300050508 Bacteria 3026
1080 nmdc:mga09592_765792_c1 3300050508 Unclassified 818
1081 nmdc:mga09592_932156_c1 3300050508 Unclassified 729
1082 nmdc:mga0qj67_101677_c1 3300050509 Bacteria 2318
1083 nmdc:mga0qj67_11104_c1 3300050509 Bacteria 6744
1084 nmdc:mga0qj67_1239392_c1 3300050509 Bacteria 579
1085 nmdc:mga0qj67_130450_c1 3300050509 Bacteria 2036
1086 nmdc:mga0qj67_142244_c1 3300050509 Bacteria 1945
1087 nmdc:mga0qj67_4378_c1 3300050509 Bacteria 10227
1088 nmdc:mga0qj67_677049_c1 3300050509 Unclassified 822
1089 nmdc:mga0qj67_807740_c1 3300050509 Bacteria 742
1090 nmdc:mga0qj67_82973_c1 3300050509 Bacteria 2570
1091 nmdc:mga0qj67_989494_c1 3300050509 Bacteria 660
1092 nmdc:mga06r32_1066955_c1 3300050510 Bacteria 758
1093 nmdc:mga06r32_115765_c1 3300050510 Bacteria 2641
1094 nmdc:mga06r32_137586_c1 3300050510 Bacteria 2417
1095 nmdc:mga06r32_1559_c1 3300050510 Bacteria 20685
1096 nmdc:mga06r32_1588156_c1 3300050510 Bacteria 593
1097 nmdc:mga06r32_163048_c1 3300050510 Bacteria 2212
1098 nmdc:mga06r32_163801_c1 3300050510 Bacteria 2206
1099 nmdc:mga06r32_171563_c1 3300050510 Unclassified 2153
1100 nmdc:mga06r32_19745_c1 3300050510 Bacteria 6192
1101 nmdc:mga06r32_25988_c1 3300050510 Bacteria 5455
1102 nmdc:mga06r32_297000_c1 3300050510 Bacteria 1602
1103 nmdc:mga06r32_324564_c1 3300050510 Bacteria 1524
1104 nmdc:mga06r32_3506_c1 3300050510 Bacteria 14007
1105 nmdc:mga06r32_362_c1 3300050510 Bacteria 38094
1106 nmdc:mga06r32_386526_c1 3300050510 Bacteria 1382
1107 nmdc:mga06r32_40659_c1 3300050510 Bacteria 4416
1108 nmdc:mga06r32_929252_c1 3300050510 Bacteria 825
1109 nmdc:mga06r32_96178_c1 3300050510 Bacteria 2900
1110 nmdc:mga06r32_969206_c1 3300050510 Unclassified 804
1111 nmdc:mga08y16_1133829_c1 3300050511 Unclassified 756
1112 nmdc:mga08y16_1522697_c1 3300050511 Bacteria 629
1113 nmdc:mga08y16_15473_c1 3300050511 Bacteria 8024
1114 nmdc:mga08y16_1799662_c1 3300050511 Unclassified 566
1115 nmdc:mga08y16_182510_c1 3300050511 Bacteria 2178
1116 nmdc:mga08y16_36304_c1 3300050511 Bacteria 5176
1117 nmdc:mga08y16_413383_c1 3300050511 Bacteria 1379
1118 nmdc:mga08y16_445626_c1 3300050511 Bacteria 1321
1119 nmdc:mga08y16_476958_c1 3300050511 Bacteria 1270
1120 nmdc:mga08y16_50063_c1 3300050511 Bacteria 4372
1121 nmdc:mga08y16_557128_c1 3300050511 Bacteria 1159
1122 nmdc:mga08y16_732373_c1 3300050511 Bacteria 986
1123 nmdc:mga0n895_1450178_c1 3300050512 Bacteria 654
1124 nmdc:mga0n895_1465383_c1 3300050512 Bacteria 650
1125 nmdc:mga0n895_1520_c1 3300050512 Bacteria 17416
1126 nmdc:mga0n895_1697_c1 3300050512 Bacteria 16647
1127 nmdc:mga0n895_173687_c1 3300050512 Bacteria 2186
1128 nmdc:mga0n895_192324_c1 3300050512 Unclassified 2071
1129 nmdc:mga0n895_20759_c1 3300050512 Bacteria 6133
1130 nmdc:mga0n895_341327_c1 3300050512 Bacteria 1517
1131 nmdc:mga0n895_367939_c1 3300050512 Bacteria 1456
1132 nmdc:mga0n895_394649_c1 3300050512 Bacteria 1399
1133 nmdc:mga0n895_447315_c1 3300050512 Bacteria 1305
1134 nmdc:mga0n895_46099_c1 3300050512 Bacteria 4257
1135 nmdc:mga0n895_50521_c1 3300050512 Bacteria 4077
1136 nmdc:mga0n895_61775_c1 3300050512 Bacteria 3700
1137 nmdc:mga0n895_851566_c1 3300050512 Bacteria 899
1138 nmdc:mga0rr50_1155491_c1 3300050513 Bacteria 658
1139 nmdc:mga0rr50_12829_c1 3300050513 Bacteria 5431
1140 nmdc:mga0rr50_143427_c1 3300050513 Bacteria 1923
1141 nmdc:mga0rr50_168945_c1 3300050513 Unclassified 1781
1142 nmdc:mga0rr50_1858396_c1 3300050513 Unclassified 506
1143 nmdc:mga0rr50_197893_c1 3300050513 Bacteria 1650
1144 nmdc:mga0rr50_229826_c1 3300050513 Unclassified 1534
1145 nmdc:mga0rr50_313029_c1 3300050513 Bacteria 1315
1146 nmdc:mga0rr50_406919_c1 3300050513 Bacteria 1150
1147 nmdc:mga0rr50_508512_c1 3300050513 Bacteria 1025
1148 nmdc:mga0rr50_51575_c1 3300050513 Bacteria 3053
1149 nmdc:mga0rr50_590629_c1 3300050513 Bacteria 947
1150 nmdc:mga0rr50_78208_c1 3300050513 Bacteria 2545
1151 nmdc:mga0rr50_993647_c1 3300050513 Bacteria 715
1152 nmdc:mga08x19_15509_c1 3300050514 Bacteria 4637
1153 nmdc:mga08x19_192355_c1 3300050514 Unclassified 1396
1154 nmdc:mga08x19_22197_c1 3300050514 Bacteria 3929
1155 nmdc:mga08x19_241508_c1 3300050514 Bacteria 1245
1156 nmdc:mga08x19_482919_c1 3300050514 Bacteria 874
1157 nmdc:mga08x19_517813_c1 3300050514 Bacteria 843
1158 nmdc:mga08x19_65966_c1 3300050514 Bacteria 2352
1159 nmdc:mga0a205_105832_c1 3300050515 Bacteria 2712
1160 nmdc:mga0a205_16603_c1 3300050515 Bacteria 6895
1161 nmdc:mga0a205_2509_c1 3300050515 Bacteria 16179
1162 nmdc:mga0a205_27126_c1 3300050515 Bacteria 5468
1163 nmdc:mga0a205_314036_c1 3300050515 Bacteria 1026
1164 nmdc:mga0a205_353568_c1 3300050515 Unclassified 1336
1165 nmdc:mga0a205_36141_c2 3300050515 Bacteria 3744
1166 nmdc:mga0a205_466869_c1 3300050515 Bacteria 1121
