F491715
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1209 | 689 | 958 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0254856|Ga0496115_0254856_11_1015 |
| Length | 334 |
| Sequence | LFYSKGGRLLFVHHDARAGIGARVRRVIEQGRKTVVPSYLQSPSSQSMPDHQFVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFNDVETAHFFMRVVFTAADLAVDLGALQTGFKAIAERFGMDWQMRDRASRRRVMLLVSTSDHCLADILYRWRTGELQMIPTAIVSNHPRETYSSLDFGDIPFHYLPVTRETKREQETAILKLAGDTATDLVVLARYMQILSDEMTAKLSGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHYVTSALDEGPIIEQDVERISHRDTPEDLVRKGRDIERRVLARAMRHHLEDRVILNGRKTVVFMD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 31 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 32 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 33 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 34 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 35 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 36 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 37 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 38 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 39 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 40 | 2791355199 | |||
| 41 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 42 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 43 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 44 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 45 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 46 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 47 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 48 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 49 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 50 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 51 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 52 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 53 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 54 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 55 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 56 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 57 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 58 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 59 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 60 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 61 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 62 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 63 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 64 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 65 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 66 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 67 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 68 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 69 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 70 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 71 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 72 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 73 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 74 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 75 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 76 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 77 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 78 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 79 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 80 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 81 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 82 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 83 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 84 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 85 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 86 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 87 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 88 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 89 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 90 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 91 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 92 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 93 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 94 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 95 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 96 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 97 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 98 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 99 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 100 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 101 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 102 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 103 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 104 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 105 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 106 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 107 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 108 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 109 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 110 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 111 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 112 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 113 | 2904699407 | |||
| 114 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 115 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 116 | 2906610324 | |||
| 117 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 118 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 119 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 120 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 121 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 122 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 123 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 124 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 125 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 126 | 2922368715 | |||
| 127 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 128 | 2922425934 | |||
| 129 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 130 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 131 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 132 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 133 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 134 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 135 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 136 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 137 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 138 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 139 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 140 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 141 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 142 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 143 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 144 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 145 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 146 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 147 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 148 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 149 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 150 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 151 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 152 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 153 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 154 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 155 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 156 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 157 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 158 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 159 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 160 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 161 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 162 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 163 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 164 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 165 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 166 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 167 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 168 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 169 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 170 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 171 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 172 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 173 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 174 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 175 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 176 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 177 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 178 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 179 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 180 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 181 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 182 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 183 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 184 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 185 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 186 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 187 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 188 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 189 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 190 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 191 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 192 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 193 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 194 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 195 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 196 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 197 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 198 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 199 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 200 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 201 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 202 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 203 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 204 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 205 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 206 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 207 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 208 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 209 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 210 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 211 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 212 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 213 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 214 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 215 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 216 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 217 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 218 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 219 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 220 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 221 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 222 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 223 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 224 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 225 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 226 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 227 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 229 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 230 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 232 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 239 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 249 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 251 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 252 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 253 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 254 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 256 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 257 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 258 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 259 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 261 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 262 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 263 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 264 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 265 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 266 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 267 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 268 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 269 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 270 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 271 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 273 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 274 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 275 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 276 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 277 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 278 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 279 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 280 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 281 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 282 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 283 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 285 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 286 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 287 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 289 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 290 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 291 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 292 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 293 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 294 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 312 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 315 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 316 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 317 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 318 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 319 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 320 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 321 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 322 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 331 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 332 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 333 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 336 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 337 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 338 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 339 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 343 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 346 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 395 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 396 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 397 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 398 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 400 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 404 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 405 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 406 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 407 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 408 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 409 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 410 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 411 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 412 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 413 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 414 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 415 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 416 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 417 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 418 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 419 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 420 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 421 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 422 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 423 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 424 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 425 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 426 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 427 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 428 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 429 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 430 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 431 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 432 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 433 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 434 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 435 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 436 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 437 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 438 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 439 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 440 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 441 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 442 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 443 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 444 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 445 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 446 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 447 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 448 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 449 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 450 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 451 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 452 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 453 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 454 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 455 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 456 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 457 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 458 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 459 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 460 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 461 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 462 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 463 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 464 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 465 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 466 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 467 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 540 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 541 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 542 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 543 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 544 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 545 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 546 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 547 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 548 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 549 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 550 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 551 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 552 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 553 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 554 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 555 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 556 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 557 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 558 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 559 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 560 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 561 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 562 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 563 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 564 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 565 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 587 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 588 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 589 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 595 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 596 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 597 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 598 