1167 nmdc:mga0a205_478541_c1 3300050515 Bacteria 1104
1168 nmdc:mga0a205_627338_c1 3300050515 Bacteria 927
1169 nmdc:mga0a205_678302_c1 3300050515 Bacteria 881
1170 nmdc:mga0a205_73535_c1 3300050515 Bacteria 3302
1171 nmdc:mga0a205_78091_c1 3300050515 Bacteria 3198
1172 nmdc:mga0a205_924248_c1 3300050515 Bacteria 719
1173 nmdc:mga0a205_9702_c1 3300050515 Bacteria 8814
1174 nmdc:mga0a205_972462_c1 3300050515 Bacteria 696
1175 Ga0501084_0012540 3300054114 Bacteria 7020
1176 Ga0501084_0028194 3300054114 Bacteria 4692
1177 Ga0501084_0044028 3300054114 Bacteria 3735
1178 Ga0501084_0097990 3300054114 Bacteria 2462
1179 Ga0501084_0111619 3300054114 Bacteria 2297
1180 Ga0501084_0130734 3300054114 Bacteria 2113
1181 Ga0501084_0142094 3300054114 Bacteria 2021
1182 Ga0501084_0212404 3300054114 Bacteria 1632
1183 Ga0501084_0557616 3300054114 Bacteria 968
1184 Ga0501084_0576130 3300054114 Bacteria 951
1185 Ga0501084_1417945 3300054114 Unclassified 582
1186 Ga0501084_1558857 3300054114 Bacteria 552
1187 Ga0590077_013271 3300059426 Bacteria 1713
1188 Ga0501082_0000590 3300060353 Bacteria 32111
1189 Ga0501082_0003964 3300060353 Bacteria 12924
1190 Ga0501082_0008208 3300060353 Bacteria 9008
1191 Ga0501082_0015947 3300060353 Bacteria 6463
1192 Ga0501082_0072479 3300060353 Bacteria 2967
1193 Ga0501082_0100781 3300060353 Bacteria 2498
1194 Ga0501082_0295835 3300060353 Bacteria 1410
1195 Ga0501082_0488058 3300060353 Bacteria 1077
1196 Ga0501082_1469968 3300060353 Bacteria 595
1197 Ga0501082_1551098 3300060353 Bacteria 578
1198 Ga0530510_0002307 3300061734 Bacteria 13077
1199 Ga0530510_0022455 3300061734 Bacteria 4495
1200 Ga0530510_0128373 3300061734 Bacteria 1864
1201 Ga0530510_0178412 3300061734 Bacteria 1574
1202 Ga0530510_0209720 3300061734 Bacteria 1447
1203 Ga0530510_0234774 3300061734 Bacteria 1364
1204 Ga0530510_0278861 3300061734 Bacteria 1248
1205 Ga0530510_0325584 3300061734 Bacteria 1152
1206 Ga0530510_0338363 3300061734 Bacteria 1129
1207 Ga0530510_0372839 3300061734 Bacteria 1074
1208 Ga0530510_0413162 3300061734 Unclassified 1018
1209 Ga0530510_0640856 3300061734 Bacteria 809
1210 Ga0530510_0694398 3300061734 Bacteria 775
1211 Ga0530510_0827297 3300061734 Archaea 707
1212 Ga0530510_0954375 3300061734 Bacteria 656
1213 Ga0530510_1248356 3300061734 Unclassified 570
1214 Ga0530510_1412858 3300061734 Unclassified 534
1215 Ga0501084_0907619
1216 JGI24741J21665_1023992
1217 JGI25406J46586_10015974
1218 JGI25406J46586_10065332
1219 JGI25406J46586_10081419
1220 JGI25406J46586_10142270
1221 JGI26128J50194_1010636
1222 JGI26145J50221_1002117
1223 JGI25405J52794_10004720
1224 Ga0058859_10037472
1225 Ga0058859_10768951
1226 Ga0058859_11391544
1227 Ga0058859_11732724
1228 Ga0058861_10477873
1229 Ga0058860_10876418
1230 Ga0058860_11679250
1231 Ga0058860_12106589
1232 Ga0058860_12170436
1233 Ga0058862_12377746
1234 Ga0065704_10031781
1235 Ga0065715_10562705
1236 Ga0065707_10016615
1237 Ga0065707_10285750
1238 Ga0065707_10311258
1239 Ga0065707_10350567
1240 Ga0065707_10402663
1241 Ga0065707_10553988
1242 Ga0065707_10558055
1243 Ga0065707_11162912
1244 Ga0070676_10001923
1245 Ga0070676_10051948
1246 Ga0070676_11286300
1247 Ga0070690_100075396
1248 Ga0070690_100700809
1249 Ga0070670_100859021
1250 Ga0070670_100883191
1251 Ga0068869_100000334
1252 Ga0068869_100049437
1253 Ga0068869_101391491
1254 Ga0070680_100014161
1255 Ga0070680_100089536
1256 Ga0070680_100301356
1257 Ga0070680_100962446
1258 Ga0070689_100052388
1259 Ga0070689_100070990
1260 Ga0070689_101377873
1261 Ga0070691_10019467
1262 Ga0070691_10045540
1263 Ga0070691_10301199
1264 Ga0070692_10141383
1265 Ga0070669_100104750
1266 Ga0070669_100116043
1267 Ga0070669_100302428
1268 Ga0070671_101328713
1269 Ga0070671_101578801
1270 Ga0070674_100173260
1271 Ga0070688_100144754
1272 Ga0070688_101208199
1273 Ga0070688_101811686
1274 Ga0070659_100000322
1275 Ga0070667_101889438
1276 Ga0070703_10006125
1277 Ga0070703_10028057
1278 Ga0070703_10065515
1279 Ga0070709_10029454
1280 Ga0070709_10104135
1281 Ga0070701_10036232
1282 Ga0070701_10036494
1283 Ga0070701_10187032
1284 Ga0070701_10305114
1285 Ga0070701_10492082
1286 Ga0070701_10722042
1287 Ga0070701_11268607
1288 Ga0070711_100022583
1289 Ga0070711_102073594
1290 Ga0070705_100020861
1291 Ga0070705_100021124
1292 Ga0070705_100069587
1293 Ga0070705_100193146
1294 Ga0070705_100324041
1295 Ga0070705_100539213
1296 Ga0070705_101848785
1297 Ga0070700_100050887
1298 Ga0070700_100185166
1299 Ga0070700_100669202
1300 Ga0070694_100038085
1301 Ga0070694_100237880
1302 Ga0070694_100297029
1303 Ga0070694_100388625
1304 Ga0070694_100494077
1305 Ga0070694_100593866
1306 Ga0070694_100812869
1307 Ga0070694_100935640
1308 Ga0070694_101348941
1309 Ga0070694_101642185
1310 Ga0070708_100032836
1311 Ga0070708_100053892
1312 Ga0070708_100079838
1313 Ga0070708_100081247
1314 Ga0070708_100135531
1315 Ga0070708_100284779
1316 Ga0070708_100381582
1317 Ga0070708_100423040
1318 Ga0070708_100423041
1319 Ga0070708_100457172
1320 Ga0070708_100488380
1321 Ga0070708_100518276
1322 Ga0070708_100527075
1323 Ga0070708_100533289
1324 Ga0070708_100533721
1325 Ga0070708_100555901
1326 Ga0070662_100028042
1327 Ga0070681_10244267
1328 Ga0068867_100166681
1329 Ga0068867_101780190
1330 Ga0068867_102144540
1331 Ga0070685_10128319
1332 Ga0070685_11038909
1333 Ga0070706_100014993
1334 Ga0070706_100046579
1335 Ga0070706_100084670
1336 Ga0070706_100100610
1337 Ga0070706_100203897
1338 Ga0070706_100223772
1339 Ga0070706_100238354
1340 Ga0070706_100371264
1341 Ga0070706_100653166
1342 Ga0070706_100699029
1343 Ga0070706_100925814
1344 Ga0070706_101020707
1345 Ga0070706_101966398
1346 Ga0070706_101982410
1347 Ga0070707_100013537
1348 Ga0070707_100028869
1349 Ga0070707_100033928
1350 Ga0070707_100129381
1351 Ga0070707_100256321
1352 Ga0070707_100482336
1353 Ga0070707_100562254
1354 Ga0070707_100704161
1355 Ga0070707_100743378
1356 Ga0070707_100884667
1357 Ga0070707_101015459
1358 Ga0070707_101329939
1359 Ga0070707_101545458
1360 Ga0070707_101783354
1361 Ga0070707_102007936
1362 Ga0070698_100024909
1363 Ga0070698_100030245
1364 Ga0070698_100063832
1365 Ga0070698_100103161
1366 Ga0070698_100277816
1367 Ga0070698_100330904
1368 Ga0070698_100391629
1369 Ga0070698_100484864
1370 Ga0070698_100493587
1371 Ga0070698_100502150
1372 Ga0070698_100514055
1373 Ga0070698_100755238
1374 Ga0070698_101229474
1375 Ga0070698_101315336
1376 Ga0070699_100015968
1377 Ga0070699_100026413
1378 Ga0070699_100027923
1379 Ga0070699_100036833
1380 Ga0070699_100090597
1381 Ga0070699_100141101
1382 Ga0070699_100169131
1383 Ga0070699_100256918
1384 Ga0070699_100324142
1385 Ga0070699_100340512
1386 Ga0070699_100362695
1387 Ga0070699_100385746
1388 Ga0070699_100410261
1389 Ga0070699_100629964
1390 Ga0070699_100858654
1391 Ga0070699_101194462
1392 Ga0070699_101353940
1393 Ga0070699_101646263
1394 Ga0070679_100633469
1395 Ga0070684_100188934
1396 Ga0070697_100002001
1397 Ga0070697_100002329
1398 Ga0070697_100007571
1399 Ga0070697_100100330
1400 Ga0070697_100162253
1401 Ga0070697_100210323
1402 Ga0070697_100218691
1403 Ga0070697_100236014
1404 Ga0070697_100248193
1405 Ga0070697_100610952
1406 Ga0070697_100612024
1407 Ga0070697_100731861
1408 Ga0070697_100930804
1409 Ga0070697_101457695
1410 Ga0070697_102014792
1411 Ga0068853_102121921
1412 Ga0070672_100078055
1413 Ga0070672_101816681
1414 Ga0070695_100006290
1415 Ga0070695_100006368
1416 Ga0070695_100020952
1417 Ga0070695_100023186
1418 Ga0070695_100044183
1419 Ga0070695_100399784
1420 Ga0070696_100005955
1421 Ga0070696_100010264
1422 Ga0070696_100100169
1423 Ga0070696_100189848
1424 Ga0070696_100260746
1425 Ga0070696_100295415
1426 Ga0070696_100449093
1427 Ga0070696_100524567
1428 Ga0070696_101760659
1429 Ga0070693_100035214
1430 Ga0070693_100124583
1431 Ga0070693_100211406
1432 Ga0070693_100746451
1433 Ga0070693_101526237
1434 Ga0070704_100026326
1435 Ga0070704_100076784
1436 Ga0070704_100092351
1437 Ga0070704_100226480
1438 Ga0070704_100413300
1439 Ga0070704_100633338
1440 Ga0070704_100789200
1441 Ga0070704_100841855
1442 Ga0070704_101605529
1443 Ga0068855_101168026
1444 Ga0070664_101135791
1445 Ga0068857_100082144
1446 Ga0068857_100415893
1447 Ga0068857_100654978
1448 Ga0068854_100738170
1449 Ga0070702_100145400
1450 Ga0070702_100360774
1451 Ga0068852_100658631
1452 Ga0068859_100043002
1453 Ga0068859_100137350
1454 Ga0068859_100478458
1455 Ga0068859_100487835
1456 Ga0068859_100532157
1457 Ga0068859_100664112
1458 Ga0068859_100804701
1459 Ga0068859_101325754
1460 Ga0068866_10191693
1461 Ga0068866_11314064
1462 Ga0068861_100213449
1463 Ga0068861_100258332
1464 Ga0068861_100267524
1465 Ga0068861_100640112
1466 Ga0068861_100829508
1467 Ga0068870_10000479
1468 Ga0068870_11158496
1469 Ga0068870_11202351
1470 Ga0068863_100058489
1471 Ga0068863_100325206
1472 Ga0068863_100915148
1473 Ga0068863_102203784
1474 Ga0068858_100361958
1475 Ga0068858_100497511
1476 Ga0068860_100202881
1477 Ga0068860_100227490
1478 Ga0068860_100427555
1479 Ga0068860_100468100
1480 Ga0068860_100547209
1481 Ga0068860_100720769
1482 Ga0068860_100803526
1483 Ga0068860_100932783
1484 Ga0068860_101715855
1485 Ga0068862_100003646
1486 Ga0068862_100044850
1487 Ga0068862_100318117
1488 Ga0068862_100320095
1489 Ga0068862_100480680
1490 Ga0068862_100550967
1491 Ga0068862_100605410
1492 Ga0081455_10001120
1493 Ga0081455_10004905
1494 Ga0081455_10295174
1495 Ga0081455_10308343
1496 Ga0081538_10005259
1497 Ga0081538_10045831
1498 Ga0081538_10046485
1499 Ga0081538_10055970
1500 Ga0081538_10066023
1501 Ga0081538_10381163
1502 Ga0081540_1082094
1503 Ga0081540_1135920