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 599 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 600 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 601 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 602 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 603 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 607 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 609 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 611 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 612 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 613 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 614 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 615 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 616 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 617 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 618 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 619 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 621 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 622 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 623 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 624 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 625 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 626 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 627 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 628 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 629 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 630 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 631 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 632 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 633 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 634 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 635 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 636 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 637 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 638 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 639 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 640 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 641 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 642 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 643 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 644 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 645 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 646 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 647 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 648 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 649 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 650 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 651 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 652 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 653 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 654 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 655 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 656 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 657 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 658 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 659 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 660 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 661 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 662 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 663 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 664 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 665 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 666 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 667 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 668 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 669 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 670 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 671 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 672 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 673 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 674 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 675 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 676 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 677 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 678 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 679 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 680 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 681 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 682 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 683 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 684 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 685 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 686 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 687 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 688 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 689 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.49 |
| Metatranscriptomes | 0.08 |
| Isolates | 20.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.71 |
| Nodule | 15.38 |
| Rhizoplane | 3.56 |
| Rhizosphere | 50.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10035312 | 3300001989 | Bacteria | 1695 |
| 2 | JGI24737J22298_10007014 | 3300001990 | Bacteria | 3820 |
| 3 | JGI25162J39368_1003562 | 3300002737 | Bacteria | 4374 |
| 4 | JGI25157J39369_1004272 | 3300002741 | Bacteria | 2644 |
| 5 | JGI25157J39369_1004469 | 3300002741 | Bacteria | 2527 |
| 6 | JGI25163J39215_1000989 | 3300002771 | Bacteria | 6283 |
| 7 | JGI25163J39215_1001956 | 3300002771 | Bacteria | 2577 |
| 8 | JGI25164J39214_1001231 | 3300002772 | Bacteria | 6840 |
| 9 | JGI25151J46595_10034545 | 3300003187 | Bacteria | 1932 |
| 10 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 11 | JGI25406J46586_10002347 | 3300003203 | Bacteria | 8944 |
| 12 | JGI25165J46597_1002202 | 3300003214 | Bacteria | 6896 |
| 13 | JGI25153J46596_10001032 | 3300003215 | Bacteria | 16967 |
| 14 | JGI25153J46596_10001653 | 3300003215 | Bacteria | 13206 |
| 15 | JGI25153J46596_10001857 | 3300003215 | Bacteria | 12522 |
| 16 | JGI25160J50197_1000935 | 3300003354 | Bacteria | 15360 |
| 17 | JGI25160J50197_1004654 | 3300003354 | Bacteria | 5888 |
| 18 | JGI25404J52841_10000792 | 3300003659 | Bacteria | 5005 |
| 19 | JGI25404J52841_10003180 | 3300003659 | Bacteria | 3216 |
| 20 | JGI25404J52841_10023374 | 3300003659 | Bacteria | 1334 |
| 21 | Ga0055538_1002542 | 3300003751 | Bacteria | 2628 |
| 22 | Ga0055538_1002885 | 3300003751 | Bacteria | 2343 |
| 23 | Ga0055539_1008044 | 3300003752 | Bacteria | 1325 |
| 24 | Ga0055533_1000545 | 3300003756 | Bacteria | 13392 |
| 25 | Ga0055535_1002327 | 3300003761 | Bacteria | 6896 |
| 26 | Ga0055535_1018064 | 3300003761 | Bacteria | 927 |
| 27 | Ga0055542_1000744 | 3300003762 | Bacteria | 25103 |
| 28 | Ga0055542_1003371 | 3300003762 | Bacteria | 4374 |
| 29 | Ga0055542_1008531 | 3300003762 | Bacteria | 2001 |
| 30 | Ga0055529_1001508 | 3300003763 | Bacteria | 6779 |
| 31 | Ga0055524_1016860 | 3300003775 | Bacteria | 2598 |
| 32 | Ga0055524_1024837 | 3300003775 | Bacteria | 1889 |
| 33 | Ga0055536_1005549 | 3300003781 | Bacteria | 6135 |
| 34 | Ga0055536_1007021 | 3300003781 | Bacteria | 5116 |
| 35 | Ga0055530_10002947 | 3300003791 | Bacteria | 10283 |
| 36 | Ga0055531_10001282 | 3300003794 | Bacteria | 18939 |
| 37 | Ga0055531_10008111 | 3300003794 | Bacteria | 5597 |
| 38 | Ga0055531_10011812 | 3300003794 | Bacteria | 4169 |
| 39 | Ga0055531_10012762 | 3300003794 | Bacteria | 3924 |
| 40 | Ga0055531_10014943 | 3300003794 | Bacteria | 3460 |
| 41 | Ga0055531_10029170 | 3300003794 | Bacteria | 1885 |
| 42 | Ga0065165_1002030 | 3300005262 | Bacteria | 18853 |
| 43 | Ga0065165_1002068 | 3300005262 | Bacteria | 18536 |
| 44 | Ga0070683_100019548 | 3300005329 | Bacteria | 6017 |
| 45 | Ga0070666_10016850 | 3300005335 | Bacteria | 4678 |
| 46 | Ga0070680_100012050 | 3300005336 | Bacteria | 6710 |
| 47 | Ga0070680_100075324 | 3300005336 | Bacteria | 2778 |
| 48 | Ga0070680_100097312 | 3300005336 | Bacteria | 2440 |
| 49 | Ga0070682_100031822 | 3300005337 | Bacteria | 3193 |
| 50 | Ga0070660_100006509 | 3300005339 | Bacteria | 8101 |
| 51 | Ga0070660_100128586 | 3300005339 | Bacteria | 2026 |
| 52 | Ga0070689_100000503 | 3300005340 | Bacteria | 23097 |
| 53 | Ga0070661_100129304 | 3300005344 | Bacteria | 1896 |
| 54 | Ga0070661_100258404 | 3300005344 | Bacteria | 1346 |
| 55 | Ga0070668_100011527 | 3300005347 | Bacteria | 6581 |
| 56 | Ga0070668_100096616 | 3300005347 | Bacteria | 2335 |
| 57 | Ga0070669_100073590 | 3300005353 | Bacteria | 2531 |
| 58 | Ga0070671_100159491 | 3300005355 | Bacteria | 1907 |
| 59 | Ga0070674_100118650 | 3300005356 | Bacteria | 1955 |
| 60 | Ga0070667_100000013 | 3300005367 | Bacteria | 255674 |
| 61 | Ga0070667_100103439 | 3300005367 | Bacteria | 2462 |
| 62 | Ga0070703_10048097 | 3300005406 | Bacteria | 1354 |
| 63 | Ga0070709_10011973 | 3300005434 | Bacteria | 4848 |
| 64 | Ga0070709_10022883 | 3300005434 | Bacteria | 3662 |
| 65 | Ga0070709_10056329 | 3300005434 | Bacteria | 2485 |
| 66 | Ga0070714_100364754 | 3300005435 | Bacteria | 1359 |
| 67 | Ga0070713_100097083 | 3300005436 | Bacteria | 2545 |
| 68 | Ga0070713_100124711 | 3300005436 | Bacteria | 2263 |
| 69 | Ga0070713_100133713 | 3300005436 | Bacteria | 2189 |
| 70 | Ga0070710_10018063 | 3300005437 | Bacteria | 3622 |
| 71 | Ga0070710_10025623 | 3300005437 | Bacteria | 3124 |
| 72 | Ga0070710_10039002 | 3300005437 | Bacteria | 2612 |
| 73 | Ga0070711_100016347 | 3300005439 | Bacteria | 4711 |
| 74 | Ga0070708_100057508 | 3300005445 | Bacteria | 3463 |
| 75 | Ga0070663_100009960 | 3300005455 | Bacteria | 5908 |
| 76 | Ga0070663_100019091 | 3300005455 | Bacteria | 4510 |
| 77 | Ga0070663_100019789 | 3300005455 | Bacteria | 4445 |
| 78 | Ga0070663_100115551 | 3300005455 | Bacteria | 2021 |
| 79 | Ga0070663_100310786 | 3300005455 | Bacteria | 1264 |
| 80 | Ga0070678_100067719 | 3300005456 | Bacteria | 2659 |
| 81 | Ga0070662_100181198 | 3300005457 | Bacteria | 1660 |
| 82 | Ga0070662_100285966 | 3300005457 | Bacteria | 1336 |
| 83 | Ga0070681_10031355 | 3300005458 | Bacteria | 5336 |
| 84 | Ga0070681_10068440 | 3300005458 | Bacteria | 3516 |
| 85 | Ga0070699_100446325 | 3300005518 | Bacteria | 1173 |
| 86 | Ga0070679_100048769 | 3300005530 | Bacteria | 4218 |
| 87 | Ga0070679_100284240 | 3300005530 | Bacteria | 1606 |
| 88 | Ga0070684_100004940 | 3300005535 | Bacteria | 10177 |
| 89 | Ga0070684_100110440 | 3300005535 | Bacteria | 2465 |
| 90 | Ga0070684_100298275 | 3300005535 | Bacteria | 1478 |
| 91 | Ga0070697_100036758 | 3300005536 | Bacteria | 3956 |
| 92 | Ga0068853_100027282 | 3300005539 | Bacteria | 4797 |
| 93 | Ga0068853_100051545 | 3300005539 | Bacteria | 3542 |
| 94 | Ga0068853_100068499 | 3300005539 | Bacteria | 3085 |
| 95 | Ga0070665_100143080 | 3300005548 | Bacteria | 2395 |
| 96 | Ga0070665_100446776 | 3300005548 | Bacteria | 1302 |
| 97 | Ga0068855_100057686 | 3300005563 | Bacteria | 4551 |
| 98 | Ga0068855_100074786 | 3300005563 | Bacteria | 3934 |
| 99 | Ga0068855_100102540 | 3300005563 | Bacteria | 3293 |
| 100 | Ga0068855_100156671 | 3300005563 | Bacteria | 2587 |
| 101 | Ga0068857_100003812 | 3300005577 | Bacteria | 12691 |
| 102 | Ga0068857_100010456 | 3300005577 | Bacteria | 8065 |
| 103 | Ga0068857_100017758 | 3300005577 | Bacteria | 6236 |
| 104 | Ga0068854_100023631 | 3300005578 | Bacteria | 4200 |
| 105 | Ga0068854_100031462 | 3300005578 | Bacteria | 3687 |
| 106 | Ga0068856_100024631 | 3300005614 | Bacteria | 5859 |
| 107 | Ga0068856_100050802 | 3300005614 | Bacteria | 4088 |
| 108 | Ga0068856_100697533 | 3300005614 | Bacteria | 1035 |
| 109 | Ga0070702_100112820 | 3300005615 | Bacteria | 1689 |
| 110 | Ga0068852_100004160 | 3300005616 | Bacteria | 10196 |
| 111 | Ga0068852_100007043 | 3300005616 | Bacteria | 8188 |
| 112 | Ga0068852_100280329 | 3300005616 | Bacteria | 1606 |
| 113 | Ga0068859_100026770 | 3300005617 | Bacteria | 5785 |
| 114 | Ga0068866_10091719 | 3300005718 | Bacteria | 1656 |
| 115 | Ga0068861_100042398 | 3300005719 | Bacteria | 3410 |
| 116 | Ga0068851_10001214 | 3300005834 | Bacteria | 11191 |
| 117 | Ga0068851_10006472 | 3300005834 | Bacteria | 5349 |
| 118 | Ga0068863_100000192 | 3300005841 | Bacteria | 64858 |
| 119 | Ga0068863_100251707 | 3300005841 | Bacteria | 1706 |
| 120 | Ga0068860_100001343 | 3300005843 | Bacteria | 26758 |
| 121 | Ga0068862_100470093 | 3300005844 | Bacteria | 1188 |
| 122 | Ga0081455_10004707 | 3300005937 | Bacteria | 15168 |
| 123 | Ga0081455_10015886 | 3300005937 | Bacteria | 7288 |
| 124 | Ga0081455_10028943 | 3300005937 | Bacteria | 5057 |
| 125 | Ga0081540_1001530 | 3300005983 | Bacteria | 19855 |
| 126 | Ga0081540_1007530 | 3300005983 | Bacteria | 7749 |
| 127 | Ga0081540_1012734 | 3300005983 | Bacteria | 5513 |
| 128 | Ga0081540_1021844 | 3300005983 | Bacteria | 3794 |
| 129 | Ga0081540_1024489 | 3300005983 | Bacteria | 3502 |
| 130 | Ga0081540_1050002 | 3300005983 | Bacteria | 2080 |
| 131 | Ga0081540_1056776 | 3300005983 | Bacteria | 1898 |
| 132 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 133 | Ga0081539_10001561 | 3300005985 | Bacteria | 38000 |
| 134 | Ga0081539_10014949 | 3300005985 | Bacteria | 5693 |
| 135 | Ga0081539_10039994 | 3300005985 | Bacteria | 2759 |
| 136 | Ga0070717_10005931 | 3300006028 | Bacteria | 8946 |
| 137 | Ga0075365_10034424 | 3300006038 | Bacteria | 3271 |
| 138 | Ga0075365_10082935 | 3300006038 | Bacteria | 2174 |
| 139 | Ga0075365_10154602 | 3300006038 | Bacteria | 1596 |
| 140 | Ga0075365_10167433 | 3300006038 | Bacteria | 1533 |
| 141 | Ga0075368_10022590 | 3300006042 | Bacteria | 2395 |
| 142 | Ga0075363_100010388 | 3300006048 | Bacteria | 4419 |
| 143 | Ga0075363_100081410 | 3300006048 | Bacteria | 1771 |
| 144 | Ga0075364_10059723 | 3300006051 | Bacteria | 2500 |
| 145 | Ga0075432_10044317 | 3300006058 | Bacteria | 1560 |
| 146 | Ga0070715_10072955 | 3300006163 | Bacteria | 1538 |
| 147 | Ga0070716_100036868 | 3300006173 | Bacteria | 2698 |
| 148 | Ga0070716_100057358 | 3300006173 | Bacteria | 2238 |
| 149 | Ga0070716_100158364 | 3300006173 | Bacteria | 1464 |
| 150 | Ga0075362_10087758 | 3300006177 | Bacteria | 1441 |
| 151 | Ga0075367_10023705 | 3300006178 | Bacteria | 3456 |
| 152 | Ga0075367_10125747 | 3300006178 | Bacteria | 1582 |
| 153 | Ga0075369_10009297 | 3300006186 | Bacteria | 3813 |
| 154 | Ga0075369_10040575 | 3300006186 | Bacteria | 1990 |
| 155 | Ga0075369_10103099 | 3300006186 | Bacteria | 1281 |
| 156 | Ga0075366_10021402 | 3300006195 | Bacteria | 3759 |
| 157 | Ga0075366_10042268 | 3300006195 | Bacteria | 2698 |
| 158 | Ga0075366_10065532 | 3300006195 | Bacteria | 2161 |
| 159 | Ga0097621_100194874 | 3300006237 | Bacteria | 1756 |
| 160 | Ga0075370_10055630 | 3300006353 | Bacteria | 2248 |
| 161 | Ga0068871_100123094 | 3300006358 | Bacteria | 2193 |
| 162 | Ga0068871_100195093 | 3300006358 | Bacteria | 1746 |
| 163 | Ga0075436_100192550 | 3300006914 | Bacteria | 1443 |
| 164 | Ga0075436_100223615 | 3300006914 | Bacteria | 1336 |
| 165 | Ga0097620_100026770 | 3300006931 | Bacteria | 5785 |
| 166 | Ga0099824_1006034 | 3300006942 | Bacteria | 16807 |
| 167 | Ga0099824_1022602 | 3300006942 | Bacteria | 4107 |
| 168 | Ga0099822_1001290 | 3300006943 | Bacteria | 28696 |
| 169 | Ga0099823_1045654 | 3300006944 | Bacteria | 2911 |
| 170 | Ga0075435_100269521 | 3300007076 | Bacteria | 1452 |
| 171 | Ga0099794_10006306 | 3300007265 | Bacteria | 4792 |
| 172 | Ga0099795_10028502 | 3300007788 | Bacteria | 1899 |
| 173 | Ga0105240_10007705 | 3300009093 | Bacteria | 15579 |
| 174 | Ga0105240_10013464 | 3300009093 | Bacteria | 11233 |
| 175 | Ga0105240_10022611 | 3300009093 | Bacteria | 8328 |
| 176 | Ga0105240_10028339 | 3300009093 | Bacteria | 7316 |
| 177 | Ga0105240_10028431 | 3300009093 | Bacteria | 7304 |
| 178 | Ga0105240_10038303 | 3300009093 | Bacteria | 6151 |
| 179 | Ga0105240_10237054 | 3300009093 | Bacteria | 2117 |
| 180 | Ga0105240_10498991 | 3300009093 | Bacteria | 1354 |
| 181 | Ga0105247_10097521 | 3300009101 | Bacteria | 1875 |
| 182 | Ga0105247_10108391 | 3300009101 | Bacteria | 1784 |
| 183 | Ga0105241_10010762 | 3300009174 | Bacteria | 6713 |
| 184 | Ga0105241_10046704 | 3300009174 | Bacteria | 3289 |
| 185 | Ga0105241_10140830 | 3300009174 | Bacteria | 1963 |
| 186 | Ga0105241_10178257 | 3300009174 | Bacteria | 1761 |
| 187 | Ga0105242_10324093 | 3300009176 | Bacteria | 1414 |
| 188 | Ga0105248_10138967 | 3300009177 | Bacteria | 2740 |
| 189 | Ga0105248_10260551 | 3300009177 | Bacteria | 1952 |
| 190 | Ga0105237_10004743 | 3300009545 | Bacteria | 15634 |
| 191 | Ga0105237_10011260 | 3300009545 | Bacteria | 9463 |
| 192 | Ga0105237_10031433 | 3300009545 | Bacteria | 5384 |
| 193 | Ga0105237_10116230 | 3300009545 | Bacteria | 2668 |
| 194 | Ga0105237_10122646 | 3300009545 | Bacteria | 2593 |
| 195 | Ga0105237_10427450 | 3300009545 | Bacteria | 1330 |
| 196 | Ga0105238_10002076 | 3300009551 | Bacteria | 20251 |
| 197 | Ga0105238_10010980 | 3300009551 | Bacteria | 9108 |
| 198 | Ga0105238_10011639 | 3300009551 | Bacteria | 8863 |
| 199 | Ga0105238_10012649 | 3300009551 | Bacteria | 8517 |
| 200 | Ga0105238_10172449 | 3300009551 | Bacteria | 2139 |
| 201 | Ga0105238_10172915 | 3300009551 | Bacteria | 2136 |
| 202 | Ga0105238_10232319 | 3300009551 | Bacteria | 1821 |
| 203 | Ga0105239_10013891 | 3300010375 | Bacteria | 8938 |
| 204 | Ga0105239_10016664 | 3300010375 | Bacteria | 8122 |
| 205 | Ga0105239_10039944 | 3300010375 | Bacteria | 5140 |
| 206 | Ga0105239_10040575 | 3300010375 | Bacteria | 5100 |
| 207 | Ga0105239_10047131 | 3300010375 | Bacteria | 4723 |
| 208 | Ga0105239_10077508 | 3300010375 | Bacteria | 3657 |
| 209 | Ga0105239_10081016 | 3300010375 | Bacteria | 3572 |
| 210 | Ga0105239_10119220 | 3300010375 | Bacteria | 2929 |
| 211 | Ga0105239_10163948 | 3300010375 | Bacteria | 2485 |
| 212 | Ga0105239_11007636 | 3300010375 | Bacteria | 958 |
| 213 | Ga0105246_10061502 | 3300011119 | Bacteria | 2613 |
| 214 | Ga0157373_10000801 | 3300013100 | Bacteria | 24325 |
| 215 | Ga0157373_10019948 | 3300013100 | Bacteria | 4877 |
| 216 | Ga0157370_10037505 | 3300013104 | Bacteria | 4698 |
| 217 | Ga0157370_10156955 | 3300013104 | Bacteria | 2117 |
| 218 | Ga0157370_10250270 | 3300013104 | Bacteria | 1639 |
| 219 | Ga0157369_10018998 | 3300013105 | Bacteria | 7697 |
| 220 | Ga0157369_10052606 | 3300013105 | Bacteria | 4406 |
| 221 | Ga0157369_10065128 | 3300013105 | Bacteria | 3923 |
| 222 | Ga0157369_10087630 | 3300013105 | Bacteria | 3324 |
| 223 | Ga0157369_10341886 | 3300013105 | Bacteria | 1554 |
| 224 | Ga0157374_10027280 | 3300013296 | Bacteria | 5148 |
| 225 | Ga0163162_10501800 | 3300013306 | Bacteria | 1344 |
| 226 | Ga0157372_10371637 | 3300013307 | Bacteria | 1666 |
| 227 | Ga0157372_10495585 | 3300013307 | Bacteria | 1424 |
| 228 | Ga0157375_10230780 | 3300013308 | Bacteria | 2010 |
| 229 | Ga0157375_10293692 | 3300013308 | Bacteria | 1788 |
| 230 | Ga0163163_10165115 | 3300014325 | Bacteria | 2260 |
| 231 | Ga0182008_10166277 | 3300014497 | Bacteria | 1112 |
| 232 | Ga0157379_10223611 | 3300014968 | Bacteria | 1706 |
| 233 | Ga0157376_10182028 | 3300014969 | Bacteria | 1922 |
| 234 | Ga0157376_10255422 | 3300014969 | Bacteria | 1639 |
| 235 | Ga0157376_10502907 | 3300014969 | Bacteria | 1191 |
| 236 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 237 | Ga0214544_1000073 | 3300021320 | Bacteria | 123701 |
| 238 | Ga0214544_1007210 | 3300021320 | Bacteria | 19738 |
| 239 | Ga0214542_1000104 | 3300021321 | Bacteria | 112526 |
| 240 | Ga0214542_1000196 | 3300021321 | Bacteria | 95225 |
| 241 | Ga0214545_1000028 | 3300021324 | Bacteria | 127957 |
| 242 | Ga0214545_1025379 | 3300021324 | Bacteria | 3447 |
| 243 | Ga0214543_1000044 | 3300021327 | Bacteria | 158132 |
| 244 | Ga0214543_1000096 | 3300021327 | Bacteria | 111598 |
| 245 | Ga0213874_10007742 | 3300021377 | Bacteria | 2591 |
| 246 | Ga0213876_10121308 | 3300021384 | Bacteria | 1388 |
| 247 | Ga0209435_105841 | 3300025206 | Bacteria | 1378 |
| 248 | Ga0209435_107683 | 3300025206 | Bacteria | 1192 |
| 249 | Ga0209760_100585 | 3300025207 | Bacteria | 6376 |
| 250 | Ga0209784_100709 | 3300025224 | Bacteria | 8923 |
| 251 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 252 | Ga0209672_101666 | 3300025228 | Bacteria | 7228 |
| 253 | Ga0209563_103577 | 3300025230 | Bacteria | 3173 |
| 254 | Ga0207427_100156 | 3300025231 | Bacteria | 77311 |
| 255 | Ga0207427_102344 | 3300025231 | Bacteria | 5195 |
| 256 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 257 | Ga0209437_100224 | 3300025233 | Bacteria | 101515 |
| 258 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 259 | Ga0209258_101060 | 3300025242 | Bacteria | 11992 |
| 260 | Ga0207425_1026947 | 3300025245 | Bacteria | 1175 |
| 261 | Ga0209646_1005630 | 3300025246 | Bacteria | 2165 |
| 262 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 263 | Ga0209677_101054 | 3300025253 | Bacteria | 13094 |
| 264 | Ga0209677_102254 | 3300025253 | Bacteria | 7456 |
| 265 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 266 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 267 | Ga0209148_1000680 | 3300025254 | Bacteria | 28419 |
| 268 | Ga0209759_1001568 | 3300025256 | Bacteria | 12465 |
| 269 | Ga0209759_1007024 | 3300025256 | Bacteria | 3687 |