1504 Ga0081539_10000259
1505 Ga0081539_10000841
1506 Ga0081539_10006865
1507 Ga0081539_10010137
1508 Ga0081539_10149888
1509 Ga0081539_10164832
1510 Ga0081539_10254463
1511 Ga0070717_11732925
1512 Ga0075432_10594147
1513 Ga0070715_11019284
1514 Ga0070716_100012253
1515 Ga0070712_100003108
1516 Ga0070712_100498250
1517 Ga0075427_10038029
1518 Ga0068871_100880885
1519 Ga0068871_101396904
1520 Ga0075428_100001502
1521 Ga0075428_100002009
1522 Ga0075428_100026534
1523 Ga0075428_100041452
1524 Ga0075428_100115759
1525 Ga0075428_100142724
1526 Ga0075428_100210223
1527 Ga0075428_100316931
1528 Ga0075428_100349207
1529 Ga0075428_100360396
1530 Ga0075428_100401493
1531 Ga0075428_100486615
1532 Ga0075428_100533008
1533 Ga0075428_101510925
1534 Ga0075428_102096018
1535 Ga0075430_100002189
1536 Ga0075430_100003206
1537 Ga0075430_100017625
1538 Ga0075430_100032764
1539 Ga0075430_100073903
1540 Ga0075430_100148907
1541 Ga0075430_100156811
1542 Ga0075430_100177539
1543 Ga0075430_100270821
1544 Ga0075430_100479217
1545 Ga0075430_100637374
1546 Ga0075430_100762620
1547 Ga0075430_100965925
1548 Ga0075430_101461119
1549 Ga0075430_101488046
1550 Ga0075430_101494151
1551 Ga0075431_100000176
1552 Ga0075431_100000454
1553 Ga0075431_100005244
1554 Ga0075431_100007148
1555 Ga0075431_100008987
1556 Ga0075431_100014992
1557 Ga0075431_100021484
1558 Ga0075431_100029934
1559 Ga0075431_100083755
1560 Ga0075431_100184495
1561 Ga0075431_100194700
1562 Ga0075431_100212443
1563 Ga0075431_100239773
1564 Ga0075431_100292451
1565 Ga0075431_100322170
1566 Ga0075431_100462617
1567 Ga0075431_100608758
1568 Ga0075431_100707369
1569 Ga0075431_101439767
1570 Ga0075431_102077154
1571 Ga0075433_10002079
1572 Ga0075433_10012666
1573 Ga0075433_10014926
1574 Ga0075433_10017004
1575 Ga0075433_10057274
1576 Ga0075433_10057868
1577 Ga0075433_10075818
1578 Ga0075433_10119494
1579 Ga0075433_10127732
1580 Ga0075433_10203565
1581 Ga0075433_10213143
1582 Ga0075433_10287774
1583 Ga0075433_10328910
1584 Ga0075433_10396083
1585 Ga0075433_10551017
1586 Ga0075433_10580247
1587 Ga0075433_10880295
1588 Ga0075433_11199886
1589 Ga0075434_100001605
1590 Ga0075434_100007481
1591 Ga0075434_100025554
1592 Ga0075434_100034888
1593 Ga0075434_100057348
1594 Ga0075434_100077328
1595 Ga0075434_100094066
1596 Ga0075434_100125498
1597 Ga0075434_100131465
1598 Ga0075434_100144204
1599 Ga0075434_100277505
1600 Ga0075434_100523162
1601 Ga0075434_100715273
1602 Ga0075434_100766332
1603 Ga0075434_101016579
1604 Ga0075434_101190247
1605 Ga0075434_102610215
1606 Ga0075429_100000055
1607 Ga0075429_100007890
1608 Ga0075429_100022608
1609 Ga0075429_100028515
1610 Ga0075429_100056122
1611 Ga0075429_100072646
1612 Ga0075429_100222919
1613 Ga0075429_100254177
1614 Ga0075429_100300019
1615 Ga0075429_100339680
1616 Ga0075429_100396344
1617 Ga0075429_100406714
1618 Ga0075429_100646519
1619 Ga0075429_100803691
1620 Ga0075429_100995396
1621 Ga0075429_101178267
1622 Ga0075429_101489652
1623 Ga0075429_101565412
1624 Ga0068865_100161425
1625 Ga0068865_100604613
1626 Ga0068865_100950178
1627 Ga0075436_100044560
1628 Ga0075436_100270512
1629 Ga0075436_100391039
1630 Ga0075436_100422956
1631 Ga0075436_100733931
1632 Ga0075436_100746503
1633 Ga0097620_100043002
1634 Ga0097620_100137352
1635 Ga0097620_100478466
1636 Ga0097620_100487867
1637 Ga0097620_100532249
1638 Ga0097620_100664144
1639 Ga0097620_100804702
1640 Ga0097620_101325610
1641 Ga0097620_102159380
1642 Ga0075435_100018364
1643 Ga0075435_100032123
1644 Ga0075435_100043154
1645 Ga0075435_100045716
1646 Ga0075435_100076147
1647 Ga0075435_100076755
1648 Ga0075435_100088292
1649 Ga0075435_100118725
1650 Ga0075435_100151111
1651 Ga0075435_100283061
1652 Ga0075435_100323116
1653 Ga0075435_100349277
1654 Ga0075435_100370291
1655 Ga0075435_100876189
1656 Ga0075435_101096777
1657 Ga0099794_10006037
1658 Ga0099794_10023163
1659 Ga0099794_10146926
1660 Ga0099794_10191730
1661 Ga0099794_10230289
1662 Ga0099794_10362193
1663 Ga0099794_10426923
1664 Ga0099795_10341141
1665 Ga0105240_12284995
1666 Ga0111539_10000988
1667 Ga0111539_10003789
1668 Ga0111539_10006645
1669 Ga0111539_10045721
1670 Ga0111539_10086616
1671 Ga0111539_10201876
1672 Ga0111539_10316459
1673 Ga0111539_10415838
1674 Ga0111539_10914019
1675 Ga0111539_10974854
1676 Ga0111539_11927611
1677 Ga0111539_12503783
1678 Ga0111539_12614628
1679 Ga0111539_13235363
1680 Ga0111539_13510825
1681 Ga0105245_10049483
1682 Ga0105247_10050757
1683 Ga0105247_10341310
1684 Ga0105247_11009974
1685 Ga0105247_11377224
1686 Ga0114129_10000065
1687 Ga0114129_10001130
1688 Ga0114129_10001403
1689 Ga0114129_10001601
1690 Ga0114129_10007826
1691 Ga0114129_10015668
1692 Ga0114129_10033268
1693 Ga0114129_10037554
1694 Ga0114129_10044048
1695 Ga0114129_10096552
1696 Ga0114129_10121705