| 270 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 271 | Ga0209233_1003740 | 3300025261 | Bacteria | 5316 |
| 272 | Ga0209233_1004006 | 3300025261 | Bacteria | 5103 |
| 273 | Ga0209233_1006666 | 3300025261 | Bacteria | 3704 |
| 274 | Ga0209233_1012488 | 3300025261 | Bacteria | 2464 |
| 275 | Ga0209233_1024000 | 3300025261 | Bacteria | 1533 |
| 276 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 277 | Ga0209455_1002008 | 3300025272 | Bacteria | 8342 |
| 278 | Ga0209455_1005197 | 3300025272 | Bacteria | 4078 |
| 279 | Ga0209455_1009241 | 3300025272 | Bacteria | 2604 |
| 280 | Ga0209455_1011701 | 3300025272 | Bacteria | 2146 |
| 281 | Ga0209673_1004025 | 3300025273 | Bacteria | 8140 |
| 282 | Ga0209130_1010280 | 3300025284 | Bacteria | 2590 |
| 283 | Ga0209130_1029167 | 3300025284 | Bacteria | 1152 |
| 284 | Ga0209676_1001462 | 3300025292 | Bacteria | 22110 |
| 285 | Ga0209676_1003938 | 3300025292 | Bacteria | 8600 |
| 286 | Ga0209676_1004689 | 3300025292 | Bacteria | 7499 |
| 287 | Ga0209676_1010527 | 3300025292 | Bacteria | 3836 |
| 288 | Ga0209676_1011182 | 3300025292 | Bacteria | 3648 |
| 289 | Ga0209676_1011834 | 3300025292 | Bacteria | 3480 |
| 290 | Ga0209676_1034383 | 3300025292 | Bacteria | 1499 |
| 291 | Ga0209025_1003033 | 3300025294 | Bacteria | 16562 |
| 292 | Ga0209025_1006289 | 3300025294 | Bacteria | 9284 |
| 293 | Ga0209025_1052993 | 3300025294 | Bacteria | 1596 |
| 294 | Ga0209564_1004691 | 3300025295 | Bacteria | 8198 |
| 295 | Ga0209564_1005302 | 3300025295 | Bacteria | 7426 |
| 296 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 297 | Ga0209758_1000187 | 3300025297 | Bacteria | 138759 |
| 298 | Ga0209758_1000482 | 3300025297 | Bacteria | 65578 |
| 299 | Ga0209758_1001650 | 3300025297 | Bacteria | 25317 |
| 300 | Ga0209758_1015384 | 3300025297 | Bacteria | 3966 |
| 301 | Ga0209758_1016071 | 3300025297 | Bacteria | 3824 |
| 302 | Ga0209758_1020409 | 3300025297 | Bacteria | 3135 |
| 303 | Ga0209758_1031792 | 3300025297 | Bacteria | 2157 |
| 304 | Ga0209758_1036035 | 3300025297 | Bacteria | 1939 |
| 305 | Ga0209050_1002752 | 3300025298 | Bacteria | 14152 |
| 306 | Ga0209256_1004202 | 3300025299 | Bacteria | 9257 |
| 307 | Ga0209256_1007084 | 3300025299 | Bacteria | 5664 |
| 308 | Ga0209256_1009510 | 3300025299 | Bacteria | 4250 |
| 309 | Ga0209256_1011461 | 3300025299 | Bacteria | 3541 |
| 310 | Ga0207426_1000160 | 3300025302 | Bacteria | 174540 |
| 311 | Ga0207426_1000527 | 3300025302 | Bacteria | 55514 |
| 312 | Ga0209051_1003094 | 3300025303 | Bacteria | 11224 |
| 313 | Ga0209051_1048360 | 3300025303 | Bacteria | 1443 |
| 314 | Ga0209257_1000652 | 3300025304 | Bacteria | 55125 |
| 315 | Ga0209257_1001906 | 3300025304 | Bacteria | 22534 |
| 316 | Ga0209257_1002013 | 3300025304 | Bacteria | 21724 |
| 317 | Ga0209257_1002127 | 3300025304 | Bacteria | 20664 |
| 318 | Ga0209257_1004808 | 3300025304 | Bacteria | 10040 |
| 319 | Ga0209257_1027397 | 3300025304 | Bacteria | 1898 |
| 320 | Ga0207656_10002942 | 3300025321 | Bacteria | 5811 |
| 321 | Ga0207656_10023522 | 3300025321 | Bacteria | 2482 |
| 322 | Ga0207653_10017591 | 3300025885 | Bacteria | 2251 |
| 323 | Ga0207692_10024985 | 3300025898 | Bacteria | 2785 |
| 324 | Ga0207710_10058711 | 3300025900 | Bacteria | 1740 |
| 325 | Ga0207647_10000586 | 3300025904 | Bacteria | 28285 |
| 326 | Ga0207647_10001777 | 3300025904 | Bacteria | 16548 |
| 327 | Ga0207647_10011712 | 3300025904 | Bacteria | 6138 |
| 328 | Ga0207685_10060982 | 3300025905 | Bacteria | 1494 |
| 329 | Ga0207699_10001145 | 3300025906 | Bacteria | 12548 |
| 330 | Ga0207699_10012170 | 3300025906 | Bacteria | 4370 |
| 331 | Ga0207699_10024297 | 3300025906 | Bacteria | 3312 |
| 332 | Ga0207643_10008582 | 3300025908 | Bacteria | 5481 |
| 333 | Ga0207705_10192254 | 3300025909 | Bacteria | 1544 |
| 334 | Ga0207684_10273034 | 3300025910 | Bacteria | 1459 |
| 335 | Ga0207654_10000136 | 3300025911 | Bacteria | 47311 |
| 336 | Ga0207654_10087335 | 3300025911 | Bacteria | 1892 |
| 337 | Ga0207654_10120095 | 3300025911 | Bacteria | 1649 |
| 338 | Ga0207707_10001642 | 3300025912 | Bacteria | 20636 |
| 339 | Ga0207707_10007605 | 3300025912 | Bacteria | 9443 |
| 340 | Ga0207707_10223821 | 3300025912 | Bacteria | 1638 |
| 341 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 342 | Ga0207695_10002311 | 3300025913 | Bacteria | 28436 |
| 343 | Ga0207695_10011572 | 3300025913 | Bacteria | 10672 |
| 344 | Ga0207695_10075771 | 3300025913 | Bacteria | 3422 |
| 345 | Ga0207695_10133917 | 3300025913 | Bacteria | 2433 |
| 346 | Ga0207695_10273781 | 3300025913 | Bacteria | 1583 |
| 347 | Ga0207695_10470794 | 3300025913 | Bacteria | 1139 |
| 348 | Ga0207671_10003843 | 3300025914 | Bacteria | 14693 |
| 349 | Ga0207671_10007380 | 3300025914 | Bacteria | 9548 |
| 350 | Ga0207693_10001764 | 3300025915 | Bacteria | 18977 |
| 351 | Ga0207693_10005866 | 3300025915 | Bacteria | 10193 |
| 352 | Ga0207693_10049791 | 3300025915 | Bacteria | 3290 |
| 353 | Ga0207693_10128070 | 3300025915 | Bacteria | 1996 |
| 354 | Ga0207663_10006336 | 3300025916 | Bacteria | 6047 |
| 355 | Ga0207663_10035891 | 3300025916 | Bacteria | 2978 |
| 356 | Ga0207663_10045043 | 3300025916 | Bacteria | 2711 |
| 357 | Ga0207660_10025057 | 3300025917 | Bacteria | 4046 |
| 358 | Ga0207660_10048220 | 3300025917 | Bacteria | 3014 |
| 359 | Ga0207660_10084741 | 3300025917 | Bacteria | 2336 |
| 360 | Ga0207657_10006868 | 3300025919 | Bacteria | 11742 |
| 361 | Ga0207657_10022746 | 3300025919 | Bacteria | 5854 |
| 362 | Ga0207657_10195815 | 3300025919 | Bacteria | 1628 |
| 363 | Ga0207649_10137710 | 3300025920 | Bacteria | 1666 |
| 364 | Ga0207652_10006786 | 3300025921 | Bacteria | 9230 |
| 365 | Ga0207652_10012536 | 3300025921 | Bacteria | 6852 |
| 366 | Ga0207652_10295227 | 3300025921 | Bacteria | 1462 |
| 367 | Ga0207681_10072592 | 3300025923 | Bacteria | 2404 |
| 368 | Ga0207694_10000135 | 3300025924 | Bacteria | 75715 |
| 369 | Ga0207694_10014853 | 3300025924 | Bacteria | 5873 |
| 370 | Ga0207694_10027086 | 3300025924 | Bacteria | 4364 |
| 371 | Ga0207694_10114340 | 3300025924 | Bacteria | 2149 |
| 372 | Ga0207694_10161114 | 3300025924 | Bacteria | 1812 |
| 373 | Ga0207700_10017875 | 3300025928 | Bacteria | 4747 |
| 374 | Ga0207700_10228653 | 3300025928 | Bacteria | 1580 |
| 375 | Ga0207664_10415534 | 3300025929 | Bacteria | 1198 |
| 376 | Ga0207709_10356375 | 3300025935 | Bacteria | 1106 |
| 377 | Ga0207670_10009585 | 3300025936 | Bacteria | 5532 |
| 378 | Ga0207665_10004976 | 3300025939 | Bacteria | 8868 |
| 379 | Ga0207665_10009679 | 3300025939 | Bacteria | 6329 |
| 380 | Ga0207711_10080269 | 3300025941 | Bacteria | 2849 |
| 381 | Ga0207711_10268516 | 3300025941 | Bacteria | 1569 |
| 382 | Ga0207689_10083658 | 3300025942 | Bacteria | 2623 |
| 383 | Ga0207661_10007779 | 3300025944 | Bacteria | 7633 |
| 384 | Ga0207661_10029064 | 3300025944 | Bacteria | 4242 |
| 385 | Ga0207661_10099615 | 3300025944 | Bacteria | 2437 |
| 386 | Ga0207667_10018495 | 3300025949 | Bacteria | 7812 |
| 387 | Ga0207667_10019153 | 3300025949 | Bacteria | 7654 |
| 388 | Ga0207667_10086526 | 3300025949 | Bacteria | 3243 |
| 389 | Ga0207651_10209562 | 3300025960 | Bacteria | 1568 |
| 390 | Ga0207668_10012810 | 3300025972 | Bacteria | 5145 |
| 391 | Ga0207668_10078657 | 3300025972 | Bacteria | 2382 |
| 392 | Ga0207640_10003325 | 3300025981 | Bacteria | 8660 |
| 393 | Ga0207640_10007395 | 3300025981 | Bacteria | 6061 |
| 394 | Ga0207640_10334687 | 3300025981 | Bacteria | 1210 |
| 395 | Ga0207658_10000068 | 3300025986 | Bacteria | 113745 |
| 396 | Ga0207639_10011442 | 3300026041 | Bacteria | 6164 |
| 397 | Ga0207639_10023493 | 3300026041 | Bacteria | 4453 |
| 398 | Ga0207639_10025712 | 3300026041 | Bacteria | 4271 |
| 399 | Ga0207639_10107556 | 3300026041 | Bacteria | 2266 |
| 400 | Ga0207639_10156665 | 3300026041 | Bacteria | 1914 |
| 401 | Ga0207639_10178821 | 3300026041 | Bacteria | 1803 |
| 402 | Ga0207678_10010017 | 3300026067 | Bacteria | 8317 |
| 403 | Ga0207678_10027242 | 3300026067 | Bacteria | 4983 |
| 404 | Ga0207678_10031917 | 3300026067 | Bacteria | 4592 |
| 405 | Ga0207678_10164964 | 3300026067 | Bacteria | 1892 |
| 406 | Ga0207678_10178056 | 3300026067 | Bacteria | 1816 |
| 407 | Ga0207678_10220533 | 3300026067 | Bacteria | 1623 |
| 408 | Ga0207678_10259994 | 3300026067 | Bacteria | 1488 |
| 409 | Ga0207708_10196166 | 3300026075 | Bacteria | 1609 |
| 410 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 411 | Ga0207702_10000334 | 3300026078 | Bacteria | 54042 |
| 412 | Ga0207702_10013080 | 3300026078 | Bacteria | 6900 |
| 413 | Ga0207702_10161086 | 3300026078 | Bacteria | 2049 |
| 414 | Ga0207641_10000074 | 3300026088 | Bacteria | 145908 |
| 415 | Ga0207641_10040878 | 3300026088 | Bacteria | 3885 |
| 416 | Ga0207676_10123226 | 3300026095 | Bacteria | 2190 |
| 417 | Ga0207676_10128917 | 3300026095 | Bacteria | 2147 |
| 418 | Ga0207674_10007361 | 3300026116 | Bacteria | 12820 |
| 419 | Ga0207674_10013128 | 3300026116 | Bacteria | 9219 |
| 420 | Ga0207674_10016608 | 3300026116 | Bacteria | 8049 |
| 421 | Ga0207674_10137426 | 3300026116 | Bacteria | 2405 |
| 422 | Ga0207675_100038699 | 3300026118 | Bacteria | 4450 |
| 423 | Ga0207683_10106473 | 3300026121 | Bacteria | 2507 |
| 424 | Ga0207683_10340240 | 3300026121 | Bacteria | 1376 |
| 425 | Ga0207683_10397199 | 3300026121 | Bacteria | 1268 |
| 426 | Ga0207698_10019685 | 3300026142 | Bacteria | 4626 |
| 427 | Ga0207698_10053737 | 3300026142 | Bacteria | 3094 |
| 428 | Ga0207698_10140431 | 3300026142 | Bacteria | 2080 |
| 429 | Ga0209389_1000003 | 3300027296 | Bacteria | 268927 |
| 430 | Ga0209389_1000365 | 3300027296 | Bacteria | 27120 |
| 431 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 432 | Ga0209589_1003813 | 3300027357 | Bacteria | 26265 |
| 433 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 434 | Ga0209489_100022 | 3300027361 | Bacteria | 202016 |
| 435 | Ga0209489_100498 | 3300027361 | Bacteria | 73687 |
| 436 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 437 | Ga0209700_100023 | 3300027363 | Bacteria | 229662 |
| 438 | Ga0209179_1005710 | 3300027512 | Bacteria | 1965 |
| 439 | Ga0209813_10008418 | 3300027866 | Bacteria | 2605 |
| 440 | Ga0268266_10116479 | 3300028379 | Bacteria | 2373 |
| 441 | Ga0268266_10134134 | 3300028379 | Bacteria | 2217 |
| 442 | Ga0268266_10269747 | 3300028379 | Bacteria | 1579 |
| 443 | Ga0268266_10272143 | 3300028379 | Bacteria | 1572 |
| 444 | Ga0268266_10427907 | 3300028379 | Bacteria | 1255 |
| 445 | Ga0268265_10253428 | 3300028380 | Bacteria | 1560 |
| 446 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 447 | Ga0268264_10018779 | 3300028381 | Bacteria | 5653 |
| 448 | Ga0265323_10001786 | 3300028653 | Bacteria | 10211 |
| 449 | Ga0265336_10001310 | 3300028666 | Bacteria | 11611 |
| 450 | Ga0307517_10027736 | 3300028786 | Bacteria | 6785 |
| 451 | Ga0307515_10035428 | 3300028794 | Bacteria | 8119 |
| 452 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 453 | Ga0307511_10033076 | 3300030521 | Bacteria | 4574 |
| 454 | Ga0265340_10012398 | 3300031247 | Bacteria | 4503 |
| 455 | Ga0265339_10008262 | 3300031249 | Bacteria | 6632 |
| 456 | Ga0265339_10050216 | 3300031249 | Bacteria | 2281 |
| 457 | Ga0265331_10039190 | 3300031250 | Bacteria | 2312 |
| 458 | Ga0265331_10113786 | 3300031250 | Bacteria | 1240 |
| 459 | Ga0307513_10277813 | 3300031456 | Bacteria | 1454 |
| 460 | Ga0307408_100020620 | 3300031548 | Bacteria | 4452 |
| 461 | Ga0307508_10000419 | 3300031616 | Bacteria | 50420 |
| 462 | Ga0307508_10043572 | 3300031616 | Bacteria | 4020 |
| 463 | Ga0307508_10135882 | 3300031616 | Bacteria | 2062 |
| 464 | Ga0316575_10012581 | 3300031665 | Bacteria | 3151 |
| 465 | Ga0265314_10003890 | 3300031711 | Bacteria | 14201 |
| 466 | Ga0265314_10028507 | 3300031711 | Bacteria | 4162 |
| 467 | Ga0265314_10170254 | 3300031711 | Bacteria | 1316 |
| 468 | Ga0265342_10013315 | 3300031712 | Bacteria | 5527 |
| 469 | Ga0265342_10116622 | 3300031712 | Bacteria | 1507 |
| 470 | Ga0316578_10172332 | 3300031728 | Bacteria | 1304 |
| 471 | Ga0307516_10062970 | 3300031730 | Bacteria | 3592 |
| 472 | Ga0307516_10129607 | 3300031730 | Bacteria | 2303 |
| 473 | Ga0307413_10430879 | 3300031824 | Bacteria | 1041 |
| 474 | Ga0307406_10464960 | 3300031901 | Bacteria | 1018 |
| 475 | Ga0307416_100345553 | 3300032002 | Bacteria | 1503 |
| 476 | Ga0307510_10015138 | 3300033180 | Bacteria | 9117 |
| 477 | Ga0307510_10031597 | 3300033180 | Bacteria | 5979 |
| 478 | Ga0307510_10249336 | 3300033180 | Bacteria | 1264 |
| 479 | Ga0315911_1000014 | 3300033442 | Bacteria | 207605 |
| 480 | Ga0373926_0038401 | 3300035083 | Bacteria | 1705 |
| 481 | Ga0373934_0099482 | 3300035086 | Bacteria | 1176 |
| 482 | Ga0373923_0004573 | 3300035111 | Bacteria | 4603 |
| 483 | Ga0373945_0066435 | 3300035116 | Bacteria | 1356 |
| 484 | Ga0373953_0007862 | 3300035117 | Bacteria | 3594 |
| 485 | Ga0373953_0008978 | 3300035117 | Bacteria | 3417 |
| 486 | Ga0373954_0044140 | 3300035118 | Bacteria | 2079 |
| 487 | Ga0373956_0043097 | 3300035119 | Bacteria | 2008 |
| 488 | Ga0373957_0025990 | 3300035120 | Bacteria | 2114 |
| 489 | Ga0373957_0031719 | 3300035120 | Bacteria | 1943 |
| 490 | Ga0373943_0102771 | 3300035170 | Bacteria | 1497 |
| 491 | Ga0373955_0047370 | 3300035172 | Bacteria | 2327 |
| 492 | Ga0373955_0225370 | 3300035172 | Bacteria | 1120 |
| 493 | Ga0316574_0000500 | 3300035398 | Bacteria | 15901 |
| 494 | Ga0373924_0025186 | 3300035410 | Bacteria | 2351 |
| 495 | Ga0373931_0005209 | 3300035691 | Bacteria | 5998 |
| 496 | Ga0373935_0001026 | 3300035692 | Bacteria | 15187 |
| 497 | Ga0373935_0067145 | 3300035692 | Bacteria | 2305 |
| 498 | Ga0373935_0140324 | 3300035692 | Bacteria | 1632 |
| 499 | Ga0373927_0021479 | 3300035695 | Bacteria | 4231 |
| 500 | Ga0373927_0055143 | 3300035695 | Bacteria | 2570 |
| 501 | Ga0373927_0074287 | 3300035695 | Bacteria | 2201 |
| 502 | Ga0373927_0103441 | 3300035695 | Bacteria | 1853 |
| 503 | Ga0373933_0000631 | 3300035724 | Bacteria | 21995 |
| 504 | Ga0373933_0027843 | 3300035724 | Bacteria | 3258 |
| 505 | Ga0373933_0255814 | 3300035724 | Bacteria | 1128 |
| 506 | Ga0373947_0129732 | 3300035725 | Bacteria | 1608 |
| 507 | Ga0373947_0291588 | 3300035725 | Bacteria | 1086 |
| 508 | Ga0373937_0626563 | 3300036401 | Bacteria | 1021 |
| 509 | Ga0372808_011507 | 3300036459 | Bacteria | 1252 |
| 510 | Ga0373925_0032857 | 3300037068 | Bacteria | 3821 |
| 511 | Ga0373925_0037551 | 3300037068 | Bacteria | 3577 |
| 512 | Ga0373925_0067129 | 3300037068 | Bacteria | 2705 |
| 513 | Ga0373925_0158442 | 3300037068 | Bacteria | 1782 |
| 514 | Ga0395900_0014369 | 3300037418 | Bacteria | 8082 |
| 515 | Ga0395900_0364388 | 3300037418 | Bacteria | 1416 |
| 516 | Ga0395898_0010290 | 3300037466 | Bacteria | 9790 |
| 517 | Ga0395898_0472182 | 3300037466 | Bacteria | 1194 |
| 518 | Ga0395898_0669162 | 3300037466 | Bacteria | 980 |
| 519 | Ga0395905_0117070 | 3300037471 | Bacteria | 2504 |
| 520 | Ga0395905_0163570 | 3300037471 | Bacteria | 2091 |
| 521 | Ga0395905_0328988 | 3300037471 | Bacteria | 1418 |
| 522 | Ga0436364_0525954 | 3300037853 | Bacteria | 904 |
| 523 | Ga0395901_0019804 | 3300038443 | Bacteria | 6882 |
| 524 | Ga0395901_0243240 | 3300038443 | Bacteria | 1876 |
| 525 | Ga0395901_0344679 | 3300038443 | Bacteria | 1539 |
| 526 | Ga0395901_0447416 | 3300038443 | Bacteria | 1322 |
| 527 | Ga0436365_0260840 | 3300039437 | Bacteria | 28419 |
| 528 | Ga0436365_0385088 | 3300039437 | Bacteria | 1355 |
| 529 | Ga0436365_1204968 | 3300039437 | Bacteria | 2267 |
| 530 | Ga0436365_1207416 | 3300039437 | Bacteria | 1588 |
| 531 | Ga0436360_0030607 | 3300039438 | Bacteria | 1506 |
| 532 | Ga0436361_0560308 | 3300039447 | Bacteria | 2274 |
| 533 | Ga0436361_1156995 | 3300039447 | Bacteria | 2486 |
| 534 | Ga0436363_0604370 | 3300039450 | Bacteria | 2439 |
| 535 | Ga0436363_1032871 | 3300039450 | Bacteria | 2653 |
| 536 | Ga0436363_1645002 | 3300039450 | Bacteria | 3999 |
| 537 | Ga0436362_0119752 | 3300039453 | Bacteria | 1955 |
| 538 | Ga0436362_0907410 | 3300039453 | Bacteria | 1871 |
| 539 | Ga0439465_0021447 | 3300041413 | Bacteria | 2025 |
| 540 | Ga0451798_1041797 | 3300041458 | Bacteria | 1094 |
| 541 | Ga0439452_009623 | 3300042010 | Bacteria | 2841 |
| 542 | Ga0466972_0001189 | 3300044658 | Bacteria | 12505 |
| 543 | Ga0466972_0199477 | 3300044658 | Bacteria | 937 |
| 544 | Ga0466965_0135663 | 3300044683 | Bacteria | 1278 |
| 545 | Ga0466966_0001683 | 3300044684 | Bacteria | 14266 |
| 546 | Ga0466966_0049627 | 3300044684 | Bacteria | 2673 |
| 547 | Ga0466966_0131705 | 3300044684 | Bacteria | 1531 |
| 548 | Ga0466961_0000084 | 3300044693 | Bacteria | 58908 |
| 549 | Ga0466963_0134187 | 3300044694 | Bacteria | 1712 |
| 550 | Ga0466963_0182671 | 3300044694 | Bacteria | 1465 |
| 551 | Ga0466963_0295189 | 3300044694 | Bacteria | 1140 |
| 552 | Ga0466968_0053255 | 3300044735 | Bacteria | 1733 |
| 553 | Ga0466957_0392658 | 3300044842 | Bacteria | 948 |
| 554 | Ga0466960_0013508 | 3300044901 | Bacteria | 3472 |
| 555 | Ga0466960_0125366 | 3300044901 | Bacteria | 1349 |
| 556 | Ga0466959_0002035 | 3300045049 | Bacteria | 12774 |
| 557 | Ga0466959_0079518 | 3300045049 | Bacteria | 2364 |
| 558 | Ga0495592_0070595 | 3300046454 | Bacteria | 2544 |
| 559 | Ga0495592_0095183 | 3300046454 | Bacteria | 2130 |
| 560 | Ga0495603_0006560 | 3300046455 | Bacteria | 6983 |
| 561 | Ga0495603_0019060 | 3300046455 | Bacteria | 4155 |
| 562 | Ga0495603_0043319 | 3300046455 | Bacteria | 2688 |
| 563 | Ga0495590_0001803 | 3300046457 | Bacteria | 9079 |
| 564 | Ga0495629_0008449 | 3300046459 | Bacteria | 7579 |
| 565 | Ga0495629_0050927 | 3300046459 | Bacteria | 2899 |
| 566 | Ga0495629_0192999 | 3300046459 | Bacteria | 1409 |
| 567 | Ga0495638_0000607 | 3300046460 | Bacteria | 40083 |
| 568 | Ga0495638_0002596 | 3300046460 | Bacteria | 14582 |
| 569 | Ga0495638_0008098 | 3300046460 | Bacteria | 7474 |
| 570 | Ga0495638_0023075 | 3300046460 | Bacteria | 4075 |
| 571 | Ga0495641_0013759 | 3300046461 | Bacteria | 4421 |
| 572 | Ga0495651_0303722 | 3300046462 | Bacteria | 1069 |
| 573 | Ga0495650_0000337 | 3300046471 | Bacteria | 83530 |
| 574 | Ga0495650_0002809 | 3300046471 | Bacteria | 13365 |
| 575 | Ga0495650_0024475 | 3300046471 | Bacteria | 2850 |
| 576 | Ga0495580_0009943 | 3300046472 | Bacteria | 7444 |
| 577 | Ga0495582_0004249 | 3300046473 | Bacteria | 8054 |
| 578 | Ga0495639_0001631 | 3300046475 | Bacteria | 10005 |
| 579 | Ga0495639_0063123 | 3300046475 | Bacteria | 1700 |
| 580 | Ga0495662_0008011 | 3300046476 | Bacteria | 5203 |
| 581 | Ga0495664_0040432 | 3300046477 | Bacteria | 2757 |
| 582 | Ga0495664_0062486 | 3300046477 | Bacteria | 2218 |
| 583 | Ga0495594_0001269 | 3300046499 | Bacteria | 13192 |
| 584 | Ga0495594_0107978 | 3300046499 | Bacteria | 1568 |
| 585 | Ga0495596_0137897 | 3300046500 | Bacteria | 947 |
| 586 | Ga0495583_0043305 | 3300046506 | Bacteria | 2097 |
| 587 | Ga0495606_0000401 | 3300046507 | Bacteria | 73149 |
| 588 | Ga0495606_0001096 | 3300046507 | Bacteria | 38817 |
| 589 | Ga0495606_0199117 | 3300046507 | Bacteria | 1143 |
| 590 | Ga0495608_0353570 | 3300046511 | Bacteria | 904 |
| 591 | Ga0495610_0013500 | 3300046512 | Bacteria | 4851 |
| 592 | Ga0495610_0054907 | 3300046512 | Bacteria | 1923 |
| 593 | Ga0495618_0014515 | 3300046514 | Bacteria | 4801 |
| 594 | Ga0495618_0080762 | 3300046514 | Bacteria | 2075 |
| 595 | Ga0495620_0091015 | 3300046515 | Bacteria | 1224 |
| 596 | Ga0495628_0163021 | 3300046516 | Bacteria | 1693 |
| 597 | Ga0495628_0225330 | 3300046516 | Bacteria | 1407 |
| 598 | Ga0495630_0055028 | 3300046517 | Bacteria | 2981 |
| 599 | Ga0495630_0056773 | 3300046517 | Bacteria | 2933 |
| 600 | Ga0495631_0002173 | 3300046518 | Bacteria | 11316 |
| 601 | Ga0495632_0082351 | 3300046519 | Bacteria | 1534 |
| 602 | Ga0495632_0110116 | 3300046519 | Bacteria | 1293 |
| 603 | Ga0495637_0092392 | 3300046520 | Bacteria | 1192 |
| 604 | Ga0495643_0091940 | 3300046522 | Bacteria | 1564 |
| 605 | Ga0495648_0008195 | 3300046524 | Bacteria | 8245 |
| 606 | Ga0495648_0029614 | 3300046524 | Bacteria | 3631 |
| 607 | Ga0495648_0049853 | 3300046524 | Bacteria | 2563 |
| 608 | Ga0495648_0100072 | 3300046524 | Bacteria | 1602 |
| 609 | Ga0495663_0053697 | 3300046525 | Bacteria | 1253 |
| 610 | Ga0495652_0033765 | 3300046529 | Bacteria | 4463 |
| 611 | Ga0495652_0068069 | 3300046529 | Bacteria | 2984 |
| 612 | Ga0495652_0076737 | 3300046529 | Bacteria | 2771 |
| 613 | Ga0495654_0012605 | 3300046530 | Bacteria | 4539 |
| 614 | Ga0495654_0017015 | 3300046530 | Bacteria | 3829 |
| 615 | Ga0495654_0135061 | 3300046530 | Bacteria | 1104 |
| 616 | Ga0495665_0001884 | 3300046531 | Bacteria | 11332 |
| 617 | Ga0495665_0041435 | 3300046531 | Bacteria | 2451 |
| 618 | Ga0495640_0049976 | 3300046533 | Bacteria | 2881 |
| 619 | Ga0495640_0115599 | 3300046533 | Bacteria | 1748 |
| 620 | Ga0495587_0010826 | 3300046536 | Bacteria | 5790 |
| 621 | Ga0495587_0156786 | 3300046536 | Bacteria | 1296 |
| 622 | Ga0495598_0036538 | 3300046537 | Bacteria | 1412 |
| 623 | Ga0495609_0111457 | 3300046538 | Bacteria | 1181 |
| 624 | Ga0495597_0078505 | 3300046542 | Bacteria | 1414 |
| 625 | Ga0495645_0030368 | 3300046543 | Bacteria | 3935 |
| 626 | Ga0495645_0038734 | 3300046543 | Bacteria | 3477 |
| 627 | Ga0495622_0039639 | 3300046557 | Bacteria | 2193 |
| 628 | Ga0495622_0044786 | 3300046557 | Bacteria | 2056 |
| 629 | Ga0495622_0139720 | 3300046557 | Bacteria | 1100 |
| 630 | Ga0495633_0001837 | 3300046558 | Bacteria | 15600 |
| 631 | Ga0495667_0017299 | 3300046559 | Bacteria | 4870 |
| 632 | Ga0495667_0197906 | 3300046559 | Bacteria | 1286 |
| 633 | Ga0495668_0002966 | 3300046616 | Bacteria | 13310 |
| 634 | Ga0495668_0069829 | 3300046616 | Bacteria | 1931 |
| 635 | Ga0495668_0280350 | 3300046616 | Bacteria | 913 |
| 636 | Ga0495634_0010587 | 3300046642 | Bacteria | 6753 |
| 637 | Ga0495611_0005006 | 3300046648 | Bacteria | 5678 |
| 638 | Ga0495625_0028749 | 3300046660 | Bacteria | 4164 |
| 639 | Ga0495635_0015901 | 3300046663 | Bacteria | 5256 |
| 640 | Ga0495635_0036927 | 3300046663 | Bacteria | 3383 |
| 641 | Ga0495635_0063109 | 3300046663 | Bacteria | 2544 |
| 642 | Ga0495635_0082411 | 3300046663 | Bacteria | 2201 |
| 643 | Ga0495588_0004512 | 3300046674 | Bacteria | 6155 |
| 644 | Ga0495588_0058437 | 3300046674 | Bacteria | 1994 |
| 645 | Ga0495657_0070096 | 3300046675 | Bacteria | 2291 |
| 646 | Ga0495657_0074074 | 3300046675 | Bacteria | 2216 |
| 647 | Ga0495599_0129243 | 3300046678 | Bacteria | 1569 |
| 648 | Ga0495646_0198350 | 3300046680 | Bacteria | 1094 |
| 649 | Ga0495647_0025999 | 3300046681 | Bacteria | 2142 |
| 650 | Ga0495658_0011741 | 3300046683 | Bacteria | 4415 |
| 651 | Ga0495658_0186725 | 3300046683 | Bacteria | 1287 |
| 652 | Ga0495613_0009118 | 3300046689 | Bacteria | 7356 |
| 653 | Ga0495613_0287713 | 3300046689 | Bacteria | 1140 |
| 654 | Ga0495624_0008474 | 3300046690 | Bacteria | 7166 |
| 655 | Ga0495624_0215827 | 3300046690 | Bacteria | 1163 |
| 656 | Ga0495649_0001571 | 3300046694 | Bacteria | 17089 |
| 657 | Ga0495589_0158552 | 3300046794 | Bacteria | 1078 |
| 658 | Ga0495600_0016852 | 3300046809 | Bacteria | 4644 |
| 659 | Ga0495600_0230689 | 3300046809 | Bacteria | 1182 |
| 660 | Ga0495581_0012281 | 3300047315 | Bacteria | 4960 |
| 661 | Ga0495581_0095930 | 3300047315 | Bacteria | 1722 |
| 662 | Ga0495581_0250424 | 3300047315 | Bacteria | 1036 |
| 663 | Ga0495604_0031622 | 3300047317 | Bacteria | 4197 |
| 664 | Ga0495674_0003482 | 3300047319 | Bacteria | 15299 |
| 665 | Ga0495674_0135975 | 3300047319 | Bacteria | 2068 |
| 666 | Ga0495672_0002709 | 3300047320 | Bacteria | 15894 |
| 667 | Ga0495672_0017857 | 3300047320 | Bacteria | 4732 |
| 668 | Ga0495672_0092772 | 3300047320 | Bacteria | 1655 |
| 669 | Ga0495676_0074454 | 3300047321 | Bacteria | 2600 |
| 670 | Ga0495676_0114136 | 3300047321 | Bacteria | 1977 |
| 671 | Ga0495680_0025271 | 3300047322 | Bacteria | 4918 |
| 672 | Ga0495680_0077191 | 3300047322 | Bacteria | 2523 |
| 673 | Ga0495680_0114293 | 3300047322 | Bacteria | 1998 |
| 674 | Ga0495687_012621 | 3300047443 | Bacteria | 4454 |
| 675 | Ga0495675_0185101 | 3300047444 | Bacteria | 1273 |
| 676 | Ga0495675_0209844 | 3300047444 | Bacteria | 1183 |
| 677 | Ga0495673_0088746 | 3300047469 | Bacteria | 1267 |
| 678 | Ga0495681_0046405 | 3300047470 | Bacteria | 2072 |
| 679 | Ga0495684_0011768 | 3300047471 | Bacteria | 6751 |
| 680 | Ga0495684_0035799 | 3300047471 | Bacteria | 3806 |
| 681 | Ga0495684_0073531 | 3300047471 | Bacteria | 2597 |
| 682 | Ga0495686_0004342 | 3300047472 | Bacteria | 11710 |
| 683 | Ga0495686_0031272 | 3300047472 | Bacteria | 3453 |
| 684 | Ga0495593_0004676 | 3300047673 | Bacteria | 8141 |
| 685 | Ga0495593_0144056 | 3300047673 | Bacteria | 1206 |
| 686 | Ga0495602_0109798 | 3300048088 | Bacteria | 2243 |
| 687 | Ga0495602_0153540 | 3300048088 | Bacteria | 1806 |
| 688 | Ga0495602_0157399 | 3300048088 | Bacteria | 1777 |
| 689 | Ga0495615_0079342 | 3300048090 | Bacteria | 898 |
| 690 | Ga0496101_0203576 | 3300048904 | Bacteria | 1531 |
| 691 | Ga0496102_0082886 | 3300048905 | Bacteria | 2958 |
| 692 | Ga0496102_0204050 | 3300048905 | Bacteria | 1863 |
| 693 | Ga0496102_0413430 | 3300048905 | Bacteria | 1267 |
| 694 | Ga0496103_0032897 | 3300048906 | Bacteria | 3166 |
| 695 | Ga0496104_0080773 | 3300048907 | Bacteria | 3100 |
| 696 | Ga0496104_0099795 | 3300048907 | Bacteria | 2779 |
| 697 | Ga0496104_0319851 | 3300048907 | Bacteria | 1465 |
| 698 | Ga0496105_0077006 | 3300048908 | Bacteria | 2754 |
| 699 | Ga0496105_0167789 | 3300048908 | Bacteria | 1800 |
| 700 | Ga0496106_0000790 | 3300048909 | Bacteria | 22889 |
| 701 | Ga0496107_0315886 | 3300048910 | Bacteria | 1163 |
| 702 | Ga0496108_0214432 | 3300048911 | Bacteria | 1672 |
| 703 | Ga0496108_0235532 | 3300048911 | Bacteria | 1592 |
| 704 | Ga0496108_0274322 | 3300048911 | Bacteria | 1468 |
| 705 | Ga0496109_0015593 | 3300048912 | Bacteria | 6628 |
| 706 | Ga0496109_0151473 | 3300048912 | Bacteria | 2171 |
| 707 | Ga0496109_0246168 | 3300048912 | Bacteria | 1683 |
| 708 | Ga0496109_0618547 | 3300048912 | Bacteria | 1019 |
| 709 | Ga0496110_0169397 | 3300048913 | Bacteria | 1981 |
| 710 | Ga0496111_0051321 | 3300048914 | Bacteria | 2977 |
| 711 | Ga0496111_0053939 | 3300048914 | Bacteria | 2905 |
| 712 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 713 | Ga0496112_0015024 | 3300048915 | Bacteria | 7208 |
| 714 | Ga0496112_0039667 | 3300048915 | Bacteria | 4603 |
| 715 | Ga0496112_0254388 | 3300048915 | Bacteria | 1707 |
| 716 | Ga0496113_0002731 | 3300048916 | Bacteria | 10367 |
| 717 | Ga0496113_0018344 | 3300048916 | Bacteria | 4871 |
| 718 | Ga0496114_0059427 | 3300048917 | Bacteria | 3194 |
| 719 | Ga0496114_0238993 | 3300048917 | Bacteria | 1597 |
| 720 | Ga0496114_0405843 | 3300048917 | Bacteria | 1207 |
| 721 | Ga0496114_0408694 | 3300048917 | Bacteria | 1202 |
| 722 | Ga0496115_0000182 | 3300048918 | Bacteria | 58480 |
| 723 | Ga0496115_0000503 | 3300048918 | Bacteria | 30610 |
| 724 | Ga0496115_0123259 | 3300048918 | Bacteria | 2133 |
| 725 | Ga0496115_0163009 | 3300048918 | Bacteria | 1843 |
| 726 | Ga0496115_0254346 | 3300048918 | Bacteria | 1445 |
| 727 | Ga0496115_0254856 | 3300048918 | Bacteria | 1444 |
| 728 | Ga0496115_0274765 | 3300048918 | Bacteria | 1384 |
| 729 | Ga0496115_0339463 | 3300048918 | Bacteria | 1226 |
| 730 | Ga0496116_0019933 | 3300048919 | Bacteria | 5114 |
| 731 | Ga0496117_0080969 | 3300048920 | Bacteria | 2133 |
| 732 | Ga0496117_0161793 | 3300048920 | Bacteria | 1310 |
| 733 | Ga0496117_0162717 | 3300048920 | Bacteria | 1305 |
| 734 | Ga0496118_0011291 | 3300048921 | Bacteria | 8736 |
| 735 | Ga0496118_0012803 | 3300048921 | Bacteria | 8007 |
| 736 | Ga0496118_0021505 | 3300048921 | Bacteria | 5673 |
| 737 | Ga0496118_0023093 | 3300048921 | Bacteria | 5415 |
| 738 | Ga0496118_0035179 | 3300048921 | Bacteria | 4072 |
| 739 | Ga0496118_0081149 | 3300048921 | Bacteria | 2278 |
| 740 | Ga0496119_0064564 | 3300048922 | Bacteria | 2173 |
| 741 | Ga0496119_0095487 | 3300048922 | Bacteria | 1679 |
| 742 | Ga0496119_0120355 | 3300048922 | Bacteria | 1444 |
| 743 | Ga0496120_0136034 | 3300048923 | Bacteria | 1253 |
| 744 | Ga0496121_0000774 | 3300048924 | Bacteria | 58528 |
| 745 | Ga0496121_0001681 | 3300048924 | Bacteria | 36391 |
| 746 | Ga0496121_0003198 | 3300048924 | Bacteria | 23590 |
| 747 | Ga0496121_0004204 | 3300048924 | Bacteria | 19648 |
| 748 | Ga0496121_0020289 | 3300048924 | Bacteria | 6588 |
| 749 | Ga0496121_0049511 | 3300048924 | Bacteria | 3562 |
| 750 | Ga0496121_0061247 | 3300048924 | Bacteria | 3089 |
| 751 | Ga0496121_0075015 | 3300048924 | Bacteria | 2703 |
| 752 | Ga0496121_0076458 | 3300048924 | Bacteria | 2669 |
| 753 | Ga0496121_0085056 | 3300048924 | Bacteria | 2491 |
| 754 | Ga0496121_0161089 | 3300048924 | Bacteria | 1640 |
| 755 | Ga0496121_0231594 | 3300048924 | Bacteria | 1293 |
| 756 | Ga0496121_0266137 | 3300048924 | Bacteria | 1181 |
| 757 | Ga0496121_0292714 | 3300048924 | Bacteria | 1108 |
| 758 | Ga0496122_0004199 | 3300048925 | Bacteria | 18120 |
| 759 | Ga0496122_0020976 | 3300048925 | Bacteria | 5870 |
| 760 | Ga0496122_0076193 | 3300048925 | Bacteria | 2361 |
| 761 | Ga0496123_0012131 | 3300048926 | Bacteria | 7381 |
| 762 | Ga0496123_0015113 | 3300048926 | Bacteria | 6351 |
| 763 | Ga0496123_0067660 | 3300048926 | Bacteria | 2254 |
| 764 | Ga0496124_0002423 | 3300048927 | Bacteria | 24474 |
| 765 | Ga0496124_0292724 | 3300048927 | Bacteria | 1181 |
| 766 | Ga0496125_0001052 | 3300048928 | Bacteria | 42645 |
| 767 | Ga0496125_0012360 | 3300048928 | Bacteria | 8481 |
| 768 | Ga0496125_0014815 | 3300048928 | Bacteria | 7573 |
| 769 | Ga0496125_0015380 | 3300048928 | Bacteria | 7405 |
| 770 | Ga0496125_0027633 | 3300048928 | Bacteria | 5139 |
| 771 | Ga0496125_0089784 | 3300048928 | Bacteria | 2309 |
| 772 | Ga0496126_0002928 | 3300048929 | Bacteria | 22201 |
| 773 | Ga0496126_0007386 | 3300048929 | Bacteria | 12053 |
| 774 | Ga0496126_0016425 | 3300048929 | Bacteria | 7402 |
| 775 | Ga0496126_0018165 | 3300048929 | Bacteria | 6977 |
| 776 | Ga0496126_0018440 | 3300048929 | Bacteria | 6914 |
| 777 | Ga0496126_0074838 | 3300048929 | Bacteria | 3007 |
| 778 | Ga0496126_0110874 | 3300048929 | Bacteria | 2390 |
| 779 | Ga0496126_0172532 | 3300048929 | Bacteria | 1841 |
| 780 | Ga0496126_0175038 | 3300048929 | Bacteria | 1826 |
| 781 | Ga0496126_0255043 | 3300048929 | Bacteria | 1460 |
| 782 | Ga0496126_0316652 | 3300048929 | Bacteria | 1283 |
| 783 | Ga0496126_0402734 | 3300048929 | Bacteria | 1109 |
| 784 | Ga0496126_0479714 | 3300048929 | Bacteria | 996 |
| 785 | Ga0495678_000397 | 3300049459 | Bacteria | 43960 |
| 786 | Ga0495682_0041853 | 3300049460 | Bacteria | 1679 |
| 787 | Ga0495682_0056874 | 3300049460 | Bacteria | 1417 |
| 788 | Ga0501031_0012411 | 3300049568 | Bacteria | 5557 |
| 789 | Ga0501031_0166768 | 3300049568 | Bacteria | 1439 |
| 790 | Ga0501031_0196295 | 3300049568 | Bacteria | 1317 |
| 791 | Ga0501032_0000683 | 3300049569 | Bacteria | 27581 |
| 792 | Ga0501032_0021357 | 3300049569 | Bacteria | 4500 |
| 793 | Ga0501032_0025241 | 3300049569 | Bacteria | 4097 |
| 794 | Ga0501032_0044830 | 3300049569 | Bacteria | 2992 |
| 795 | Ga0501032_0149285 | 3300049569 | Bacteria | 1537 |
| 796 | Ga0501033_0000645 | 3300049570 | Bacteria | 32274 |
| 797 | Ga0501033_0041465 | 3300049570 | Bacteria | 3434 |
| 798 | Ga0501033_0043903 | 3300049570 | Bacteria | 3328 |
| 799 | Ga0501033_0128242 | 3300049570 | Bacteria | 1839 |
| 800 | Ga0501033_0257586 | 3300049570 | Bacteria | 1235 |
| 801 | Ga0501034_0004310 | 3300049571 | Bacteria | 15861 |
| 802 | Ga0501034_0012439 | 3300049571 | Bacteria | 8790 |
| 803 | Ga0501034_0018499 | 3300049571 | Bacteria | 7143 |
| 804 | Ga0501034_0315596 | 3300049571 | Bacteria | 1497 |
| 805 | Ga0501034_0432597 | 3300049571 | Bacteria | 1235 |
| 806 | Ga0501034_0456263 | 3300049571 | Bacteria | 1195 |
| 807 | Ga0501036_0002022 | 3300049572 | Bacteria | 15776 |
| 808 | Ga0501036_0175017 | 3300049572 | Bacteria | 1807 |
| 809 | Ga0501037_0000484 | 3300049573 | Bacteria | 32262 |
| 810 | Ga0501037_0043321 | 3300049573 | Bacteria | 3308 |
| 811 | Ga0501037_0064760 | 3300049573 | Bacteria | 2663 |
| 812 | Ga0501037_0076969 | 3300049573 | Bacteria | 2421 |
| 813 | Ga0501038_0003716 | 3300049574 | Bacteria | 14216 |
| 814 | Ga0501038_0012105 | 3300049574 | Bacteria | 7879 |
| 815 | Ga0501038_0374584 | 3300049574 | Bacteria | 1105 |
| 816 | Ga0501039_0001484 | 3300049575 | Bacteria | 17245 |
| 817 | Ga0501039_0058706 | 3300049575 | Bacteria | 2980 |
| 818 | Ga0501039_0091357 | 3300049575 | Bacteria | 2373 |
| 819 | Ga0501039_0136704 | 3300049575 | Bacteria | 1924 |
| 820 | Ga0501043_0000593 | 3300049579 | Bacteria | 32115 |
| 821 | Ga0501043_0005035 | 3300049579 | Bacteria | 10690 |
| 822 | Ga0501043_0051221 | 3300049579 | Bacteria | 3244 |
| 823 | Ga0501043_0078301 | 3300049579 | Bacteria | 2597 |
| 824 | Ga0501043_0088763 | 3300049579 | Bacteria | 2430 |
| 825 | Ga0501046_0000499 | 3300049580 | Bacteria | 39177 |
| 826 | Ga0501046_0046091 | 3300049580 | Bacteria | 3461 |
| 827 | Ga0501046_0049205 | 3300049580 | Bacteria | 3335 |
| 828 | Ga0501046_0055557 | 3300049580 | Bacteria | 3110 |
| 829 | Ga0501046_0139669 | 3300049580 | Bacteria | 1834 |
| 830 | Ga0501046_0235020 | 3300049580 | Bacteria | 1353 |
| 831 | Ga0501047_0001042 | 3300049581 | Bacteria | 27709 |
| 832 | Ga0501047_0204652 | 3300049581 | Bacteria | 1833 |
| 833 | Ga0501047_0487877 | 3300049581 | Bacteria | 1059 |
| 834 | Ga0501048_0029959 | 3300049582 | Bacteria | 3942 |
| 835 | Ga0501048_0081143 | 3300049582 | Bacteria | 2288 |
| 836 | Ga0501048_0221807 | 3300049582 | Bacteria | 1341 |
| 837 | Ga0501067_0003275 | 3300049583 | Bacteria | 8916 |
| 838 | Ga0501068_0004322 | 3300049584 | Bacteria | 7720 |
| 839 | Ga0501068_0102770 | 3300049584 | Bacteria | 1772 |
| 840 | Ga0501069_0002891 | 3300049585 | Bacteria | 8818 |
| 841 | Ga0501070_0000773 | 3300049586 | Bacteria | 29138 |
| 842 | Ga0501070_0126861 | 3300049586 | Bacteria | 2108 |
| 843 | Ga0501073_0009539 | 3300049589 | Bacteria | 7161 |
| 844 | Ga0501073_0010870 | 3300049589 | Bacteria | 6665 |
| 845 | Ga0501073_0041356 | 3300049589 | Bacteria | 3257 |
| 846 | Ga0501073_0155097 | 3300049589 | Bacteria | 1587 |
| 847 | Ga0501073_0158622 | 3300049589 | Bacteria | 1568 |
| 848 | Ga0501074_0015366 | 3300049590 | Bacteria | 5565 |
| 849 | Ga0501074_0086189 | 3300049590 | Bacteria | 2250 |
| 850 | Ga0501076_0173607 | 3300049592 | Bacteria | 1757 |
| 851 | Ga0501223_033078 | 3300049663 | Bacteria | 1005 |
| 852 | Ga0501224_015249 | 3300049664 | Bacteria | 1139 |
| 853 | Ga0501249_000124 | 3300049679 | Bacteria | 23746 |
| 854 | Ga0501249_000246 | 3300049679 | Bacteria | 16076 |
| 855 | Ga0501079_0046250 | 3300049741 | Bacteria | 3358 |
| 856 | Ga0501079_0335621 | 3300049741 | Bacteria | 1184 |
| 857 | Ga0501080_0000326 | 3300049742 | Bacteria | 36467 |
| 858 | Ga0501080_0130087 | 3300049742 | Bacteria | 2330 |
| 859 | Ga0501035_0009126 | 3300049822 | Bacteria | 9221 |
| 860 | Ga0501035_0136964 | 3300049822 | Bacteria | 2131 |
| 861 | Ga0501035_0174477 | 3300049822 | Bacteria | 1855 |
| 862 | Ga0501035_0292098 | 3300049822 | Bacteria | 1375 |
| 863 | Ga0501044_0003564 | 3300049823 | Bacteria | 17514 |
| 864 | Ga0501044_0006626 | 3300049823 | Bacteria | 12773 |
| 865 | Ga0501044_0373593 | 3300049823 | Bacteria | 1342 |
| 866 | Ga0501044_0475838 | 3300049823 | Bacteria | 1153 |
| 867 | Ga0501045_0448897 | 3300049824 | Bacteria | 959 |
| 868 | Ga0501204_005645 | 3300049850 | Bacteria | 1378 |
| 869 | nmdc:mga03683_134383_c1 | 3300050489 | Bacteria | 1109 |
| 870 | nmdc:mga03n38_154959_c1 | 3300050490 | Bacteria | 1156 |
| 871 | nmdc:mga03n38_32318_c1 | 3300050490 | Bacteria | 2216 |
| 872 | nmdc:mga00v17_177787_c1 | 3300050491 | Bacteria | 1373 |
| 873 | nmdc:mga00v17_76850_c1 | 3300050491 | Bacteria | 2078 |
| 874 | nmdc:mga0yw44_11896_c1 | 3300050492 | Bacteria | 4517 |
| 875 | nmdc:mga0yw44_122864_c1 | 3300050492 | Bacteria | 1674 |
| 876 | nmdc:mga0yw44_21958_c1 | 3300050492 | Bacteria | 3570 |
| 877 | nmdc:mga0yw44_92219_c1 | 3300050492 | Bacteria | 1917 |
| 878 | nmdc:mga0k408_83011_c1 | 3300050493 | Bacteria | 1878 |
| 879 | nmdc:mga06z11_17981_c1 | 3300050494 | Bacteria | 3220 |
| 880 | nmdc:mga04h51_14163_c1 | 3300050495 | Bacteria | 2273 |
| 881 | nmdc:mga07m45_65899_c1 | 3300050496 | Bacteria | 2057 |
| 882 | nmdc:mga0qj67_276810_c1 | 3300050509 | Bacteria | 1360 |
| 883 | nmdc:mga0n895_46682_c1 | 3300050512 | Bacteria | 4232 |
| 884 | nmdc:mga0rr50_259288_c1 | 3300050513 | Bacteria | 1446 |
| 885 | nmdc:mga0sz30_16554_c1 | 3300050516 | Bacteria | 2930 |
| 886 | nmdc:mga0sz30_27264_c1 | 3300050516 | Bacteria | 2346 |
| 887 | nmdc:mga0sz30_28004_c1 | 3300050516 | Bacteria | 2317 |
| 888 | nmdc:mga0sz30_5917_c1 | 3300050516 | Bacteria | 4513 |
| 889 | Ga0495601_0024411 | 3300053077 | Bacteria | 3723 |
| 890 | Ga0500635_0002397 | 3300053080 | Bacteria | 4640 |
| 891 | Ga0500635_0012314 | 3300053080 | Bacteria | 2454 |
| 892 | Ga0495619_0077617 | 3300053085 | Bacteria | 2231 |
| 893 | Ga0495619_0156690 | 3300053085 | Bacteria | 1572 |
| 894 | Ga0495619_0171841 | 3300053085 | Bacteria | 1499 |
| 895 | Ga0500578_0000168 | 3300053086 | Bacteria | 78140 |
| 896 | Ga0500578_0090485 | 3300053086 | Bacteria | 1942 |
| 897 | Ga0500643_000060 | 3300053087 | Bacteria | 128090 |
| 898 | Ga0500647_0010576 | 3300053091 | Bacteria | 4087 |
| 899 | Ga0500651_0013537 | 3300053093 | Bacteria | 4972 |
| 900 | Ga0500651_0086930 | 3300053093 | Bacteria | 1930 |
| 901 | Ga0500566_0000232 | 3300053094 | Bacteria | 29876 |
| 902 | Ga0500566_0000433 | 3300053094 | Bacteria | 23328 |
| 903 | Ga0500566_0000445 | 3300053094 | Bacteria | 23074 |
| 904 | Ga0500566_0197350 | 3300053094 | Bacteria | 1019 |
| 905 | Ga0500641_0008597 | 3300053096 | Bacteria | 3649 |
| 906 | Ga0500641_0025576 | 3300053096 | Bacteria | 2284 |
| 907 | Ga0500641_0042983 | 3300053096 | Bacteria | 1833 |
| 908 | Ga0500641_0128644 | 3300053096 | Bacteria | 1092 |
| 909 | Ga0500650_0011541 | 3300053098 | Bacteria | 3642 |
| 910 | Ga0500650_0037422 | 3300053098 | Bacteria | 2229 |
| 911 | Ga0500554_043149 | 3300053102 | Bacteria | 1392 |
| 912 | Ga0500555_001000 | 3300053103 | Bacteria | 9674 |
| 913 | Ga0500556_0001087 | 3300053104 | Bacteria | 13707 |
| 914 | Ga0500557_000007 | 3300053105 | Bacteria | 136781 |
| 915 | Ga0500562_001945 | 3300053108 | Bacteria | 5180 |
| 916 | Ga0500562_015370 | 3300053108 | Bacteria | 1962 |
| 917 | Ga0500572_000629 | 3300053111 | Bacteria | 11778 |
| 918 | Ga0500572_001647 | 3300053111 | Bacteria | 5861 |
| 919 | Ga0500592_005232 | 3300053116 | Bacteria | 2062 |
| 920 | Ga0500594_0000149 | 3300053118 | Bacteria | 19052 |
| 921 | Ga0500595_023394 | 3300053119 | Bacteria | 2172 |
| 922 | Ga0500607_059418 | 3300053121 | Bacteria | 2009 |
| 923 | Ga0500614_001108 | 3300053123 | Bacteria | 6657 |
| 924 | Ga0500618_013103 | 3300053125 | Bacteria | 2153 |
| 925 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 926 | Ga0500642_0004617 | 3300053130 | Bacteria | 4339 |
| 927 | Ga0500559_0001723 | 3300053136 | Bacteria | 11997 |
| 928 | Ga0500559_0002898 | 3300053136 | Bacteria | 8636 |
| 929 | Ga0500559_0007012 | 3300053136 | Bacteria | 5036 |
| 930 | Ga0500559_0011203 | 3300053136 | Bacteria | 3834 |
| 931 | Ga0500561_0038078 | 3300053137 | Bacteria | 1255 |
| 932 | Ga0500568_0002271 | 3300053139 | Bacteria | 11457 |
| 933 | Ga0500573_0061914 | 3300053140 | Bacteria | 2143 |
| 934 | Ga0500577_0001357 | 3300053142 | Bacteria | 6246 |
| 935 | Ga0500586_004250 | 3300053145 | Bacteria | 3480 |
| 936 | Ga0500590_092735 | 3300053148 | Bacteria | 1464 |
| 937 | Ga0500603_001060 | 3300053150 | Bacteria | 6461 |
| 938 | Ga0500603_003471 | 3300053150 | Bacteria | 3382 |
| 939 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 940 | Ga0500622_0000112 | 3300053156 | Bacteria | 83558 |
| 941 | Ga0500622_0004242 | 3300053156 | Bacteria | 9118 |
| 942 | Ga0500630_005547 | 3300053159 | Bacteria | 6167 |
| 943 | Ga0500639_010254 | 3300053163 | Bacteria | 4905 |
| 944 | Ga0500639_054758 | 3300053163 | Bacteria | 2071 |
| 945 | Ga0500636_0003689 | 3300053177 | Bacteria | 8635 |
| 946 | Ga0500636_0025996 | 3300053177 | Bacteria | 3460 |
| 947 | Ga0500637_0026010 | 3300053178 | Bacteria | 3221 |
| 948 | Ga0500576_014386 | 3300053725 | Bacteria | 3564 |
| 949 | Ga0500625_004431 | 3300053729 | Bacteria | 5741 |
| 950 | Ga0500645_049289 | 3300053730 | Bacteria | 1232 |
| 951 | Ga0500609_000708 | 3300053731 | Bacteria | 5029 |
| 952 | Ga0500596_001871 | 3300053735 | Bacteria | 4231 |
| 953 | Ga0500596_002960 | 3300053735 | Bacteria | 3286 |
| 954 | Ga0500601_000071 | 3300053737 | Bacteria | 20922 |
| 955 | Ga0500601_003391 | 3300053737 | Bacteria | 1727 |
| 956 | Ga0500661_000283 | 3300055283 | Bacteria | 9215 |
| 957 | Ga0500661_004156 | 3300055283 | Bacteria | 2709 |
| 958 | Ga0466962_0032764 | 3300061719 | Bacteria | 2487 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0525954 | Ga0436364_0525954_21_830 | 266 |
| 2 | 3300049571 | Ga0501034_0432597 | Ga0501034_0432597_402_1211 | 266 |
| 3 | 3300049584 | Ga0501068_0102770 | Ga0501068_0102770_914_1723 | 266 |
| 4 | 3300013296 | Ga0157374_10027280 | Ga0157374_100272803 | 270 |
| 5 | iso_pu_bacteria | 2582581279 | 2585149631 | 273 |
| 6 | iso_pu_bacteria | 2941485952 | 2941488838 | 273 |
| 7 | iso_pu_bacteria | 2721755755 | 2723844237 | 275 |
| 8 | 3300005985 | Ga0081539_10039994 | Ga0081539_100399941 | 277 |
| 9 | 3300013100 | Ga0157373_10000801 | Ga0157373_1000080129 | 277 |
| 10 | 3300031824 | Ga0307413_10430879 | Ga0307413_104308792 | 277 |
| 11 | 3300046457 | Ga0495590_0001803 | Ga0495590_0001803_6772_7614 | 277 |
| 12 | 3300046460 | Ga0495638_0000607 | Ga0495638_0000607_6942_7784 | 277 |
| 13 | 3300046471 | Ga0495650_0024475 | Ga0495650_0024475_1778_2620 | 277 |
| 14 | 3300046512 | Ga0495610_0013500 | Ga0495610_0013500_3495_4337 | 277 |
| 15 | 3300046518 | Ga0495631_0002173 | Ga0495631_0002173_9715_10557 | 277 |
| 16 | 3300046530 | Ga0495654_0012605 | Ga0495654_0012605_3079_3921 | 277 |
| 17 | 3300046616 | Ga0495668_0002966 | Ga0495668_0002966_11130_11972 | 277 |
| 18 | 3300047472 | Ga0495686_0004342 | Ga0495686_0004342_7227_8069 | 277 |
| 19 | 3300048928 | Ga0496125_0001052 | Ga0496125_0001052_23215_24054 | 277 |
| 20 | 3300049459 | Ga0495678_000397 | Ga0495678_000397_35263_36105 | 277 |
| 21 | 3300053086 | Ga0500578_0000168 | Ga0500578_0000168_33579_34421 | 277 |
| 22 | 3300053108 | Ga0500562_001945 | Ga0500562_001945_4262_5104 | 277 |