1697 Ga0114129_10164507
1698 Ga0114129_10180641
1699 Ga0114129_10180666
1700 Ga0114129_10183077
1701 Ga0114129_10216436
1702 Ga0114129_10238739
1703 Ga0114129_10297194
1704 Ga0114129_10315764
1705 Ga0114129_10344159
1706 Ga0114129_10363519
1707 Ga0114129_10372306
1708 Ga0114129_10472947
1709 Ga0114129_10523536
1710 Ga0114129_10721768
1711 Ga0114129_10862026
1712 Ga0114129_10922765
1713 Ga0114129_10955877
1714 Ga0114129_11005383
1715 Ga0114129_11316454
1716 Ga0114129_11377910
1717 Ga0114129_11489283
1718 Ga0114129_12117230
1719 Ga0105243_10044580
1720 Ga0105243_10428911
1721 Ga0105243_10545355
1722 Ga0105243_11009294
1723 Ga0105243_11215541
1724 Ga0105243_12316140
1725 Ga0105241_10058914
1726 Ga0105241_10497807
1727 Ga0105241_11189491
1728 Ga0105241_11623554
1729 Ga0105242_10076521
1730 Ga0105242_10370767
1731 Ga0105242_10438781
1732 Ga0105242_11120737
1733 Ga0105242_13160908
1734 Ga0105248_10100073
1735 Ga0105237_12301482
1736 Ga0105249_10057295
1737 Ga0105249_10094642
1738 Ga0105249_10172525
1739 Ga0105249_10273859
1740 Ga0105249_10439413
1741 Ga0105249_10788667
1742 Ga0105239_11916496
1743 Ga0105246_10041648
1744 Ga0105246_10611326
1745 Ga0105246_11201682
1746 Ga0105246_11940083
1747 Ga0157371_10801924
1748 Ga0157378_10027876
1749 Ga0157378_10637049
1750 Ga0163162_10044756
1751 Ga0163162_10070927
1752 Ga0163162_10386526
1753 Ga0163162_10410611
1754 Ga0163162_11186867
1755 Ga0157372_10050672
1756 Ga0157375_10473871
1757 Ga0157375_11137438
1758 Ga0163163_13244224
1759 Ga0157380_10197471
1760 Ga0157380_10441541
1761 Ga0157380_10576821
1762 Ga0157380_11688098
1763 Ga0157380_12702228
1764 Ga0157377_10286814
1765 Ga0157377_10616853
1766 Ga0157377_10889241
1767 Ga0157379_12424182
1768 Ga0157376_10460104
1769 Ga0163161_10392199
1770 Ga0163161_11027598
1771 Ga0163161_11163210
1772 Ga0163161_11703623
1773 Ga0206354_10623338
1774 Ga0207653_10015422
1775 Ga0207653_10015830
1776 Ga0207682_10044511
1777 Ga0207642_10806738
1778 Ga0207710_10281677
1779 Ga0207688_10023247
1780 Ga0207647_10085460
1781 Ga0207699_10090609
1782 Ga0207645_10073602
1783 Ga0207643_10362041
1784 Ga0207643_10428574
1785 Ga0207684_10017845
1786 Ga0207684_10046875
1787 Ga0207684_10066643
1788 Ga0207684_10076849
1789 Ga0207684_10115401
1790 Ga0207684_10146063
1791 Ga0207684_10186113
1792 Ga0207684_10220979
1793 Ga0207684_10228288
1794 Ga0207684_10230747
1795 Ga0207684_10243789
1796 Ga0207684_10286987
1797 Ga0207684_10309994
1798 Ga0207684_10626529
1799 Ga0207684_11056955
1800 Ga0207684_11547467
1801 Ga0207654_10014739
1802 Ga0207654_10095525
1803 Ga0207707_10832802
1804 Ga0207695_11038225
1805 Ga0207693_10023774
1806 Ga0207693_10207779
1807 Ga0207663_11284334
1808 Ga0207660_10017368
1809 Ga0207660_10530675
1810 Ga0207646_10003306
1811 Ga0207646_10012150
1812 Ga0207646_10056835
1813 Ga0207646_10124179
1814 Ga0207646_10153048
1815 Ga0207646_10254690
1816 Ga0207646_10311914
1817 Ga0207646_10570958
1818 Ga0207646_10996886
1819 Ga0207681_10054002
1820 Ga0207687_10141402
1821 Ga0207706_10105657
1822 Ga0207686_10042900
1823 Ga0207709_10102591
1824 Ga0207709_10163604
1825 Ga0207709_10298418
1826 Ga0207709_11464781
1827 Ga0207670_10074680
1828 Ga0207670_10116184
1829 Ga0207670_10398600
1830 Ga0207670_10405725
1831 Ga0207670_11334967
1832 Ga0207669_10146448
1833 Ga0207704_10806510
1834 Ga0207704_11112353
1835 Ga0207665_10009574
1836 Ga0207665_10081619
1837 Ga0207691_11166589
1838 Ga0207711_11247224
1839 Ga0207689_10022473
1840 Ga0207689_10057202
1841 Ga0207689_10135414
1842 Ga0207712_10056636
1843 Ga0207712_10150526
1844 Ga0207712_10189338
1845 Ga0207712_10198724
1846 Ga0207712_10291617
1847 Ga0207712_10403047
1848 Ga0207712_10447246
1849 Ga0207668_12014260
1850 Ga0207640_10562098
1851 Ga0207658_11178932
1852 Ga0207677_10154677
1853 Ga0207703_10235825
1854 Ga0207703_10243304
1855 Ga0207703_10926119
1856 Ga0207639_10557621
1857 Ga0207678_10005772
1858 Ga0207678_10619576
1859 Ga0207708_10150904
1860 Ga0207708_10606692
1861 Ga0207708_11025117
1862 Ga0207708_11261945
1863 Ga0207641_10049562
1864 Ga0207641_10256382
1865 Ga0207641_10799444
1866 Ga0207641_11265018
1867 Ga0207648_10027052
1868 Ga0207648_10093158
1869 Ga0207676_10261193
1870 Ga0207674_10027557
1871 Ga0207674_10485084
1872 Ga0207674_10540800
1873 Ga0207675_100021298
1874 Ga0207675_100064080
1875 Ga0207675_100084386
1876 Ga0207675_100144218
1877 Ga0207675_100148087
1878 Ga0207675_100253256
1879 Ga0207675_100926301
1880 Ga0207675_101402014
1881 Ga0207698_12283391
1882 Ga0209969_1000979
1883 Ga0209981_1003308
1884 Ga0209996_1024155
1885 Ga0209995_1000523
1886 Ga0209968_1000756
1887 Ga0209982_1005681
1888 Ga0209970_1000820
1889 Ga0210002_1003031
1890 Ga0209983_1012841
1891 Ga0209588_1073278
1892 Ga0209588_1116201
1893 Ga0209588_1279518
1894 Ga0209971_1001462
1895 Ga0209966_1000550