| 23 | 3300053118 | Ga0500594_0000149 | Ga0500594_0000149_12663_13505 | 277 |
| 24 | 3300053156 | Ga0500622_0004242 | Ga0500622_0004242_4024_4866 | 277 |
| 25 | 3300046558 | Ga0495633_0001837 | Ga0495633_0001837_11014_11856 | 278 |
| 26 | 3300047444 | Ga0495675_0185101 | Ga0495675_0185101_414_1259 | 278 |
| 27 | 3300049571 | Ga0501034_0315596 | Ga0501034_0315596_406_1251 | 278 |
| 28 | 3300053140 | Ga0500573_0061914 | Ga0500573_0061914_605_1447 | 278 |
| 29 | 3300053148 | Ga0500590_092735 | Ga0500590_092735_602_1447 | 278 |
| 30 | 3300053136 | Ga0500559_0011203 | Ga0500559_0011203_1391_2245 | 279 |
| 31 | iso_pu_bacteria | 2857524615 | 2857530102 | 279 |
| 32 | iso_pu_bacteria | 2885374607 | 2885377221 | 279 |
| 33 | iso_pu_bacteria | 2893066018 | 2893071703 | 279 |
| 34 | iso_pu_bacteria | 2919073203 | 2919076892 | 279 |
| 35 | iso_pu_bacteria | 8003014200 | 8003014689 | 279 |
| 36 | iso_pu_bacteria | 2507262055 | 2507506346 | 280 |
| 37 | iso_pu_bacteria | 2507262055 | 2507510293 | 280 |
| 38 | iso_pu_bacteria | 2508501009 | 2508540586 | 280 |
| 39 | iso_pu_bacteria | 2508501009 | 2508544303 | 280 |
| 40 | iso_pu_bacteria | 2508501042 | 2508697756 | 280 |
| 41 | iso_pu_bacteria | 2508501128 | 2509154320 | 280 |
| 42 | iso_pu_bacteria | 2511231028 | 2511400967 | 280 |
| 43 | iso_pu_bacteria | 2513237092 | 2513628586 | 280 |
| 44 | iso_pu_bacteria | 2513237094 | 2513640304 | 280 |
| 45 | iso_pu_bacteria | 2513237095 | 2513648703 | 280 |
| 46 | iso_pu_bacteria | 2513237096 | 2513659069 | 280 |
| 47 | iso_pu_bacteria | 2513237098 | 2513674776 | 280 |
| 48 | iso_pu_bacteria | 2513237101 | 2513698050 | 280 |
| 49 | iso_pu_bacteria | 2513237102 | 2513706939 | 280 |
| 50 | iso_pu_bacteria | 2513237104 | 2513715981 | 280 |
| 51 | iso_pu_bacteria | 2513237137 | 2513860316 | 280 |
| 52 | iso_pu_bacteria | 2513237139 | 2513878627 | 280 |
| 53 | iso_pu_bacteria | 2513237141 | 2513893822 | 280 |
| 54 | iso_pu_bacteria | 2513237145 | 2513921332 | 280 |
| 55 | iso_pu_bacteria | 2513237161 | 2514013499 | 280 |
| 56 | iso_pu_bacteria | 2515154112 | 2515630512 | 280 |
| 57 | iso_pu_bacteria | 2517572143 | 2517894216 | 280 |
| 58 | iso_pu_bacteria | 2524023205 | 2524441727 | 280 |
| 59 | iso_pu_bacteria | 2524023210 | 2524466048 | 280 |
| 60 | iso_pu_bacteria | 2524023228 | 2524536064 | 280 |
| 61 | iso_pu_bacteria | 2528768022 | 2528855181 | 280 |
| 62 | iso_pu_bacteria | 2617270735 | 2617349874 | 280 |
| 63 | iso_pu_bacteria | 2617270741 | 2617379230 | 280 |
| 64 | iso_pu_bacteria | 2667528175 | 2671123526 | 280 |
| 65 | iso_pu_bacteria | 2721755755 | 2723847401 | 280 |
| 66 | iso_pu_bacteria | 2728368998 | 2728748673 | 280 |
| 67 | iso_pu_bacteria | 2744054633 | 2745075010 | 280 |
| 68 | iso_pu_bacteria | 2791355196 | 2793065803 | 280 |
| 69 | iso_pu_bacteria | 2791355197 | 2793071462 | 280 |
| 70 | iso_pu_bacteria | 2791355199 | 2793081213 | 280 |
| 71 | iso_pu_bacteria | 2802429603 | 2805917243 | 280 |
| 72 | iso_pu_bacteria | 2816332527 | 2818241881 | 280 |
| 73 | iso_pu_bacteria | 2818991467 | 2819720406 | 280 |
| 74 | iso_pu_bacteria | 2824600985 | 2824606657 | 280 |
| 75 | iso_pu_bacteria | 2824609381 | 2824612454 | 280 |
| 76 | iso_pu_bacteria | 2824617872 | 2824620995 | 280 |
| 77 | iso_pu_bacteria | 2824617872 | 2824621187 | 280 |
| 78 | iso_pu_bacteria | 2824626560 | 2824629700 | 280 |
| 79 | iso_pu_bacteria | 2824626560 | 2824629950 | 280 |
| 80 | iso_pu_bacteria | 2824635225 | 2824636309 | 280 |
| 81 | iso_pu_bacteria | 2824635225 | 2824637009 | 280 |
| 82 | iso_pu_bacteria | 2824644064 | 2824644911 | 280 |
| 83 | iso_pu_bacteria | 2824644064 | 2824646008 | 280 |
| 84 | iso_pu_bacteria | 2824653114 | 2824656863 | 280 |
| 85 | iso_pu_bacteria | 2824661429 | 2824664649 | 280 |
| 86 | iso_pu_bacteria | 2824671348 | 2824673085 | 280 |
| 87 | iso_pu_bacteria | 2824679649 | 2824679965 | 280 |
| 88 | iso_pu_bacteria | 2824687955 | 2824689727 | 280 |
| 89 | iso_pu_bacteria | 2824696289 | 2824698758 | 280 |
| 90 | iso_pu_bacteria | 2824704595 | 2824705729 | 280 |
| 91 | iso_pu_bacteria | 2824704595 | 2824709616 | 280 |
| 92 | iso_pu_bacteria | 2824714736 | 2824715202 | 280 |
| 93 | iso_pu_bacteria | 2824714736 | 2824717355 | 280 |
| 94 | iso_pu_bacteria | 2824723954 | 2824724509 | 280 |
| 95 | iso_pu_bacteria | 2824723954 | 2824725440 | 280 |
| 96 | iso_pu_bacteria | 2824732956 | 2824735390 | 280 |
| 97 | iso_pu_bacteria | 2824746037 | 2824749922 | 280 |
| 98 | iso_pu_bacteria | 2824753945 | 2824755349 | 280 |
| 99 | iso_pu_bacteria | 2824763712 | 2824771124 | 280 |
| 100 | iso_pu_bacteria | 2824773399 | 2824778415 | 280 |
| 101 | iso_pu_bacteria | 2824773399 | 2824781336 | 280 |
| 102 | iso_pu_bacteria | 2838122688 | 2838125519 | 280 |
| 103 | iso_pu_bacteria | 2841941048 | 2841941817 | 280 |
| 104 | iso_pu_bacteria | 2841949485 | 2841951247 | 280 |
| 105 | iso_pu_bacteria | 2841957949 | 2841959182 | 280 |
| 106 | iso_pu_bacteria | 2841966195 | 2841968759 | 280 |
| 107 | iso_pu_bacteria | 2841974524 | 2841976042 | 280 |
| 108 | iso_pu_bacteria | 2841983080 | 2841989102 | 280 |
| 109 | iso_pu_bacteria | 2842038055 | 2842045228 | 280 |
| 110 | iso_pu_bacteria | 2842045827 | 2842049110 | 280 |
| 111 | iso_pu_bacteria | 2842775625 | 2842779617 | 280 |
| 112 | iso_pu_bacteria | 2844315083 | 2844317447 | 280 |
| 113 | iso_pu_bacteria | 2847930680 | 2847934232 | 280 |
| 114 | iso_pu_bacteria | 2847939898 | 2847944818 | 280 |
| 115 | iso_pu_bacteria | 2849076700 | 2849080971 | 280 |
| 116 | iso_pu_bacteria | 2857509624 | 2857509669 | 280 |
| 117 | iso_pu_bacteria | 2874590934 | 2874594844 | 280 |
| 118 | iso_pu_bacteria | 2874604998 | 2874607349 | 280 |
| 119 | iso_pu_bacteria | 2874612657 | 2874614165 | 280 |
| 120 | iso_pu_bacteria | 2874620515 | 2874620958 | 280 |
| 121 | iso_pu_bacteria | 2874628541 | 2874632821 | 280 |
| 122 | iso_pu_bacteria | 2874645413 | 2874646639 | 280 |
| 123 | iso_pu_bacteria | 2876761206 | 2876769511 | 280 |
| 124 | iso_pu_bacteria | 2876771140 | 2876774314 | 280 |
| 125 | iso_pu_bacteria | 2876808645 | 2876811430 | 280 |
| 126 | iso_pu_bacteria | 2876818435 | 2876822896 | 280 |
| 127 | iso_pu_bacteria | 2879074833 | 2879078469 | 280 |
| 128 | iso_pu_bacteria | 2879083081 | 2879086790 | 280 |
| 129 | iso_pu_bacteria | 2879099564 | 2879109882 | 280 |
| 130 | iso_pu_bacteria | 2879110137 | 2879114822 | 280 |
| 131 | iso_pu_bacteria | 2879127579 | 2879128900 | 280 |
| 132 | iso_pu_bacteria | 2879142872 | 2879144255 | 280 |
| 133 | iso_pu_bacteria | 2881364244 | 2881368047 | 280 |
| 134 | iso_pu_bacteria | 2881665667 | 2881672667 | 280 |
| 135 | iso_pu_bacteria | 2885366525 | 2885367511 | 280 |
| 136 | iso_pu_bacteria | 2885383462 | 2885385800 | 280 |
| 137 | iso_pu_bacteria | 2888378607 | 2888382143 | 280 |
| 138 | iso_pu_bacteria | 2888388044 | 2888388542 | 280 |
| 139 | iso_pu_bacteria | 2888419890 | 2888422746 | 280 |
| 140 | iso_pu_bacteria | 2889033259 | 2889042107 | 280 |
| 141 | iso_pu_bacteria | 2903727486 | 2903733171 | 280 |
| 142 | iso_pu_bacteria | 2903748898 | 2903753720 | 280 |
| 143 | iso_pu_bacteria | 2903768456 | 2903772805 | 280 |
| 144 | iso_pu_bacteria | 2904666416 | 2904667078 | 280 |
| 145 | iso_pu_bacteria | 2904690495 | 2904697360 | 280 |
| 146 | iso_pu_bacteria | 2904699407 | 2904705341 | 280 |
| 147 | iso_pu_bacteria | 2904711408 | 2904718785 | 280 |
| 148 | iso_pu_bacteria | 2906602504 | 2906604016 | 280 |
| 149 | iso_pu_bacteria | 2906610324 | 2906611029 | 280 |
| 150 | iso_pu_bacteria | 2906626472 | 2906628687 | 280 |
| 151 | iso_pu_bacteria | 2906635258 | 2906638029 | 280 |
| 152 | iso_pu_bacteria | 2906643746 | 2906647483 | 280 |
| 153 | iso_pu_bacteria | 2906660503 | 2906661825 | 280 |
| 154 | iso_pu_bacteria | 2908739725 | 2908744545 | 280 |
| 155 | iso_pu_bacteria | 2908756301 | 2908762325 | 280 |
| 156 | iso_pu_bacteria | 2908775508 | 2908778426 | 280 |
| 157 | iso_pu_bacteria | 2922361189 | 2922368652 | 280 |
| 158 | iso_pu_bacteria | 2922368715 | 2922372217 | 280 |
| 159 | iso_pu_bacteria | 2922393267 | 2922399180 | 280 |
| 160 | iso_pu_bacteria | 2922425934 | 2922428283 | 280 |
| 161 | iso_pu_bacteria | 2929615660 | 2929616575 | 280 |
| 162 | iso_pu_bacteria | 2929624759 | 2929625319 | 280 |
| 163 | iso_pu_bacteria | 2932784394 | 2932786747 | 280 |
| 164 | iso_pu_bacteria | 2932794094 | 2932798865 | 280 |
| 165 | iso_pu_bacteria | 2932801729 | 2932805082 | 280 |
| 166 | iso_pu_bacteria | 2932809354 | 2932817886 | 280 |
| 167 | iso_pu_bacteria | 2932818245 | 2932827301 | 280 |
| 168 | iso_pu_bacteria | 2932828146 | 2932837440 | 280 |
| 169 | iso_pu_bacteria | 2933577622 | 2933578142 | 280 |
| 170 | iso_pu_bacteria | 2935608549 | 2935610790 | 280 |
| 171 | iso_pu_bacteria | 2935616580 | 2935624898 | 280 |
| 172 | iso_pu_bacteria | 2935630451 | 2935635882 | 280 |
| 173 | iso_pu_bacteria | 2935648319 | 2935654561 | 280 |
| 174 | iso_pu_bacteria | 2935656913 | 2935663441 | 280 |
| 175 | iso_pu_bacteria | 2935665750 | 2935671347 | 280 |
| 176 | iso_pu_bacteria | 2935675223 | 2935684773 | 280 |
| 177 | iso_pu_bacteria | 2935684952 | 2935691993 | 280 |
| 178 | iso_pu_bacteria | 2935694250 | 2935695063 | 280 |
| 179 | iso_pu_bacteria | 2935703347 | 2935707984 | 280 |
| 180 | iso_pu_bacteria | 2935713505 | 2935721832 | 280 |
| 181 | iso_pu_bacteria | 2935722832 | 2935731170 | 280 |
| 182 | iso_pu_bacteria | 2935732158 | 2935738968 | 280 |
| 183 | iso_pu_bacteria | 2935741537 | 2935747847 | 280 |
| 184 | iso_pu_bacteria | 2935750917 | 2935756431 | 280 |
| 185 | iso_pu_bacteria | 2935760218 | 2935761586 | 280 |
| 186 | iso_pu_bacteria | 2935769743 | 2935774426 | 280 |
| 187 | iso_pu_bacteria | 2935777560 | 2935783451 | 280 |
| 188 | iso_pu_bacteria | 2935785616 | 2935790555 | 280 |
| 189 | iso_pu_bacteria | 2935793552 | 2935799037 | 280 |
| 190 | iso_pu_bacteria | 2935801545 | 2935804911 | 280 |
| 191 | iso_pu_bacteria | 2935810662 | 2935812098 | 280 |
| 192 | iso_pu_bacteria | 2935819856 | 2935820274 | 280 |
| 193 | iso_pu_bacteria | 2935837841 | 2935846938 | 280 |
| 194 | iso_pu_bacteria | 2935847175 | 2935849716 | 280 |
| 195 | iso_pu_bacteria | 2935855204 | 2935863529 | 280 |
| 196 | iso_pu_bacteria | 2935864058 | 2935872732 | 280 |
| 197 | iso_pu_bacteria | 2935873716 | 2935882655 | 280 |
| 198 | iso_pu_bacteria | 2935883170 | 2935889272 | 280 |
| 199 | iso_pu_bacteria | 2935908558 | 2935915997 | 280 |
| 200 | iso_pu_bacteria | 2935916978 | 2935919145 | 280 |
| 201 | iso_pu_bacteria | 2935926038 | 2935933384 | 280 |
| 202 | iso_pu_bacteria | 2935934488 | 2935941885 | 280 |
| 203 | iso_pu_bacteria | 2935942939 | 2935950275 | 280 |
| 204 | iso_pu_bacteria | 2935951376 | 2935958875 | 280 |
| 205 | iso_pu_bacteria | 2935959822 | 2935966052 | 280 |
| 206 | iso_pu_bacteria | 2935967501 | 2935970316 | 280 |
| 207 | iso_pu_bacteria | 2935975950 | 2935979820 | 280 |
| 208 | iso_pu_bacteria | 2935984226 | 2935992030 | 280 |
| 209 | iso_pu_bacteria | 2935992306 | 2935997498 | 280 |
| 210 | iso_pu_bacteria | 2936002035 | 2936005277 | 280 |
| 211 | iso_pu_bacteria | 2936011229 | 2936017626 | 280 |
| 212 | iso_pu_bacteria | 2936019824 | 2936026129 | 280 |
| 213 | iso_pu_bacteria | 2936028420 | 2936034941 | 280 |
| 214 | iso_pu_bacteria | 2936037263 | 2936038692 | 280 |
| 215 | iso_pu_bacteria | 2936046547 | 2936053028 | 280 |
| 216 | iso_pu_bacteria | 2936055302 | 2936061903 | 280 |
| 217 | iso_pu_bacteria | 2940556831 | 2940562345 | 280 |
| 218 | iso_pu_bacteria | 2941507105 | 2941512513 | 280 |
| 219 | iso_pu_bacteria | 2941515067 | 2941520214 | 280 |
| 220 | iso_pu_bacteria | 2941523033 | 2941528390 | 280 |
| 221 | iso_pu_bacteria | 2941531003 | 2941535234 | 280 |
| 222 | iso_pu_bacteria | 2941538514 | 2941539569 | 280 |
| 223 | iso_pu_bacteria | 3003665799 | 3003668315 | 280 |
| 224 | iso_pu_bacteria | 3005474847 | 3005478269 | 280 |
| 225 | iso_pu_bacteria | 3005483717 | 3005486579 | 280 |
| 226 | iso_pu_bacteria | 3005587118 | 3005593573 | 280 |
| 227 | iso_pu_bacteria | 3005594810 | 3005597169 | 280 |
| 228 | iso_pu_bacteria | 3005710791 | 3005713202 | 280 |
| 229 | iso_pu_bacteria | 3005718088 | 3005720567 | 280 |
| 230 | iso_pu_bacteria | 8006926726 | 8006927798 | 280 |
| 231 | iso_pu_bacteria | 8006933436 | 8006942947 | 280 |
| 232 | iso_pu_bacteria | 8006964411 | 8006970946 | 280 |
| 233 | iso_pu_bacteria | 8006973647 | 8006982667 | 280 |
| 234 | iso_pu_bacteria | 8006984368 | 8006988722 | 280 |
| 235 | iso_pu_bacteria | 8006994254 | 8007001899 | 280 |
| 236 | iso_pu_bacteria | 8016511872 | 8016515492 | 280 |
| 237 | iso_pu_bacteria | 8016522445 | 8016523178 | 280 |
| 238 | iso_pu_bacteria | 8016530956 | 8016536653 | 280 |
| 239 | iso_pu_bacteria | 8016539877 | 8016540934 | 280 |
| 240 | iso_pu_bacteria | 8016548790 | 8016552314 | 280 |
| 241 | iso_pu_bacteria | 8016557553 | 8016560699 | 280 |
| 242 | iso_pu_bacteria | 8016566248 | 8016566326 | 280 |
| 243 | iso_pu_bacteria | 8016575299 | 8016579081 | 280 |
| 244 | iso_pu_bacteria | 8016583857 | 8016590512 | 280 |
| 245 | iso_pu_bacteria | 8016595262 | 8016598581 | 280 |
| 246 | iso_pu_bacteria | 8016613128 | 8016621289 | 280 |
| 247 | iso_pu_bacteria | 8016630954 | 8016632874 | 280 |
| 248 | iso_pu_bacteria | 8017057580 | 8017060988 | 280 |
| 249 | iso_pu_bacteria | 8019530166 | 8019536362 | 280 |
| 250 | iso_pu_bacteria | 8019547302 | 8019555824 | 280 |
| 251 | iso_pu_bacteria | 8019555841 | 8019558738 | 280 |
| 252 | iso_pu_bacteria | 8019576017 | 8019580431 | 280 |
| 253 | iso_pu_bacteria | 8019586578 | 8019588153 | 280 |
| 254 | iso_pu_bacteria | 8019597564 | 8019603188 | 280 |
| 255 | iso_pu_bacteria | 8019608314 | 8019615347 | 280 |
| 256 | iso_pu_bacteria | 8019619141 | 8019626215 | 280 |
| 257 | iso_pu_bacteria | 8019629233 | 8019636281 | 280 |
| 258 | iso_pu_bacteria | 8019638758 | 8019643393 | 280 |
| 259 | iso_pu_bacteria | 8019648815 | 8019656177 | 280 |
| 260 | iso_pu_bacteria | 8019668869 | 8019673675 | 280 |
| 261 | iso_pu_bacteria | 8019687851 | 8019688097 | 280 |
| 262 | iso_pu_bacteria | 8055742211 | 8055748221 | 280 |
| 263 | iso_pu_bacteria | 8056673599 | 8056681145 | 280 |
| 264 | iso_pu_bacteria | 8056681323 | 8056684399 | 280 |
| 265 | iso_pu_bacteria | 8056689827 | 8056694330 | 280 |
| 266 | iso_pu_bacteria | 8056967851 | 8056969029 | 280 |
| 267 | 3300005455 | Ga0070663_100009960 | Ga0070663_1000099602 | 281 |
| 268 | 3300005548 | Ga0070665_100446776 | Ga0070665_1004467762 | 281 |
| 269 | 3300007265 | Ga0099794_10006306 | Ga0099794_100063064 | 281 |
| 270 | 3300021384 | Ga0213876_10121308 | Ga0213876_101213082 | 281 |
| 271 | 3300026067 | Ga0207678_10027242 | Ga0207678_100272422 | 281 |
| 272 | 3300028379 | Ga0268266_10427907 | Ga0268266_104279072 | 281 |
| 273 | 3300048921 | Ga0496118_0012803 | Ga0496118_0012803_1084_1956 | 281 |
| 274 | 3300048922 | Ga0496119_0064564 | Ga0496119_0064564_1121_1993 | 281 |
| 275 | 3300048924 | Ga0496121_0266137 | Ga0496121_0266137_124_996 | 281 |
| 276 | 3300048925 | Ga0496122_0004199 | Ga0496122_0004199_11500_12372 | 281 |
| 277 | 3300048926 | Ga0496123_0012131 | Ga0496123_0012131_112_984 | 281 |
| 278 | 3300049568 | Ga0501031_0196295 | Ga0501031_0196295_253_1110 | 281 |
| 279 | 3300049570 | Ga0501033_0128242 | Ga0501033_0128242_161_1015 | 281 |
| 280 | 3300049579 | Ga0501043_0088763 | Ga0501043_0088763_929_1786 | 281 |
| 281 | 3300049580 | Ga0501046_0235020 | Ga0501046_0235020_481_1338 | 281 |
| 282 | iso_pu_bacteria | 2643221577 | 2643896789 | 281 |
| 283 | iso_pu_bacteria | 2643221685 | 2644478994 | 281 |
| 284 | 3300006358 | Ga0068871_100195093 | Ga0068871_1001950932 | 282 |
| 285 | 3300009177 | Ga0105248_10260551 | Ga0105248_102605512 | 282 |
| 286 | 3300025284 | Ga0209130_1029167 | Ga0209130_10291671 | 282 |
| 287 | 3300025295 | Ga0209564_1004691 | Ga0209564_10046914 | 282 |
| 288 | 3300035120 | Ga0373957_0025990 | Ga0373957_0025990_996_1856 | 282 |
| 289 | 3300046500 | Ga0495596_0137897 | Ga0495596_0137897_52_912 | 282 |
| 290 | 3300046506 | Ga0495583_0043305 | Ga0495583_0043305_531_1391 | 282 |
| 291 | 3300046530 | Ga0495654_0017015 | Ga0495654_0017015_1274_2134 | 282 |
| 292 | 3300046616 | Ga0495668_0280350 | Ga0495668_0280350_18_878 | 282 |
| 293 | 3300046674 | Ga0495588_0058437 | Ga0495588_0058437_398_1258 | 282 |
| 294 | 3300047470 | Ga0495681_0046405 | Ga0495681_0046405_423_1283 | 282 |
| 295 | 3300048919 | Ga0496116_0019933 | Ga0496116_0019933_1055_1915 | 282 |
| 296 | 3300048920 | Ga0496117_0161793 | Ga0496117_0161793_230_1090 | 282 |
| 297 | 3300048921 | Ga0496118_0081149 | Ga0496118_0081149_1163_2023 | 282 |
| 298 | 3300048923 | Ga0496120_0136034 | Ga0496120_0136034_296_1156 | 282 |
| 299 | 3300048924 | Ga0496121_0004204 | Ga0496121_0004204_8766_9626 | 282 |
| 300 | 3300048925 | Ga0496122_0076193 | Ga0496122_0076193_1119_1979 | 282 |
| 301 | 3300048926 | Ga0496123_0067660 | Ga0496123_0067660_1028_1888 | 282 |
| 302 | 3300048928 | Ga0496125_0089784 | Ga0496125_0089784_693_1553 | 282 |
| 303 | 3300048929 | Ga0496126_0402734 | Ga0496126_0402734_230_1090 | 282 |
| 304 | 3300050492 | nmdc:mga0yw44_92219_c1 | nmdc:mga0yw44_92219_c1_448_1308 | 282 |
| 305 | 3300053096 | Ga0500641_0008597 | Ga0500641_0008597_1303_2163 | 282 |
| 306 | 3300053098 | Ga0500650_0037422 | Ga0500650_0037422_319_1179 | 282 |
| 307 | 3300053104 | Ga0500556_0001087 | Ga0500556_0001087_8911_9771 | 282 |
| 308 | 3300053108 | Ga0500562_015370 | Ga0500562_015370_106_966 | 282 |
| 309 | 3300053116 | Ga0500592_005232 | Ga0500592_005232_457_1317 | 282 |
| 310 | 3300053125 | Ga0500618_013103 | Ga0500618_013103_317_1177 | 282 |
| 311 | 3300053130 | Ga0500642_0000026 | Ga0500642_0000026_4992_5852 | 282 |
| 312 | 3300053139 | Ga0500568_0002271 | Ga0500568_0002271_8123_8983 | 282 |
| 313 | 3300053142 | Ga0500577_0001357 | Ga0500577_0001357_3834_4697 | 282 |
| 314 | 3300053156 | Ga0500622_0000112 | Ga0500622_0000112_3456_4316 | 282 |
| 315 | iso_pu_bacteria | 2739367700 | 2739730251 | 282 |
| 316 | iso_pu_bacteria | 2884411467 | 2884412153 | 282 |
| 317 | iso_pu_bacteria | 2928963466 | 2928967687 | 282 |
| 318 | 3300003187 | JGI25151J46595_10034545 | JGI25151J46595_100345452 | 283 |
| 319 | 3300003215 | JGI25153J46596_10001032 | JGI25153J46596_1000103212 | 283 |
| 320 | 3300003215 | JGI25153J46596_10001653 | JGI25153J46596_100016539 | 283 |
| 321 | 3300003215 | JGI25153J46596_10001857 | JGI25153J46596_100018575 | 283 |
| 322 | 3300003354 | JGI25160J50197_1000935 | JGI25160J50197_10009358 | 283 |
| 323 | 3300003354 | JGI25160J50197_1004654 | JGI25160J50197_10046547 | 283 |
| 324 | 3300003659 | JGI25404J52841_10000792 | JGI25404J52841_100007924 | 283 |
| 325 | 3300003659 | JGI25404J52841_10003180 | JGI25404J52841_100031804 | 283 |
| 326 | 3300003659 | JGI25404J52841_10023374 | JGI25404J52841_100233742 | 283 |
| 327 | 3300003752 | Ga0055539_1008044 | Ga0055539_10080442 | 283 |
| 328 | 3300003762 | Ga0055542_1008531 | Ga0055542_10085311 | 283 |
| 329 | 3300003775 | Ga0055524_1016860 | Ga0055524_10168601 | 283 |
| 330 | 3300003775 | Ga0055524_1024837 | Ga0055524_10248373 | 283 |
| 331 | 3300003781 | Ga0055536_1005549 | Ga0055536_10055492 | 283 |
| 332 | 3300003781 | Ga0055536_1007021 | Ga0055536_10070213 | 283 |
| 333 | 3300003791 | Ga0055530_10002947 | Ga0055530_100029475 | 283 |
| 334 | 3300003794 | Ga0055531_10008111 | Ga0055531_100081116 | 283 |
| 335 | 3300003794 | Ga0055531_10011812 | Ga0055531_100118124 | 283 |
| 336 | 3300003794 | Ga0055531_10012762 | Ga0055531_100127622 | 283 |
| 337 | 3300003794 | Ga0055531_10029170 | Ga0055531_100291703 | 283 |
| 338 | 3300005262 | Ga0065165_1002030 | Ga0065165_100203014 | 283 |
| 339 | 3300005262 | Ga0065165_1002068 | Ga0065165_10020686 | 283 |
| 340 | 3300005329 | Ga0070683_100019548 | Ga0070683_1000195487 | 283 |
| 341 | 3300005336 | Ga0070680_100012050 | Ga0070680_1000120504 | 283 |
| 342 | 3300005336 | Ga0070680_100075324 | Ga0070680_1000753242 | 283 |
| 343 | 3300005336 | Ga0070680_100097312 | Ga0070680_1000973121 | 283 |
| 344 | 3300005337 | Ga0070682_100031822 | Ga0070682_1000318221 | 283 |
| 345 | 3300005339 | Ga0070660_100006509 | Ga0070660_1000065097 | 283 |
| 346 | 3300005339 | Ga0070660_100128586 | Ga0070660_1001285863 | 283 |
| 347 | 3300005347 | Ga0070668_100096616 | Ga0070668_1000966163 | 283 |
| 348 | 3300005355 | Ga0070671_100159491 | Ga0070671_1001594912 | 283 |
| 349 | 3300005356 | Ga0070674_100118650 | Ga0070674_1001186502 | 283 |
| 350 | 3300005367 | Ga0070667_100103439 | Ga0070667_1001034391 | 283 |
| 351 | 3300005406 | Ga0070703_10048097 | Ga0070703_100480972 | 283 |
| 352 | 3300005434 | Ga0070709_10011973 | Ga0070709_100119731 | 283 |
| 353 | 3300005434 | Ga0070709_10022883 | Ga0070709_100228833 | 283 |
| 354 | 3300005434 | Ga0070709_10056329 | Ga0070709_100563292 | 283 |
| 355 | 3300005435 | Ga0070714_100364754 | Ga0070714_1003647542 | 283 |
| 356 | 3300005436 | Ga0070713_100097083 | Ga0070713_1000970833 | 283 |
| 357 | 3300005436 | Ga0070713_100124711 | Ga0070713_1001247112 | 283 |
| 358 | 3300005436 | Ga0070713_100133713 | Ga0070713_1001337131 | 283 |
| 359 | 3300005437 | Ga0070710_10018063 | Ga0070710_100180634 | 283 |
| 360 | 3300005437 | Ga0070710_10025623 | Ga0070710_100256232 | 283 |
| 361 | 3300005437 | Ga0070710_10039002 | Ga0070710_100390023 | 283 |
| 362 | 3300005439 | Ga0070711_100016347 | Ga0070711_1000163476 | 283 |
| 363 | 3300005445 | Ga0070708_100057508 | Ga0070708_1000575083 | 283 |
| 364 | 3300005455 | Ga0070663_100115551 | Ga0070663_1001155512 | 283 |
| 365 | 3300005455 | Ga0070663_100310786 | Ga0070663_1003107862 | 283 |
| 366 | 3300005456 | Ga0070678_100067719 | Ga0070678_1000677192 | 283 |
| 367 | 3300005457 | Ga0070662_100181198 | Ga0070662_1001811982 | 283 |
| 368 | 3300005457 | Ga0070662_100285966 | Ga0070662_1002859661 | 283 |
| 369 | 3300005458 | Ga0070681_10031355 | Ga0070681_100313554 | 283 |
| 370 | 3300005458 | Ga0070681_10068440 | Ga0070681_100684403 | 283 |
| 371 | 3300005518 | Ga0070699_100446325 | Ga0070699_1004463252 | 283 |
| 372 | 3300005530 | Ga0070679_100048769 | Ga0070679_1000487692 | 283 |
| 373 | 3300005530 | Ga0070679_100284240 | Ga0070679_1002842402 | 283 |
| 374 | 3300005535 | Ga0070684_100004940 | Ga0070684_1000049403 | 283 |
| 375 | 3300005535 | Ga0070684_100110440 | Ga0070684_1001104403 | 283 |
| 376 | 3300005535 | Ga0070684_100298275 | Ga0070684_1002982751 | 283 |
| 377 | 3300005536 | Ga0070697_100036758 | Ga0070697_1000367584 | 283 |
| 378 | 3300005539 | Ga0068853_100027282 | Ga0068853_1000272826 | 283 |
| 379 | 3300005539 | Ga0068853_100051545 | Ga0068853_1000515452 | 283 |
| 380 | 3300005539 | Ga0068853_100068499 | Ga0068853_1000684993 | 283 |
| 381 | 3300005548 | Ga0070665_100143080 | Ga0070665_1001430802 | 283 |
| 382 | 3300005563 | Ga0068855_100057686 | Ga0068855_1000576863 | 283 |
| 383 | 3300005563 | Ga0068855_100074786 | Ga0068855_1000747862 | 283 |
| 384 | 3300005563 | Ga0068855_100102540 | Ga0068855_1001025402 | 283 |
| 385 | 3300005563 | Ga0068855_100156671 | Ga0068855_1001566712 | 283 |
| 386 | 3300005577 | Ga0068857_100003812 | Ga0068857_1000038127 | 283 |
| 387 | 3300005577 | Ga0068857_100010456 | Ga0068857_1000104564 | 283 |
| 388 | 3300005577 | Ga0068857_100017758 | Ga0068857_1000177585 | 283 |
| 389 | 3300005578 | Ga0068854_100023631 | Ga0068854_1000236313 | 283 |
| 390 | 3300005578 | Ga0068854_100031462 | Ga0068854_1000314622 | 283 |
| 391 | 3300005614 | Ga0068856_100024631 | Ga0068856_1000246313 | 283 |
| 392 | 3300005614 | Ga0068856_100050802 | Ga0068856_1000508022 | 283 |
| 393 | 3300005614 | Ga0068856_100697533 | Ga0068856_1006975331 | 283 |
| 394 | 3300005615 | Ga0070702_100112820 | Ga0070702_1001128202 | 283 |
| 395 | 3300005616 | Ga0068852_100004160 | Ga0068852_1000041605 | 283 |
| 396 | 3300005616 | Ga0068852_100007043 | Ga0068852_1000070437 | 283 |
| 397 | 3300005616 | Ga0068852_100280329 | Ga0068852_1002803292 | 283 |
| 398 | 3300005718 | Ga0068866_10091719 | Ga0068866_100917192 | 283 |
| 399 | 3300005719 | Ga0068861_100042398 | Ga0068861_1000423981 | 283 |
| 400 | 3300005834 | Ga0068851_10001214 | Ga0068851_100012145 | 283 |
| 401 | 3300005834 | Ga0068851_10006472 | Ga0068851_100064721 | 283 |
| 402 | 3300005841 | Ga0068863_100251707 | Ga0068863_1002517072 | 283 |
| 403 | 3300005844 | Ga0068862_100470093 | Ga0068862_1004700932 | 283 |
| 404 | 3300005937 | Ga0081455_10004707 | Ga0081455_100047079 | 283 |
| 405 | 3300005937 | Ga0081455_10015886 | Ga0081455_100158864 | 283 |
| 406 | 3300005937 | Ga0081455_10028943 | Ga0081455_100289434 | 283 |
| 407 | 3300005983 | Ga0081540_1001530 | Ga0081540_100153015 | 283 |
| 408 | 3300005983 | Ga0081540_1007530 | Ga0081540_10075306 | 283 |
| 409 | 3300005983 | Ga0081540_1012734 | Ga0081540_10127345 | 283 |
| 410 | 3300005983 | Ga0081540_1021844 | Ga0081540_10218443 | 283 |
| 411 | 3300005983 | Ga0081540_1024489 | Ga0081540_10244894 | 283 |
| 412 | 3300005983 | Ga0081540_1050002 | Ga0081540_10500022 | 283 |
| 413 | 3300005983 | Ga0081540_1056776 | Ga0081540_10567762 | 283 |
| 414 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008153 | 283 |
| 415 | 3300005985 | Ga0081539_10001561 | Ga0081539_1000156124 | 283 |
| 416 | 3300005985 | Ga0081539_10014949 | Ga0081539_100149492 | 283 |
| 417 | 3300006028 | Ga0070717_10005931 | Ga0070717_100059313 | 283 |
| 418 | 3300006038 | Ga0075365_10034424 | Ga0075365_100344243 | 283 |
| 419 | 3300006038 | Ga0075365_10082935 | Ga0075365_100829352 | 283 |
| 420 | 3300006038 | Ga0075365_10154602 | Ga0075365_101546021 | 283 |
| 421 | 3300006038 | Ga0075365_10167433 | Ga0075365_101674331 | 283 |
| 422 | 3300006042 | Ga0075368_10022590 | Ga0075368_100225902 | 283 |
| 423 | 3300006048 | Ga0075363_100010388 | Ga0075363_1000103883 | 283 |
| 424 | 3300006048 | Ga0075363_100081410 | Ga0075363_1000814102 | 283 |
| 425 | 3300006058 | Ga0075432_10044317 | Ga0075432_100443172 | 283 |
| 426 | 3300006163 | Ga0070715_10072955 | Ga0070715_100729552 | 283 |
| 427 | 3300006173 | Ga0070716_100036868 | Ga0070716_1000368681 | 283 |
| 428 | 3300006173 | Ga0070716_100057358 | Ga0070716_1000573582 | 283 |
| 429 | 3300006173 | Ga0070716_100158364 | Ga0070716_1001583642 | 283 |
| 430 | 3300006177 | Ga0075362_10087758 | Ga0075362_100877582 | 283 |
| 431 | 3300006178 | Ga0075367_10023705 | Ga0075367_100237052 | 283 |
| 432 | 3300006178 | Ga0075367_10125747 | Ga0075367_101257471 | 283 |
| 433 | 3300006186 | Ga0075369_10040575 | Ga0075369_100405752 | 283 |
| 434 | 3300006186 | Ga0075369_10103099 | Ga0075369_101030992 | 283 |
| 435 | 3300006195 | Ga0075366_10021402 | Ga0075366_100214023 | 283 |
| 436 | 3300006195 | Ga0075366_10042268 | Ga0075366_100422683 | 283 |
| 437 | 3300006195 | Ga0075366_10065532 | Ga0075366_100655322 | 283 |
| 438 | 3300006237 | Ga0097621_100194874 | Ga0097621_1001948742 | 283 |
| 439 | 3300006353 | Ga0075370_10055630 | Ga0075370_100556302 | 283 |
| 440 | 3300006358 | Ga0068871_100123094 | Ga0068871_1001230942 | 283 |
| 441 | 3300006914 | Ga0075436_100192550 | Ga0075436_1001925502 | 283 |
| 442 | 3300006914 | Ga0075436_100223615 | Ga0075436_1002236151 | 283 |
| 443 | 3300006942 | Ga0099824_1006034 | Ga0099824_100603414 | 283 |
| 444 | 3300006942 | Ga0099824_1022602 | Ga0099824_10226024 | 283 |
| 445 | 3300006943 | Ga0099822_1001290 | Ga0099822_100129026 | 283 |
| 446 | 3300006944 | Ga0099823_1045654 | Ga0099823_10456543 | 283 |
| 447 | 3300007076 | Ga0075435_100269521 | Ga0075435_1002695211 | 283 |
| 448 | 3300007788 | Ga0099795_10028502 | Ga0099795_100285022 | 283 |
| 449 | 3300009093 | Ga0105240_10007705 | Ga0105240_100077053 | 283 |
| 450 | 3300009093 | Ga0105240_10013464 | Ga0105240_100134644 | 283 |
| 451 | 3300009093 | Ga0105240_10022611 | Ga0105240_100226115 | 283 |
| 452 | 3300009093 | Ga0105240_10028431 | Ga0105240_100284316 | 283 |
| 453 | 3300009093 | Ga0105240_10038303 | Ga0105240_100383035 | 283 |
| 454 | 3300009093 | Ga0105240_10237054 | Ga0105240_102370543 | 283 |
| 455 | 3300009093 | Ga0105240_10498991 | Ga0105240_104989911 | 283 |
| 456 | 3300009101 | Ga0105247_10097521 | Ga0105247_100975212 | 283 |
| 457 | 3300009101 | Ga0105247_10108391 | Ga0105247_101083912 | 283 |
| 458 | 3300009174 | Ga0105241_10010762 | Ga0105241_100107623 | 283 |
| 459 | 3300009174 | Ga0105241_10046704 | Ga0105241_100467043 | 283 |
| 460 | 3300009174 | Ga0105241_10140830 | Ga0105241_101408302 | 283 |
| 461 | 3300009174 | Ga0105241_10178257 | Ga0105241_101782572 | 283 |
| 462 | 3300009176 | Ga0105242_10324093 | Ga0105242_103240931 | 283 |
| 463 | 3300009177 | Ga0105248_10138967 | Ga0105248_101389673 | 283 |
| 464 | 3300009545 | Ga0105237_10004743 | Ga0105237_1000474311 | 283 |
| 465 | 3300009545 | Ga0105237_10011260 | Ga0105237_100112605 | 283 |
| 466 | 3300009545 | Ga0105237_10031433 | Ga0105237_100314333 | 283 |
| 467 | 3300009545 | Ga0105237_10122646 | Ga0105237_101226461 | 283 |
| 468 | 3300009545 | Ga0105237_10427450 | Ga0105237_104274501 | 283 |
| 469 | 3300009551 | Ga0105238_10002076 | Ga0105238_100020765 | 283 |
| 470 | 3300009551 | Ga0105238_10010980 | Ga0105238_100109803 | 283 |
| 471 | 3300009551 | Ga0105238_10012649 | Ga0105238_100126492 | 283 |
| 472 | 3300009551 | Ga0105238_10172915 | Ga0105238_101729152 | 283 |
| 473 | 3300009551 | Ga0105238_10232319 | Ga0105238_102323193 | 283 |
| 474 | 3300010375 | Ga0105239_10013891 | Ga0105239_100138915 | 283 |
| 475 | 3300010375 | Ga0105239_10039944 | Ga0105239_100399443 | 283 |
| 476 | 3300010375 | Ga0105239_10047131 | Ga0105239_100471314 | 283 |
| 477 | 3300010375 | Ga0105239_10077508 | Ga0105239_100775083 | 283 |
| 478 | 3300010375 | Ga0105239_10081016 | Ga0105239_100810164 | 283 |
| 479 | 3300010375 | Ga0105239_10119220 | Ga0105239_101192203 | 283 |
| 480 | 3300010375 | Ga0105239_10163948 | Ga0105239_101639481 | 283 |
| 481 | 3300010375 | Ga0105239_11007636 | Ga0105239_110076361 | 283 |
| 482 | 3300011119 | Ga0105246_10061502 | Ga0105246_100615023 | 283 |
| 483 | 3300013100 | Ga0157373_10019948 | Ga0157373_100199485 | 283 |
| 484 | 3300013104 | Ga0157370_10037505 | Ga0157370_100375053 | 283 |
| 485 | 3300013104 | Ga0157370_10156955 | Ga0157370_101569552 | 283 |
| 486 | 3300013104 | Ga0157370_10250270 | Ga0157370_102502702 | 283 |
| 487 | 3300013105 | Ga0157369_10018998 | Ga0157369_100189986 | 283 |
| 488 | 3300013105 | Ga0157369_10052606 | Ga0157369_100526063 | 283 |
| 489 | 3300013105 | Ga0157369_10065128 | Ga0157369_100651284 | 283 |
| 490 | 3300013105 | Ga0157369_10341886 | Ga0157369_103418862 | 283 |
| 491 | 3300013306 | Ga0163162_10501800 | Ga0163162_105018001 | 283 |
| 492 | 3300013307 | Ga0157372_10371637 | Ga0157372_103716372 | 283 |
| 493 | 3300013307 | Ga0157372_10495585 | Ga0157372_104955851 | 283 |
| 494 | 3300013308 | Ga0157375_10230780 | Ga0157375_102307803 | 283 |
| 495 | 3300013308 | Ga0157375_10293692 | Ga0157375_102936921 | 283 |
| 496 | 3300014325 | Ga0163163_10165115 | Ga0163163_101651151 | 283 |
| 497 | 3300014497 | Ga0182008_10166277 | Ga0182008_101662772 | 283 |
| 498 | 3300014968 | Ga0157379_10223611 | Ga0157379_102236112 | 283 |
| 499 | 3300014969 | Ga0157376_10182028 | Ga0157376_101820282 | 283 |
| 500 | 3300014969 | Ga0157376_10502907 | Ga0157376_105029072 | 283 |
| 501 | 3300021320 | Ga0214544_1000073 | Ga0214544_10000732 | 283 |
| 502 | 3300021320 | Ga0214544_1007210 | Ga0214544_100721011 | 283 |
| 503 | 3300021321 | Ga0214542_1000104 | Ga0214542_10001042 | 283 |
| 504 | 3300021321 | Ga0214542_1000196 | Ga0214542_100019674 | 283 |
| 505 | 3300021324 | Ga0214545_1000028 | Ga0214545_100002817 | 283 |
| 506 | 3300021324 | Ga0214545_1025379 | Ga0214545_10253792 | 283 |
| 507 | 3300021327 | Ga0214543_1000044 | Ga0214543_1000044147 | 283 |
| 508 | 3300021327 | Ga0214543_1000096 | Ga0214543_10000962 | 283 |
| 509 | 3300021377 | Ga0213874_10007742 | Ga0213874_100077422 | 283 |
| 510 | 3300025230 | Ga0209563_103577 | Ga0209563_1035771 | 283 |
| 511 | 3300025245 | Ga0207425_1026947 | Ga0207425_10269472 | 283 |
| 512 | 3300025253 | Ga0209677_101054 | Ga0209677_1010545 | 283 |
| 513 | 3300025253 | Ga0209677_102254 | Ga0209677_1022548 | 283 |
| 514 | 3300025254 | Ga0209148_1000680 | Ga0209148_100068012 | 283 |
| 515 | 3300025261 | Ga0209233_1003740 | Ga0209233_10037402 | 283 |
| 516 | 3300025261 | Ga0209233_1004006 | Ga0209233_10040065 | 283 |
| 517 | 3300025261 | Ga0209233_1006666 | Ga0209233_10066661 | 283 |
| 518 | 3300025261 | Ga0209233_1012488 | Ga0209233_10124882 | 283 |
| 519 | 3300025272 | Ga0209455_1002008 | Ga0209455_10020085 | 283 |
| 520 | 3300025272 | Ga0209455_1005197 | Ga0209455_10051973 | 283 |
| 521 | 3300025272 | Ga0209455_1011701 | Ga0209455_10117011 | 283 |
| 522 | 3300025273 | Ga0209673_1004025 | Ga0209673_10040253 | 283 |
| 523 | 3300025284 | Ga0209130_1010280 | Ga0209130_10102802 | 283 |
| 524 | 3300025292 | Ga0209676_1001462 | Ga0209676_100146214 | 283 |
| 525 | 3300025292 | Ga0209676_1003938 | Ga0209676_10039388 | 283 |
| 526 | 3300025292 | Ga0209676_1004689 | Ga0209676_10046892 | 283 |
| 527 | 3300025292 | Ga0209676_1010527 | Ga0209676_10105274 | 283 |
| 528 | 3300025292 | Ga0209676_1011182 | Ga0209676_10111824 | 283 |
| 529 | 3300025292 | Ga0209676_1011834 | Ga0209676_10118342 | 283 |
| 530 | 3300025292 | Ga0209676_1034383 | Ga0209676_10343831 | 283 |
| 531 | 3300025294 | Ga0209025_1003033 | Ga0209025_10030337 | 283 |
| 532 | 3300025294 | Ga0209025_1052993 | Ga0209025_10529931 | 283 |
| 533 | 3300025295 | Ga0209564_1005302 | Ga0209564_10053023 | 283 |
| 534 | 3300025297 | Ga0209758_1000075 | Ga0209758_1000075192 | 283 |
| 535 | 3300025297 | Ga0209758_1000187 | Ga0209758_100018763 | 283 |
| 536 | 3300025297 | Ga0209758_1000482 | Ga0209758_100048250 | 283 |
| 537 | 3300025297 | Ga0209758_1001650 | Ga0209758_100165013 | 283 |
| 538 | 3300025297 | Ga0209758_1015384 | Ga0209758_10153842 | 283 |
| 539 | 3300025297 | Ga0209758_1016071 | Ga0209758_10160714 | 283 |
| 540 | 3300025297 | Ga0209758_1020409 | Ga0209758_10204093 | 283 |
| 541 | 3300025297 | Ga0209758_1031792 | Ga0209758_10317922 | 283 |
| 542 | 3300025297 | Ga0209758_1036035 | Ga0209758_10360353 | 283 |
| 543 | 3300025298 | Ga0209050_1002752 | Ga0209050_100275210 | 283 |
| 544 | 3300025299 | Ga0209256_1007084 | Ga0209256_10070842 | 283 |
| 545 | 3300025299 | Ga0209256_1009510 | Ga0209256_10095102 | 283 |
| 546 | 3300025299 | Ga0209256_1011461 | Ga0209256_10114612 | 283 |
| 547 | 3300025302 | Ga0207426_1000160 | Ga0207426_1000160161 | 283 |
| 548 | 3300025302 | Ga0207426_1000527 | Ga0207426_100052739 | 283 |
| 549 | 3300025303 | Ga0209051_1003094 | Ga0209051_10030942 | 283 |
| 550 | 3300025303 | Ga0209051_1048360 | Ga0209051_10483601 | 283 |
| 551 | 3300025304 | Ga0209257_1000652 | Ga0209257_100065234 | 283 |
| 552 | 3300025304 | Ga0209257_1002013 | Ga0209257_100201311 | 283 |
| 553 | 3300025304 | Ga0209257_1002127 | Ga0209257_100212715 | 283 |
| 554 | 3300025304 | Ga0209257_1004808 | Ga0209257_100480810 | 283 |
| 555 | 3300025304 | Ga0209257_1027397 | Ga0209257_10273972 | 283 |
| 556 | 3300025321 | Ga0207656_10002942 | Ga0207656_100029426 | 283 |
| 557 | 3300025321 | Ga0207656_10023522 | Ga0207656_100235221 | 283 |
| 558 | 3300025885 | Ga0207653_10017591 | Ga0207653_100175912 | 283 |
| 559 | 3300025898 | Ga0207692_10024985 | Ga0207692_100249853 | 283 |
| 560 | 3300025900 | Ga0207710_10058711 | Ga0207710_100587112 | 283 |
| 561 | 3300025904 | Ga0207647_10000586 | Ga0207647_1000058622 | 283 |
| 562 | 3300025904 | Ga0207647_10001777 | Ga0207647_1000177713 | 283 |
| 563 | 3300025905 | Ga0207685_10060982 | Ga0207685_100609821 | 283 |
| 564 | 3300025906 | Ga0207699_10012170 | Ga0207699_100121703 | 283 |
| 565 | 3300025906 | Ga0207699_10024297 | Ga0207699_100242973 | 283 |
| 566 | 3300025908 | Ga0207643_10008582 | Ga0207643_100085824 | 283 |
| 567 | 3300025909 | Ga0207705_10192254 | Ga0207705_101922542 | 283 |
| 568 | 3300025910 | Ga0207684_10273034 | Ga0207684_102730341 | 283 |
| 569 | 3300025911 | Ga0207654_10000136 | Ga0207654_100001364 | 283 |
| 570 | 3300025911 | Ga0207654_10087335 | Ga0207654_100873352 | 283 |
| 571 | 3300025911 | Ga0207654_10120095 | Ga0207654_101200952 | 283 |
| 572 | 3300025912 | Ga0207707_10001642 | Ga0207707_100016424 | 283 |
| 573 | 3300025912 | Ga0207707_10007605 | Ga0207707_100076054 | 283 |
| 574 | 3300025912 | Ga0207707_10223821 | Ga0207707_102238212 | 283 |
| 575 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029365 | 283 |
| 576 | 3300025913 | Ga0207695_10002311 | Ga0207695_1000231116 | 283 |
| 577 | 3300025913 | Ga0207695_10011572 | Ga0207695_100115725 | 283 |
| 578 | 3300025913 | Ga0207695_10075771 | Ga0207695_100757714 | 283 |
| 579 | 3300025913 | Ga0207695_10133917 | Ga0207695_101339172 | 283 |
| 580 | 3300025913 | Ga0207695_10273781 | Ga0207695_102737812 | 283 |
| 581 | 3300025913 | Ga0207695_10470794 | Ga0207695_104707941 | 283 |
| 582 | 3300025914 | Ga0207671_10003843 | Ga0207671_100038436 | 283 |
| 583 | 3300025914 | Ga0207671_10007380 | Ga0207671_100073806 | 283 |
| 584 | 3300025915 | Ga0207693_10001764 | Ga0207693_1000176411 | 283 |
| 585 | 3300025915 | Ga0207693_10005866 | Ga0207693_100058665 | 283 |
| 586 | 3300025915 | Ga0207693_10128070 | Ga0207693_101280702 | 283 |
| 587 | 3300025916 | Ga0207663_10006336 | Ga0207663_100063361 | 283 |
| 588 | 3300025916 | Ga0207663_10035891 | Ga0207663_100358913 | 283 |
| 589 | 3300025916 | Ga0207663_10045043 | Ga0207663_100450431 | 283 |
| 590 | 3300025917 | Ga0207660_10025057 | Ga0207660_100250574 | 283 |
| 591 | 3300025917 | Ga0207660_10048220 | Ga0207660_100482203 | 283 |
| 592 | 3300025917 | Ga0207660_10084741 | Ga0207660_100847412 | 283 |
| 593 | 3300025919 | Ga0207657_10006868 | Ga0207657_1000686811 | 283 |
| 594 | 3300025919 | Ga0207657_10022746 | Ga0207657_100227464 | 283 |
| 595 | 3300025919 | Ga0207657_10195815 | Ga0207657_101958152 | 283 |
| 596 | 3300025921 | Ga0207652_10006786 | Ga0207652_100067868 | 283 |
| 597 | 3300025921 | Ga0207652_10012536 | Ga0207652_100125363 | 283 |
| 598 | 3300025921 | Ga0207652_10295227 | Ga0207652_102952272 | 283 |
| 599 | 3300025924 | Ga0207694_10000135 | Ga0207694_1000013523 | 283 |
| 600 | 3300025924 | Ga0207694_10014853 | Ga0207694_100148534 | 283 |
| 601 | 3300025924 | Ga0207694_10027086 | Ga0207694_100270863 | 283 |
| 602 | 3300025924 | Ga0207694_10114340 | Ga0207694_101143402 | 283 |
| 603 | 3300025924 | Ga0207694_10161114 | Ga0207694_101611143 | 283 |
| 604 | 3300025928 | Ga0207700_10017875 | Ga0207700_100178753 | 283 |
| 605 | 3300025928 | Ga0207700_10228653 | Ga0207700_102286532 | 283 |
| 606 | 3300025929 | Ga0207664_10415534 | Ga0207664_104155342 | 283 |
| 607 | 3300025935 | Ga0207709_10356375 | Ga0207709_103563751 | 283 |
| 608 | 3300025939 | Ga0207665_10004976 | Ga0207665_100049764 | 283 |
| 609 | 3300025939 | Ga0207665_10009679 | Ga0207665_100096793 | 283 |
| 610 | 3300025941 | Ga0207711_10080269 | Ga0207711_100802692 | 283 |
| 611 | 3300025941 | Ga0207711_10268516 | Ga0207711_102685162 | 283 |
| 612 | 3300025942 | Ga0207689_10083658 | Ga0207689_100836583 | 283 |
| 613 | 3300025944 | Ga0207661_10007779 | Ga0207661_100077798 | 283 |
| 614 | 3300025944 | Ga0207661_10029064 | Ga0207661_100290643 | 283 |
| 615 | 3300025944 | Ga0207661_10099615 | Ga0207661_100996152 | 283 |
| 616 | 3300025949 | Ga0207667_10018495 | Ga0207667_100184954 | 283 |
| 617 | 3300025949 | Ga0207667_10019153 | Ga0207667_100191537 | 283 |
| 618 | 3300025949 | Ga0207667_10086526 | Ga0207667_100865264 | 283 |
| 619 | 3300025960 | Ga0207651_10209562 | Ga0207651_102095621 | 283 |
| 620 | 3300025972 | Ga0207668_10078657 | Ga0207668_100786573 | 283 |
| 621 | 3300025981 | Ga0207640_10003325 | Ga0207640_100033256 | 283 |
| 622 | 3300025981 | Ga0207640_10007395 | Ga0207640_100073954 | 283 |
| 623 | 3300025981 | Ga0207640_10334687 | Ga0207640_103346871 | 283 |
| 624 | 3300026041 | Ga0207639_10011442 | Ga0207639_100114427 | 283 |
| 625 | 3300026041 | Ga0207639_10023493 | Ga0207639_100234934 | 283 |
| 626 | 3300026041 | Ga0207639_10025712 | Ga0207639_100257123 | 283 |
| 627 | 3300026041 | Ga0207639_10107556 | Ga0207639_101075562 | 283 |
| 628 | 3300026041 | Ga0207639_10156665 | Ga0207639_101566652 | 283 |
| 629 | 3300026041 | Ga0207639_10178821 | Ga0207639_101788212 | 283 |
| 630 | 3300026067 | Ga0207678_10031917 | Ga0207678_100319173 | 283 |
| 631 | 3300026067 | Ga0207678_10164964 | Ga0207678_101649642 | 283 |
| 632 | 3300026067 | Ga0207678_10178056 | Ga0207678_101780562 | 283 |
| 633 | 3300026067 | Ga0207678_10220533 | Ga0207678_102205332 | 283 |
| 634 | 3300026067 | Ga0207678_10259994 | Ga0207678_102599942 | 283 |
| 635 | 3300026075 | Ga0207708_10196166 | Ga0207708_101961661 | 283 |
| 636 | 3300026078 | Ga0207702_10000026 | Ga0207702_10000026127 | 283 |
| 637 | 3300026078 | Ga0207702_10000334 | Ga0207702_1000033438 | 283 |
| 638 | 3300026078 | Ga0207702_10013080 | Ga0207702_100130805 | 283 |
| 639 | 3300026078 | Ga0207702_10161086 | Ga0207702_101610862 | 283 |
| 640 | 3300026088 | Ga0207641_10040878 | Ga0207641_100408784 | 283 |
| 641 | 3300026095 | Ga0207676_10123226 | Ga0207676_101232262 | 283 |
| 642 | 3300026095 | Ga0207676_10128917 | Ga0207676_101289173 | 283 |
| 643 | 3300026116 | Ga0207674_10007361 | Ga0207674_100073618 | 283 |
| 644 | 3300026116 | Ga0207674_10013128 | Ga0207674_100131287 | 283 |
| 645 | 3300026116 | Ga0207674_10016608 | Ga0207674_100166085 | 283 |
| 646 | 3300026116 | Ga0207674_10137426 | Ga0207674_101374263 | 283 |
| 647 | 3300026118 | Ga0207675_100038699 | Ga0207675_1000386994 | 283 |
| 648 | 3300026121 | Ga0207683_10106473 | Ga0207683_101064734 | 283 |
| 649 | 3300026121 | Ga0207683_10340240 | Ga0207683_103402401 | 283 |
| 650 | 3300026121 | Ga0207683_10397199 | Ga0207683_103971991 | 283 |
| 651 | 3300026142 | Ga0207698_10019685 | Ga0207698_100196854 | 283 |
| 652 | 3300026142 | Ga0207698_10053737 | Ga0207698_100537372 | 283 |
| 653 | 3300026142 | Ga0207698_10140431 | Ga0207698_101404312 | 283 |
| 654 | 3300027296 | Ga0209389_1000003 | Ga0209389_100000393 | 283 |
| 655 | 3300027296 | Ga0209389_1000365 | Ga0209389_100036514 | 283 |
| 656 | 3300027357 | Ga0209589_1003813 | Ga0209589_100381314 | 283 |
| 657 | 3300027361 | Ga0209489_100022 | Ga0209489_10002269 | 283 |
| 658 | 3300027361 | Ga0209489_100498 | Ga0209489_10049810 | 283 |
| 659 | 3300027363 | Ga0209700_100023 | Ga0209700_10002392 | 283 |
| 660 | 3300027512 | Ga0209179_1005710 | Ga0209179_10057102 | 283 |
| 661 | 3300027866 | Ga0209813_10008418 | Ga0209813_100084183 | 283 |
| 662 | 3300028379 | Ga0268266_10116479 | Ga0268266_101164792 | 283 |
| 663 | 3300028379 | Ga0268266_10134134 | Ga0268266_101341342 | 283 |
| 664 | 3300028379 | Ga0268266_10269747 | Ga0268266_102697471 | 283 |
| 665 | 3300028379 | Ga0268266_10272143 | Ga0268266_102721432 | 283 |
| 666 | 3300028380 | Ga0268265_10253428 | Ga0268265_102534282 | 283 |
| 667 | 3300028381 | Ga0268264_10000020 | Ga0268264_1000002012 | 283 |
| 668 | 3300028653 | Ga0265323_10001786 | Ga0265323_100017866 | 283 |