1896 Ga0209966_1053854
1897 Ga0209998_10000002
1898 Ga0209974_10004164
1899 Ga0209974_10052101
1900 Ga0207428_10000029
1901 Ga0207428_10015779
1902 Ga0207428_10287237
1903 Ga0207428_10692084
1904 Ga0207428_10692209
1905 Ga0207428_10758120
1906 Ga0207428_10822465
1907 Ga0207428_10887603
1908 Ga0268265_10005030
1909 Ga0268265_10135224
1910 Ga0268265_10342345
1911 Ga0268265_10343145
1912 Ga0268265_10387402
1913 Ga0268265_10486832
1914 Ga0268265_10527343
1915 Ga0268265_10788705
1916 Ga0268264_10048001
1917 Ga0268264_10135951
1918 Ga0268264_10359884
1919 Ga0268264_10390947
1920 Ga0268264_10944780
1921 Ga0268264_11709622
1922 Ga0268264_11870514
1923 Ga0307408_100083906
1924 Ga0307408_100287144
1925 Ga0307408_100402043
1926 Ga0307408_100687521
1927 Ga0307408_102320681
1928 Ga0307410_10099053
1929 Ga0307410_10237006
1930 Ga0307406_10174566
1931 Ga0307406_10344045
1932 Ga0307406_10691324
1933 Ga0307406_10763837
1934 Ga0307407_10207759
1935 Ga0307412_10711212
1936 Ga0307409_100072890
1937 Ga0307409_100326957
1938 Ga0307409_100767158
1939 Ga0307409_101911448
1940 Ga0307409_102314454
1941 Ga0307416_100263272
1942 Ga0307416_100403013
1943 Ga0307416_100590797
1944 Ga0307416_101639222
1945 Ga0307414_10365478
1946 Ga0307411_11531950
1947 Ga0307415_100173508
1948 Ga0373930_0029175
1949 Ga0373930_0201732
1950 Ga0373948_0006218
1951 Ga0373948_0090028
1952 Ga0373948_0187837
1953 Ga0373958_0075085
1954 Ga0373959_0093981
1955 Ga0373928_0046790
1956 Ga0373940_0014722
1957 Ga0373940_0068784
1958 Ga0373940_0152528
1959 Ga0373949_0056010
1960 Ga0373949_0088066
1961 Ga0373951_0003011
1962 Ga0373952_0071648
1963 Ga0373952_0184455
1964 Ga0373932_0040503
1965 Ga0373932_0046584
1966 Ga0373932_0099869
1967 Ga0373939_0356843
1968 Ga0373942_0037285
1969 Ga0373942_0039101
1970 Ga0373942_0082600
1971 Ga0373961_0010679
1972 Ga0373962_0004535
1973 Ga0373931_0018968
1974 Ga0373931_0730945
1975 Ga0373947_0921908
1976 Ga0395899_0005874
1977 Ga0395900_0058126
1978 Ga0395900_0060598
1979 Ga0395900_1014230
1980 Ga0395898_0011090
1981 Ga0395898_0388532
1982 Ga0395898_0879210
1983 Ga0395905_0114390
1984 Ga0395901_0001902
1985 Ga0395901_0056556
1986 Ga0242420_065434
1987 Ga0439441_104801
1988 Ga0439448_0005397
1989 Ga0439448_0163148
1990 Ga0439450_036349
1991 Ga0439450_042938
1992 Ga0439463_038456
1993 Ga0450892_005987
1994 Ga0450892_019228
1995 Ga0439434_0300633
1996 Ga0439464_0004479
1997 Ga0439460_0003445
1998 Ga0439460_0120389
1999 Ga0451577_0005116
2000 Ga0451577_0134166
2001 Ga0451577_0210834
2002 Ga0451577_0223371
2003 Ga0451577_0575003
2004 Ga0453683_0003298
2005 Ga0453683_0010733
2006 Ga0453683_0036593
2007 Ga0453683_0082681
2008 Ga0453683_0120282
2009 Ga0453683_0319344
2010 Ga0453683_0383627
2011 Ga0453683_0953772
2012 Ga0453684_0053477
2013 Ga0453684_0066225
2014 Ga0453684_0538781
2015 Ga0453684_1280163
2016 Ga0451576_0015014
2017 Ga0451576_0019925
2018 Ga0451576_0054060
2019 Ga0451576_0092411
2020 Ga0451576_0167119
2021 Ga0451576_0183565
2022 Ga0451576_0312728
2023 Ga0451576_0495161
2024 Ga0451576_0862233
2025 Ga0495603_0210317
2026 Ga0495580_0116499
2027 Ga0495580_0513138
2028 Ga0495584_0208753
2029 Ga0495642_0196532
2030 Ga0495598_0338081
2031 Ga0495609_0425393
2032 Ga0495656_0025609
2033 Ga0495656_0230705
2034 Ga0495658_0598189
2035 Ga0496102_0021070
2036 Ga0496102_0184054
2037 Ga0496102_0347881
2038 Ga0496106_0313507
2039 Ga0496110_0715956
2040 Ga0496113_0202685
2041 Ga0496115_0988944
2042 Ga0501298_064113
2043 Ga0501312_089265
2044 Ga0501031_0133156
2045 Ga0501031_0445964
2046 Ga0501031_0517476
2047 Ga0501032_0651797
2048 Ga0501033_0081589
2049 Ga0501033_0173736
2050 Ga0501033_0199207
2051 Ga0501033_0210334
2052 Ga0501033_0598405
2053 Ga0501034_0227225
2054 Ga0501034_1133471
2055 Ga0501036_0076928
2056 Ga0501036_0093665
2057 Ga0501036_0113050
2058 Ga0501036_0141929
2059 Ga0501036_0323099
2060 Ga0501036_0478492
2061 Ga0501036_0878415
2062 Ga0501036_1222567
2063 Ga0501037_0133885
2064 Ga0501037_0314221
2065 Ga0501037_0326650
2066 Ga0501038_0093693
2067 Ga0501038_0109268
2068 Ga0501038_0151302
2069 Ga0501038_0163670
2070 Ga0501038_0321594
2071 Ga0501039_0032404
2072 Ga0501039_0060402
2073 Ga0501039_0062807
2074 Ga0501039_0092931
2075 Ga0501039_0280055
2076 Ga0501039_0661061
2077 Ga0501039_0841713
2078 Ga0501040_0004023
2079 Ga0501040_0007035
2080 Ga0501040_0027124
2081 Ga0501040_0131582
2082 Ga0501040_0135854
2083 Ga0501040_0263644
2084 Ga0501040_0295877
2085 Ga0501040_0618960
2086 Ga0501040_1278501
2087 Ga0501041_0008676
2088 Ga0501041_0031209
2089 Ga0501041_0039706
2090 Ga0501041_0057523
2091 Ga0501041_0326076
2092 Ga0501041_0480567
2093 Ga0501041_0510507
2094 Ga0501041_0583688
2095 Ga0501041_0651584
2096 Ga0501041_0805304
2097 Ga0501042_0042455
2098 Ga0501042_0046947
2099 Ga0501042_0072132