| 669 | 3300028666 | Ga0265336_10001310 | Ga0265336_100013102 | 283 |
| 670 | 3300028786 | Ga0307517_10027736 | Ga0307517_100277365 | 283 |
| 671 | 3300028794 | Ga0307515_10035428 | Ga0307515_100354282 | 283 |
| 672 | 3300028800 | Ga0265338_10000013 | Ga0265338_1000001318 | 283 |
| 673 | 3300030521 | Ga0307511_10033076 | Ga0307511_100330762 | 283 |
| 674 | 3300031247 | Ga0265340_10012398 | Ga0265340_100123985 | 283 |
| 675 | 3300031249 | Ga0265339_10008262 | Ga0265339_100082625 | 283 |
| 676 | 3300031249 | Ga0265339_10050216 | Ga0265339_100502163 | 283 |
| 677 | 3300031250 | Ga0265331_10039190 | Ga0265331_100391903 | 283 |
| 678 | 3300031250 | Ga0265331_10113786 | Ga0265331_101137862 | 283 |
| 679 | 3300031456 | Ga0307513_10277813 | Ga0307513_102778132 | 283 |
| 680 | 3300031548 | Ga0307408_100020620 | Ga0307408_1000206202 | 283 |
| 681 | 3300031616 | Ga0307508_10000419 | Ga0307508_1000041910 | 283 |
| 682 | 3300031616 | Ga0307508_10043572 | Ga0307508_100435723 | 283 |
| 683 | 3300031616 | Ga0307508_10135882 | Ga0307508_101358822 | 283 |
| 684 | 3300031711 | Ga0265314_10003890 | Ga0265314_100038904 | 283 |
| 685 | 3300031711 | Ga0265314_10028507 | Ga0265314_100285073 | 283 |
| 686 | 3300031711 | Ga0265314_10170254 | Ga0265314_101702542 | 283 |
| 687 | 3300031712 | Ga0265342_10013315 | Ga0265342_100133153 | 283 |
| 688 | 3300031712 | Ga0265342_10116622 | Ga0265342_101166221 | 283 |
| 689 | 3300031730 | Ga0307516_10062970 | Ga0307516_100629704 | 283 |
| 690 | 3300031730 | Ga0307516_10129607 | Ga0307516_101296072 | 283 |
| 691 | 3300031901 | Ga0307406_10464960 | Ga0307406_104649601 | 283 |
| 692 | 3300032002 | Ga0307416_100345553 | Ga0307416_1003455532 | 283 |
| 693 | 3300033180 | Ga0307510_10015138 | Ga0307510_100151383 | 283 |
| 694 | 3300033180 | Ga0307510_10031597 | Ga0307510_100315974 | 283 |
| 695 | 3300033180 | Ga0307510_10249336 | Ga0307510_102493361 | 283 |
| 696 | 3300033442 | Ga0315911_1000014 | Ga0315911_100001455 | 283 |
| 697 | 3300035083 | Ga0373926_0038401 | Ga0373926_0038401_124_987 | 283 |
| 698 | 3300035086 | Ga0373934_0099482 | Ga0373934_0099482_28_891 | 283 |
| 699 | 3300035111 | Ga0373923_0004573 | Ga0373923_0004573_3228_4091 | 283 |
| 700 | 3300035117 | Ga0373953_0007862 | Ga0373953_0007862_2294_3157 | 283 |
| 701 | 3300035117 | Ga0373953_0008978 | Ga0373953_0008978_2197_3060 | 283 |
| 702 | 3300035118 | Ga0373954_0044140 | Ga0373954_0044140_899_1762 | 283 |
| 703 | 3300035119 | Ga0373956_0043097 | Ga0373956_0043097_731_1594 | 283 |
| 704 | 3300035120 | Ga0373957_0031719 | Ga0373957_0031719_484_1347 | 283 |
| 705 | 3300035170 | Ga0373943_0102771 | Ga0373943_0102771_576_1439 | 283 |
| 706 | 3300035172 | Ga0373955_0047370 | Ga0373955_0047370_1167_2030 | 283 |
| 707 | 3300035172 | Ga0373955_0225370 | Ga0373955_0225370_161_1024 | 283 |
| 708 | 3300035410 | Ga0373924_0025186 | Ga0373924_0025186_1120_1983 | 283 |
| 709 | 3300035691 | Ga0373931_0005209 | Ga0373931_0005209_3726_4589 | 283 |
| 710 | 3300035692 | Ga0373935_0001026 | Ga0373935_0001026_11036_11899 | 283 |
| 711 | 3300035692 | Ga0373935_0067145 | Ga0373935_0067145_951_1814 | 283 |
| 712 | 3300035692 | Ga0373935_0140324 | Ga0373935_0140324_254_1117 | 283 |
| 713 | 3300035695 | Ga0373927_0021479 | Ga0373927_0021479_3225_4088 | 283 |
| 714 | 3300035695 | Ga0373927_0055143 | Ga0373927_0055143_601_1464 | 283 |
| 715 | 3300035695 | Ga0373927_0074287 | Ga0373927_0074287_692_1555 | 283 |
| 716 | 3300035695 | Ga0373927_0103441 | Ga0373927_0103441_933_1796 | 283 |
| 717 | 3300035724 | Ga0373933_0000631 | Ga0373933_0000631_10213_11076 | 283 |
| 718 | 3300035724 | Ga0373933_0027843 | Ga0373933_0027843_2022_2885 | 283 |
| 719 | 3300035724 | Ga0373933_0255814 | Ga0373933_0255814_134_997 | 283 |
| 720 | 3300035725 | Ga0373947_0129732 | Ga0373947_0129732_360_1223 | 283 |
| 721 | 3300035725 | Ga0373947_0291588 | Ga0373947_0291588_134_997 | 283 |
| 722 | 3300036401 | Ga0373937_0626563 | Ga0373937_0626563_41_904 | 283 |
| 723 | 3300036459 | Ga0372808_011507 | Ga0372808_011507_263_1126 | 283 |
| 724 | 3300037068 | Ga0373925_0032857 | Ga0373925_0032857_2034_2897 | 283 |
| 725 | 3300037068 | Ga0373925_0037551 | Ga0373925_0037551_548_1411 | 283 |
| 726 | 3300037068 | Ga0373925_0067129 | Ga0373925_0067129_73_936 | 283 |
| 727 | 3300037068 | Ga0373925_0158442 | Ga0373925_0158442_540_1403 | 283 |
| 728 | 3300037418 | Ga0395900_0014369 | Ga0395900_0014369_292_1155 | 283 |
| 729 | 3300037418 | Ga0395900_0364388 | Ga0395900_0364388_294_1157 | 283 |
| 730 | 3300037466 | Ga0395898_0010290 | Ga0395898_0010290_3583_4446 | 283 |
| 731 | 3300037466 | Ga0395898_0472182 | Ga0395898_0472182_259_1122 | 283 |
| 732 | 3300037466 | Ga0395898_0669162 | Ga0395898_0669162_90_953 | 283 |
| 733 | 3300037471 | Ga0395905_0163570 | Ga0395905_0163570_45_908 | 283 |
| 734 | 3300037471 | Ga0395905_0328988 | Ga0395905_0328988_196_1059 | 283 |
| 735 | 3300038443 | Ga0395901_0019804 | Ga0395901_0019804_5059_5922 | 283 |
| 736 | 3300038443 | Ga0395901_0243240 | Ga0395901_0243240_178_1041 | 283 |
| 737 | 3300038443 | Ga0395901_0344679 | Ga0395901_0344679_542_1405 | 283 |
| 738 | 3300038443 | Ga0395901_0447416 | Ga0395901_0447416_243_1106 | 283 |
| 739 | 3300039437 | Ga0436365_0385088 | Ga0436365_0385088_212_1075 | 283 |
| 740 | 3300039437 | Ga0436365_1204968 | Ga0436365_1204968_1233_2096 | 283 |
| 741 | 3300039437 | Ga0436365_1207416 | Ga0436365_1207416_345_1208 | 283 |
| 742 | 3300039438 | Ga0436360_0030607 | Ga0436360_0030607_200_1063 | 283 |
| 743 | 3300039447 | Ga0436361_1156995 | Ga0436361_1156995_1511_2374 | 283 |
| 744 | 3300039450 | Ga0436363_1032871 | Ga0436363_1032871_274_1137 | 283 |
| 745 | 3300039450 | Ga0436363_1645002 | Ga0436363_1645002_1690_2613 | 283 |
| 746 | 3300041413 | Ga0439465_0021447 | Ga0439465_0021447_694_1545 | 283 |
| 747 | 3300041458 | Ga0451798_1041797 | Ga0451798_1041797_139_1002 | 283 |
| 748 | 3300042010 | Ga0439452_009623 | Ga0439452_009623_1242_2093 | 283 |
| 749 | 3300044658 | Ga0466972_0001189 | Ga0466972_0001189_1205_2068 | 283 |
| 750 | 3300044658 | Ga0466972_0199477 | Ga0466972_0199477_45_908 | 283 |
| 751 | 3300044683 | Ga0466965_0135663 | Ga0466965_0135663_221_1084 | 283 |
| 752 | 3300044684 | Ga0466966_0001683 | Ga0466966_0001683_12667_13530 | 283 |
| 753 | 3300044684 | Ga0466966_0049627 | Ga0466966_0049627_1317_2180 | 283 |
| 754 | 3300044684 | Ga0466966_0131705 | Ga0466966_0131705_636_1499 | 283 |
| 755 | 3300044693 | Ga0466961_0000084 | Ga0466961_0000084_37910_38773 | 283 |
| 756 | 3300044694 | Ga0466963_0134187 | Ga0466963_0134187_55_918 | 283 |
| 757 | 3300044694 | Ga0466963_0182671 | Ga0466963_0182671_51_983 | 283 |
| 758 | 3300044694 | Ga0466963_0295189 | Ga0466963_0295189_42_905 | 283 |
| 759 | 3300044735 | Ga0466968_0053255 | Ga0466968_0053255_415_1278 | 283 |
| 760 | 3300044842 | Ga0466957_0392658 | Ga0466957_0392658_51_914 | 283 |
| 761 | 3300044901 | Ga0466960_0013508 | Ga0466960_0013508_689_1552 | 283 |
| 762 | 3300044901 | Ga0466960_0125366 | Ga0466960_0125366_404_1267 | 283 |
| 763 | 3300045049 | Ga0466959_0002035 | Ga0466959_0002035_2200_3063 | 283 |
| 764 | 3300045049 | Ga0466959_0079518 | Ga0466959_0079518_484_1347 | 283 |
| 765 | 3300046454 | Ga0495592_0070595 | Ga0495592_0070595_425_1288 | 283 |
| 766 | 3300046454 | Ga0495592_0095183 | Ga0495592_0095183_282_1145 | 283 |
| 767 | 3300046455 | Ga0495603_0006560 | Ga0495603_0006560_237_1100 | 283 |
| 768 | 3300046455 | Ga0495603_0019060 | Ga0495603_0019060_796_1659 | 283 |
| 769 | 3300046455 | Ga0495603_0043319 | Ga0495603_0043319_250_1113 | 283 |
| 770 | 3300046459 | Ga0495629_0008449 | Ga0495629_0008449_3408_4271 | 283 |
| 771 | 3300046459 | Ga0495629_0050927 | Ga0495629_0050927_1358_2221 | 283 |
| 772 | 3300046459 | Ga0495629_0192999 | Ga0495629_0192999_62_925 | 283 |
| 773 | 3300046460 | Ga0495638_0008098 | Ga0495638_0008098_3050_3913 | 283 |
| 774 | 3300046461 | Ga0495641_0013759 | Ga0495641_0013759_2737_3600 | 283 |
| 775 | 3300046462 | Ga0495651_0303722 | Ga0495651_0303722_194_1057 | 283 |
| 776 | 3300046472 | Ga0495580_0009943 | Ga0495580_0009943_3287_4150 | 283 |
| 777 | 3300046473 | Ga0495582_0004249 | Ga0495582_0004249_4987_5850 | 283 |
| 778 | 3300046475 | Ga0495639_0001631 | Ga0495639_0001631_2728_3591 | 283 |
| 779 | 3300046475 | Ga0495639_0063123 | Ga0495639_0063123_752_1615 | 283 |
| 780 | 3300046476 | Ga0495662_0008011 | Ga0495662_0008011_1052_1915 | 283 |
| 781 | 3300046477 | Ga0495664_0040432 | Ga0495664_0040432_1814_2677 | 283 |
| 782 | 3300046477 | Ga0495664_0062486 | Ga0495664_0062486_1172_2035 | 283 |
| 783 | 3300046499 | Ga0495594_0001269 | Ga0495594_0001269_3957_4820 | 283 |
| 784 | 3300046499 | Ga0495594_0107978 | Ga0495594_0107978_482_1345 | 283 |
| 785 | 3300046507 | Ga0495606_0199117 | Ga0495606_0199117_270_1133 | 283 |
| 786 | 3300046511 | Ga0495608_0353570 | Ga0495608_0353570_19_882 | 283 |
| 787 | 3300046512 | Ga0495610_0054907 | Ga0495610_0054907_463_1326 | 283 |
| 788 | 3300046514 | Ga0495618_0014515 | Ga0495618_0014515_3785_4648 | 283 |
| 789 | 3300046514 | Ga0495618_0080762 | Ga0495618_0080762_1128_1991 | 283 |
| 790 | 3300046515 | Ga0495620_0091015 | Ga0495620_0091015_297_1160 | 283 |
| 791 | 3300046516 | Ga0495628_0163021 | Ga0495628_0163021_176_1039 | 283 |
| 792 | 3300046516 | Ga0495628_0225330 | Ga0495628_0225330_456_1319 | 283 |
| 793 | 3300046517 | Ga0495630_0055028 | Ga0495630_0055028_90_953 | 283 |
| 794 | 3300046517 | Ga0495630_0056773 | Ga0495630_0056773_1733_2596 | 283 |
| 795 | 3300046519 | Ga0495632_0082351 | Ga0495632_0082351_164_1027 | 283 |
| 796 | 3300046519 | Ga0495632_0110116 | Ga0495632_0110116_417_1280 | 283 |
| 797 | 3300046520 | Ga0495637_0092392 | Ga0495637_0092392_95_958 | 283 |
| 798 | 3300046522 | Ga0495643_0091940 | Ga0495643_0091940_404_1267 | 283 |
| 799 | 3300046524 | Ga0495648_0008195 | Ga0495648_0008195_148_1011 | 283 |
| 800 | 3300046524 | Ga0495648_0029614 | Ga0495648_0029614_208_1071 | 283 |
| 801 | 3300046524 | Ga0495648_0049853 | Ga0495648_0049853_1560_2423 | 283 |
| 802 | 3300046524 | Ga0495648_0100072 | Ga0495648_0100072_75_938 | 283 |
| 803 | 3300046525 | Ga0495663_0053697 | Ga0495663_0053697_129_992 | 283 |
| 804 | 3300046529 | Ga0495652_0033765 | Ga0495652_0033765_382_1245 | 283 |
| 805 | 3300046529 | Ga0495652_0068069 | Ga0495652_0068069_79_942 | 283 |
| 806 | 3300046529 | Ga0495652_0076737 | Ga0495652_0076737_292_1155 | 283 |
| 807 | 3300046530 | Ga0495654_0135061 | Ga0495654_0135061_57_920 | 283 |
| 808 | 3300046531 | Ga0495665_0001884 | Ga0495665_0001884_1000_1863 | 283 |
| 809 | 3300046531 | Ga0495665_0041435 | Ga0495665_0041435_954_1817 | 283 |
| 810 | 3300046533 | Ga0495640_0049976 | Ga0495640_0049976_187_1050 | 283 |
| 811 | 3300046533 | Ga0495640_0115599 | Ga0495640_0115599_424_1287 | 283 |
| 812 | 3300046536 | Ga0495587_0010826 | Ga0495587_0010826_488_1351 | 283 |
| 813 | 3300046536 | Ga0495587_0156786 | Ga0495587_0156786_240_1103 | 283 |
| 814 | 3300046537 | Ga0495598_0036538 | Ga0495598_0036538_229_1092 | 283 |
| 815 | 3300046538 | Ga0495609_0111457 | Ga0495609_0111457_52_915 | 283 |
| 816 | 3300046542 | Ga0495597_0078505 | Ga0495597_0078505_475_1338 | 283 |
| 817 | 3300046543 | Ga0495645_0030368 | Ga0495645_0030368_2135_2998 | 283 |
| 818 | 3300046543 | Ga0495645_0038734 | Ga0495645_0038734_2604_3467 | 283 |
| 819 | 3300046557 | Ga0495622_0044786 | Ga0495622_0044786_83_946 | 283 |
| 820 | 3300046557 | Ga0495622_0139720 | Ga0495622_0139720_127_990 | 283 |
| 821 | 3300046559 | Ga0495667_0017299 | Ga0495667_0017299_1934_2797 | 283 |
| 822 | 3300046559 | Ga0495667_0197906 | Ga0495667_0197906_234_1097 | 283 |
| 823 | 3300046616 | Ga0495668_0069829 | Ga0495668_0069829_629_1492 | 283 |
| 824 | 3300046642 | Ga0495634_0010587 | Ga0495634_0010587_3366_4229 | 283 |
| 825 | 3300046648 | Ga0495611_0005006 | Ga0495611_0005006_4481_5344 | 283 |
| 826 | 3300046663 | Ga0495635_0015901 | Ga0495635_0015901_2069_2932 | 283 |
| 827 | 3300046663 | Ga0495635_0036927 | Ga0495635_0036927_423_1286 | 283 |
| 828 | 3300046663 | Ga0495635_0063109 | Ga0495635_0063109_23_886 | 283 |
| 829 | 3300046663 | Ga0495635_0082411 | Ga0495635_0082411_966_1829 | 283 |
| 830 | 3300046674 | Ga0495588_0004512 | Ga0495588_0004512_2494_3357 | 283 |
| 831 | 3300046675 | Ga0495657_0070096 | Ga0495657_0070096_416_1279 | 283 |
| 832 | 3300046675 | Ga0495657_0074074 | Ga0495657_0074074_760_1623 | 283 |
| 833 | 3300046678 | Ga0495599_0129243 | Ga0495599_0129243_435_1298 | 283 |
| 834 | 3300046680 | Ga0495646_0198350 | Ga0495646_0198350_90_953 | 283 |
| 835 | 3300046681 | Ga0495647_0025999 | Ga0495647_0025999_67_930 | 283 |
| 836 | 3300046683 | Ga0495658_0011741 | Ga0495658_0011741_681_1544 | 283 |
| 837 | 3300046683 | Ga0495658_0186725 | Ga0495658_0186725_210_1073 | 283 |
| 838 | 3300046689 | Ga0495613_0009118 | Ga0495613_0009118_4433_5296 | 283 |
| 839 | 3300046689 | Ga0495613_0287713 | Ga0495613_0287713_224_1087 | 283 |
| 840 | 3300046690 | Ga0495624_0008474 | Ga0495624_0008474_2206_3069 | 283 |
| 841 | 3300046690 | Ga0495624_0215827 | Ga0495624_0215827_140_1003 | 283 |
| 842 | 3300046794 | Ga0495589_0158552 | Ga0495589_0158552_107_970 | 283 |
| 843 | 3300046809 | Ga0495600_0016852 | Ga0495600_0016852_3391_4254 | 283 |
| 844 | 3300046809 | Ga0495600_0230689 | Ga0495600_0230689_255_1118 | 283 |
| 845 | 3300047315 | Ga0495581_0012281 | Ga0495581_0012281_1897_2760 | 283 |
| 846 | 3300047315 | Ga0495581_0095930 | Ga0495581_0095930_763_1626 | 283 |
| 847 | 3300047315 | Ga0495581_0250424 | Ga0495581_0250424_111_974 | 283 |
| 848 | 3300047317 | Ga0495604_0031622 | Ga0495604_0031622_162_1025 | 283 |
| 849 | 3300047319 | Ga0495674_0003482 | Ga0495674_0003482_1300_2163 | 283 |
| 850 | 3300047319 | Ga0495674_0135975 | Ga0495674_0135975_1158_2021 | 283 |
| 851 | 3300047320 | Ga0495672_0002709 | Ga0495672_0002709_12534_13421 | 283 |
| 852 | 3300047320 | Ga0495672_0017857 | Ga0495672_0017857_1208_2071 | 283 |
| 853 | 3300047320 | Ga0495672_0092772 | Ga0495672_0092772_761_1624 | 283 |
| 854 | 3300047321 | Ga0495676_0074454 | Ga0495676_0074454_591_1454 | 283 |
| 855 | 3300047321 | Ga0495676_0114136 | Ga0495676_0114136_546_1409 | 283 |
| 856 | 3300047322 | Ga0495680_0025271 | Ga0495680_0025271_1807_2670 | 283 |
| 857 | 3300047322 | Ga0495680_0077191 | Ga0495680_0077191_966_1829 | 283 |
| 858 | 3300047322 | Ga0495680_0114293 | Ga0495680_0114293_141_1004 | 283 |
| 859 | 3300047443 | Ga0495687_012621 | Ga0495687_012621_953_1816 | 283 |
| 860 | 3300047444 | Ga0495675_0209844 | Ga0495675_0209844_47_910 | 283 |
| 861 | 3300047469 | Ga0495673_0088746 | Ga0495673_0088746_381_1244 | 283 |
| 862 | 3300047471 | Ga0495684_0011768 | Ga0495684_0011768_412_1275 | 283 |
| 863 | 3300047471 | Ga0495684_0035799 | Ga0495684_0035799_1358_2221 | 283 |
| 864 | 3300047471 | Ga0495684_0073531 | Ga0495684_0073531_391_1254 | 283 |
| 865 | 3300047472 | Ga0495686_0031272 | Ga0495686_0031272_531_1394 | 283 |
| 866 | 3300047673 | Ga0495593_0004676 | Ga0495593_0004676_2409_3272 | 283 |
| 867 | 3300047673 | Ga0495593_0144056 | Ga0495593_0144056_62_925 | 283 |
| 868 | 3300048088 | Ga0495602_0109798 | Ga0495602_0109798_261_1124 | 283 |
| 869 | 3300048088 | Ga0495602_0153540 | Ga0495602_0153540_358_1221 | 283 |
| 870 | 3300048088 | Ga0495602_0157399 | Ga0495602_0157399_481_1344 | 283 |
| 871 | 3300048090 | Ga0495615_0079342 | Ga0495615_0079342_21_884 | 283 |
| 872 | 3300048904 | Ga0496101_0203576 | Ga0496101_0203576_221_1084 | 283 |
| 873 | 3300048905 | Ga0496102_0082886 | Ga0496102_0082886_1000_1863 | 283 |
| 874 | 3300048905 | Ga0496102_0204050 | Ga0496102_0204050_975_1838 | 283 |
| 875 | 3300048905 | Ga0496102_0413430 | Ga0496102_0413430_264_1127 | 283 |
| 876 | 3300048906 | Ga0496103_0032897 | Ga0496103_0032897_1706_2569 | 283 |
| 877 | 3300048907 | Ga0496104_0080773 | Ga0496104_0080773_1580_2443 | 283 |
| 878 | 3300048907 | Ga0496104_0099795 | Ga0496104_0099795_1763_2626 | 283 |
| 879 | 3300048907 | Ga0496104_0319851 | Ga0496104_0319851_398_1261 | 283 |
| 880 | 3300048908 | Ga0496105_0077006 | Ga0496105_0077006_336_1199 | 283 |
| 881 | 3300048908 | Ga0496105_0167789 | Ga0496105_0167789_427_1290 | 283 |
| 882 | 3300048909 | Ga0496106_0000790 | Ga0496106_0000790_14207_15070 | 283 |
| 883 | 3300048910 | Ga0496107_0315886 | Ga0496107_0315886_237_1100 | 283 |
| 884 | 3300048911 | Ga0496108_0214432 | Ga0496108_0214432_777_1640 | 283 |
| 885 | 3300048911 | Ga0496108_0235532 | Ga0496108_0235532_160_1023 | 283 |
| 886 | 3300048911 | Ga0496108_0274322 | Ga0496108_0274322_497_1360 | 283 |
| 887 | 3300048912 | Ga0496109_0015593 | Ga0496109_0015593_854_1717 | 283 |
| 888 | 3300048912 | Ga0496109_0151473 | Ga0496109_0151473_55_918 | 283 |
| 889 | 3300048912 | Ga0496109_0246168 | Ga0496109_0246168_370_1233 | 283 |
| 890 | 3300048912 | Ga0496109_0618547 | Ga0496109_0618547_82_945 | 283 |
| 891 | 3300048913 | Ga0496110_0169397 | Ga0496110_0169397_663_1526 | 283 |
| 892 | 3300048914 | Ga0496111_0051321 | Ga0496111_0051321_1622_2485 | 283 |
| 893 | 3300048914 | Ga0496111_0053939 | Ga0496111_0053939_534_1397 | 283 |
| 894 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_232968_233831 | 283 |
| 895 | 3300048915 | Ga0496112_0015024 | Ga0496112_0015024_6028_6891 | 283 |
| 896 | 3300048915 | Ga0496112_0039667 | Ga0496112_0039667_1922_2785 | 283 |
| 897 | 3300048915 | Ga0496112_0254388 | Ga0496112_0254388_519_1382 | 283 |
| 898 | 3300048916 | Ga0496113_0018344 | Ga0496113_0018344_2958_3821 | 283 |
| 899 | 3300048917 | Ga0496114_0059427 | Ga0496114_0059427_1155_2018 | 283 |
| 900 | 3300048917 | Ga0496114_0405843 | Ga0496114_0405843_185_1048 | 283 |
| 901 | 3300048917 | Ga0496114_0408694 | Ga0496114_0408694_152_1015 | 283 |
| 902 | 3300048918 | Ga0496115_0163009 | Ga0496115_0163009_928_1791 | 283 |
| 903 | 3300048918 | Ga0496115_0254346 | Ga0496115_0254346_358_1221 | 283 |
| 904 | 3300048918 | Ga0496115_0274765 | Ga0496115_0274765_274_1137 | 283 |
| 905 | 3300048918 | Ga0496115_0339463 | Ga0496115_0339463_140_1003 | 283 |
| 906 | 3300048920 | Ga0496117_0080969 | Ga0496117_0080969_52_915 | 283 |
| 907 | 3300048920 | Ga0496117_0162717 | Ga0496117_0162717_102_965 | 283 |
| 908 | 3300048921 | Ga0496118_0011291 | Ga0496118_0011291_1538_2401 | 283 |
| 909 | 3300048921 | Ga0496118_0021505 | Ga0496118_0021505_3004_3867 | 283 |
| 910 | 3300048921 | Ga0496118_0023093 | Ga0496118_0023093_4165_5028 | 283 |
| 911 | 3300048922 | Ga0496119_0095487 | Ga0496119_0095487_170_1033 | 283 |
| 912 | 3300048922 | Ga0496119_0120355 | Ga0496119_0120355_37_900 | 283 |
| 913 | 3300048924 | Ga0496121_0000774 | Ga0496121_0000774_44944_45807 | 283 |
| 914 | 3300048924 | Ga0496121_0001681 | Ga0496121_0001681_6091_6954 | 283 |
| 915 | 3300048924 | Ga0496121_0003198 | Ga0496121_0003198_7885_8748 | 283 |
| 916 | 3300048924 | Ga0496121_0020289 | Ga0496121_0020289_699_1562 | 283 |
| 917 | 3300048924 | Ga0496121_0049511 | Ga0496121_0049511_53_916 | 283 |
| 918 | 3300048924 | Ga0496121_0061247 | Ga0496121_0061247_2211_3074 | 283 |
| 919 | 3300048924 | Ga0496121_0075015 | Ga0496121_0075015_352_1215 | 283 |
| 920 | 3300048924 | Ga0496121_0076458 | Ga0496121_0076458_987_1850 | 283 |
| 921 | 3300048924 | Ga0496121_0085056 | Ga0496121_0085056_1474_2337 | 283 |
| 922 | 3300048924 | Ga0496121_0161089 | Ga0496121_0161089_289_1152 | 283 |
| 923 | 3300048924 | Ga0496121_0231594 | Ga0496121_0231594_53_916 | 283 |
| 924 | 3300048924 | Ga0496121_0292714 | Ga0496121_0292714_27_890 | 283 |
| 925 | 3300048925 | Ga0496122_0020976 | Ga0496122_0020976_4622_5485 | 283 |
| 926 | 3300048926 | Ga0496123_0015113 | Ga0496123_0015113_1373_2236 | 283 |
| 927 | 3300048927 | Ga0496124_0002423 | Ga0496124_0002423_7796_8659 | 283 |
| 928 | 3300048927 | Ga0496124_0292724 | Ga0496124_0292724_28_891 | 283 |
| 929 | 3300048928 | Ga0496125_0012360 | Ga0496125_0012360_4552_5415 | 283 |
| 930 | 3300048928 | Ga0496125_0014815 | Ga0496125_0014815_3397_4260 | 283 |
| 931 | 3300048928 | Ga0496125_0015380 | Ga0496125_0015380_3084_3947 | 283 |
| 932 | 3300048929 | Ga0496126_0002928 | Ga0496126_0002928_4851_5714 | 283 |
| 933 | 3300048929 | Ga0496126_0007386 | Ga0496126_0007386_4423_5286 | 283 |
| 934 | 3300048929 | Ga0496126_0016425 | Ga0496126_0016425_2424_3287 | 283 |
| 935 | 3300048929 | Ga0496126_0018165 | Ga0496126_0018165_1288_2151 | 283 |
| 936 | 3300048929 | Ga0496126_0018440 | Ga0496126_0018440_2423_3286 | 283 |
| 937 | 3300048929 | Ga0496126_0074838 | Ga0496126_0074838_1583_2446 | 283 |
| 938 | 3300048929 | Ga0496126_0110874 | Ga0496126_0110874_1042_1905 | 283 |
| 939 | 3300048929 | Ga0496126_0172532 | Ga0496126_0172532_185_1048 | 283 |
| 940 | 3300048929 | Ga0496126_0175038 | Ga0496126_0175038_59_922 | 283 |
| 941 | 3300048929 | Ga0496126_0255043 | Ga0496126_0255043_122_985 | 283 |
| 942 | 3300049460 | Ga0495682_0041853 | Ga0495682_0041853_128_991 | 283 |
| 943 | 3300049460 | Ga0495682_0056874 | Ga0495682_0056874_522_1385 | 283 |
| 944 | 3300049568 | Ga0501031_0012411 | Ga0501031_0012411_3012_3875 | 283 |
| 945 | 3300049568 | Ga0501031_0166768 | Ga0501031_0166768_379_1242 | 283 |
| 946 | 3300049569 | Ga0501032_0000683 | Ga0501032_0000683_8476_9339 | 283 |
| 947 | 3300049569 | Ga0501032_0025241 | Ga0501032_0025241_2285_3148 | 283 |
| 948 | 3300049569 | Ga0501032_0044830 | Ga0501032_0044830_1979_2842 | 283 |
| 949 | 3300049570 | Ga0501033_0000645 | Ga0501033_0000645_13169_14032 | 283 |
| 950 | 3300049570 | Ga0501033_0041465 | Ga0501033_0041465_1559_2422 | 283 |