2100 Ga0501042_0194622
2101 Ga0501042_0279949
2102 Ga0501042_0365701
2103 Ga0501042_0458972
2104 Ga0501042_0480736
2105 Ga0501042_0701790
2106 Ga0501043_0366694
2107 Ga0501043_0804040
2108 Ga0501043_0818233
2109 Ga0501046_0001412
2110 Ga0501046_0053261
2111 Ga0501046_0067845
2112 Ga0501046_0118122
2113 Ga0501046_0191423
2114 Ga0501046_0615268
2115 Ga0501047_0096018
2116 Ga0501048_0018086
2117 Ga0501048_0032371
2118 Ga0501048_0137305
2119 Ga0501048_0980705
2120 Ga0501048_1178235
2121 Ga0501067_0052498
2122 Ga0501067_0068020
2123 Ga0501067_0203095
2124 Ga0501067_0328445
2125 Ga0501068_0012505
2126 Ga0501068_0028353
2127 Ga0501068_0106831
2128 Ga0501068_0306817
2129 Ga0501069_0149453
2130 Ga0501069_0338606
2131 Ga0501069_0513203
2132 Ga0501070_0465116
2133 Ga0501070_0602614
2134 Ga0501070_0616319
2135 Ga0501071_0025805
2136 Ga0501071_0064858
2137 Ga0501071_0420778
2138 Ga0501071_0440965
2139 Ga0501071_0597981
2140 Ga0501071_0677279
2141 Ga0501071_0958676
2142 Ga0501072_0002745
2143 Ga0501072_0076464
2144 Ga0501072_0092542
2145 Ga0501072_0094874
2146 Ga0501072_0122515
2147 Ga0501072_0132086
2148 Ga0501072_0135984
2149 Ga0501072_0145582
2150 Ga0501072_0148893
2151 Ga0501072_0268164
2152 Ga0501072_0270102
2153 Ga0501072_0329255
2154 Ga0501072_0582170
2155 Ga0501072_1306143
2156 Ga0501073_0159577
2157 Ga0501073_1273070
2158 Ga0501074_0040360
2159 Ga0501074_0086047
2160 Ga0501074_0092770
2161 Ga0501074_0165237
2162 Ga0501074_0443923
2163 Ga0501074_0774874
2164 Ga0501074_1115173
2165 Ga0501075_0021502
2166 Ga0501075_0047481
2167 Ga0501075_0084079
2168 Ga0501075_0090646
2169 Ga0501075_0100519
2170 Ga0501075_0116652
2171 Ga0501075_0142078
2172 Ga0501075_0194009
2173 Ga0501075_0235573
2174 Ga0501076_0004216
2175 Ga0501076_0004618
2176 Ga0501076_0014054
2177 Ga0501076_0036531
2178 Ga0501076_0037970
2179 Ga0501076_0064866
2180 Ga0501076_0093057
2181 Ga0501076_0100713
2182 Ga0501076_0127968
2183 Ga0501076_0236400
2184 Ga0501076_0266243
2185 Ga0501076_0526365
2186 Ga0501076_0627479
2187 Ga0501077_0006892
2188 Ga0501077_0010491
2189 Ga0501077_0045422
2190 Ga0501077_0062536
2191 Ga0501077_0072963
2192 Ga0501077_0076492
2193 Ga0501077_0190366
2194 Ga0501077_0218529
2195 Ga0501077_0523112
2196 Ga0501077_0600529
2197 Ga0501079_0001422
2198 Ga0501079_0013655
2199 Ga0501079_0023059
2200 Ga0501079_0032782
2201 Ga0501079_0040925
2202 Ga0501079_0097512
2203 Ga0501079_0298050
2204 Ga0501079_0488187
2205 Ga0501079_0560255
2206 Ga0501079_0585144
2207 Ga0501079_0842389
2208 Ga0501079_1598340
2209 Ga0501080_0029771
2210 Ga0501080_0049896
2211 Ga0501080_0065631
2212 Ga0501080_0158464
2213 Ga0501080_0226355
2214 Ga0501080_0686539
2215 Ga0501081_0002905
2216 Ga0501081_0006389
2217 Ga0501081_0006586
2218 Ga0501081_0018986
2219 Ga0501081_0096106
2220 Ga0501081_0122935
2221 Ga0501081_0437225
2222 Ga0501081_0602178
2223 Ga0501081_0603727
2224 Ga0501081_0605834
2225 Ga0501081_0656585
2226 Ga0501081_0697739
2227 Ga0501081_0892874
2228 Ga0501081_0899504
2229 Ga0501083_0055749
2230 Ga0501083_0058318
2231 Ga0501083_0061119
2232 Ga0501083_0808914
2233 Ga0501083_0911123
2234 Ga0501278_020062
2235 Ga0501283_051576
2236 Ga0501035_0136696
2237 Ga0501035_0280317
2238 Ga0501035_0436113
2239 Ga0501035_0758203
2240 Ga0501035_0895137
2241 Ga0501044_0269548
2242 Ga0501045_0010104
2243 Ga0501045_0068872
2244 Ga0501045_0079383
2245 Ga0501045_0101139
2246 Ga0501045_0147647
2247 Ga0501045_0149372
2248 Ga0501045_0362199
2249 Ga0501045_0460770
2250 Ga0501045_0575716
2251 Ga0501045_1141112
2252 Ga0501045_1222943
2253 Ga0501045_1379253
2254 nmdc:mga05p37_1100326_c1
2255 nmdc:mga05p37_110352_c1
2256 nmdc:mga05p37_1132819_c1
2257 nmdc:mga05p37_1180363_c1
2258 nmdc:mga05p37_1258469_c1
2259 nmdc:mga05p37_155527_c1
2260 nmdc:mga05p37_15726_c1
2261 nmdc:mga05p37_211497_c1
2262 nmdc:mga05p37_21826_c1
2263 nmdc:mga05p37_2251_c1
2264 nmdc:mga05p37_238943_c1
2265 nmdc:mga05p37_244871_c1
2266 nmdc:mga05p37_248985_c1
2267 nmdc:mga05p37_253510_c1
2268 nmdc:mga05p37_267068_c1
2269 nmdc:mga05p37_26908_c1
2270 nmdc:mga05p37_283869_c1
2271 nmdc:mga05p37_28806_c1
2272 nmdc:mga05p37_32462_c1
2273 nmdc:mga05p37_33645_c1
2274 nmdc:mga05p37_37967_c1
2275 nmdc:mga05p37_42690_c1
2276 nmdc:mga05p37_435145_c1
2277 nmdc:mga05p37_679336_c1
2278 nmdc:mga05p37_679661_c1
2279 nmdc:mga05p37_699980_c1
2280 nmdc:mga05p37_884_c1
2281 nmdc:mga09592_131544_c1
2282 nmdc:mga09592_1448248_c1
2283 nmdc:mga09592_1777_c1
2284 nmdc:mga09592_249354_c1
2285 nmdc:mga09592_29903_c1
2286 nmdc:mga09592_356872_c1
2287 nmdc:mga09592_51707_c1
2288 nmdc:mga09592_5306_c1
2289 nmdc:mga09592_54032_c1
2290 nmdc:mga09592_561458_c1
2291 nmdc:mga09592_562764_c1
2292 nmdc:mga09592_67410_c1
2293 nmdc:mga09592_67810_c1
2294 nmdc:mga09592_765792_c1
2295 nmdc:mga09592_932156_c1
2296 nmdc:mga0qj67_101677_c1
2297 nmdc:mga0qj67_11104_c1
2298 nmdc:mga0qj67_1239392_c1
2299 nmdc:mga0qj67_130450_c1
2300 nmdc:mga0qj67_142244_c1
2301 nmdc:mga0qj67_4378_c1
2302 nmdc:mga0qj67_677049_c1
2303 nmdc:mga0qj67_807740_c1
2304 nmdc:mga0qj67_82973_c1
2305 nmdc:mga0qj67_989494_c1
2306 nmdc:mga06r32_1066955_c1
2307 nmdc:mga06r32_115765_c1
2308 nmdc:mga06r32_137586_c1
2309 nmdc:mga06r32_1559_c1
2310 nmdc:mga06r32_1588156_c1
2311 nmdc:mga06r32_163048_c1
2312 nmdc:mga06r32_163801_c1
2313 nmdc:mga06r32_171563_c1
2314 nmdc:mga06r32_19745_c1
2315 nmdc:mga06r32_25988_c1
2316 nmdc:mga06r32_297000_c1
2317 nmdc:mga06r32_324564_c1
2318 nmdc:mga06r32_3506_c1
2319 nmdc:mga06r32_362_c1
2320 nmdc:mga06r32_386526_c1
2321 nmdc:mga06r32_40659_c1
2322 nmdc:mga06r32_929252_c1
2323 nmdc:mga06r32_96178_c1
2324 nmdc:mga06r32_969206_c1
2325 nmdc:mga08y16_1133829_c1
2326 nmdc:mga08y16_1522697_c1
2327 nmdc:mga08y16_15473_c1
2328 nmdc:mga08y16_1799662_c1
2329 nmdc:mga08y16_182510_c1
2330 nmdc:mga08y16_36304_c1
2331 nmdc:mga08y16_413383_c1
2332 nmdc:mga08y16_445626_c1
2333 nmdc:mga08y16_476958_c1
2334 nmdc:mga08y16_50063_c1
2335 nmdc:mga08y16_557128_c1
2336 nmdc:mga08y16_732373_c1
2337 nmdc:mga0n895_1450178_c1
2338 nmdc:mga0n895_1465383_c1
2339 nmdc:mga0n895_1520_c1
2340 nmdc:mga0n895_1697_c1
2341 nmdc:mga0n895_173687_c1
2342 nmdc:mga0n895_192324_c1
2343 nmdc:mga0n895_20759_c1
2344 nmdc:mga0n895_341327_c1
2345 nmdc:mga0n895_367939_c1
2346 nmdc:mga0n895_394649_c1
2347 nmdc:mga0n895_447315_c1
2348 nmdc:mga0n895_46099_c1
2349 nmdc:mga0n895_50521_c1
2350 nmdc:mga0n895_61775_c1
2351 nmdc:mga0n895_851566_c1
2352 nmdc:mga0rr50_1155491_c1
2353 nmdc:mga0rr50_12829_c1
2354 nmdc:mga0rr50_143427_c1
2355 nmdc:mga0rr50_168945_c1
2356 nmdc:mga0rr50_1858396_c1
2357 nmdc:mga0rr50_197893_c1
2358 nmdc:mga0rr50_229826_c1
2359 nmdc:mga0rr50_313029_c1
2360 nmdc:mga0rr50_406919_c1
2361 nmdc:mga0rr50_508512_c1
2362 nmdc:mga0rr50_51575_c1
2363 nmdc:mga0rr50_590629_c1
2364 nmdc:mga0rr50_78208_c1
2365 nmdc:mga0rr50_993647_c1
2366 nmdc:mga08x19_15509_c1
2367 nmdc:mga08x19_192355_c1
2368 nmdc:mga08x19_22197_c1
2369 nmdc:mga08x19_241508_c1
2370 nmdc:mga08x19_482919_c1
2371 nmdc:mga08x19_517813_c1
2372 nmdc:mga08x19_65966_c1
2373 nmdc:mga0a205_105832_c1
2374 nmdc:mga0a205_16603_c1
2375 nmdc:mga0a205_2509_c1
2376 nmdc:mga0a205_27126_c1
2377 nmdc:mga0a205_314036_c1
2378 nmdc:mga0a205_353568_c1
2379 nmdc:mga0a205_36141_c2
2380 nmdc:mga0a205_466869_c1
2381 nmdc:mga0a205_478541_c1
2382 nmdc:mga0a205_627338_c1
2383 nmdc:mga0a205_678302_c1
2384 nmdc:mga0a205_73535_c1
2385 nmdc:mga0a205_78091_c1
2386 nmdc:mga0a205_924248_c1
2387 nmdc:mga0a205_9702_c1
2388 nmdc:mga0a205_972462_c1
2389 Ga0501084_0012540
2390 Ga0501084_0028194
2391 Ga0501084_0044028
2392 Ga0501084_0097990
2393 Ga0501084_0111619
2394 Ga0501084_0130734
2395 Ga0501084_0142094
2396 Ga0501084_0212404
2397 Ga0501084_0557616
2398 Ga0501084_0576130
2399 Ga0501084_1417945
2400 Ga0501084_1558857
2401 Ga0590077_013271
2402 Ga0501082_0000590
2403 Ga0501082_0003964
2404 Ga0501082_0008208
2405 Ga0501082_0015947
2406 Ga0501082_0072479
2407 Ga0501082_0100781
2408 Ga0501082_0295835
2409 Ga0501082_0488058
2410 Ga0501082_1469968
2411 Ga0501082_1551098
2412 Ga0530510_0002307
2413 Ga0530510_0022455
2414 Ga0530510_0128373
2415 Ga0530510_0178412
2416 Ga0530510_0209720
2417 Ga0530510_0234774
2418 Ga0530510_0278861
2419 Ga0530510_0325584
2420 Ga0530510_0338363
2421 Ga0530510_0372839
2422 Ga0530510_0413162
2423 Ga0530510_0640856
2424 Ga0530510_0694398
2425 Ga0530510_0827297
2426 Ga0530510_0954375
2427 Ga0530510_1248356
2428 Ga0530510_1412858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8673 36 110
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8591 31 110
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8566 31 110
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.855 31 110
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.853 31 110
ID Description Score Start End Superfamily
af_P77634_1_156_2.60.120.810 Mainly Beta;Sandwich;Jelly Rolls; 0.8097 35 110 2.60.120.810
5wsdA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8093 36 109 2.60.120.10
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8005 36 112 2.60.120.10
3fz3F01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7967 36 109 2.60.120.10
3myxA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7958 35 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V7CUE5-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9995 1 111
AF-A0A5N9H4E3-F1-model_v4 Cupin domain-containing protein 0.998 1 112
AF-A0A2V6Z0E3-F1-model_v4 Cupin domain-containing protein 0.9917 37 112
AF-A0A2V7CUE5-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9906 1 111
AF-A0A2E9LKU9-F1-model_v4 Cupin domain-containing protein 0.9874 44 111

Map