| 951 | 3300049570 | Ga0501033_0257586 | Ga0501033_0257586_181_1044 | 283 |
| 952 | 3300049571 | Ga0501034_0004310 | Ga0501034_0004310_14375_15238 | 283 |
| 953 | 3300049571 | Ga0501034_0018499 | Ga0501034_0018499_4146_5009 | 283 |
| 954 | 3300049571 | Ga0501034_0456263 | Ga0501034_0456263_56_919 | 283 |
| 955 | 3300049572 | Ga0501036_0002022 | Ga0501036_0002022_2260_3123 | 283 |
| 956 | 3300049572 | Ga0501036_0175017 | Ga0501036_0175017_210_1073 | 283 |
| 957 | 3300049573 | Ga0501037_0000484 | Ga0501037_0000484_13169_14032 | 283 |
| 958 | 3300049573 | Ga0501037_0043321 | Ga0501037_0043321_1606_2469 | 283 |
| 959 | 3300049573 | Ga0501037_0064760 | Ga0501037_0064760_1012_1875 | 283 |
| 960 | 3300049574 | Ga0501038_0003716 | Ga0501038_0003716_4528_5391 | 283 |
| 961 | 3300049574 | Ga0501038_0012105 | Ga0501038_0012105_3886_4749 | 283 |
| 962 | 3300049575 | Ga0501039_0001484 | Ga0501039_0001484_13106_13969 | 283 |
| 963 | 3300049575 | Ga0501039_0058706 | Ga0501039_0058706_1402_2265 | 283 |
| 964 | 3300049575 | Ga0501039_0091357 | Ga0501039_0091357_1432_2295 | 283 |
| 965 | 3300049579 | Ga0501043_0000593 | Ga0501043_0000593_17580_18443 | 283 |
| 966 | 3300049579 | Ga0501043_0005035 | Ga0501043_0005035_4007_4870 | 283 |
| 967 | 3300049579 | Ga0501043_0051221 | Ga0501043_0051221_1722_2573 | 283 |
| 968 | 3300049580 | Ga0501046_0000499 | Ga0501046_0000499_20639_21502 | 283 |
| 969 | 3300049580 | Ga0501046_0049205 | Ga0501046_0049205_1927_2790 | 283 |
| 970 | 3300049580 | Ga0501046_0139669 | Ga0501046_0139669_330_1193 | 283 |
| 971 | 3300049581 | Ga0501047_0001042 | Ga0501047_0001042_18243_19106 | 283 |
| 972 | 3300049581 | Ga0501047_0204652 | Ga0501047_0204652_637_1500 | 283 |
| 973 | 3300049581 | Ga0501047_0487877 | Ga0501047_0487877_143_1006 | 283 |
| 974 | 3300049582 | Ga0501048_0029959 | Ga0501048_0029959_584_1447 | 283 |
| 975 | 3300049582 | Ga0501048_0221807 | Ga0501048_0221807_391_1254 | 283 |
| 976 | 3300049584 | Ga0501068_0004322 | Ga0501068_0004322_4083_4946 | 283 |
| 977 | 3300049585 | Ga0501069_0002891 | Ga0501069_0002891_4190_5053 | 283 |
| 978 | 3300049586 | Ga0501070_0000773 | Ga0501070_0000773_24724_25587 | 283 |
| 979 | 3300049589 | Ga0501073_0009539 | Ga0501073_0009539_4264_5127 | 283 |
| 980 | 3300049589 | Ga0501073_0010870 | Ga0501073_0010870_542_1405 | 283 |
| 981 | 3300049589 | Ga0501073_0155097 | Ga0501073_0155097_657_1520 | 283 |
| 982 | 3300049589 | Ga0501073_0158622 | Ga0501073_0158622_308_1171 | 283 |
| 983 | 3300049590 | Ga0501074_0015366 | Ga0501074_0015366_215_1078 | 283 |
| 984 | 3300049663 | Ga0501223_033078 | Ga0501223_033078_83_949 | 283 |
| 985 | 3300049664 | Ga0501224_015249 | Ga0501224_015249_162_1028 | 283 |
| 986 | 3300049679 | Ga0501249_000124 | Ga0501249_000124_5005_5871 | 283 |
| 987 | 3300049679 | Ga0501249_000246 | Ga0501249_000246_10037_10921 | 283 |
| 988 | 3300049741 | Ga0501079_0046250 | Ga0501079_0046250_1392_2255 | 283 |
| 989 | 3300049741 | Ga0501079_0335621 | Ga0501079_0335621_33_896 | 283 |
| 990 | 3300049742 | Ga0501080_0000326 | Ga0501080_0000326_17367_18230 | 283 |
| 991 | 3300049742 | Ga0501080_0130087 | Ga0501080_0130087_813_1676 | 283 |
| 992 | 3300049822 | Ga0501035_0009126 | Ga0501035_0009126_3983_4846 | 283 |
| 993 | 3300049822 | Ga0501035_0136964 | Ga0501035_0136964_434_1297 | 283 |
| 994 | 3300049822 | Ga0501035_0174477 | Ga0501035_0174477_163_1026 | 283 |
| 995 | 3300049823 | Ga0501044_0003564 | Ga0501044_0003564_3983_4846 | 283 |
| 996 | 3300049823 | Ga0501044_0006626 | Ga0501044_0006626_8238_9101 | 283 |
| 997 | 3300049823 | Ga0501044_0373593 | Ga0501044_0373593_345_1208 | 283 |
| 998 | 3300049824 | Ga0501045_0448897 | Ga0501045_0448897_42_905 | 283 |
| 999 | 3300049850 | Ga0501204_005645 | Ga0501204_005645_423_1289 | 283 |
| 1000 | 3300050489 | nmdc:mga03683_134383_c1 | nmdc:mga03683_134383_c1_215_1078 | 283 |
| 1001 | 3300050490 | nmdc:mga03n38_154959_c1 | nmdc:mga03n38_154959_c1_229_1092 | 283 |
| 1002 | 3300050491 | nmdc:mga00v17_177787_c1 | nmdc:mga00v17_177787_c1_432_1295 | 283 |
| 1003 | 3300050492 | nmdc:mga0yw44_11896_c1 | nmdc:mga0yw44_11896_c1_1814_2677 | 283 |
| 1004 | 3300050492 | nmdc:mga0yw44_122864_c1 | nmdc:mga0yw44_122864_c1_353_1216 | 283 |
| 1005 | 3300050492 | nmdc:mga0yw44_21958_c1 | nmdc:mga0yw44_21958_c1_2025_2888 | 283 |
| 1006 | 3300050493 | nmdc:mga0k408_83011_c1 | nmdc:mga0k408_83011_c1_517_1380 | 283 |
| 1007 | 3300050494 | nmdc:mga06z11_17981_c1 | nmdc:mga06z11_17981_c1_801_1664 | 283 |
| 1008 | 3300050495 | nmdc:mga04h51_14163_c1 | nmdc:mga04h51_14163_c1_1305_2168 | 283 |
| 1009 | 3300050496 | nmdc:mga07m45_65899_c1 | nmdc:mga07m45_65899_c1_875_1738 | 283 |
| 1010 | 3300050509 | nmdc:mga0qj67_276810_c1 | nmdc:mga0qj67_276810_c1_335_1198 | 283 |
| 1011 | 3300050512 | nmdc:mga0n895_46682_c1 | nmdc:mga0n895_46682_c1_2092_2955 | 283 |
| 1012 | 3300050513 | nmdc:mga0rr50_259288_c1 | nmdc:mga0rr50_259288_c1_569_1432 | 283 |
| 1013 | 3300050516 | nmdc:mga0sz30_16554_c1 | nmdc:mga0sz30_16554_c1_1769_2632 | 283 |
| 1014 | 3300050516 | nmdc:mga0sz30_28004_c1 | nmdc:mga0sz30_28004_c1_720_1583 | 283 |
| 1015 | 3300050516 | nmdc:mga0sz30_5917_c1 | nmdc:mga0sz30_5917_c1_2796_3659 | 283 |
| 1016 | 3300053077 | Ga0495601_0024411 | Ga0495601_0024411_1677_2540 | 283 |
| 1017 | 3300053080 | Ga0500635_0002397 | Ga0500635_0002397_1340_2203 | 283 |
| 1018 | 3300053080 | Ga0500635_0012314 | Ga0500635_0012314_913_1776 | 283 |
| 1019 | 3300053085 | Ga0495619_0077617 | Ga0495619_0077617_643_1506 | 283 |
| 1020 | 3300053085 | Ga0495619_0171841 | Ga0495619_0171841_130_993 | 283 |
| 1021 | 3300053086 | Ga0500578_0090485 | Ga0500578_0090485_771_1634 | 283 |
| 1022 | 3300053087 | Ga0500643_000060 | Ga0500643_000060_74505_75368 | 283 |
| 1023 | 3300053091 | Ga0500647_0010576 | Ga0500647_0010576_2032_2895 | 283 |
| 1024 | 3300053093 | Ga0500651_0013537 | Ga0500651_0013537_2062_2925 | 283 |
| 1025 | 3300053093 | Ga0500651_0086930 | Ga0500651_0086930_330_1193 | 283 |
| 1026 | 3300053094 | Ga0500566_0000232 | Ga0500566_0000232_16001_16864 | 283 |
| 1027 | 3300053094 | Ga0500566_0000433 | Ga0500566_0000433_14279_15142 | 283 |
| 1028 | 3300053094 | Ga0500566_0197350 | Ga0500566_0197350_137_1000 | 283 |
| 1029 | 3300053096 | Ga0500641_0025576 | Ga0500641_0025576_511_1374 | 283 |
| 1030 | 3300053096 | Ga0500641_0042983 | Ga0500641_0042983_748_1611 | 283 |
| 1031 | 3300053096 | Ga0500641_0128644 | Ga0500641_0128644_197_1060 | 283 |
| 1032 | 3300053098 | Ga0500650_0011541 | Ga0500650_0011541_660_1523 | 283 |
| 1033 | 3300053102 | Ga0500554_043149 | Ga0500554_043149_295_1158 | 283 |
| 1034 | 3300053103 | Ga0500555_001000 | Ga0500555_001000_6998_7861 | 283 |
| 1035 | 3300053105 | Ga0500557_000007 | Ga0500557_000007_51496_52359 | 283 |
| 1036 | 3300053111 | Ga0500572_000629 | Ga0500572_000629_2105_2968 | 283 |
| 1037 | 3300053111 | Ga0500572_001647 | Ga0500572_001647_50_913 | 283 |
| 1038 | 3300053119 | Ga0500595_023394 | Ga0500595_023394_235_1098 | 283 |
| 1039 | 3300053121 | Ga0500607_059418 | Ga0500607_059418_321_1184 | 283 |
| 1040 | 3300053123 | Ga0500614_001108 | Ga0500614_001108_2829_3692 | 283 |
| 1041 | 3300053130 | Ga0500642_0004617 | Ga0500642_0004617_1840_2703 | 283 |
| 1042 | 3300053136 | Ga0500559_0001723 | Ga0500559_0001723_5053_5916 | 283 |
| 1043 | 3300053136 | Ga0500559_0007012 | Ga0500559_0007012_3056_3919 | 283 |
| 1044 | 3300053137 | Ga0500561_0038078 | Ga0500561_0038078_281_1144 | 283 |
| 1045 | 3300053150 | Ga0500603_001060 | Ga0500603_001060_1775_2638 | 283 |
| 1046 | 3300053150 | Ga0500603_003471 | Ga0500603_003471_1284_2147 | 283 |
| 1047 | 3300053159 | Ga0500630_005547 | Ga0500630_005547_2823_3686 | 283 |
| 1048 | 3300053163 | Ga0500639_010254 | Ga0500639_010254_3056_3919 | 283 |
| 1049 | 3300053163 | Ga0500639_054758 | Ga0500639_054758_1159_2022 | 283 |
| 1050 | 3300053177 | Ga0500636_0025996 | Ga0500636_0025996_1231_2094 | 283 |
| 1051 | 3300053178 | Ga0500637_0026010 | Ga0500637_0026010_1377_2240 | 283 |
| 1052 | 3300053725 | Ga0500576_014386 | Ga0500576_014386_765_1628 | 283 |
| 1053 | 3300053729 | Ga0500625_004431 | Ga0500625_004431_2965_3828 | 283 |
| 1054 | 3300053730 | Ga0500645_049289 | Ga0500645_049289_248_1111 | 283 |
| 1055 | 3300053731 | Ga0500609_000708 | Ga0500609_000708_19_882 | 283 |
| 1056 | 3300053735 | Ga0500596_001871 | Ga0500596_001871_2068_2931 | 283 |
| 1057 | 3300053735 | Ga0500596_002960 | Ga0500596_002960_336_1199 | 283 |
| 1058 | 3300053737 | Ga0500601_000071 | Ga0500601_000071_17944_18834 | 283 |
| 1059 | 3300053737 | Ga0500601_003391 | Ga0500601_003391_571_1434 | 283 |
| 1060 | 3300055283 | Ga0500661_000283 | Ga0500661_000283_1569_2432 | 283 |
| 1061 | 3300055283 | Ga0500661_004156 | Ga0500661_004156_1378_2241 | 283 |
| 1062 | 3300061719 | Ga0466962_0032764 | Ga0466962_0032764_1177_2040 | 283 |
| 1063 | iso_pu_bacteria | 2602042107 | 2603861335 | 283 |
| 1064 | iso_pu_bacteria | 2885409591 | 2885414076 | 283 |
| 1065 | iso_pu_bacteria | 2935638405 | 2935646880 | 283 |
| 1066 | iso_pu_bacteria | 2935827899 | 2935836147 | 283 |
| 1067 | iso_pu_bacteria | 3005506211 | 3005512272 | 283 |
| 1068 | 3300005335 | Ga0070666_10016850 | Ga0070666_100168501 | 284 |
| 1069 | 3300005347 | Ga0070668_100011527 | Ga0070668_1000115276 | 284 |
| 1070 | 3300005353 | Ga0070669_100073590 | Ga0070669_1000735902 | 284 |
| 1071 | 3300005367 | Ga0070667_100000013 | Ga0070667_1000000131 | 284 |
| 1072 | 3300005841 | Ga0068863_100000192 | Ga0068863_1000001924 | 284 |
| 1073 | 3300005843 | Ga0068860_100001343 | Ga0068860_1000013432 | 284 |
| 1074 | 3300006051 | Ga0075364_10059723 | Ga0075364_100597232 | 284 |
| 1075 | 3300006186 | Ga0075369_10009297 | Ga0075369_100092975 | 284 |
| 1076 | 3300009545 | Ga0105237_10116230 | Ga0105237_101162304 | 284 |
| 1077 | 3300025294 | Ga0209025_1006289 | Ga0209025_10062897 | 284 |
| 1078 | 3300025923 | Ga0207681_10072592 | Ga0207681_100725923 | 284 |
| 1079 | 3300025972 | Ga0207668_10012810 | Ga0207668_100128103 | 284 |
| 1080 | 3300025986 | Ga0207658_10000068 | Ga0207658_100000681 | 284 |
| 1081 | 3300026088 | Ga0207641_10000074 | Ga0207641_100000745 | 284 |
| 1082 | 3300027357 | Ga0209589_1000004 | Ga0209589_100000483 | 284 |
| 1083 | 3300027361 | Ga0209489_100004 | Ga0209489_10000483 | 284 |
| 1084 | 3300027363 | Ga0209700_100004 | Ga0209700_10000483 | 284 |
| 1085 | 3300028381 | Ga0268264_10018779 | Ga0268264_100187791 | 284 |
| 1086 | 3300046471 | Ga0495650_0002809 | Ga0495650_0002809_10383_11270 | 284 |
| 1087 | 3300048921 | Ga0496118_0035179 | Ga0496118_0035179_168_1043 | 284 |
| 1088 | 3300049570 | Ga0501033_0043903 | Ga0501033_0043903_936_1913 | 284 |
| 1089 | 3300049592 | Ga0501076_0173607 | Ga0501076_0173607_500_1402 | 284 |
| 1090 | 3300050491 | nmdc:mga00v17_76850_c1 | nmdc:mga00v17_76850_c1_757_1632 | 284 |
| 1091 | 3300050516 | nmdc:mga0sz30_27264_c1 | nmdc:mga0sz30_27264_c1_668_1543 | 284 |
| 1092 | 3300053094 | Ga0500566_0000445 | Ga0500566_0000445_20547_21422 | 284 |
| 1093 | 3300053136 | Ga0500559_0002898 | Ga0500559_0002898_55_930 | 284 |
| 1094 | 3300053145 | Ga0500586_004250 | Ga0500586_004250_544_1419 | 284 |
| 1095 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_179027_179902 | 284 |
| 1096 | 3300053177 | Ga0500636_0003689 | Ga0500636_0003689_4245_5120 | 284 |
| 1097 | 3300001990 | JGI24737J22298_10007014 | JGI24737J22298_100070143 | 285 |
| 1098 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_1000001411 | 285 |
| 1099 | 3300003203 | JGI25406J46586_10002347 | JGI25406J46586_100023473 | 285 |
| 1100 | 3300003794 | Ga0055531_10001282 | Ga0055531_1000128220 | 285 |
| 1101 | 3300003794 | Ga0055531_10014943 | Ga0055531_100149433 | 285 |
| 1102 | 3300005344 | Ga0070661_100129304 | Ga0070661_1001293042 | 285 |
| 1103 | 3300005455 | Ga0070663_100019091 | Ga0070663_1000190914 | 285 |
| 1104 | 3300005617 | Ga0068859_100026770 | Ga0068859_1000267703 | 285 |
| 1105 | 3300006931 | Ga0097620_100026770 | Ga0097620_1000267703 | 285 |
| 1106 | 3300009093 | Ga0105240_10028339 | Ga0105240_100283393 | 285 |
| 1107 | 3300009551 | Ga0105238_10011639 | Ga0105238_100116394 | 285 |
| 1108 | 3300009551 | Ga0105238_10172449 | Ga0105238_101724492 | 285 |
| 1109 | 3300010375 | Ga0105239_10016664 | Ga0105239_100166646 | 285 |
| 1110 | 3300010375 | Ga0105239_10040575 | Ga0105239_100405753 | 285 |
| 1111 | 3300025299 | Ga0209256_1004202 | Ga0209256_10042023 | 285 |
| 1112 | 3300025304 | Ga0209257_1001906 | Ga0209257_100190611 | 285 |
| 1113 | 3300025906 | Ga0207699_10001145 | Ga0207699_100011459 | 285 |
| 1114 | 3300025915 | Ga0207693_10049791 | Ga0207693_100497914 | 285 |
| 1115 | 3300031665 | Ga0316575_10012581 | Ga0316575_100125813 | 285 |
| 1116 | 3300031728 | Ga0316578_10172332 | Ga0316578_101723321 | 285 |
| 1117 | 3300035116 | Ga0373945_0066435 | Ga0373945_0066435_143_1066 | 285 |
| 1118 | 3300035398 | Ga0316574_0000500 | Ga0316574_0000500_7437_8363 | 285 |
| 1119 | 3300037471 | Ga0395905_0117070 | Ga0395905_0117070_591_1529 | 285 |
| 1120 | 3300039437 | Ga0436365_0260840 | Ga0436365_0260840_20086_21006 | 285 |
| 1121 | 3300039450 | Ga0436363_0604370 | Ga0436363_0604370_989_1909 | 285 |
| 1122 | 3300039453 | Ga0436362_0119752 | Ga0436362_0119752_73_993 | 285 |
| 1123 | 3300039453 | Ga0436362_0907410 | Ga0436362_0907410_843_1772 | 285 |
| 1124 | 3300046507 | Ga0495606_0001096 | Ga0495606_0001096_33347_34321 | 285 |
| 1125 | 3300048918 | Ga0496115_0254856 | Ga0496115_0254856_11_1015 | 285 |
| 1126 | 3300048928 | Ga0496125_0027633 | Ga0496125_0027633_359_1264 | 285 |
| 1127 | 3300049569 | Ga0501032_0021357 | Ga0501032_0021357_2562_3425 | 285 |
| 1128 | 3300049569 | Ga0501032_0149285 | Ga0501032_0149285_458_1378 | 285 |
| 1129 | 3300049571 | Ga0501034_0012439 | Ga0501034_0012439_5894_6757 | 285 |
| 1130 | 3300049573 | Ga0501037_0076969 | Ga0501037_0076969_807_1670 | 285 |
| 1131 | 3300049574 | Ga0501038_0374584 | Ga0501038_0374584_201_1064 | 285 |
| 1132 | 3300049575 | Ga0501039_0136704 | Ga0501039_0136704_559_1479 | 285 |
| 1133 | 3300049579 | Ga0501043_0078301 | Ga0501043_0078301_1106_1969 | 285 |
| 1134 | 3300049580 | Ga0501046_0046091 | Ga0501046_0046091_667_1530 | 285 |
| 1135 | 3300049580 | Ga0501046_0055557 | Ga0501046_0055557_1670_2590 | 285 |
| 1136 | 3300049582 | Ga0501048_0081143 | Ga0501048_0081143_200_1120 | 285 |
| 1137 | 3300049583 | Ga0501067_0003275 | Ga0501067_0003275_5570_6490 | 285 |
| 1138 | 3300049586 | Ga0501070_0126861 | Ga0501070_0126861_352_1272 | 285 |
| 1139 | 3300049589 | Ga0501073_0041356 | Ga0501073_0041356_1195_2115 | 285 |
| 1140 | 3300049590 | Ga0501074_0086189 | Ga0501074_0086189_630_1550 | 285 |
| 1141 | 3300049822 | Ga0501035_0292098 | Ga0501035_0292098_10_930 | 285 |
| 1142 | 3300049823 | Ga0501044_0475838 | Ga0501044_0475838_167_1030 | 285 |
| 1143 | 3300050490 | nmdc:mga03n38_32318_c1 | nmdc:mga03n38_32318_c1_631_1620 | 285 |
| 1144 | 3300053085 | Ga0495619_0156690 | Ga0495619_0156690_223_1227 | 285 |
| 1145 | iso_pu_bacteria | 2517093001 | 2517105648 | 285 |
| 1146 | iso_pu_bacteria | 2738543024 | 2739305789 | 285 |
| 1147 | 3300001989 | JGI24739J22299_10035312 | JGI24739J22299_100353121 | 286 |
| 1148 | 3300002737 | JGI25162J39368_1003562 | JGI25162J39368_10035622 | 286 |
| 1149 | 3300002741 | JGI25157J39369_1004272 | JGI25157J39369_10042722 | 286 |
| 1150 | 3300002741 | JGI25157J39369_1004469 | JGI25157J39369_10044693 | 286 |
| 1151 | 3300002771 | JGI25163J39215_1000989 | JGI25163J39215_10009897 | 286 |
| 1152 | 3300002771 | JGI25163J39215_1001956 | JGI25163J39215_10019563 | 286 |
| 1153 | 3300002772 | JGI25164J39214_1001231 | JGI25164J39214_10012313 | 286 |
| 1154 | 3300003214 | JGI25165J46597_1002202 | JGI25165J46597_10022028 | 286 |
| 1155 | 3300003751 | Ga0055538_1002542 | Ga0055538_10025423 | 286 |
| 1156 | 3300003751 | Ga0055538_1002885 | Ga0055538_10028853 | 286 |
| 1157 | 3300003756 | Ga0055533_1000545 | Ga0055533_10005451 | 286 |
| 1158 | 3300003761 | Ga0055535_1002327 | Ga0055535_10023278 | 286 |
| 1159 | 3300003761 | Ga0055535_1018064 | Ga0055535_10180641 | 286 |
| 1160 | 3300003762 | Ga0055542_1000744 | Ga0055542_10007443 | 286 |
| 1161 | 3300003762 | Ga0055542_1003371 | Ga0055542_10033712 | 286 |
| 1162 | 3300003763 | Ga0055529_1001508 | Ga0055529_10015083 | 286 |
| 1163 | 3300005340 | Ga0070689_100000503 | Ga0070689_1000005033 | 286 |
| 1164 | 3300005344 | Ga0070661_100258404 | Ga0070661_1002584042 | 286 |
| 1165 | 3300005455 | Ga0070663_100019789 | Ga0070663_1000197893 | 286 |
| 1166 | 3300013105 | Ga0157369_10087630 | Ga0157369_100876303 | 286 |
| 1167 | 3300014969 | Ga0157376_10255422 | Ga0157376_102554222 | 286 |
| 1168 | 3300015687 | Ga0183368_1003 | Ga0183368_1003717 | 286 |
| 1169 | 3300025206 | Ga0209435_105841 | Ga0209435_1058411 | 286 |
| 1170 | 3300025206 | Ga0209435_107683 | Ga0209435_1076832 | 286 |
| 1171 | 3300025207 | Ga0209760_100585 | Ga0209760_1005852 | 286 |
| 1172 | 3300025224 | Ga0209784_100709 | Ga0209784_1007098 | 286 |
| 1173 | 3300025226 | Ga0209674_100012 | Ga0209674_100012468 | 286 |
| 1174 | 3300025228 | Ga0209672_101666 | Ga0209672_1016667 | 286 |
| 1175 | 3300025231 | Ga0207427_100156 | Ga0207427_1001568 | 286 |
| 1176 | 3300025231 | Ga0207427_102344 | Ga0207427_1023446 | 286 |
| 1177 | 3300025233 | Ga0209437_100147 | Ga0209437_1001478 | 286 |
| 1178 | 3300025233 | Ga0209437_100224 | Ga0209437_10022449 | 286 |
| 1179 | 3300025242 | Ga0209258_100049 | Ga0209258_100049100 | 286 |
| 1180 | 3300025242 | Ga0209258_101060 | Ga0209258_1010601 | 286 |
| 1181 | 3300025246 | Ga0209646_1005630 | Ga0209646_10056301 | 286 |
| 1182 | 3300025250 | Ga0209026_1000099 | Ga0209026_1000099163 | 286 |
| 1183 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005995 | 286 |
| 1184 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010920 | 286 |
| 1185 | 3300025256 | Ga0209759_1001568 | Ga0209759_10015688 | 286 |
| 1186 | 3300025256 | Ga0209759_1007024 | Ga0209759_10070243 | 286 |
| 1187 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009250 | 286 |
| 1188 | 3300025261 | Ga0209233_1024000 | Ga0209233_10240002 | 286 |
| 1189 | 3300025272 | Ga0209455_1000086 | Ga0209455_1000086251 | 286 |
| 1190 | 3300025272 | Ga0209455_1009241 | Ga0209455_10092412 | 286 |
| 1191 | 3300025904 | Ga0207647_10011712 | Ga0207647_100117123 | 286 |
| 1192 | 3300025920 | Ga0207649_10137710 | Ga0207649_101377101 | 286 |
| 1193 | 3300025936 | Ga0207670_10009585 | Ga0207670_100095853 | 286 |
| 1194 | 3300026067 | Ga0207678_10010017 | Ga0207678_100100177 | 286 |
| 1195 | 3300039447 | Ga0436361_0560308 | Ga0436361_0560308_307_1182 | 286 |
| 1196 | 3300046460 | Ga0495638_0002596 | Ga0495638_0002596_2647_3507 | 286 |
| 1197 | 3300046460 | Ga0495638_0023075 | Ga0495638_0023075_2537_3397 | 286 |
| 1198 | 3300046471 | Ga0495650_0000337 | Ga0495650_0000337_82020_82880 | 286 |
| 1199 | 3300046507 | Ga0495606_0000401 | Ga0495606_0000401_31155_32015 | 286 |
| 1200 | 3300046557 | Ga0495622_0039639 | Ga0495622_0039639_857_1717 | 286 |
| 1201 | 3300046660 | Ga0495625_0028749 | Ga0495625_0028749_695_1555 | 286 |
| 1202 | 3300046694 | Ga0495649_0001571 | Ga0495649_0001571_11201_12061 | 286 |
| 1203 | 3300048916 | Ga0496113_0002731 | Ga0496113_0002731_3628_4488 | 286 |
| 1204 | 3300048917 | Ga0496114_0238993 | Ga0496114_0238993_25_885 | 286 |
| 1205 | 3300048918 | Ga0496115_0000182 | Ga0496115_0000182_2805_3665 | 286 |
| 1206 | 3300048918 | Ga0496115_0000503 | Ga0496115_0000503_15589_16449 | 286 |
| 1207 | 3300048918 | Ga0496115_0123259 | Ga0496115_0123259_241_1101 | 286 |
| 1208 | 3300048929 | Ga0496126_0316652 | Ga0496126_0316652_248_1108 | 286 |
| 1209 | 3300048929 | Ga0496126_0479714 | Ga0496126_0479714_50_910 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3obi-assembly1.cif.gz_A | crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution | 0.9608 | 5 | 286 |
| 3n0v-assembly1.cif.gz_C | crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution | 0.9488 | 6 | 284 |
| 3lou-assembly1.cif.gz_A | crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.9483 | 5 | 285 |
| 3n0v-assembly1.cif.gz_B | crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution | 0.9481 | 6 | 284 |
| 3obi-assembly1.cif.gz_A | crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution | 0.9478 | 5 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nrbA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9372 | 5 | 87 | 3.30.70.260 |
| 3obiD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9334 | 5 | 87 | 3.30.70.260 |
| 3n0vB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9169 | 6 | 87 | 3.30.70.260 |
| af_Q58953_1_90_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9132 | 5 | 85 | 3.30.70.260 |
| 3nrbB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9127 | 90 | 286 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258Q1R9-F1-model_v4 | Formyltetrahydrofolate deformylase | 0.9928 | 4 | 117 |
GO:0006189
GO:0008864 |
| AF-A0A4V1UA86-F1-model_v4 | deleted | 0.9793 | 5 | 113 |
|
| AF-A0A3M2U885-F1-model_v4 | Formyltetrahydrofolate deformylase | 0.9739 | 6 | 113 |
GO:0006189
GO:0008864 |
| AF-A0A258Q1R9-F1-model_v4 | Formyltetrahydrofolate deformylase | 0.9673 | 4 | 117 |
GO:0006189
GO:0008864 |
| AF-C5TBB0-F1-model_v4 | Formyltetrahydrofolate deformylase (EC 3.5.1.10) (Formyl-FH(4) hydrolase) | 0.9651 | 4 | 285 |
GO:0006189
GO:0006730 GO:0008864 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar