F491715

General Info

Members Datasets Scaffolds Average Seq Length
1209 689 958 287

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0254856|Ga0496115_0254856_11_1015
Length 334
Sequence LFYSKGGRLLFVHHDARAGIGARVRRVIEQGRKTVVPSYLQSPSSQSMPDHQFVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFNDVETAHFFMRVVFTAADLAVDLGALQTGFKAIAERFGMDWQMRDRASRRRVMLLVSTSDHCLADILYRWRTGELQMIPTAIVSNHPRETYSSLDFGDIPFHYLPVTRETKREQETAILKLAGDTATDLVVLARYMQILSDEMTAKLSGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHYVTSALDEGPIIEQDVERISHRDTPEDLVRKGRDIERRVLARAMRHHLEDRVILNGRKTVVFMD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
31 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
34 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
35 2738543024 Aminobacter sp. AP02 Isolate Unclassified
36 2739367700 Dyella sp. YR388 Isolate Unclassified
37 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
38 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
39 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
40 2791355199
41 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
42 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
43 2818991467 Bosea vestrisii 3192 Isolate Unclassified
44 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
45 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
46 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
47 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
48 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
49 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
50 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
51 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
52 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
53 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
54 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
55 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
56 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
57 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
58 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
59 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
60 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
61 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
62 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
63 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
64 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
65 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
66 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
67 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
68 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
69 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
70 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
71 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
72 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
73 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
74 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
75 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
76 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
77 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
78 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
79 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
80 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
81 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
82 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
83 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
84 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
85 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
86 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
87 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
88 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
89 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
90 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
91 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
92 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
93 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
94 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
95 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
96 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
97 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
98 2884411467 Dyella sp. AD56 Isolate Rhizosphere
99 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
100 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
101 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
102 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
103 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
104 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
105 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
106 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
107 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
108 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
109 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
110 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
111 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
112 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
113 2904699407
114 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
115 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
116 2906610324
117 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
118 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
119 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
120 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
121 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
122 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
123 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
124 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
125 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
126 2922368715
127 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
128 2922425934
129 2928963466 Dyella japonica 1073 Isolate Unclassified
130 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
131 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
132 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
133 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
134 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
135 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
136 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
137 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
138 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
139 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
140 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
141 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
142 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
143 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
144 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
145 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
146 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
147 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
148 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
149 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
150 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
151 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
152 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
153 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
154 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
155 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
156 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
157 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
158 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
159 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
160 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
161 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
162 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
163 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
164 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
165 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
166 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
167 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
168 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
169 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
170 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
171 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
172 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
173 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
174 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
175 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
176 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
177 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
178 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
179 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
180 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
181 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
182 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
183 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
184 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
185 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
186 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
187 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
188 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
189 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
190 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
191 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
192 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
193 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
194 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
195 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
196 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
197 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
198 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
199 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
200 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
201 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
202 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
203 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
204 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
205 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
206 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
207 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
208 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
209 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
210 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
211 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
212 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
213 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
214 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
215 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
216 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
217 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
218 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
219 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
220 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
221 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
222 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
223 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
224 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
225 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
226 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
227 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
228 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
229 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
230 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
231 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
232 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
233 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
234 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
235 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
236 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
237 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
238 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
239 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
240 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
241 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
242 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
243 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
244 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
245 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
246 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
247 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
248 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
249 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
250 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
251 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
252 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
253 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
254 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
255 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
256 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
257 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
258 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
259 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
260 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
261 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
262 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
263 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
264 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
265 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
266 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
267 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
268 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
269 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
270 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
271 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
272 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
273 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
274 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
275 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
276 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
277 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
278 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
279 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
280 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
281 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
282 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
283 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
284 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
285 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
286 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
289 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
290 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
291 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
292 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
293 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
294 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
295 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
296 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
297 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
298 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
299 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
300 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
301 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
302 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
303 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
304 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
305 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
306 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
307 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
308 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
309 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
310 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
311 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
312 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
313 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
314 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
315 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
316 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
317 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
318 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
319 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
320 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
321 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
322 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
323 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
328 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
329 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
331 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
332 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
333 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
336 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
337 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
339 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
340 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
342 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
344 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
347 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
395 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
396 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
397 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
398 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
400 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
404 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
405 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
406 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
407 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
408 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
409 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
410 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
411 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
412 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
413 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
414 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
415 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
416 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
417 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
418 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
419 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
420 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
421 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
422 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
423 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
424 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
425 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
426 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
427 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
428 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
429 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
430 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
431 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
432 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
433 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
434 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
435 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
436 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
437 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
438 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
439 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
440 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
441 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
442 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
443 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
444 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
445 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
446 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
447 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
448 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
449 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
450 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
451 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
452 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
453 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
454 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
455 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
456 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
457 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
458 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
459 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
460 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
461 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
462 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
463 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
464 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
465 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
466 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
467 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
468 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
469 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
470 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
471 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
472 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
473 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
474 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
475 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
476 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
477 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
478 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
479 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
480 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
481 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
482 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
483 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
484 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
485 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
486 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
487 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
488 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
489 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
490 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
491 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
492 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
493 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
494 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
495 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
496 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
497 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
498 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
499 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
500 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
501 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
502 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
503 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
504 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
505 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
506 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
507 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
508 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
509 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
510 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
511 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
512 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
513 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
514 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
515 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
516 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
517 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
518 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
519 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
520 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
521 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
522 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
523 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
524 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
525 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
526 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
527 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
528 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
529 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
530 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
531 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
532 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
533 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
534 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
535 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
536 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
537 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
538 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
539 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
540 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
541 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
542 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
543 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
544 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
545 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
546 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
547 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
548 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
549 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
550 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
551 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
552 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
553 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
554 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
555 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
556 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
557 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
558 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
559 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
560 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
561 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
562 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
563 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
564 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
565 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
566 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
567 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
568 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
569 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
571 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
579 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
580 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
581 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
582 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
583 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
584 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
585 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
586 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
587 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
588 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
589 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
590 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
591 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
595 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
596 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
597 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
598 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
599 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
600 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
601 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
602 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
603 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
604 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
605 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
606 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
607 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
608 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
609 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
610 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
611 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
612 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
613 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
614 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
615 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
616 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
617 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
618 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
619 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
620 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
621 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
622 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
623 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
624 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
625 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
626 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
627 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
628 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
629 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
630 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
631 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
632 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
633 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
634 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
635 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
636 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
637 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
638 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
639 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
640 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
641 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
642 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
643 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
644 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
645 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
646 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
647 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
648 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
649 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
650 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
651 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
652 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
653 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
654 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
655 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
656 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
657 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
658 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
659 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
660 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
661 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
662 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
663 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
664 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
665 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
666 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
667 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
668 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
669 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
670 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
671 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
672 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
673 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
674 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
675 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
676 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
677 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
678 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
679 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
680 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
681 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
682 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
683 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
684 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
685 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
686 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
687 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
688 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
689 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.49
Metatranscriptomes 0.08
Isolates 20.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.71
Nodule 15.38
Rhizoplane 3.56
Rhizosphere 50.62
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10035312 3300001989 Bacteria 1695
2 JGI24737J22298_10007014 3300001990 Bacteria 3820
3 JGI25162J39368_1003562 3300002737 Bacteria 4374
4 JGI25157J39369_1004272 3300002741 Bacteria 2644
5 JGI25157J39369_1004469 3300002741 Bacteria 2527
6 JGI25163J39215_1000989 3300002771 Bacteria 6283
7 JGI25163J39215_1001956 3300002771 Bacteria 2577
8 JGI25164J39214_1001231 3300002772 Bacteria 6840
9 JGI25151J46595_10034545 3300003187 Bacteria 1932
10 JGI25406J46586_10000014 3300003203 Bacteria 93855
11 JGI25406J46586_10002347 3300003203 Bacteria 8944
12 JGI25165J46597_1002202 3300003214 Bacteria 6896
13 JGI25153J46596_10001032 3300003215 Bacteria 16967
14 JGI25153J46596_10001653 3300003215 Bacteria 13206
15 JGI25153J46596_10001857 3300003215 Bacteria 12522
16 JGI25160J50197_1000935 3300003354 Bacteria 15360
17 JGI25160J50197_1004654 3300003354 Bacteria 5888
18 JGI25404J52841_10000792 3300003659 Bacteria 5005
19 JGI25404J52841_10003180 3300003659 Bacteria 3216
20 JGI25404J52841_10023374 3300003659 Bacteria 1334
21 Ga0055538_1002542 3300003751 Bacteria 2628
22 Ga0055538_1002885 3300003751 Bacteria 2343
23 Ga0055539_1008044 3300003752 Bacteria 1325
24 Ga0055533_1000545 3300003756 Bacteria 13392
25 Ga0055535_1002327 3300003761 Bacteria 6896
26 Ga0055535_1018064 3300003761 Bacteria 927
27 Ga0055542_1000744 3300003762 Bacteria 25103
28 Ga0055542_1003371 3300003762 Bacteria 4374
29 Ga0055542_1008531 3300003762 Bacteria 2001
30 Ga0055529_1001508 3300003763 Bacteria 6779
31 Ga0055524_1016860 3300003775 Bacteria 2598
32 Ga0055524_1024837 3300003775 Bacteria 1889
33 Ga0055536_1005549 3300003781 Bacteria 6135
34 Ga0055536_1007021 3300003781 Bacteria 5116
35 Ga0055530_10002947 3300003791 Bacteria 10283
36 Ga0055531_10001282 3300003794 Bacteria 18939
37 Ga0055531_10008111 3300003794 Bacteria 5597
38 Ga0055531_10011812 3300003794 Bacteria 4169
39 Ga0055531_10012762 3300003794 Bacteria 3924
40 Ga0055531_10014943 3300003794 Bacteria 3460
41 Ga0055531_10029170 3300003794 Bacteria 1885
42 Ga0065165_1002030 3300005262 Bacteria 18853
43 Ga0065165_1002068 3300005262 Bacteria 18536
44 Ga0070683_100019548 3300005329 Bacteria 6017
45 Ga0070666_10016850 3300005335 Bacteria 4678
46 Ga0070680_100012050 3300005336 Bacteria 6710
47 Ga0070680_100075324 3300005336 Bacteria 2778
48 Ga0070680_100097312 3300005336 Bacteria 2440
49 Ga0070682_100031822 3300005337 Bacteria 3193
50 Ga0070660_100006509 3300005339 Bacteria 8101
51 Ga0070660_100128586 3300005339 Bacteria 2026
52 Ga0070689_100000503 3300005340 Bacteria 23097
53 Ga0070661_100129304 3300005344 Bacteria 1896
54 Ga0070661_100258404 3300005344 Bacteria 1346
55 Ga0070668_100011527 3300005347 Bacteria 6581
56 Ga0070668_100096616 3300005347 Bacteria 2335
57 Ga0070669_100073590 3300005353 Bacteria 2531
58 Ga0070671_100159491 3300005355 Bacteria 1907
59 Ga0070674_100118650 3300005356 Bacteria 1955
60 Ga0070667_100000013 3300005367 Bacteria 255674
61 Ga0070667_100103439 3300005367 Bacteria 2462
62 Ga0070703_10048097 3300005406 Bacteria 1354
63 Ga0070709_10011973 3300005434 Bacteria 4848
64 Ga0070709_10022883 3300005434 Bacteria 3662
65 Ga0070709_10056329 3300005434 Bacteria 2485
66 Ga0070714_100364754 3300005435 Bacteria 1359
67 Ga0070713_100097083 3300005436 Bacteria 2545
68 Ga0070713_100124711 3300005436 Bacteria 2263
69 Ga0070713_100133713 3300005436 Bacteria 2189
70 Ga0070710_10018063 3300005437 Bacteria 3622
71 Ga0070710_10025623 3300005437 Bacteria 3124
72 Ga0070710_10039002 3300005437 Bacteria 2612
73 Ga0070711_100016347 3300005439 Bacteria 4711
74 Ga0070708_100057508 3300005445 Bacteria 3463
75 Ga0070663_100009960 3300005455 Bacteria 5908
76 Ga0070663_100019091 3300005455 Bacteria 4510
77 Ga0070663_100019789 3300005455 Bacteria 4445
78 Ga0070663_100115551 3300005455 Bacteria 2021
79 Ga0070663_100310786 3300005455 Bacteria 1264
80 Ga0070678_100067719 3300005456 Bacteria 2659
81 Ga0070662_100181198 3300005457 Bacteria 1660
82 Ga0070662_100285966 3300005457 Bacteria 1336
83 Ga0070681_10031355 3300005458 Bacteria 5336
84 Ga0070681_10068440 3300005458 Bacteria 3516
85 Ga0070699_100446325 3300005518 Bacteria 1173
86 Ga0070679_100048769 3300005530 Bacteria 4218
87 Ga0070679_100284240 3300005530 Bacteria 1606
88 Ga0070684_100004940 3300005535 Bacteria 10177
89 Ga0070684_100110440 3300005535 Bacteria 2465
90 Ga0070684_100298275 3300005535 Bacteria 1478
91 Ga0070697_100036758 3300005536 Bacteria 3956
92 Ga0068853_100027282 3300005539 Bacteria 4797
93 Ga0068853_100051545 3300005539 Bacteria 3542
94 Ga0068853_100068499 3300005539 Bacteria 3085
95 Ga0070665_100143080 3300005548 Bacteria 2395
96 Ga0070665_100446776 3300005548 Bacteria 1302
97 Ga0068855_100057686 3300005563 Bacteria 4551
98 Ga0068855_100074786 3300005563 Bacteria 3934
99 Ga0068855_100102540 3300005563 Bacteria 3293
100 Ga0068855_100156671 3300005563 Bacteria 2587
101 Ga0068857_100003812 3300005577 Bacteria 12691
102 Ga0068857_100010456 3300005577 Bacteria 8065
103 Ga0068857_100017758 3300005577 Bacteria 6236
104 Ga0068854_100023631 3300005578 Bacteria 4200
105 Ga0068854_100031462 3300005578 Bacteria 3687
106 Ga0068856_100024631 3300005614 Bacteria 5859
107 Ga0068856_100050802 3300005614 Bacteria 4088
108 Ga0068856_100697533 3300005614 Bacteria 1035
109 Ga0070702_100112820 3300005615 Bacteria 1689
110 Ga0068852_100004160 3300005616 Bacteria 10196
111 Ga0068852_100007043 3300005616 Bacteria 8188
112 Ga0068852_100280329 3300005616 Bacteria 1606
113 Ga0068859_100026770 3300005617 Bacteria 5785
114 Ga0068866_10091719 3300005718 Bacteria 1656
115 Ga0068861_100042398 3300005719 Bacteria 3410
116 Ga0068851_10001214 3300005834 Bacteria 11191
117 Ga0068851_10006472 3300005834 Bacteria 5349
118 Ga0068863_100000192 3300005841 Bacteria 64858
119 Ga0068863_100251707 3300005841 Bacteria 1706
120 Ga0068860_100001343 3300005843 Bacteria 26758
121 Ga0068862_100470093 3300005844 Bacteria 1188
122 Ga0081455_10004707 3300005937 Bacteria 15168
123 Ga0081455_10015886 3300005937 Bacteria 7288
124 Ga0081455_10028943 3300005937 Bacteria 5057
125 Ga0081540_1001530 3300005983 Bacteria 19855
126 Ga0081540_1007530 3300005983 Bacteria 7749
127 Ga0081540_1012734 3300005983 Bacteria 5513
128 Ga0081540_1021844 3300005983 Bacteria 3794
129 Ga0081540_1024489 3300005983 Bacteria 3502
130 Ga0081540_1050002 3300005983 Bacteria 2080
131 Ga0081540_1056776 3300005983 Bacteria 1898
132 Ga0081539_10000008 3300005985 Bacteria 525071
133 Ga0081539_10001561 3300005985 Bacteria 38000
134 Ga0081539_10014949 3300005985 Bacteria 5693
135 Ga0081539_10039994 3300005985 Bacteria 2759
136 Ga0070717_10005931 3300006028 Bacteria 8946
137 Ga0075365_10034424 3300006038 Bacteria 3271
138 Ga0075365_10082935 3300006038 Bacteria 2174
139 Ga0075365_10154602 3300006038 Bacteria 1596
140 Ga0075365_10167433 3300006038 Bacteria 1533
141 Ga0075368_10022590 3300006042 Bacteria 2395
142 Ga0075363_100010388 3300006048 Bacteria 4419
143 Ga0075363_100081410 3300006048 Bacteria 1771
144 Ga0075364_10059723 3300006051 Bacteria 2500
145 Ga0075432_10044317 3300006058 Bacteria 1560
146 Ga0070715_10072955 3300006163 Bacteria 1538
147 Ga0070716_100036868 3300006173 Bacteria 2698
148 Ga0070716_100057358 3300006173 Bacteria 2238
149 Ga0070716_100158364 3300006173 Bacteria 1464
150 Ga0075362_10087758 3300006177 Bacteria 1441
151 Ga0075367_10023705 3300006178 Bacteria 3456
152 Ga0075367_10125747 3300006178 Bacteria 1582
153 Ga0075369_10009297 3300006186 Bacteria 3813
154 Ga0075369_10040575 3300006186 Bacteria 1990
155 Ga0075369_10103099 3300006186 Bacteria 1281
156 Ga0075366_10021402 3300006195 Bacteria 3759
157 Ga0075366_10042268 3300006195 Bacteria 2698
158 Ga0075366_10065532 3300006195 Bacteria 2161
159 Ga0097621_100194874 3300006237 Bacteria 1756
160 Ga0075370_10055630 3300006353 Bacteria 2248
161 Ga0068871_100123094 3300006358 Bacteria 2193
162 Ga0068871_100195093 3300006358 Bacteria 1746
163 Ga0075436_100192550 3300006914 Bacteria 1443
164 Ga0075436_100223615 3300006914 Bacteria 1336
165 Ga0097620_100026770 3300006931 Bacteria 5785
166 Ga0099824_1006034 3300006942 Bacteria 16807
167 Ga0099824_1022602 3300006942 Bacteria 4107
168 Ga0099822_1001290 3300006943 Bacteria 28696
169 Ga0099823_1045654 3300006944 Bacteria 2911
170 Ga0075435_100269521 3300007076 Bacteria 1452
171 Ga0099794_10006306 3300007265 Bacteria 4792
172 Ga0099795_10028502 3300007788 Bacteria 1899
173 Ga0105240_10007705 3300009093 Bacteria 15579
174 Ga0105240_10013464 3300009093 Bacteria 11233
175 Ga0105240_10022611 3300009093 Bacteria 8328
176 Ga0105240_10028339 3300009093 Bacteria 7316
177 Ga0105240_10028431 3300009093 Bacteria 7304
178 Ga0105240_10038303 3300009093 Bacteria 6151
179 Ga0105240_10237054 3300009093 Bacteria 2117
180 Ga0105240_10498991 3300009093 Bacteria 1354
181 Ga0105247_10097521 3300009101 Bacteria 1875
182 Ga0105247_10108391 3300009101 Bacteria 1784
183 Ga0105241_10010762 3300009174 Bacteria 6713
184 Ga0105241_10046704 3300009174 Bacteria 3289
185 Ga0105241_10140830 3300009174 Bacteria 1963
186 Ga0105241_10178257 3300009174 Bacteria 1761
187 Ga0105242_10324093 3300009176 Bacteria 1414
188 Ga0105248_10138967 3300009177 Bacteria 2740
189 Ga0105248_10260551 3300009177 Bacteria 1952
190 Ga0105237_10004743 3300009545 Bacteria 15634
191 Ga0105237_10011260 3300009545 Bacteria 9463
192 Ga0105237_10031433 3300009545 Bacteria 5384
193 Ga0105237_10116230 3300009545 Bacteria 2668
194 Ga0105237_10122646 3300009545 Bacteria 2593
195 Ga0105237_10427450 3300009545 Bacteria 1330
196 Ga0105238_10002076 3300009551 Bacteria 20251
197 Ga0105238_10010980 3300009551 Bacteria 9108
198 Ga0105238_10011639 3300009551 Bacteria 8863
199 Ga0105238_10012649 3300009551 Bacteria 8517
200 Ga0105238_10172449 3300009551 Bacteria 2139
201 Ga0105238_10172915 3300009551 Bacteria 2136
202 Ga0105238_10232319 3300009551 Bacteria 1821
203 Ga0105239_10013891 3300010375 Bacteria 8938
204 Ga0105239_10016664 3300010375 Bacteria 8122
205 Ga0105239_10039944 3300010375 Bacteria 5140
206 Ga0105239_10040575 3300010375 Bacteria 5100
207 Ga0105239_10047131 3300010375 Bacteria 4723
208 Ga0105239_10077508 3300010375 Bacteria 3657
209 Ga0105239_10081016 3300010375 Bacteria 3572
210 Ga0105239_10119220 3300010375 Bacteria 2929
211 Ga0105239_10163948 3300010375 Bacteria 2485
212 Ga0105239_11007636 3300010375 Bacteria 958
213 Ga0105246_10061502 3300011119 Bacteria 2613
214 Ga0157373_10000801 3300013100 Bacteria 24325
215 Ga0157373_10019948 3300013100 Bacteria 4877
216 Ga0157370_10037505 3300013104 Bacteria 4698
217 Ga0157370_10156955 3300013104 Bacteria 2117
218 Ga0157370_10250270 3300013104 Bacteria 1639
219 Ga0157369_10018998 3300013105 Bacteria 7697
220 Ga0157369_10052606 3300013105 Bacteria 4406
221 Ga0157369_10065128 3300013105 Bacteria 3923
222 Ga0157369_10087630 3300013105 Bacteria 3324
223 Ga0157369_10341886 3300013105 Bacteria 1554
224 Ga0157374_10027280 3300013296 Bacteria 5148
225 Ga0163162_10501800 3300013306 Bacteria 1344
226 Ga0157372_10371637 3300013307 Bacteria 1666
227 Ga0157372_10495585 3300013307 Bacteria 1424
228 Ga0157375_10230780 3300013308 Bacteria 2010
229 Ga0157375_10293692 3300013308 Bacteria 1788
230 Ga0163163_10165115 3300014325 Bacteria 2260
231 Ga0182008_10166277 3300014497 Bacteria 1112
232 Ga0157379_10223611 3300014968 Bacteria 1706
233 Ga0157376_10182028 3300014969 Bacteria 1922
234 Ga0157376_10255422 3300014969 Bacteria 1639
235 Ga0157376_10502907 3300014969 Bacteria 1191
236 Ga0183368_1003 3300015687 Bacteria 1276390
237 Ga0214544_1000073 3300021320 Bacteria 123701
238 Ga0214544_1007210 3300021320 Bacteria 19738
239 Ga0214542_1000104 3300021321 Bacteria 112526
240 Ga0214542_1000196 3300021321 Bacteria 95225
241 Ga0214545_1000028 3300021324 Bacteria 127957
242 Ga0214545_1025379 3300021324 Bacteria 3447
243 Ga0214543_1000044 3300021327 Bacteria 158132
244 Ga0214543_1000096 3300021327 Bacteria 111598
245 Ga0213874_10007742 3300021377 Bacteria 2591
246 Ga0213876_10121308 3300021384 Bacteria 1388
247 Ga0209435_105841 3300025206 Bacteria 1378
248 Ga0209435_107683 3300025206 Bacteria 1192
249 Ga0209760_100585 3300025207 Bacteria 6376
250 Ga0209784_100709 3300025224 Bacteria 8923
251 Ga0209674_100012 3300025226 Bacteria 950162
252 Ga0209672_101666 3300025228 Bacteria 7228
253 Ga0209563_103577 3300025230 Bacteria 3173
254 Ga0207427_100156 3300025231 Bacteria 77311
255 Ga0207427_102344 3300025231 Bacteria 5195
256 Ga0209437_100147 3300025233 Bacteria 161997
257 Ga0209437_100224 3300025233 Bacteria 101515
258 Ga0209258_100049 3300025242 Bacteria 358328
259 Ga0209258_101060 3300025242 Bacteria 11992
260 Ga0207425_1026947 3300025245 Bacteria 1175
261 Ga0209646_1005630 3300025246 Bacteria 2165
262 Ga0209026_1000099 3300025250 Bacteria 161750
263 Ga0209677_101054 3300025253 Bacteria 13094
264 Ga0209677_102254 3300025253 Bacteria 7456
265 Ga0209148_1000005 3300025254 Bacteria 1806504
266 Ga0209148_1000010 3300025254 Bacteria 1265567
267 Ga0209148_1000680 3300025254 Bacteria 28419
268 Ga0209759_1001568 3300025256 Bacteria 12465
269 Ga0209759_1007024 3300025256 Bacteria 3687
270 Ga0209233_1000009 3300025261 Bacteria 1265567
271 Ga0209233_1003740 3300025261 Bacteria 5316
272 Ga0209233_1004006 3300025261 Bacteria 5103
273 Ga0209233_1006666 3300025261 Bacteria 3704
274 Ga0209233_1012488 3300025261 Bacteria 2464
275 Ga0209233_1024000 3300025261 Bacteria 1533
276 Ga0209455_1000086 3300025272 Bacteria 244650
277 Ga0209455_1002008 3300025272 Bacteria 8342
278 Ga0209455_1005197 3300025272 Bacteria 4078
279 Ga0209455_1009241 3300025272 Bacteria 2604
280 Ga0209455_1011701 3300025272 Bacteria 2146
281 Ga0209673_1004025 3300025273 Bacteria 8140
282 Ga0209130_1010280 3300025284 Bacteria 2590
283 Ga0209130_1029167 3300025284 Bacteria 1152
284 Ga0209676_1001462 3300025292 Bacteria 22110
285 Ga0209676_1003938 3300025292 Bacteria 8600
286 Ga0209676_1004689 3300025292 Bacteria 7499
287 Ga0209676_1010527 3300025292 Bacteria 3836
288 Ga0209676_1011182 3300025292 Bacteria 3648
289 Ga0209676_1011834 3300025292 Bacteria 3480
290 Ga0209676_1034383 3300025292 Bacteria 1499
291 Ga0209025_1003033 3300025294 Bacteria 16562
292 Ga0209025_1006289 3300025294 Bacteria 9284
293 Ga0209025_1052993 3300025294 Bacteria 1596
294 Ga0209564_1004691 3300025295 Bacteria 8198
295 Ga0209564_1005302 3300025295 Bacteria 7426
296 Ga0209758_1000075 3300025297 Bacteria 271585
297 Ga0209758_1000187 3300025297 Bacteria 138759
298 Ga0209758_1000482 3300025297 Bacteria 65578
299 Ga0209758_1001650 3300025297 Bacteria 25317
300 Ga0209758_1015384 3300025297 Bacteria 3966
301 Ga0209758_1016071 3300025297 Bacteria 3824
302 Ga0209758_1020409 3300025297 Bacteria 3135
303 Ga0209758_1031792 3300025297 Bacteria 2157
304 Ga0209758_1036035 3300025297 Bacteria 1939
305 Ga0209050_1002752 3300025298 Bacteria 14152
306 Ga0209256_1004202 3300025299 Bacteria 9257
307 Ga0209256_1007084 3300025299 Bacteria 5664
308 Ga0209256_1009510 3300025299 Bacteria 4250
309 Ga0209256_1011461 3300025299 Bacteria 3541
310 Ga0207426_1000160 3300025302 Bacteria 174540
311 Ga0207426_1000527 3300025302 Bacteria 55514
312 Ga0209051_1003094 3300025303 Bacteria 11224
313 Ga0209051_1048360 3300025303 Bacteria 1443
314 Ga0209257_1000652 3300025304 Bacteria 55125
315 Ga0209257_1001906 3300025304 Bacteria 22534
316 Ga0209257_1002013 3300025304 Bacteria 21724
317 Ga0209257_1002127 3300025304 Bacteria 20664
318 Ga0209257_1004808 3300025304 Bacteria 10040
319 Ga0209257_1027397 3300025304 Bacteria 1898
320 Ga0207656_10002942 3300025321 Bacteria 5811
321 Ga0207656_10023522 3300025321 Bacteria 2482
322 Ga0207653_10017591 3300025885 Bacteria 2251
323 Ga0207692_10024985 3300025898 Bacteria 2785
324 Ga0207710_10058711 3300025900 Bacteria 1740
325 Ga0207647_10000586 3300025904 Bacteria 28285
326 Ga0207647_10001777 3300025904 Bacteria 16548
327 Ga0207647_10011712 3300025904 Bacteria 6138
328 Ga0207685_10060982 3300025905 Bacteria 1494
329 Ga0207699_10001145 3300025906 Bacteria 12548
330 Ga0207699_10012170 3300025906 Bacteria 4370
331 Ga0207699_10024297 3300025906 Bacteria 3312
332 Ga0207643_10008582 3300025908 Bacteria 5481
333 Ga0207705_10192254 3300025909 Bacteria 1544
334 Ga0207684_10273034 3300025910 Bacteria 1459
335 Ga0207654_10000136 3300025911 Bacteria 47311
336 Ga0207654_10087335 3300025911 Bacteria 1892
337 Ga0207654_10120095 3300025911 Bacteria 1649
338 Ga0207707_10001642 3300025912 Bacteria 20636
339 Ga0207707_10007605 3300025912 Bacteria 9443
340 Ga0207707_10223821 3300025912 Bacteria 1638
341 Ga0207695_10000029 3300025913 Bacteria 548364
342 Ga0207695_10002311 3300025913 Bacteria 28436
343 Ga0207695_10011572 3300025913 Bacteria 10672
344 Ga0207695_10075771 3300025913 Bacteria 3422
345 Ga0207695_10133917 3300025913 Bacteria 2433
346 Ga0207695_10273781 3300025913 Bacteria 1583
347 Ga0207695_10470794 3300025913 Bacteria 1139
348 Ga0207671_10003843 3300025914 Bacteria 14693
349 Ga0207671_10007380 3300025914 Bacteria 9548
350 Ga0207693_10001764 3300025915 Bacteria 18977
351 Ga0207693_10005866 3300025915 Bacteria 10193
352 Ga0207693_10049791 3300025915 Bacteria 3290
353 Ga0207693_10128070 3300025915 Bacteria 1996
354 Ga0207663_10006336 3300025916 Bacteria 6047
355 Ga0207663_10035891 3300025916 Bacteria 2978
356 Ga0207663_10045043 3300025916 Bacteria 2711
357 Ga0207660_10025057 3300025917 Bacteria 4046
358 Ga0207660_10048220 3300025917 Bacteria 3014
359 Ga0207660_10084741 3300025917 Bacteria 2336
360 Ga0207657_10006868 3300025919 Bacteria 11742
361 Ga0207657_10022746 3300025919 Bacteria 5854
362 Ga0207657_10195815 3300025919 Bacteria 1628
363 Ga0207649_10137710 3300025920 Bacteria 1666
364 Ga0207652_10006786 3300025921 Bacteria 9230
365 Ga0207652_10012536 3300025921 Bacteria 6852
366 Ga0207652_10295227 3300025921 Bacteria 1462
367 Ga0207681_10072592 3300025923 Bacteria 2404
368 Ga0207694_10000135 3300025924 Bacteria 75715
369 Ga0207694_10014853 3300025924 Bacteria 5873
370 Ga0207694_10027086 3300025924 Bacteria 4364
371 Ga0207694_10114340 3300025924 Bacteria 2149
372 Ga0207694_10161114 3300025924 Bacteria 1812
373 Ga0207700_10017875 3300025928 Bacteria 4747
374 Ga0207700_10228653 3300025928 Bacteria 1580
375 Ga0207664_10415534 3300025929 Bacteria 1198
376 Ga0207709_10356375 3300025935 Bacteria 1106
377 Ga0207670_10009585 3300025936 Bacteria 5532
378 Ga0207665_10004976 3300025939 Bacteria 8868
379 Ga0207665_10009679 3300025939 Bacteria 6329
380 Ga0207711_10080269 3300025941 Bacteria 2849
381 Ga0207711_10268516 3300025941 Bacteria 1569
382 Ga0207689_10083658 3300025942 Bacteria 2623
383 Ga0207661_10007779 3300025944 Bacteria 7633
384 Ga0207661_10029064 3300025944 Bacteria 4242
385 Ga0207661_10099615 3300025944 Bacteria 2437
386 Ga0207667_10018495 3300025949 Bacteria 7812
387 Ga0207667_10019153 3300025949 Bacteria 7654
388 Ga0207667_10086526 3300025949 Bacteria 3243
389 Ga0207651_10209562 3300025960 Bacteria 1568
390 Ga0207668_10012810 3300025972 Bacteria 5145
391 Ga0207668_10078657 3300025972 Bacteria 2382
392 Ga0207640_10003325 3300025981 Bacteria 8660
393 Ga0207640_10007395 3300025981 Bacteria 6061
394 Ga0207640_10334687 3300025981 Bacteria 1210
395 Ga0207658_10000068 3300025986 Bacteria 113745
396 Ga0207639_10011442 3300026041 Bacteria 6164
397 Ga0207639_10023493 3300026041 Bacteria 4453
398 Ga0207639_10025712 3300026041 Bacteria 4271
399 Ga0207639_10107556 3300026041 Bacteria 2266
400 Ga0207639_10156665 3300026041 Bacteria 1914
401 Ga0207639_10178821 3300026041 Bacteria 1803
402 Ga0207678_10010017 3300026067 Bacteria 8317
403 Ga0207678_10027242 3300026067 Bacteria 4983
404 Ga0207678_10031917 3300026067 Bacteria 4592
405 Ga0207678_10164964 3300026067 Bacteria 1892
406 Ga0207678_10178056 3300026067 Bacteria 1816
407 Ga0207678_10220533 3300026067 Bacteria 1623
408 Ga0207678_10259994 3300026067 Bacteria 1488
409 Ga0207708_10196166 3300026075 Bacteria 1609
410 Ga0207702_10000026 3300026078 Bacteria 186067
411 Ga0207702_10000334 3300026078 Bacteria 54042
412 Ga0207702_10013080 3300026078 Bacteria 6900
413 Ga0207702_10161086 3300026078 Bacteria 2049
414 Ga0207641_10000074 3300026088 Bacteria 145908
415 Ga0207641_10040878 3300026088 Bacteria 3885
416 Ga0207676_10123226 3300026095 Bacteria 2190
417 Ga0207676_10128917 3300026095 Bacteria 2147
418 Ga0207674_10007361 3300026116 Bacteria 12820
419 Ga0207674_10013128 3300026116 Bacteria 9219
420 Ga0207674_10016608 3300026116 Bacteria 8049
421 Ga0207674_10137426 3300026116 Bacteria 2405
422 Ga0207675_100038699 3300026118 Bacteria 4450
423 Ga0207683_10106473 3300026121 Bacteria 2507
424 Ga0207683_10340240 3300026121 Bacteria 1376
425 Ga0207683_10397199 3300026121 Bacteria 1268
426 Ga0207698_10019685 3300026142 Bacteria 4626
427 Ga0207698_10053737 3300026142 Bacteria 3094
428 Ga0207698_10140431 3300026142 Bacteria 2080
429 Ga0209389_1000003 3300027296 Bacteria 268927
430 Ga0209389_1000365 3300027296 Bacteria 27120
431 Ga0209589_1000004 3300027357 Bacteria 578529
432 Ga0209589_1003813 3300027357 Bacteria 26265
433 Ga0209489_100004 3300027361 Bacteria 578529
434 Ga0209489_100022 3300027361 Bacteria 202016
435 Ga0209489_100498 3300027361 Bacteria 73687
436 Ga0209700_100004 3300027363 Bacteria 578529
437 Ga0209700_100023 3300027363 Bacteria 229662
438 Ga0209179_1005710 3300027512 Bacteria 1965
439 Ga0209813_10008418 3300027866 Bacteria 2605
440 Ga0268266_10116479 3300028379 Bacteria 2373
441 Ga0268266_10134134 3300028379 Bacteria 2217
442 Ga0268266_10269747 3300028379 Bacteria 1579
443 Ga0268266_10272143 3300028379 Bacteria 1572
444 Ga0268266_10427907 3300028379 Bacteria 1255
445 Ga0268265_10253428 3300028380 Bacteria 1560
446 Ga0268264_10000020 3300028381 Bacteria 483593
447 Ga0268264_10018779 3300028381 Bacteria 5653
448 Ga0265323_10001786 3300028653 Bacteria 10211
449 Ga0265336_10001310 3300028666 Bacteria 11611
450 Ga0307517_10027736 3300028786 Bacteria 6785
451 Ga0307515_10035428 3300028794 Bacteria 8119
452 Ga0265338_10000013 3300028800 Bacteria 379065
453 Ga0307511_10033076 3300030521 Bacteria 4574
454 Ga0265340_10012398 3300031247 Bacteria 4503
455 Ga0265339_10008262 3300031249 Bacteria 6632
456 Ga0265339_10050216 3300031249 Bacteria 2281
457 Ga0265331_10039190 3300031250 Bacteria 2312
458 Ga0265331_10113786 3300031250 Bacteria 1240
459 Ga0307513_10277813 3300031456 Bacteria 1454
460 Ga0307408_100020620 3300031548 Bacteria 4452
461 Ga0307508_10000419 3300031616 Bacteria 50420
462 Ga0307508_10043572 3300031616 Bacteria 4020
463 Ga0307508_10135882 3300031616 Bacteria 2062
464 Ga0316575_10012581 3300031665 Bacteria 3151
465 Ga0265314_10003890 3300031711 Bacteria 14201
466 Ga0265314_10028507 3300031711 Bacteria 4162
467 Ga0265314_10170254 3300031711 Bacteria 1316
468 Ga0265342_10013315 3300031712 Bacteria 5527
469 Ga0265342_10116622 3300031712 Bacteria 1507
470 Ga0316578_10172332 3300031728 Bacteria 1304
471 Ga0307516_10062970 3300031730 Bacteria 3592
472 Ga0307516_10129607 3300031730 Bacteria 2303
473 Ga0307413_10430879 3300031824 Bacteria 1041
474 Ga0307406_10464960 3300031901 Bacteria 1018
475 Ga0307416_100345553 3300032002 Bacteria 1503
476 Ga0307510_10015138 3300033180 Bacteria 9117
477 Ga0307510_10031597 3300033180 Bacteria 5979
478 Ga0307510_10249336 3300033180 Bacteria 1264
479 Ga0315911_1000014 3300033442 Bacteria 207605
480 Ga0373926_0038401 3300035083 Bacteria 1705
481 Ga0373934_0099482 3300035086 Bacteria 1176
482 Ga0373923_0004573 3300035111 Bacteria 4603
483 Ga0373945_0066435 3300035116 Bacteria 1356
484 Ga0373953_0007862 3300035117 Bacteria 3594
485 Ga0373953_0008978 3300035117 Bacteria 3417
486 Ga0373954_0044140 3300035118 Bacteria 2079
487 Ga0373956_0043097 3300035119 Bacteria 2008
488 Ga0373957_0025990 3300035120 Bacteria 2114
489 Ga0373957_0031719 3300035120 Bacteria 1943
490 Ga0373943_0102771 3300035170 Bacteria 1497
491 Ga0373955_0047370 3300035172 Bacteria 2327
492 Ga0373955_0225370 3300035172 Bacteria 1120
493 Ga0316574_0000500 3300035398 Bacteria 15901
494 Ga0373924_0025186 3300035410 Bacteria 2351
495 Ga0373931_0005209 3300035691 Bacteria 5998
496 Ga0373935_0001026 3300035692 Bacteria 15187
497 Ga0373935_0067145 3300035692 Bacteria 2305
498 Ga0373935_0140324 3300035692 Bacteria 1632
499 Ga0373927_0021479 3300035695 Bacteria 4231
500 Ga0373927_0055143 3300035695 Bacteria 2570
501 Ga0373927_0074287 3300035695 Bacteria 2201
502 Ga0373927_0103441 3300035695 Bacteria 1853
503 Ga0373933_0000631 3300035724 Bacteria 21995
504 Ga0373933_0027843 3300035724 Bacteria 3258
505 Ga0373933_0255814 3300035724 Bacteria 1128
506 Ga0373947_0129732 3300035725 Bacteria 1608
507 Ga0373947_0291588 3300035725 Bacteria 1086
508 Ga0373937_0626563 3300036401 Bacteria 1021
509 Ga0372808_011507 3300036459 Bacteria 1252
510 Ga0373925_0032857 3300037068 Bacteria 3821
511 Ga0373925_0037551 3300037068 Bacteria 3577
512 Ga0373925_0067129 3300037068 Bacteria 2705
513 Ga0373925_0158442 3300037068 Bacteria 1782
514 Ga0395900_0014369 3300037418 Bacteria 8082
515 Ga0395900_0364388 3300037418 Bacteria 1416
516 Ga0395898_0010290 3300037466 Bacteria 9790
517 Ga0395898_0472182 3300037466 Bacteria 1194
518 Ga0395898_0669162 3300037466 Bacteria 980
519 Ga0395905_0117070 3300037471 Bacteria 2504
520 Ga0395905_0163570 3300037471 Bacteria 2091
521 Ga0395905_0328988 3300037471 Bacteria 1418
522 Ga0436364_0525954 3300037853 Bacteria 904
523 Ga0395901_0019804 3300038443 Bacteria 6882
524 Ga0395901_0243240 3300038443 Bacteria 1876
525 Ga0395901_0344679 3300038443 Bacteria 1539
526 Ga0395901_0447416 3300038443 Bacteria 1322
527 Ga0436365_0260840 3300039437 Bacteria 28419
528 Ga0436365_0385088 3300039437 Bacteria 1355
529 Ga0436365_1204968 3300039437 Bacteria 2267
530 Ga0436365_1207416 3300039437 Bacteria 1588
531 Ga0436360_0030607 3300039438 Bacteria 1506
532 Ga0436361_0560308 3300039447 Bacteria 2274
533 Ga0436361_1156995 3300039447 Bacteria 2486
534 Ga0436363_0604370 3300039450 Bacteria 2439
535 Ga0436363_1032871 3300039450 Bacteria 2653
536 Ga0436363_1645002 3300039450 Bacteria 3999
537 Ga0436362_0119752 3300039453 Bacteria 1955
538 Ga0436362_0907410 3300039453 Bacteria 1871
539 Ga0439465_0021447 3300041413 Bacteria 2025
540 Ga0451798_1041797 3300041458 Bacteria 1094
541 Ga0439452_009623 3300042010 Bacteria 2841
542 Ga0466972_0001189 3300044658 Bacteria 12505
543 Ga0466972_0199477 3300044658 Bacteria 937
544 Ga0466965_0135663 3300044683 Bacteria 1278
545 Ga0466966_0001683 3300044684 Bacteria 14266
546 Ga0466966_0049627 3300044684 Bacteria 2673
547 Ga0466966_0131705 3300044684 Bacteria 1531
548 Ga0466961_0000084 3300044693 Bacteria 58908
549 Ga0466963_0134187 3300044694 Bacteria 1712
550 Ga0466963_0182671 3300044694 Bacteria 1465
551 Ga0466963_0295189 3300044694 Bacteria 1140
552 Ga0466968_0053255 3300044735 Bacteria 1733
553 Ga0466957_0392658 3300044842 Bacteria 948
554 Ga0466960_0013508 3300044901 Bacteria 3472
555 Ga0466960_0125366 3300044901 Bacteria 1349
556 Ga0466959_0002035 3300045049 Bacteria 12774
557 Ga0466959_0079518 3300045049 Bacteria 2364
558 Ga0495592_0070595 3300046454 Bacteria 2544
559 Ga0495592_0095183 3300046454 Bacteria 2130
560 Ga0495603_0006560 3300046455 Bacteria 6983
561 Ga0495603_0019060 3300046455 Bacteria 4155
562 Ga0495603_0043319 3300046455 Bacteria 2688
563 Ga0495590_0001803 3300046457 Bacteria 9079
564 Ga0495629_0008449 3300046459 Bacteria 7579
565 Ga0495629_0050927 3300046459 Bacteria 2899
566 Ga0495629_0192999 3300046459 Bacteria 1409
567 Ga0495638_0000607 3300046460 Bacteria 40083
568 Ga0495638_0002596 3300046460 Bacteria 14582
569 Ga0495638_0008098 3300046460 Bacteria 7474
570 Ga0495638_0023075 3300046460 Bacteria 4075
571 Ga0495641_0013759 3300046461 Bacteria 4421
572 Ga0495651_0303722 3300046462 Bacteria 1069
573 Ga0495650_0000337 3300046471 Bacteria 83530
574 Ga0495650_0002809 3300046471 Bacteria 13365
575 Ga0495650_0024475 3300046471 Bacteria 2850
576 Ga0495580_0009943 3300046472 Bacteria 7444
577 Ga0495582_0004249 3300046473 Bacteria 8054
578 Ga0495639_0001631 3300046475 Bacteria 10005
579 Ga0495639_0063123 3300046475 Bacteria 1700
580 Ga0495662_0008011 3300046476 Bacteria 5203
581 Ga0495664_0040432 3300046477 Bacteria 2757
582 Ga0495664_0062486 3300046477 Bacteria 2218
583 Ga0495594_0001269 3300046499 Bacteria 13192
584 Ga0495594_0107978 3300046499 Bacteria 1568
585 Ga0495596_0137897 3300046500 Bacteria 947
586 Ga0495583_0043305 3300046506 Bacteria 2097
587 Ga0495606_0000401 3300046507 Bacteria 73149
588 Ga0495606_0001096 3300046507 Bacteria 38817
589 Ga0495606_0199117 3300046507 Bacteria 1143
590 Ga0495608_0353570 3300046511 Bacteria 904
591 Ga0495610_0013500 3300046512 Bacteria 4851
592 Ga0495610_0054907 3300046512 Bacteria 1923
593 Ga0495618_0014515 3300046514 Bacteria 4801
594 Ga0495618_0080762 3300046514 Bacteria 2075
595 Ga0495620_0091015 3300046515 Bacteria 1224
596 Ga0495628_0163021 3300046516 Bacteria 1693
597 Ga0495628_0225330 3300046516 Bacteria 1407
598 Ga0495630_0055028 3300046517 Bacteria 2981
599 Ga0495630_0056773 3300046517 Bacteria 2933
600 Ga0495631_0002173 3300046518 Bacteria 11316
601 Ga0495632_0082351 3300046519 Bacteria 1534
602 Ga0495632_0110116 3300046519 Bacteria 1293
603 Ga0495637_0092392 3300046520 Bacteria 1192
604 Ga0495643_0091940 3300046522 Bacteria 1564
605 Ga0495648_0008195 3300046524 Bacteria 8245
606 Ga0495648_0029614 3300046524 Bacteria 3631
607 Ga0495648_0049853 3300046524 Bacteria 2563
608 Ga0495648_0100072 3300046524 Bacteria 1602
609 Ga0495663_0053697 3300046525 Bacteria 1253
610 Ga0495652_0033765 3300046529 Bacteria 4463
611 Ga0495652_0068069 3300046529 Bacteria 2984
612 Ga0495652_0076737 3300046529 Bacteria 2771
613 Ga0495654_0012605 3300046530 Bacteria 4539
614 Ga0495654_0017015 3300046530 Bacteria 3829
615 Ga0495654_0135061 3300046530 Bacteria 1104
616 Ga0495665_0001884 3300046531 Bacteria 11332
617 Ga0495665_0041435 3300046531 Bacteria 2451
618 Ga0495640_0049976 3300046533 Bacteria 2881
619 Ga0495640_0115599 3300046533 Bacteria 1748
620 Ga0495587_0010826 3300046536 Bacteria 5790
621 Ga0495587_0156786 3300046536 Bacteria 1296
622 Ga0495598_0036538 3300046537 Bacteria 1412
623 Ga0495609_0111457 3300046538 Bacteria 1181
624 Ga0495597_0078505 3300046542 Bacteria 1414
625 Ga0495645_0030368 3300046543 Bacteria 3935
626 Ga0495645_0038734 3300046543 Bacteria 3477
627 Ga0495622_0039639 3300046557 Bacteria 2193
628 Ga0495622_0044786 3300046557 Bacteria 2056
629 Ga0495622_0139720 3300046557 Bacteria 1100
630 Ga0495633_0001837 3300046558 Bacteria 15600
631 Ga0495667_0017299 3300046559 Bacteria 4870
632 Ga0495667_0197906 3300046559 Bacteria 1286
633 Ga0495668_0002966 3300046616 Bacteria 13310
634 Ga0495668_0069829 3300046616 Bacteria 1931
635 Ga0495668_0280350 3300046616 Bacteria 913
636 Ga0495634_0010587 3300046642 Bacteria 6753
637 Ga0495611_0005006 3300046648 Bacteria 5678
638 Ga0495625_0028749 3300046660 Bacteria 4164
639 Ga0495635_0015901 3300046663 Bacteria 5256
640 Ga0495635_0036927 3300046663 Bacteria 3383
641 Ga0495635_0063109 3300046663 Bacteria 2544
642 Ga0495635_0082411 3300046663 Bacteria 2201
643 Ga0495588_0004512 3300046674 Bacteria 6155
644 Ga0495588_0058437 3300046674 Bacteria 1994
645 Ga0495657_0070096 3300046675 Bacteria 2291
646 Ga0495657_0074074 3300046675 Bacteria 2216
647 Ga0495599_0129243 3300046678 Bacteria 1569
648 Ga0495646_0198350 3300046680 Bacteria 1094
649 Ga0495647_0025999 3300046681 Bacteria 2142
650 Ga0495658_0011741 3300046683 Bacteria 4415
651 Ga0495658_0186725 3300046683 Bacteria 1287
652 Ga0495613_0009118 3300046689 Bacteria 7356
653 Ga0495613_0287713 3300046689 Bacteria 1140
654 Ga0495624_0008474 3300046690 Bacteria 7166
655 Ga0495624_0215827 3300046690 Bacteria 1163
656 Ga0495649_0001571 3300046694 Bacteria 17089
657 Ga0495589_0158552 3300046794 Bacteria 1078
658 Ga0495600_0016852 3300046809 Bacteria 4644
659 Ga0495600_0230689 3300046809 Bacteria 1182
660 Ga0495581_0012281 3300047315 Bacteria 4960
661 Ga0495581_0095930 3300047315 Bacteria 1722
662 Ga0495581_0250424 3300047315 Bacteria 1036
663 Ga0495604_0031622 3300047317 Bacteria 4197
664 Ga0495674_0003482 3300047319 Bacteria 15299
665 Ga0495674_0135975 3300047319 Bacteria 2068
666 Ga0495672_0002709 3300047320 Bacteria 15894
667 Ga0495672_0017857 3300047320 Bacteria 4732
668 Ga0495672_0092772 3300047320 Bacteria 1655
669 Ga0495676_0074454 3300047321 Bacteria 2600
670 Ga0495676_0114136 3300047321 Bacteria 1977
671 Ga0495680_0025271 3300047322 Bacteria 4918
672 Ga0495680_0077191 3300047322 Bacteria 2523
673 Ga0495680_0114293 3300047322 Bacteria 1998
674 Ga0495687_012621 3300047443 Bacteria 4454
675 Ga0495675_0185101 3300047444 Bacteria 1273
676 Ga0495675_0209844 3300047444 Bacteria 1183
677 Ga0495673_0088746 3300047469 Bacteria 1267
678 Ga0495681_0046405 3300047470 Bacteria 2072
679 Ga0495684_0011768 3300047471 Bacteria 6751
680 Ga0495684_0035799 3300047471 Bacteria 3806
681 Ga0495684_0073531 3300047471 Bacteria 2597
682 Ga0495686_0004342 3300047472 Bacteria 11710
683 Ga0495686_0031272 3300047472 Bacteria 3453
684 Ga0495593_0004676 3300047673 Bacteria 8141
685 Ga0495593_0144056 3300047673 Bacteria 1206
686 Ga0495602_0109798 3300048088 Bacteria 2243
687 Ga0495602_0153540 3300048088 Bacteria 1806
688 Ga0495602_0157399 3300048088 Bacteria 1777
689 Ga0495615_0079342 3300048090 Bacteria 898
690 Ga0496101_0203576 3300048904 Bacteria 1531
691 Ga0496102_0082886 3300048905 Bacteria 2958
692 Ga0496102_0204050 3300048905 Bacteria 1863
693 Ga0496102_0413430 3300048905 Bacteria 1267
694 Ga0496103_0032897 3300048906 Bacteria 3166
695 Ga0496104_0080773 3300048907 Bacteria 3100
696 Ga0496104_0099795 3300048907 Bacteria 2779
697 Ga0496104_0319851 3300048907 Bacteria 1465
698 Ga0496105_0077006 3300048908 Bacteria 2754
699 Ga0496105_0167789 3300048908 Bacteria 1800
700 Ga0496106_0000790 3300048909 Bacteria 22889
701 Ga0496107_0315886 3300048910 Bacteria 1163
702 Ga0496108_0214432 3300048911 Bacteria 1672
703 Ga0496108_0235532 3300048911 Bacteria 1592
704 Ga0496108_0274322 3300048911 Bacteria 1468
705 Ga0496109_0015593 3300048912 Bacteria 6628
706 Ga0496109_0151473 3300048912 Bacteria 2171
707 Ga0496109_0246168 3300048912 Bacteria 1683
708 Ga0496109_0618547 3300048912 Bacteria 1019
709 Ga0496110_0169397 3300048913 Bacteria 1981
710 Ga0496111_0051321 3300048914 Bacteria 2977
711 Ga0496111_0053939 3300048914 Bacteria 2905
712 Ga0496112_0000008 3300048915 Bacteria 310323
713 Ga0496112_0015024 3300048915 Bacteria 7208
714 Ga0496112_0039667 3300048915 Bacteria 4603
715 Ga0496112_0254388 3300048915 Bacteria 1707
716 Ga0496113_0002731 3300048916 Bacteria 10367
717 Ga0496113_0018344 3300048916 Bacteria 4871
718 Ga0496114_0059427 3300048917 Bacteria 3194
719 Ga0496114_0238993 3300048917 Bacteria 1597
720 Ga0496114_0405843 3300048917 Bacteria 1207
721 Ga0496114_0408694 3300048917 Bacteria 1202
722 Ga0496115_0000182 3300048918 Bacteria 58480
723 Ga0496115_0000503 3300048918 Bacteria 30610
724 Ga0496115_0123259 3300048918 Bacteria 2133
725 Ga0496115_0163009 3300048918 Bacteria 1843
726 Ga0496115_0254346 3300048918 Bacteria 1445
727 Ga0496115_0254856 3300048918 Bacteria 1444
728 Ga0496115_0274765 3300048918 Bacteria 1384
729 Ga0496115_0339463 3300048918 Bacteria 1226
730 Ga0496116_0019933 3300048919 Bacteria 5114
731 Ga0496117_0080969 3300048920 Bacteria 2133
732 Ga0496117_0161793 3300048920 Bacteria 1310
733 Ga0496117_0162717 3300048920 Bacteria 1305
734 Ga0496118_0011291 3300048921 Bacteria 8736
735 Ga0496118_0012803 3300048921 Bacteria 8007
736 Ga0496118_0021505 3300048921 Bacteria 5673
737 Ga0496118_0023093 3300048921 Bacteria 5415
738 Ga0496118_0035179 3300048921 Bacteria 4072
739 Ga0496118_0081149 3300048921 Bacteria 2278
740 Ga0496119_0064564 3300048922 Bacteria 2173
741 Ga0496119_0095487 3300048922 Bacteria 1679
742 Ga0496119_0120355 3300048922 Bacteria 1444
743 Ga0496120_0136034 3300048923 Bacteria 1253
744 Ga0496121_0000774 3300048924 Bacteria 58528
745 Ga0496121_0001681 3300048924 Bacteria 36391
746 Ga0496121_0003198 3300048924 Bacteria 23590
747 Ga0496121_0004204 3300048924 Bacteria 19648
748 Ga0496121_0020289 3300048924 Bacteria 6588
749 Ga0496121_0049511 3300048924 Bacteria 3562
750 Ga0496121_0061247 3300048924 Bacteria 3089
751 Ga0496121_0075015 3300048924 Bacteria 2703
752 Ga0496121_0076458 3300048924 Bacteria 2669
753 Ga0496121_0085056 3300048924 Bacteria 2491
754 Ga0496121_0161089 3300048924 Bacteria 1640
755 Ga0496121_0231594 3300048924 Bacteria 1293
756 Ga0496121_0266137 3300048924 Bacteria 1181
757 Ga0496121_0292714 3300048924 Bacteria 1108
758 Ga0496122_0004199 3300048925 Bacteria 18120
759 Ga0496122_0020976 3300048925 Bacteria 5870
760 Ga0496122_0076193 3300048925 Bacteria 2361
761 Ga0496123_0012131 3300048926 Bacteria 7381
762 Ga0496123_0015113 3300048926 Bacteria 6351
763 Ga0496123_0067660 3300048926 Bacteria 2254
764 Ga0496124_0002423 3300048927 Bacteria 24474
765 Ga0496124_0292724 3300048927 Bacteria 1181
766 Ga0496125_0001052 3300048928 Bacteria 42645
767 Ga0496125_0012360 3300048928 Bacteria 8481
768 Ga0496125_0014815 3300048928 Bacteria 7573
769 Ga0496125_0015380 3300048928 Bacteria 7405
770 Ga0496125_0027633 3300048928 Bacteria 5139
771 Ga0496125_0089784 3300048928 Bacteria 2309
772 Ga0496126_0002928 3300048929 Bacteria 22201
773 Ga0496126_0007386 3300048929 Bacteria 12053
774 Ga0496126_0016425 3300048929 Bacteria 7402
775 Ga0496126_0018165 3300048929 Bacteria 6977
776 Ga0496126_0018440 3300048929 Bacteria 6914
777 Ga0496126_0074838 3300048929 Bacteria 3007
778 Ga0496126_0110874 3300048929 Bacteria 2390
779 Ga0496126_0172532 3300048929 Bacteria 1841
780 Ga0496126_0175038 3300048929 Bacteria 1826
781 Ga0496126_0255043 3300048929 Bacteria 1460
782 Ga0496126_0316652 3300048929 Bacteria 1283
783 Ga0496126_0402734 3300048929 Bacteria 1109
784 Ga0496126_0479714 3300048929 Bacteria 996
785 Ga0495678_000397 3300049459 Bacteria 43960
786 Ga0495682_0041853 3300049460 Bacteria 1679
787 Ga0495682_0056874 3300049460 Bacteria 1417
788 Ga0501031_0012411 3300049568 Bacteria 5557
789 Ga0501031_0166768 3300049568 Bacteria 1439
790 Ga0501031_0196295 3300049568 Bacteria 1317
791 Ga0501032_0000683 3300049569 Bacteria 27581
792 Ga0501032_0021357 3300049569 Bacteria 4500
793 Ga0501032_0025241 3300049569 Bacteria 4097
794 Ga0501032_0044830 3300049569 Bacteria 2992
795 Ga0501032_0149285 3300049569 Bacteria 1537
796 Ga0501033_0000645 3300049570 Bacteria 32274
797 Ga0501033_0041465 3300049570 Bacteria 3434
798 Ga0501033_0043903 3300049570 Bacteria 3328
799 Ga0501033_0128242 3300049570 Bacteria 1839
800 Ga0501033_0257586 3300049570 Bacteria 1235
801 Ga0501034_0004310 3300049571 Bacteria 15861
802 Ga0501034_0012439 3300049571 Bacteria 8790
803 Ga0501034_0018499 3300049571 Bacteria 7143
804 Ga0501034_0315596 3300049571 Bacteria 1497
805 Ga0501034_0432597 3300049571 Bacteria 1235
806 Ga0501034_0456263 3300049571 Bacteria 1195
807 Ga0501036_0002022 3300049572 Bacteria 15776
808 Ga0501036_0175017 3300049572 Bacteria 1807
809 Ga0501037_0000484 3300049573 Bacteria 32262
810 Ga0501037_0043321 3300049573 Bacteria 3308
811 Ga0501037_0064760 3300049573 Bacteria 2663
812 Ga0501037_0076969 3300049573 Bacteria 2421
813 Ga0501038_0003716 3300049574 Bacteria 14216
814 Ga0501038_0012105 3300049574 Bacteria 7879
815 Ga0501038_0374584 3300049574 Bacteria 1105
816 Ga0501039_0001484 3300049575 Bacteria 17245
817 Ga0501039_0058706 3300049575 Bacteria 2980
818 Ga0501039_0091357 3300049575 Bacteria 2373
819 Ga0501039_0136704 3300049575 Bacteria 1924
820 Ga0501043_0000593 3300049579 Bacteria 32115
821 Ga0501043_0005035 3300049579 Bacteria 10690
822 Ga0501043_0051221 3300049579 Bacteria 3244
823 Ga0501043_0078301 3300049579 Bacteria 2597
824 Ga0501043_0088763 3300049579 Bacteria 2430
825 Ga0501046_0000499 3300049580 Bacteria 39177
826 Ga0501046_0046091 3300049580 Bacteria 3461
827 Ga0501046_0049205 3300049580 Bacteria 3335
828 Ga0501046_0055557 3300049580 Bacteria 3110
829 Ga0501046_0139669 3300049580 Bacteria 1834
830 Ga0501046_0235020 3300049580 Bacteria 1353
831 Ga0501047_0001042 3300049581 Bacteria 27709
832 Ga0501047_0204652 3300049581 Bacteria 1833
833 Ga0501047_0487877 3300049581 Bacteria 1059
834 Ga0501048_0029959 3300049582 Bacteria 3942
835 Ga0501048_0081143 3300049582 Bacteria 2288
836 Ga0501048_0221807 3300049582 Bacteria 1341
837 Ga0501067_0003275 3300049583 Bacteria 8916
838 Ga0501068_0004322 3300049584 Bacteria 7720
839 Ga0501068_0102770 3300049584 Bacteria 1772
840 Ga0501069_0002891 3300049585 Bacteria 8818
841 Ga0501070_0000773 3300049586 Bacteria 29138
842 Ga0501070_0126861 3300049586 Bacteria 2108
843 Ga0501073_0009539 3300049589 Bacteria 7161
844 Ga0501073_0010870 3300049589 Bacteria 6665
845 Ga0501073_0041356 3300049589 Bacteria 3257
846 Ga0501073_0155097 3300049589 Bacteria 1587
847 Ga0501073_0158622 3300049589 Bacteria 1568
848 Ga0501074_0015366 3300049590 Bacteria 5565
849 Ga0501074_0086189 3300049590 Bacteria 2250
850 Ga0501076_0173607 3300049592 Bacteria 1757
851 Ga0501223_033078 3300049663 Bacteria 1005
852 Ga0501224_015249 3300049664 Bacteria 1139
853 Ga0501249_000124 3300049679 Bacteria 23746
854 Ga0501249_000246 3300049679 Bacteria 16076
855 Ga0501079_0046250 3300049741 Bacteria 3358
856 Ga0501079_0335621 3300049741 Bacteria 1184
857 Ga0501080_0000326 3300049742 Bacteria 36467
858 Ga0501080_0130087 3300049742 Bacteria 2330
859 Ga0501035_0009126 3300049822 Bacteria 9221
860 Ga0501035_0136964 3300049822 Bacteria 2131
861 Ga0501035_0174477 3300049822 Bacteria 1855
862 Ga0501035_0292098 3300049822 Bacteria 1375
863 Ga0501044_0003564 3300049823 Bacteria 17514
864 Ga0501044_0006626 3300049823 Bacteria 12773
865 Ga0501044_0373593 3300049823 Bacteria 1342
866 Ga0501044_0475838 3300049823 Bacteria 1153
867 Ga0501045_0448897 3300049824 Bacteria 959
868 Ga0501204_005645 3300049850 Bacteria 1378
869 nmdc:mga03683_134383_c1 3300050489 Bacteria 1109
870 nmdc:mga03n38_154959_c1 3300050490 Bacteria 1156
871 nmdc:mga03n38_32318_c1 3300050490 Bacteria 2216
872 nmdc:mga00v17_177787_c1 3300050491 Bacteria 1373
873 nmdc:mga00v17_76850_c1 3300050491 Bacteria 2078
874 nmdc:mga0yw44_11896_c1 3300050492 Bacteria 4517
875 nmdc:mga0yw44_122864_c1 3300050492 Bacteria 1674
876 nmdc:mga0yw44_21958_c1 3300050492 Bacteria 3570
877 nmdc:mga0yw44_92219_c1 3300050492 Bacteria 1917
878 nmdc:mga0k408_83011_c1 3300050493 Bacteria 1878
879 nmdc:mga06z11_17981_c1 3300050494 Bacteria 3220
880 nmdc:mga04h51_14163_c1 3300050495 Bacteria 2273
881 nmdc:mga07m45_65899_c1 3300050496 Bacteria 2057
882 nmdc:mga0qj67_276810_c1 3300050509 Bacteria 1360
883 nmdc:mga0n895_46682_c1 3300050512 Bacteria 4232
884 nmdc:mga0rr50_259288_c1 3300050513 Bacteria 1446
885 nmdc:mga0sz30_16554_c1 3300050516 Bacteria 2930
886 nmdc:mga0sz30_27264_c1 3300050516 Bacteria 2346
887 nmdc:mga0sz30_28004_c1 3300050516 Bacteria 2317
888 nmdc:mga0sz30_5917_c1 3300050516 Bacteria 4513
889 Ga0495601_0024411 3300053077 Bacteria 3723
890 Ga0500635_0002397 3300053080 Bacteria 4640
891 Ga0500635_0012314 3300053080 Bacteria 2454
892 Ga0495619_0077617 3300053085 Bacteria 2231
893 Ga0495619_0156690 3300053085 Bacteria 1572
894 Ga0495619_0171841 3300053085 Bacteria 1499
895 Ga0500578_0000168 3300053086 Bacteria 78140
896 Ga0500578_0090485 3300053086 Bacteria 1942
897 Ga0500643_000060 3300053087 Bacteria 128090
898 Ga0500647_0010576 3300053091 Bacteria 4087
899 Ga0500651_0013537 3300053093 Bacteria 4972
900 Ga0500651_0086930 3300053093 Bacteria 1930
901 Ga0500566_0000232 3300053094 Bacteria 29876
902 Ga0500566_0000433 3300053094 Bacteria 23328
903 Ga0500566_0000445 3300053094 Bacteria 23074
904 Ga0500566_0197350 3300053094 Bacteria 1019
905 Ga0500641_0008597 3300053096 Bacteria 3649
906 Ga0500641_0025576 3300053096 Bacteria 2284
907 Ga0500641_0042983 3300053096 Bacteria 1833
908 Ga0500641_0128644 3300053096 Bacteria 1092
909 Ga0500650_0011541 3300053098 Bacteria 3642
910 Ga0500650_0037422 3300053098 Bacteria 2229
911 Ga0500554_043149 3300053102 Bacteria 1392
912 Ga0500555_001000 3300053103 Bacteria 9674
913 Ga0500556_0001087 3300053104 Bacteria 13707
914 Ga0500557_000007 3300053105 Bacteria 136781
915 Ga0500562_001945 3300053108 Bacteria 5180
916 Ga0500562_015370 3300053108 Bacteria 1962
917 Ga0500572_000629 3300053111 Bacteria 11778
918 Ga0500572_001647 3300053111 Bacteria 5861
919 Ga0500592_005232 3300053116 Bacteria 2062
920 Ga0500594_0000149 3300053118 Bacteria 19052
921 Ga0500595_023394 3300053119 Bacteria 2172
922 Ga0500607_059418 3300053121 Bacteria 2009
923 Ga0500614_001108 3300053123 Bacteria 6657
924 Ga0500618_013103 3300053125 Bacteria 2153
925 Ga0500642_0000026 3300053130 Bacteria 127731
926 Ga0500642_0004617 3300053130 Bacteria 4339
927 Ga0500559_0001723 3300053136 Bacteria 11997
928 Ga0500559_0002898 3300053136 Bacteria 8636
929 Ga0500559_0007012 3300053136 Bacteria 5036
930 Ga0500559_0011203 3300053136 Bacteria 3834
931 Ga0500561_0038078 3300053137 Bacteria 1255
932 Ga0500568_0002271 3300053139 Bacteria 11457
933 Ga0500573_0061914 3300053140 Bacteria 2143
934 Ga0500577_0001357 3300053142 Bacteria 6246
935 Ga0500586_004250 3300053145 Bacteria 3480
936 Ga0500590_092735 3300053148 Bacteria 1464
937 Ga0500603_001060 3300053150 Bacteria 6461
938 Ga0500603_003471 3300053150 Bacteria 3382
939 Ga0500616_0000031 3300053153 Bacteria 415013
940 Ga0500622_0000112 3300053156 Bacteria 83558
941 Ga0500622_0004242 3300053156 Bacteria 9118
942 Ga0500630_005547 3300053159 Bacteria 6167
943 Ga0500639_010254 3300053163 Bacteria 4905
944 Ga0500639_054758 3300053163 Bacteria 2071
945 Ga0500636_0003689 3300053177 Bacteria 8635
946 Ga0500636_0025996 3300053177 Bacteria 3460
947 Ga0500637_0026010 3300053178 Bacteria 3221
948 Ga0500576_014386 3300053725 Bacteria 3564
949 Ga0500625_004431 3300053729 Bacteria 5741
950 Ga0500645_049289 3300053730 Bacteria 1232
951 Ga0500609_000708 3300053731 Bacteria 5029
952 Ga0500596_001871 3300053735 Bacteria 4231
953 Ga0500596_002960 3300053735 Bacteria 3286
954 Ga0500601_000071 3300053737 Bacteria 20922
955 Ga0500601_003391 3300053737 Bacteria 1727
956 Ga0500661_000283 3300055283 Bacteria 9215
957 Ga0500661_004156 3300055283 Bacteria 2709
958 Ga0466962_0032764 3300061719 Bacteria 2487

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0525954 Ga0436364_0525954_21_830 266
2 3300049571 Ga0501034_0432597 Ga0501034_0432597_402_1211 266
3 3300049584 Ga0501068_0102770 Ga0501068_0102770_914_1723 266
4 3300013296 Ga0157374_10027280 Ga0157374_100272803 270
5 iso_pu_bacteria 2582581279 2585149631 273
6 iso_pu_bacteria 2941485952 2941488838 273
7 iso_pu_bacteria 2721755755 2723844237 275
8 3300005985 Ga0081539_10039994 Ga0081539_100399941 277
9 3300013100 Ga0157373_10000801 Ga0157373_1000080129 277
10 3300031824 Ga0307413_10430879 Ga0307413_104308792 277
11 3300046457 Ga0495590_0001803 Ga0495590_0001803_6772_7614 277
12 3300046460 Ga0495638_0000607 Ga0495638_0000607_6942_7784 277
13 3300046471 Ga0495650_0024475 Ga0495650_0024475_1778_2620 277
14 3300046512 Ga0495610_0013500 Ga0495610_0013500_3495_4337 277
15 3300046518 Ga0495631_0002173 Ga0495631_0002173_9715_10557 277
16 3300046530 Ga0495654_0012605 Ga0495654_0012605_3079_3921 277
17 3300046616 Ga0495668_0002966 Ga0495668_0002966_11130_11972 277
18 3300047472 Ga0495686_0004342 Ga0495686_0004342_7227_8069 277
19 3300048928 Ga0496125_0001052 Ga0496125_0001052_23215_24054 277
20 3300049459 Ga0495678_000397 Ga0495678_000397_35263_36105 277
21 3300053086 Ga0500578_0000168 Ga0500578_0000168_33579_34421 277
22 3300053108 Ga0500562_001945 Ga0500562_001945_4262_5104 277
23 3300053118 Ga0500594_0000149 Ga0500594_0000149_12663_13505 277
24 3300053156 Ga0500622_0004242 Ga0500622_0004242_4024_4866 277
25 3300046558 Ga0495633_0001837 Ga0495633_0001837_11014_11856 278
26 3300047444 Ga0495675_0185101 Ga0495675_0185101_414_1259 278
27 3300049571 Ga0501034_0315596 Ga0501034_0315596_406_1251 278
28 3300053140 Ga0500573_0061914 Ga0500573_0061914_605_1447 278
29 3300053148 Ga0500590_092735 Ga0500590_092735_602_1447 278
30 3300053136 Ga0500559_0011203 Ga0500559_0011203_1391_2245 279
31 iso_pu_bacteria 2857524615 2857530102 279
32 iso_pu_bacteria 2885374607 2885377221 279
33 iso_pu_bacteria 2893066018 2893071703 279
34 iso_pu_bacteria 2919073203 2919076892 279
35 iso_pu_bacteria 8003014200 8003014689 279
36 iso_pu_bacteria 2507262055 2507506346 280
37 iso_pu_bacteria 2507262055 2507510293 280
38 iso_pu_bacteria 2508501009 2508540586 280
39 iso_pu_bacteria 2508501009 2508544303 280
40 iso_pu_bacteria 2508501042 2508697756 280
41 iso_pu_bacteria 2508501128 2509154320 280
42 iso_pu_bacteria 2511231028 2511400967 280
43 iso_pu_bacteria 2513237092 2513628586 280
44 iso_pu_bacteria 2513237094 2513640304 280
45 iso_pu_bacteria 2513237095 2513648703 280
46 iso_pu_bacteria 2513237096 2513659069 280
47 iso_pu_bacteria 2513237098 2513674776 280
48 iso_pu_bacteria 2513237101 2513698050 280
49 iso_pu_bacteria 2513237102 2513706939 280
50 iso_pu_bacteria 2513237104 2513715981 280
51 iso_pu_bacteria 2513237137 2513860316 280
52 iso_pu_bacteria 2513237139 2513878627 280
53 iso_pu_bacteria 2513237141 2513893822 280
54 iso_pu_bacteria 2513237145 2513921332 280
55 iso_pu_bacteria 2513237161 2514013499 280
56 iso_pu_bacteria 2515154112 2515630512 280
57 iso_pu_bacteria 2517572143 2517894216 280
58 iso_pu_bacteria 2524023205 2524441727 280
59 iso_pu_bacteria 2524023210 2524466048 280
60 iso_pu_bacteria 2524023228 2524536064 280
61 iso_pu_bacteria 2528768022 2528855181 280
62 iso_pu_bacteria 2617270735 2617349874 280
63 iso_pu_bacteria 2617270741 2617379230 280
64 iso_pu_bacteria 2667528175 2671123526 280
65 iso_pu_bacteria 2721755755 2723847401 280
66 iso_pu_bacteria 2728368998 2728748673 280
67 iso_pu_bacteria 2744054633 2745075010 280
68 iso_pu_bacteria 2791355196 2793065803 280
69 iso_pu_bacteria 2791355197 2793071462 280
70 iso_pu_bacteria 2791355199 2793081213 280
71 iso_pu_bacteria 2802429603 2805917243 280
72 iso_pu_bacteria 2816332527 2818241881 280
73 iso_pu_bacteria 2818991467 2819720406 280
74 iso_pu_bacteria 2824600985 2824606657 280
75 iso_pu_bacteria 2824609381 2824612454 280
76 iso_pu_bacteria 2824617872 2824620995 280
77 iso_pu_bacteria 2824617872 2824621187 280
78 iso_pu_bacteria 2824626560 2824629700 280
79 iso_pu_bacteria 2824626560 2824629950 280
80 iso_pu_bacteria 2824635225 2824636309 280
81 iso_pu_bacteria 2824635225 2824637009 280
82 iso_pu_bacteria 2824644064 2824644911 280
83 iso_pu_bacteria 2824644064 2824646008 280
84 iso_pu_bacteria 2824653114 2824656863 280
85 iso_pu_bacteria 2824661429 2824664649 280
86 iso_pu_bacteria 2824671348 2824673085 280
87 iso_pu_bacteria 2824679649 2824679965 280
88 iso_pu_bacteria 2824687955 2824689727 280
89 iso_pu_bacteria 2824696289 2824698758 280
90 iso_pu_bacteria 2824704595 2824705729 280
91 iso_pu_bacteria 2824704595 2824709616 280
92 iso_pu_bacteria 2824714736 2824715202 280
93 iso_pu_bacteria 2824714736 2824717355 280
94 iso_pu_bacteria 2824723954 2824724509 280
95 iso_pu_bacteria 2824723954 2824725440 280
96 iso_pu_bacteria 2824732956 2824735390 280
97 iso_pu_bacteria 2824746037 2824749922 280
98 iso_pu_bacteria 2824753945 2824755349 280
99 iso_pu_bacteria 2824763712 2824771124 280
100 iso_pu_bacteria 2824773399 2824778415 280
101 iso_pu_bacteria 2824773399 2824781336 280
102 iso_pu_bacteria 2838122688 2838125519 280
103 iso_pu_bacteria 2841941048 2841941817 280
104 iso_pu_bacteria 2841949485 2841951247 280
105 iso_pu_bacteria 2841957949 2841959182 280
106 iso_pu_bacteria 2841966195 2841968759 280
107 iso_pu_bacteria 2841974524 2841976042 280
108 iso_pu_bacteria 2841983080 2841989102 280
109 iso_pu_bacteria 2842038055 2842045228 280
110 iso_pu_bacteria 2842045827 2842049110 280
111 iso_pu_bacteria 2842775625 2842779617 280
112 iso_pu_bacteria 2844315083 2844317447 280
113 iso_pu_bacteria 2847930680 2847934232 280
114 iso_pu_bacteria 2847939898 2847944818 280
115 iso_pu_bacteria 2849076700 2849080971 280
116 iso_pu_bacteria 2857509624 2857509669 280
117 iso_pu_bacteria 2874590934 2874594844 280
118 iso_pu_bacteria 2874604998 2874607349 280
119 iso_pu_bacteria 2874612657 2874614165 280
120 iso_pu_bacteria 2874620515 2874620958 280
121 iso_pu_bacteria 2874628541 2874632821 280
122 iso_pu_bacteria 2874645413 2874646639 280
123 iso_pu_bacteria 2876761206 2876769511 280
124 iso_pu_bacteria 2876771140 2876774314 280
125 iso_pu_bacteria 2876808645 2876811430 280
126 iso_pu_bacteria 2876818435 2876822896 280
127 iso_pu_bacteria 2879074833 2879078469 280
128 iso_pu_bacteria 2879083081 2879086790 280
129 iso_pu_bacteria 2879099564 2879109882 280
130 iso_pu_bacteria 2879110137 2879114822 280
131 iso_pu_bacteria 2879127579 2879128900 280
132 iso_pu_bacteria 2879142872 2879144255 280
133 iso_pu_bacteria 2881364244 2881368047 280
134 iso_pu_bacteria 2881665667 2881672667 280
135 iso_pu_bacteria 2885366525 2885367511 280
136 iso_pu_bacteria 2885383462 2885385800 280
137 iso_pu_bacteria 2888378607 2888382143 280
138 iso_pu_bacteria 2888388044 2888388542 280
139 iso_pu_bacteria 2888419890 2888422746 280
140 iso_pu_bacteria 2889033259 2889042107 280
141 iso_pu_bacteria 2903727486 2903733171 280
142 iso_pu_bacteria 2903748898 2903753720 280
143 iso_pu_bacteria 2903768456 2903772805 280
144 iso_pu_bacteria 2904666416 2904667078 280
145 iso_pu_bacteria 2904690495 2904697360 280
146 iso_pu_bacteria 2904699407 2904705341 280
147 iso_pu_bacteria 2904711408 2904718785 280
148 iso_pu_bacteria 2906602504 2906604016 280
149 iso_pu_bacteria 2906610324 2906611029 280
150 iso_pu_bacteria 2906626472 2906628687 280
151 iso_pu_bacteria 2906635258 2906638029 280
152 iso_pu_bacteria 2906643746 2906647483 280
153 iso_pu_bacteria 2906660503 2906661825 280
154 iso_pu_bacteria 2908739725 2908744545 280
155 iso_pu_bacteria 2908756301 2908762325 280
156 iso_pu_bacteria 2908775508 2908778426 280
157 iso_pu_bacteria 2922361189 2922368652 280
158 iso_pu_bacteria 2922368715 2922372217 280
159 iso_pu_bacteria 2922393267 2922399180 280
160 iso_pu_bacteria 2922425934 2922428283 280
161 iso_pu_bacteria 2929615660 2929616575 280
162 iso_pu_bacteria 2929624759 2929625319 280
163 iso_pu_bacteria 2932784394 2932786747 280
164 iso_pu_bacteria 2932794094 2932798865 280
165 iso_pu_bacteria 2932801729 2932805082 280
166 iso_pu_bacteria 2932809354 2932817886 280
167 iso_pu_bacteria 2932818245 2932827301 280
168 iso_pu_bacteria 2932828146 2932837440 280
169 iso_pu_bacteria 2933577622 2933578142 280
170 iso_pu_bacteria 2935608549 2935610790 280
171 iso_pu_bacteria 2935616580 2935624898 280
172 iso_pu_bacteria 2935630451 2935635882 280
173 iso_pu_bacteria 2935648319 2935654561 280
174 iso_pu_bacteria 2935656913 2935663441 280
175 iso_pu_bacteria 2935665750 2935671347 280
176 iso_pu_bacteria 2935675223 2935684773 280
177 iso_pu_bacteria 2935684952 2935691993 280
178 iso_pu_bacteria 2935694250 2935695063 280
179 iso_pu_bacteria 2935703347 2935707984 280
180 iso_pu_bacteria 2935713505 2935721832 280
181 iso_pu_bacteria 2935722832 2935731170 280
182 iso_pu_bacteria 2935732158 2935738968 280
183 iso_pu_bacteria 2935741537 2935747847 280
184 iso_pu_bacteria 2935750917 2935756431 280
185 iso_pu_bacteria 2935760218 2935761586 280
186 iso_pu_bacteria 2935769743 2935774426 280
187 iso_pu_bacteria 2935777560 2935783451 280
188 iso_pu_bacteria 2935785616 2935790555 280
189 iso_pu_bacteria 2935793552 2935799037 280
190 iso_pu_bacteria 2935801545 2935804911 280
191 iso_pu_bacteria 2935810662 2935812098 280
192 iso_pu_bacteria 2935819856 2935820274 280
193 iso_pu_bacteria 2935837841 2935846938 280
194 iso_pu_bacteria 2935847175 2935849716 280
195 iso_pu_bacteria 2935855204 2935863529 280
196 iso_pu_bacteria 2935864058 2935872732 280
197 iso_pu_bacteria 2935873716 2935882655 280
198 iso_pu_bacteria 2935883170 2935889272 280
199 iso_pu_bacteria 2935908558 2935915997 280
200 iso_pu_bacteria 2935916978 2935919145 280
201 iso_pu_bacteria 2935926038 2935933384 280
202 iso_pu_bacteria 2935934488 2935941885 280
203 iso_pu_bacteria 2935942939 2935950275 280
204 iso_pu_bacteria 2935951376 2935958875 280
205 iso_pu_bacteria 2935959822 2935966052 280
206 iso_pu_bacteria 2935967501 2935970316 280
207 iso_pu_bacteria 2935975950 2935979820 280
208 iso_pu_bacteria 2935984226 2935992030 280
209 iso_pu_bacteria 2935992306 2935997498 280
210 iso_pu_bacteria 2936002035 2936005277 280
211 iso_pu_bacteria 2936011229 2936017626 280
212 iso_pu_bacteria 2936019824 2936026129 280
213 iso_pu_bacteria 2936028420 2936034941 280
214 iso_pu_bacteria 2936037263 2936038692 280
215 iso_pu_bacteria 2936046547 2936053028 280
216 iso_pu_bacteria 2936055302 2936061903 280
217 iso_pu_bacteria 2940556831 2940562345 280
218 iso_pu_bacteria 2941507105 2941512513 280
219 iso_pu_bacteria 2941515067 2941520214 280
220 iso_pu_bacteria 2941523033 2941528390 280
221 iso_pu_bacteria 2941531003 2941535234 280
222 iso_pu_bacteria 2941538514 2941539569 280
223 iso_pu_bacteria 3003665799 3003668315 280
224 iso_pu_bacteria 3005474847 3005478269 280
225 iso_pu_bacteria 3005483717 3005486579 280
226 iso_pu_bacteria 3005587118 3005593573 280
227 iso_pu_bacteria 3005594810 3005597169 280
228 iso_pu_bacteria 3005710791 3005713202 280
229 iso_pu_bacteria 3005718088 3005720567 280
230 iso_pu_bacteria 8006926726 8006927798 280
231 iso_pu_bacteria 8006933436 8006942947 280
232 iso_pu_bacteria 8006964411 8006970946 280
233 iso_pu_bacteria 8006973647 8006982667 280
234 iso_pu_bacteria 8006984368 8006988722 280
235 iso_pu_bacteria 8006994254 8007001899 280
236 iso_pu_bacteria 8016511872 8016515492 280
237 iso_pu_bacteria 8016522445 8016523178 280
238 iso_pu_bacteria 8016530956 8016536653 280
239 iso_pu_bacteria 8016539877 8016540934 280
240 iso_pu_bacteria 8016548790 8016552314 280
241 iso_pu_bacteria 8016557553 8016560699 280
242 iso_pu_bacteria 8016566248 8016566326 280
243 iso_pu_bacteria 8016575299 8016579081 280
244 iso_pu_bacteria 8016583857 8016590512 280
245 iso_pu_bacteria 8016595262 8016598581 280
246 iso_pu_bacteria 8016613128 8016621289 280
247 iso_pu_bacteria 8016630954 8016632874 280
248 iso_pu_bacteria 8017057580 8017060988 280
249 iso_pu_bacteria 8019530166 8019536362 280
250 iso_pu_bacteria 8019547302 8019555824 280
251 iso_pu_bacteria 8019555841 8019558738 280
252 iso_pu_bacteria 8019576017 8019580431 280
253 iso_pu_bacteria 8019586578 8019588153 280
254 iso_pu_bacteria 8019597564 8019603188 280
255 iso_pu_bacteria 8019608314 8019615347 280
256 iso_pu_bacteria 8019619141 8019626215 280
257 iso_pu_bacteria 8019629233 8019636281 280
258 iso_pu_bacteria 8019638758 8019643393 280
259 iso_pu_bacteria 8019648815 8019656177 280
260 iso_pu_bacteria 8019668869 8019673675 280
261 iso_pu_bacteria 8019687851 8019688097 280
262 iso_pu_bacteria 8055742211 8055748221 280
263 iso_pu_bacteria 8056673599 8056681145 280
264 iso_pu_bacteria 8056681323 8056684399 280
265 iso_pu_bacteria 8056689827 8056694330 280
266 iso_pu_bacteria 8056967851 8056969029 280
267 3300005455 Ga0070663_100009960 Ga0070663_1000099602 281
268 3300005548 Ga0070665_100446776 Ga0070665_1004467762 281
269 3300007265 Ga0099794_10006306 Ga0099794_100063064 281
270 3300021384 Ga0213876_10121308 Ga0213876_101213082 281
271 3300026067 Ga0207678_10027242 Ga0207678_100272422 281
272 3300028379 Ga0268266_10427907 Ga0268266_104279072 281
273 3300048921 Ga0496118_0012803 Ga0496118_0012803_1084_1956 281
274 3300048922 Ga0496119_0064564 Ga0496119_0064564_1121_1993 281
275 3300048924 Ga0496121_0266137 Ga0496121_0266137_124_996 281
276 3300048925 Ga0496122_0004199 Ga0496122_0004199_11500_12372 281
277 3300048926 Ga0496123_0012131 Ga0496123_0012131_112_984 281
278 3300049568 Ga0501031_0196295 Ga0501031_0196295_253_1110 281
279 3300049570 Ga0501033_0128242 Ga0501033_0128242_161_1015 281
280 3300049579 Ga0501043_0088763 Ga0501043_0088763_929_1786 281
281 3300049580 Ga0501046_0235020 Ga0501046_0235020_481_1338 281
282 iso_pu_bacteria 2643221577 2643896789 281
283 iso_pu_bacteria 2643221685 2644478994 281
284 3300006358 Ga0068871_100195093 Ga0068871_1001950932 282
285 3300009177 Ga0105248_10260551 Ga0105248_102605512 282
286 3300025284 Ga0209130_1029167 Ga0209130_10291671 282
287 3300025295 Ga0209564_1004691 Ga0209564_10046914 282
288 3300035120 Ga0373957_0025990 Ga0373957_0025990_996_1856 282
289 3300046500 Ga0495596_0137897 Ga0495596_0137897_52_912 282
290 3300046506 Ga0495583_0043305 Ga0495583_0043305_531_1391 282
291 3300046530 Ga0495654_0017015 Ga0495654_0017015_1274_2134 282
292 3300046616 Ga0495668_0280350 Ga0495668_0280350_18_878 282
293 3300046674 Ga0495588_0058437 Ga0495588_0058437_398_1258 282
294 3300047470 Ga0495681_0046405 Ga0495681_0046405_423_1283 282
295 3300048919 Ga0496116_0019933 Ga0496116_0019933_1055_1915 282
296 3300048920 Ga0496117_0161793 Ga0496117_0161793_230_1090 282
297 3300048921 Ga0496118_0081149 Ga0496118_0081149_1163_2023 282
298 3300048923 Ga0496120_0136034 Ga0496120_0136034_296_1156 282
299 3300048924 Ga0496121_0004204 Ga0496121_0004204_8766_9626 282
300 3300048925 Ga0496122_0076193 Ga0496122_0076193_1119_1979 282
301 3300048926 Ga0496123_0067660 Ga0496123_0067660_1028_1888 282
302 3300048928 Ga0496125_0089784 Ga0496125_0089784_693_1553 282
303 3300048929 Ga0496126_0402734 Ga0496126_0402734_230_1090 282
304 3300050492 nmdc:mga0yw44_92219_c1 nmdc:mga0yw44_92219_c1_448_1308 282
305 3300053096 Ga0500641_0008597 Ga0500641_0008597_1303_2163 282
306 3300053098 Ga0500650_0037422 Ga0500650_0037422_319_1179 282
307 3300053104 Ga0500556_0001087 Ga0500556_0001087_8911_9771 282
308 3300053108 Ga0500562_015370 Ga0500562_015370_106_966 282
309 3300053116 Ga0500592_005232 Ga0500592_005232_457_1317 282
310 3300053125 Ga0500618_013103 Ga0500618_013103_317_1177 282
311 3300053130 Ga0500642_0000026 Ga0500642_0000026_4992_5852 282
312 3300053139 Ga0500568_0002271 Ga0500568_0002271_8123_8983 282
313 3300053142 Ga0500577_0001357 Ga0500577_0001357_3834_4697 282
314 3300053156 Ga0500622_0000112 Ga0500622_0000112_3456_4316 282
315 iso_pu_bacteria 2739367700 2739730251 282
316 iso_pu_bacteria 2884411467 2884412153 282
317 iso_pu_bacteria 2928963466 2928967687 282
318 3300003187 JGI25151J46595_10034545 JGI25151J46595_100345452 283
319 3300003215 JGI25153J46596_10001032 JGI25153J46596_1000103212 283
320 3300003215 JGI25153J46596_10001653 JGI25153J46596_100016539 283
321 3300003215 JGI25153J46596_10001857 JGI25153J46596_100018575 283
322 3300003354 JGI25160J50197_1000935 JGI25160J50197_10009358 283
323 3300003354 JGI25160J50197_1004654 JGI25160J50197_10046547 283
324 3300003659 JGI25404J52841_10000792 JGI25404J52841_100007924 283
325 3300003659 JGI25404J52841_10003180 JGI25404J52841_100031804 283
326 3300003659 JGI25404J52841_10023374 JGI25404J52841_100233742 283
327 3300003752 Ga0055539_1008044 Ga0055539_10080442 283
328 3300003762 Ga0055542_1008531 Ga0055542_10085311 283
329 3300003775 Ga0055524_1016860 Ga0055524_10168601 283
330 3300003775 Ga0055524_1024837 Ga0055524_10248373 283
331 3300003781 Ga0055536_1005549 Ga0055536_10055492 283
332 3300003781 Ga0055536_1007021 Ga0055536_10070213 283
333 3300003791 Ga0055530_10002947 Ga0055530_100029475 283
334 3300003794 Ga0055531_10008111 Ga0055531_100081116 283
335 3300003794 Ga0055531_10011812 Ga0055531_100118124 283
336 3300003794 Ga0055531_10012762 Ga0055531_100127622 283
337 3300003794 Ga0055531_10029170 Ga0055531_100291703 283
338 3300005262 Ga0065165_1002030 Ga0065165_100203014 283
339 3300005262 Ga0065165_1002068 Ga0065165_10020686 283
340 3300005329 Ga0070683_100019548 Ga0070683_1000195487 283
341 3300005336 Ga0070680_100012050 Ga0070680_1000120504 283
342 3300005336 Ga0070680_100075324 Ga0070680_1000753242 283
343 3300005336 Ga0070680_100097312 Ga0070680_1000973121 283
344 3300005337 Ga0070682_100031822 Ga0070682_1000318221 283
345 3300005339 Ga0070660_100006509 Ga0070660_1000065097 283
346 3300005339 Ga0070660_100128586 Ga0070660_1001285863 283
347 3300005347 Ga0070668_100096616 Ga0070668_1000966163 283
348 3300005355 Ga0070671_100159491 Ga0070671_1001594912 283
349 3300005356 Ga0070674_100118650 Ga0070674_1001186502 283
350 3300005367 Ga0070667_100103439 Ga0070667_1001034391 283
351 3300005406 Ga0070703_10048097 Ga0070703_100480972 283
352 3300005434 Ga0070709_10011973 Ga0070709_100119731 283
353 3300005434 Ga0070709_10022883 Ga0070709_100228833 283
354 3300005434 Ga0070709_10056329 Ga0070709_100563292 283
355 3300005435 Ga0070714_100364754 Ga0070714_1003647542 283
356 3300005436 Ga0070713_100097083 Ga0070713_1000970833 283
357 3300005436 Ga0070713_100124711 Ga0070713_1001247112 283
358 3300005436 Ga0070713_100133713 Ga0070713_1001337131 283
359 3300005437 Ga0070710_10018063 Ga0070710_100180634 283
360 3300005437 Ga0070710_10025623 Ga0070710_100256232 283
361 3300005437 Ga0070710_10039002 Ga0070710_100390023 283
362 3300005439 Ga0070711_100016347 Ga0070711_1000163476 283
363 3300005445 Ga0070708_100057508 Ga0070708_1000575083 283
364 3300005455 Ga0070663_100115551 Ga0070663_1001155512 283
365 3300005455 Ga0070663_100310786 Ga0070663_1003107862 283
366 3300005456 Ga0070678_100067719 Ga0070678_1000677192 283
367 3300005457 Ga0070662_100181198 Ga0070662_1001811982 283
368 3300005457 Ga0070662_100285966 Ga0070662_1002859661 283
369 3300005458 Ga0070681_10031355 Ga0070681_100313554 283
370 3300005458 Ga0070681_10068440 Ga0070681_100684403 283
371 3300005518 Ga0070699_100446325 Ga0070699_1004463252 283
372 3300005530 Ga0070679_100048769 Ga0070679_1000487692 283
373 3300005530 Ga0070679_100284240 Ga0070679_1002842402 283
374 3300005535 Ga0070684_100004940 Ga0070684_1000049403 283
375 3300005535 Ga0070684_100110440 Ga0070684_1001104403 283
376 3300005535 Ga0070684_100298275 Ga0070684_1002982751 283
377 3300005536 Ga0070697_100036758 Ga0070697_1000367584 283
378 3300005539 Ga0068853_100027282 Ga0068853_1000272826 283
379 3300005539 Ga0068853_100051545 Ga0068853_1000515452 283
380 3300005539 Ga0068853_100068499 Ga0068853_1000684993 283
381 3300005548 Ga0070665_100143080 Ga0070665_1001430802 283
382 3300005563 Ga0068855_100057686 Ga0068855_1000576863 283
383 3300005563 Ga0068855_100074786 Ga0068855_1000747862 283
384 3300005563 Ga0068855_100102540 Ga0068855_1001025402 283
385 3300005563 Ga0068855_100156671 Ga0068855_1001566712 283
386 3300005577 Ga0068857_100003812 Ga0068857_1000038127 283
387 3300005577 Ga0068857_100010456 Ga0068857_1000104564 283
388 3300005577 Ga0068857_100017758 Ga0068857_1000177585 283
389 3300005578 Ga0068854_100023631 Ga0068854_1000236313 283
390 3300005578 Ga0068854_100031462 Ga0068854_1000314622 283
391 3300005614 Ga0068856_100024631 Ga0068856_1000246313 283
392 3300005614 Ga0068856_100050802 Ga0068856_1000508022 283
393 3300005614 Ga0068856_100697533 Ga0068856_1006975331 283
394 3300005615 Ga0070702_100112820 Ga0070702_1001128202 283
395 3300005616 Ga0068852_100004160 Ga0068852_1000041605 283
396 3300005616 Ga0068852_100007043 Ga0068852_1000070437 283
397 3300005616 Ga0068852_100280329 Ga0068852_1002803292 283
398 3300005718 Ga0068866_10091719 Ga0068866_100917192 283
399 3300005719 Ga0068861_100042398 Ga0068861_1000423981 283
400 3300005834 Ga0068851_10001214 Ga0068851_100012145 283
401 3300005834 Ga0068851_10006472 Ga0068851_100064721 283
402 3300005841 Ga0068863_100251707 Ga0068863_1002517072 283
403 3300005844 Ga0068862_100470093 Ga0068862_1004700932 283
404 3300005937 Ga0081455_10004707 Ga0081455_100047079 283
405 3300005937 Ga0081455_10015886 Ga0081455_100158864 283
406 3300005937 Ga0081455_10028943 Ga0081455_100289434 283
407 3300005983 Ga0081540_1001530 Ga0081540_100153015 283
408 3300005983 Ga0081540_1007530 Ga0081540_10075306 283
409 3300005983 Ga0081540_1012734 Ga0081540_10127345 283
410 3300005983 Ga0081540_1021844 Ga0081540_10218443 283
411 3300005983 Ga0081540_1024489 Ga0081540_10244894 283
412 3300005983 Ga0081540_1050002 Ga0081540_10500022 283
413 3300005983 Ga0081540_1056776 Ga0081540_10567762 283
414 3300005985 Ga0081539_10000008 Ga0081539_10000008153 283
415 3300005985 Ga0081539_10001561 Ga0081539_1000156124 283
416 3300005985 Ga0081539_10014949 Ga0081539_100149492 283
417 3300006028 Ga0070717_10005931 Ga0070717_100059313 283
418 3300006038 Ga0075365_10034424 Ga0075365_100344243 283
419 3300006038 Ga0075365_10082935 Ga0075365_100829352 283
420 3300006038 Ga0075365_10154602 Ga0075365_101546021 283
421 3300006038 Ga0075365_10167433 Ga0075365_101674331 283
422 3300006042 Ga0075368_10022590 Ga0075368_100225902 283
423 3300006048 Ga0075363_100010388 Ga0075363_1000103883 283
424 3300006048 Ga0075363_100081410 Ga0075363_1000814102 283
425 3300006058 Ga0075432_10044317 Ga0075432_100443172 283
426 3300006163 Ga0070715_10072955 Ga0070715_100729552 283
427 3300006173 Ga0070716_100036868 Ga0070716_1000368681 283
428 3300006173 Ga0070716_100057358 Ga0070716_1000573582 283
429 3300006173 Ga0070716_100158364 Ga0070716_1001583642 283
430 3300006177 Ga0075362_10087758 Ga0075362_100877582 283
431 3300006178 Ga0075367_10023705 Ga0075367_100237052 283
432 3300006178 Ga0075367_10125747 Ga0075367_101257471 283
433 3300006186 Ga0075369_10040575 Ga0075369_100405752 283
434 3300006186 Ga0075369_10103099 Ga0075369_101030992 283
435 3300006195 Ga0075366_10021402 Ga0075366_100214023 283
436 3300006195 Ga0075366_10042268 Ga0075366_100422683 283
437 3300006195 Ga0075366_10065532 Ga0075366_100655322 283
438 3300006237 Ga0097621_100194874 Ga0097621_1001948742 283
439 3300006353 Ga0075370_10055630 Ga0075370_100556302 283
440 3300006358 Ga0068871_100123094 Ga0068871_1001230942 283
441 3300006914 Ga0075436_100192550 Ga0075436_1001925502 283
442 3300006914 Ga0075436_100223615 Ga0075436_1002236151 283
443 3300006942 Ga0099824_1006034 Ga0099824_100603414 283
444 3300006942 Ga0099824_1022602 Ga0099824_10226024 283
445 3300006943 Ga0099822_1001290 Ga0099822_100129026 283
446 3300006944 Ga0099823_1045654 Ga0099823_10456543 283
447 3300007076 Ga0075435_100269521 Ga0075435_1002695211 283
448 3300007788 Ga0099795_10028502 Ga0099795_100285022 283
449 3300009093 Ga0105240_10007705 Ga0105240_100077053 283
450 3300009093 Ga0105240_10013464 Ga0105240_100134644 283
451 3300009093 Ga0105240_10022611 Ga0105240_100226115 283
452 3300009093 Ga0105240_10028431 Ga0105240_100284316 283
453 3300009093 Ga0105240_10038303 Ga0105240_100383035 283
454 3300009093 Ga0105240_10237054 Ga0105240_102370543 283
455 3300009093 Ga0105240_10498991 Ga0105240_104989911 283
456 3300009101 Ga0105247_10097521 Ga0105247_100975212 283
457 3300009101 Ga0105247_10108391 Ga0105247_101083912 283
458 3300009174 Ga0105241_10010762 Ga0105241_100107623 283
459 3300009174 Ga0105241_10046704 Ga0105241_100467043 283
460 3300009174 Ga0105241_10140830 Ga0105241_101408302 283
461 3300009174 Ga0105241_10178257 Ga0105241_101782572 283
462 3300009176 Ga0105242_10324093 Ga0105242_103240931 283
463 3300009177 Ga0105248_10138967 Ga0105248_101389673 283
464 3300009545 Ga0105237_10004743 Ga0105237_1000474311 283
465 3300009545 Ga0105237_10011260 Ga0105237_100112605 283
466 3300009545 Ga0105237_10031433 Ga0105237_100314333 283
467 3300009545 Ga0105237_10122646 Ga0105237_101226461 283
468 3300009545 Ga0105237_10427450 Ga0105237_104274501 283
469 3300009551 Ga0105238_10002076 Ga0105238_100020765 283
470 3300009551 Ga0105238_10010980 Ga0105238_100109803 283
471 3300009551 Ga0105238_10012649 Ga0105238_100126492 283
472 3300009551 Ga0105238_10172915 Ga0105238_101729152 283
473 3300009551 Ga0105238_10232319 Ga0105238_102323193 283
474 3300010375 Ga0105239_10013891 Ga0105239_100138915 283
475 3300010375 Ga0105239_10039944 Ga0105239_100399443 283
476 3300010375 Ga0105239_10047131 Ga0105239_100471314 283
477 3300010375 Ga0105239_10077508 Ga0105239_100775083 283
478 3300010375 Ga0105239_10081016 Ga0105239_100810164 283
479 3300010375 Ga0105239_10119220 Ga0105239_101192203 283
480 3300010375 Ga0105239_10163948 Ga0105239_101639481 283
481 3300010375 Ga0105239_11007636 Ga0105239_110076361 283
482 3300011119 Ga0105246_10061502 Ga0105246_100615023 283
483 3300013100 Ga0157373_10019948 Ga0157373_100199485 283
484 3300013104 Ga0157370_10037505 Ga0157370_100375053 283
485 3300013104 Ga0157370_10156955 Ga0157370_101569552 283
486 3300013104 Ga0157370_10250270 Ga0157370_102502702 283
487 3300013105 Ga0157369_10018998 Ga0157369_100189986 283
488 3300013105 Ga0157369_10052606 Ga0157369_100526063 283
489 3300013105 Ga0157369_10065128 Ga0157369_100651284 283
490 3300013105 Ga0157369_10341886 Ga0157369_103418862 283
491 3300013306 Ga0163162_10501800 Ga0163162_105018001 283
492 3300013307 Ga0157372_10371637 Ga0157372_103716372 283
493 3300013307 Ga0157372_10495585 Ga0157372_104955851 283
494 3300013308 Ga0157375_10230780 Ga0157375_102307803 283
495 3300013308 Ga0157375_10293692 Ga0157375_102936921 283
496 3300014325 Ga0163163_10165115 Ga0163163_101651151 283
497 3300014497 Ga0182008_10166277 Ga0182008_101662772 283
498 3300014968 Ga0157379_10223611 Ga0157379_102236112 283
499 3300014969 Ga0157376_10182028 Ga0157376_101820282 283
500 3300014969 Ga0157376_10502907 Ga0157376_105029072 283
501 3300021320 Ga0214544_1000073 Ga0214544_10000732 283
502 3300021320 Ga0214544_1007210 Ga0214544_100721011 283
503 3300021321 Ga0214542_1000104 Ga0214542_10001042 283
504 3300021321 Ga0214542_1000196 Ga0214542_100019674 283
505 3300021324 Ga0214545_1000028 Ga0214545_100002817 283
506 3300021324 Ga0214545_1025379 Ga0214545_10253792 283
507 3300021327 Ga0214543_1000044 Ga0214543_1000044147 283
508 3300021327 Ga0214543_1000096 Ga0214543_10000962 283
509 3300021377 Ga0213874_10007742 Ga0213874_100077422 283
510 3300025230 Ga0209563_103577 Ga0209563_1035771 283
511 3300025245 Ga0207425_1026947 Ga0207425_10269472 283
512 3300025253 Ga0209677_101054 Ga0209677_1010545 283
513 3300025253 Ga0209677_102254 Ga0209677_1022548 283
514 3300025254 Ga0209148_1000680 Ga0209148_100068012 283
515 3300025261 Ga0209233_1003740 Ga0209233_10037402 283
516 3300025261 Ga0209233_1004006 Ga0209233_10040065 283
517 3300025261 Ga0209233_1006666 Ga0209233_10066661 283
518 3300025261 Ga0209233_1012488 Ga0209233_10124882 283
519 3300025272 Ga0209455_1002008 Ga0209455_10020085 283
520 3300025272 Ga0209455_1005197 Ga0209455_10051973 283
521 3300025272 Ga0209455_1011701 Ga0209455_10117011 283
522 3300025273 Ga0209673_1004025 Ga0209673_10040253 283
523 3300025284 Ga0209130_1010280 Ga0209130_10102802 283
524 3300025292 Ga0209676_1001462 Ga0209676_100146214 283
525 3300025292 Ga0209676_1003938 Ga0209676_10039388 283
526 3300025292 Ga0209676_1004689 Ga0209676_10046892 283
527 3300025292 Ga0209676_1010527 Ga0209676_10105274 283
528 3300025292 Ga0209676_1011182 Ga0209676_10111824 283
529 3300025292 Ga0209676_1011834 Ga0209676_10118342 283
530 3300025292 Ga0209676_1034383 Ga0209676_10343831 283
531 3300025294 Ga0209025_1003033 Ga0209025_10030337 283
532 3300025294 Ga0209025_1052993 Ga0209025_10529931 283
533 3300025295 Ga0209564_1005302 Ga0209564_10053023 283
534 3300025297 Ga0209758_1000075 Ga0209758_1000075192 283
535 3300025297 Ga0209758_1000187 Ga0209758_100018763 283
536 3300025297 Ga0209758_1000482 Ga0209758_100048250 283
537 3300025297 Ga0209758_1001650 Ga0209758_100165013 283
538 3300025297 Ga0209758_1015384 Ga0209758_10153842 283
539 3300025297 Ga0209758_1016071 Ga0209758_10160714 283
540 3300025297 Ga0209758_1020409 Ga0209758_10204093 283
541 3300025297 Ga0209758_1031792 Ga0209758_10317922 283
542 3300025297 Ga0209758_1036035 Ga0209758_10360353 283
543 3300025298 Ga0209050_1002752 Ga0209050_100275210 283
544 3300025299 Ga0209256_1007084 Ga0209256_10070842 283
545 3300025299 Ga0209256_1009510 Ga0209256_10095102 283
546 3300025299 Ga0209256_1011461 Ga0209256_10114612 283
547 3300025302 Ga0207426_1000160 Ga0207426_1000160161 283
548 3300025302 Ga0207426_1000527 Ga0207426_100052739 283
549 3300025303 Ga0209051_1003094 Ga0209051_10030942 283
550 3300025303 Ga0209051_1048360 Ga0209051_10483601 283
551 3300025304 Ga0209257_1000652 Ga0209257_100065234 283
552 3300025304 Ga0209257_1002013 Ga0209257_100201311 283
553 3300025304 Ga0209257_1002127 Ga0209257_100212715 283
554 3300025304 Ga0209257_1004808 Ga0209257_100480810 283
555 3300025304 Ga0209257_1027397 Ga0209257_10273972 283
556 3300025321 Ga0207656_10002942 Ga0207656_100029426 283
557 3300025321 Ga0207656_10023522 Ga0207656_100235221 283
558 3300025885 Ga0207653_10017591 Ga0207653_100175912 283
559 3300025898 Ga0207692_10024985 Ga0207692_100249853 283
560 3300025900 Ga0207710_10058711 Ga0207710_100587112 283
561 3300025904 Ga0207647_10000586 Ga0207647_1000058622 283
562 3300025904 Ga0207647_10001777 Ga0207647_1000177713 283
563 3300025905 Ga0207685_10060982 Ga0207685_100609821 283
564 3300025906 Ga0207699_10012170 Ga0207699_100121703 283
565 3300025906 Ga0207699_10024297 Ga0207699_100242973 283
566 3300025908 Ga0207643_10008582 Ga0207643_100085824 283
567 3300025909 Ga0207705_10192254 Ga0207705_101922542 283
568 3300025910 Ga0207684_10273034 Ga0207684_102730341 283
569 3300025911 Ga0207654_10000136 Ga0207654_100001364 283
570 3300025911 Ga0207654_10087335 Ga0207654_100873352 283
571 3300025911 Ga0207654_10120095 Ga0207654_101200952 283
572 3300025912 Ga0207707_10001642 Ga0207707_100016424 283
573 3300025912 Ga0207707_10007605 Ga0207707_100076054 283
574 3300025912 Ga0207707_10223821 Ga0207707_102238212 283
575 3300025913 Ga0207695_10000029 Ga0207695_10000029365 283
576 3300025913 Ga0207695_10002311 Ga0207695_1000231116 283
577 3300025913 Ga0207695_10011572 Ga0207695_100115725 283
578 3300025913 Ga0207695_10075771 Ga0207695_100757714 283
579 3300025913 Ga0207695_10133917 Ga0207695_101339172 283
580 3300025913 Ga0207695_10273781 Ga0207695_102737812 283
581 3300025913 Ga0207695_10470794 Ga0207695_104707941 283
582 3300025914 Ga0207671_10003843 Ga0207671_100038436 283
583 3300025914 Ga0207671_10007380 Ga0207671_100073806 283
584 3300025915 Ga0207693_10001764 Ga0207693_1000176411 283
585 3300025915 Ga0207693_10005866 Ga0207693_100058665 283
586 3300025915 Ga0207693_10128070 Ga0207693_101280702 283
587 3300025916 Ga0207663_10006336 Ga0207663_100063361 283
588 3300025916 Ga0207663_10035891 Ga0207663_100358913 283
589 3300025916 Ga0207663_10045043 Ga0207663_100450431 283
590 3300025917 Ga0207660_10025057 Ga0207660_100250574 283
591 3300025917 Ga0207660_10048220 Ga0207660_100482203 283
592 3300025917 Ga0207660_10084741 Ga0207660_100847412 283
593 3300025919 Ga0207657_10006868 Ga0207657_1000686811 283
594 3300025919 Ga0207657_10022746 Ga0207657_100227464 283
595 3300025919 Ga0207657_10195815 Ga0207657_101958152 283
596 3300025921 Ga0207652_10006786 Ga0207652_100067868 283
597 3300025921 Ga0207652_10012536 Ga0207652_100125363 283
598 3300025921 Ga0207652_10295227 Ga0207652_102952272 283
599 3300025924 Ga0207694_10000135 Ga0207694_1000013523 283
600 3300025924 Ga0207694_10014853 Ga0207694_100148534 283
601 3300025924 Ga0207694_10027086 Ga0207694_100270863 283
602 3300025924 Ga0207694_10114340 Ga0207694_101143402 283
603 3300025924 Ga0207694_10161114 Ga0207694_101611143 283
604 3300025928 Ga0207700_10017875 Ga0207700_100178753 283
605 3300025928 Ga0207700_10228653 Ga0207700_102286532 283
606 3300025929 Ga0207664_10415534 Ga0207664_104155342 283
607 3300025935 Ga0207709_10356375 Ga0207709_103563751 283
608 3300025939 Ga0207665_10004976 Ga0207665_100049764 283
609 3300025939 Ga0207665_10009679 Ga0207665_100096793 283
610 3300025941 Ga0207711_10080269 Ga0207711_100802692 283
611 3300025941 Ga0207711_10268516 Ga0207711_102685162 283
612 3300025942 Ga0207689_10083658 Ga0207689_100836583 283
613 3300025944 Ga0207661_10007779 Ga0207661_100077798 283
614 3300025944 Ga0207661_10029064 Ga0207661_100290643 283
615 3300025944 Ga0207661_10099615 Ga0207661_100996152 283
616 3300025949 Ga0207667_10018495 Ga0207667_100184954 283
617 3300025949 Ga0207667_10019153 Ga0207667_100191537 283
618 3300025949 Ga0207667_10086526 Ga0207667_100865264 283
619 3300025960 Ga0207651_10209562 Ga0207651_102095621 283
620 3300025972 Ga0207668_10078657 Ga0207668_100786573 283
621 3300025981 Ga0207640_10003325 Ga0207640_100033256 283
622 3300025981 Ga0207640_10007395 Ga0207640_100073954 283
623 3300025981 Ga0207640_10334687 Ga0207640_103346871 283
624 3300026041 Ga0207639_10011442 Ga0207639_100114427 283
625 3300026041 Ga0207639_10023493 Ga0207639_100234934 283
626 3300026041 Ga0207639_10025712 Ga0207639_100257123 283
627 3300026041 Ga0207639_10107556 Ga0207639_101075562 283
628 3300026041 Ga0207639_10156665 Ga0207639_101566652 283
629 3300026041 Ga0207639_10178821 Ga0207639_101788212 283
630 3300026067 Ga0207678_10031917 Ga0207678_100319173 283
631 3300026067 Ga0207678_10164964 Ga0207678_101649642 283
632 3300026067 Ga0207678_10178056 Ga0207678_101780562 283
633 3300026067 Ga0207678_10220533 Ga0207678_102205332 283
634 3300026067 Ga0207678_10259994 Ga0207678_102599942 283
635 3300026075 Ga0207708_10196166 Ga0207708_101961661 283
636 3300026078 Ga0207702_10000026 Ga0207702_10000026127 283
637 3300026078 Ga0207702_10000334 Ga0207702_1000033438 283
638 3300026078 Ga0207702_10013080 Ga0207702_100130805 283
639 3300026078 Ga0207702_10161086 Ga0207702_101610862 283
640 3300026088 Ga0207641_10040878 Ga0207641_100408784 283
641 3300026095 Ga0207676_10123226 Ga0207676_101232262 283
642 3300026095 Ga0207676_10128917 Ga0207676_101289173 283
643 3300026116 Ga0207674_10007361 Ga0207674_100073618 283
644 3300026116 Ga0207674_10013128 Ga0207674_100131287 283
645 3300026116 Ga0207674_10016608 Ga0207674_100166085 283
646 3300026116 Ga0207674_10137426 Ga0207674_101374263 283
647 3300026118 Ga0207675_100038699 Ga0207675_1000386994 283
648 3300026121 Ga0207683_10106473 Ga0207683_101064734 283
649 3300026121 Ga0207683_10340240 Ga0207683_103402401 283
650 3300026121 Ga0207683_10397199 Ga0207683_103971991 283
651 3300026142 Ga0207698_10019685 Ga0207698_100196854 283
652 3300026142 Ga0207698_10053737 Ga0207698_100537372 283
653 3300026142 Ga0207698_10140431 Ga0207698_101404312 283
654 3300027296 Ga0209389_1000003 Ga0209389_100000393 283
655 3300027296 Ga0209389_1000365 Ga0209389_100036514 283
656 3300027357 Ga0209589_1003813 Ga0209589_100381314 283
657 3300027361 Ga0209489_100022 Ga0209489_10002269 283
658 3300027361 Ga0209489_100498 Ga0209489_10049810 283
659 3300027363 Ga0209700_100023 Ga0209700_10002392 283
660 3300027512 Ga0209179_1005710 Ga0209179_10057102 283
661 3300027866 Ga0209813_10008418 Ga0209813_100084183 283
662 3300028379 Ga0268266_10116479 Ga0268266_101164792 283
663 3300028379 Ga0268266_10134134 Ga0268266_101341342 283
664 3300028379 Ga0268266_10269747 Ga0268266_102697471 283
665 3300028379 Ga0268266_10272143 Ga0268266_102721432 283
666 3300028380 Ga0268265_10253428 Ga0268265_102534282 283
667 3300028381 Ga0268264_10000020 Ga0268264_1000002012 283
668 3300028653 Ga0265323_10001786 Ga0265323_100017866 283
669 3300028666 Ga0265336_10001310 Ga0265336_100013102 283
670 3300028786 Ga0307517_10027736 Ga0307517_100277365 283
671 3300028794 Ga0307515_10035428 Ga0307515_100354282 283
672 3300028800 Ga0265338_10000013 Ga0265338_1000001318 283
673 3300030521 Ga0307511_10033076 Ga0307511_100330762 283
674 3300031247 Ga0265340_10012398 Ga0265340_100123985 283
675 3300031249 Ga0265339_10008262 Ga0265339_100082625 283
676 3300031249 Ga0265339_10050216 Ga0265339_100502163 283
677 3300031250 Ga0265331_10039190 Ga0265331_100391903 283
678 3300031250 Ga0265331_10113786 Ga0265331_101137862 283
679 3300031456 Ga0307513_10277813 Ga0307513_102778132 283
680 3300031548 Ga0307408_100020620 Ga0307408_1000206202 283
681 3300031616 Ga0307508_10000419 Ga0307508_1000041910 283
682 3300031616 Ga0307508_10043572 Ga0307508_100435723 283
683 3300031616 Ga0307508_10135882 Ga0307508_101358822 283
684 3300031711 Ga0265314_10003890 Ga0265314_100038904 283
685 3300031711 Ga0265314_10028507 Ga0265314_100285073 283
686 3300031711 Ga0265314_10170254 Ga0265314_101702542 283
687 3300031712 Ga0265342_10013315 Ga0265342_100133153 283
688 3300031712 Ga0265342_10116622 Ga0265342_101166221 283
689 3300031730 Ga0307516_10062970 Ga0307516_100629704 283
690 3300031730 Ga0307516_10129607 Ga0307516_101296072 283
691 3300031901 Ga0307406_10464960 Ga0307406_104649601 283
692 3300032002 Ga0307416_100345553 Ga0307416_1003455532 283
693 3300033180 Ga0307510_10015138 Ga0307510_100151383 283
694 3300033180 Ga0307510_10031597 Ga0307510_100315974 283
695 3300033180 Ga0307510_10249336 Ga0307510_102493361 283
696 3300033442 Ga0315911_1000014 Ga0315911_100001455 283
697 3300035083 Ga0373926_0038401 Ga0373926_0038401_124_987 283
698 3300035086 Ga0373934_0099482 Ga0373934_0099482_28_891 283
699 3300035111 Ga0373923_0004573 Ga0373923_0004573_3228_4091 283
700 3300035117 Ga0373953_0007862 Ga0373953_0007862_2294_3157 283
701 3300035117 Ga0373953_0008978 Ga0373953_0008978_2197_3060 283
702 3300035118 Ga0373954_0044140 Ga0373954_0044140_899_1762 283
703 3300035119 Ga0373956_0043097 Ga0373956_0043097_731_1594 283
704 3300035120 Ga0373957_0031719 Ga0373957_0031719_484_1347 283
705 3300035170 Ga0373943_0102771 Ga0373943_0102771_576_1439 283
706 3300035172 Ga0373955_0047370 Ga0373955_0047370_1167_2030 283
707 3300035172 Ga0373955_0225370 Ga0373955_0225370_161_1024 283
708 3300035410 Ga0373924_0025186 Ga0373924_0025186_1120_1983 283
709 3300035691 Ga0373931_0005209 Ga0373931_0005209_3726_4589 283
710 3300035692 Ga0373935_0001026 Ga0373935_0001026_11036_11899 283
711 3300035692 Ga0373935_0067145 Ga0373935_0067145_951_1814 283
712 3300035692 Ga0373935_0140324 Ga0373935_0140324_254_1117 283
713 3300035695 Ga0373927_0021479 Ga0373927_0021479_3225_4088 283
714 3300035695 Ga0373927_0055143 Ga0373927_0055143_601_1464 283
715 3300035695 Ga0373927_0074287 Ga0373927_0074287_692_1555 283
716 3300035695 Ga0373927_0103441 Ga0373927_0103441_933_1796 283
717 3300035724 Ga0373933_0000631 Ga0373933_0000631_10213_11076 283
718 3300035724 Ga0373933_0027843 Ga0373933_0027843_2022_2885 283
719 3300035724 Ga0373933_0255814 Ga0373933_0255814_134_997 283
720 3300035725 Ga0373947_0129732 Ga0373947_0129732_360_1223 283
721 3300035725 Ga0373947_0291588 Ga0373947_0291588_134_997 283
722 3300036401 Ga0373937_0626563 Ga0373937_0626563_41_904 283
723 3300036459 Ga0372808_011507 Ga0372808_011507_263_1126 283
724 3300037068 Ga0373925_0032857 Ga0373925_0032857_2034_2897 283
725 3300037068 Ga0373925_0037551 Ga0373925_0037551_548_1411 283
726 3300037068 Ga0373925_0067129 Ga0373925_0067129_73_936 283
727 3300037068 Ga0373925_0158442 Ga0373925_0158442_540_1403 283
728 3300037418 Ga0395900_0014369 Ga0395900_0014369_292_1155 283
729 3300037418 Ga0395900_0364388 Ga0395900_0364388_294_1157 283
730 3300037466 Ga0395898_0010290 Ga0395898_0010290_3583_4446 283
731 3300037466 Ga0395898_0472182 Ga0395898_0472182_259_1122 283
732 3300037466 Ga0395898_0669162 Ga0395898_0669162_90_953 283
733 3300037471 Ga0395905_0163570 Ga0395905_0163570_45_908 283
734 3300037471 Ga0395905_0328988 Ga0395905_0328988_196_1059 283
735 3300038443 Ga0395901_0019804 Ga0395901_0019804_5059_5922 283
736 3300038443 Ga0395901_0243240 Ga0395901_0243240_178_1041 283
737 3300038443 Ga0395901_0344679 Ga0395901_0344679_542_1405 283
738 3300038443 Ga0395901_0447416 Ga0395901_0447416_243_1106 283
739 3300039437 Ga0436365_0385088 Ga0436365_0385088_212_1075 283
740 3300039437 Ga0436365_1204968 Ga0436365_1204968_1233_2096 283
741 3300039437 Ga0436365_1207416 Ga0436365_1207416_345_1208 283
742 3300039438 Ga0436360_0030607 Ga0436360_0030607_200_1063 283
743 3300039447 Ga0436361_1156995 Ga0436361_1156995_1511_2374 283
744 3300039450 Ga0436363_1032871 Ga0436363_1032871_274_1137 283
745 3300039450 Ga0436363_1645002 Ga0436363_1645002_1690_2613 283
746 3300041413 Ga0439465_0021447 Ga0439465_0021447_694_1545 283
747 3300041458 Ga0451798_1041797 Ga0451798_1041797_139_1002 283
748 3300042010 Ga0439452_009623 Ga0439452_009623_1242_2093 283
749 3300044658 Ga0466972_0001189 Ga0466972_0001189_1205_2068 283
750 3300044658 Ga0466972_0199477 Ga0466972_0199477_45_908 283
751 3300044683 Ga0466965_0135663 Ga0466965_0135663_221_1084 283
752 3300044684 Ga0466966_0001683 Ga0466966_0001683_12667_13530 283
753 3300044684 Ga0466966_0049627 Ga0466966_0049627_1317_2180 283
754 3300044684 Ga0466966_0131705 Ga0466966_0131705_636_1499 283
755 3300044693 Ga0466961_0000084 Ga0466961_0000084_37910_38773 283
756 3300044694 Ga0466963_0134187 Ga0466963_0134187_55_918 283
757 3300044694 Ga0466963_0182671 Ga0466963_0182671_51_983 283
758 3300044694 Ga0466963_0295189 Ga0466963_0295189_42_905 283
759 3300044735 Ga0466968_0053255 Ga0466968_0053255_415_1278 283
760 3300044842 Ga0466957_0392658 Ga0466957_0392658_51_914 283
761 3300044901 Ga0466960_0013508 Ga0466960_0013508_689_1552 283
762 3300044901 Ga0466960_0125366 Ga0466960_0125366_404_1267 283
763 3300045049 Ga0466959_0002035 Ga0466959_0002035_2200_3063 283
764 3300045049 Ga0466959_0079518 Ga0466959_0079518_484_1347 283
765 3300046454 Ga0495592_0070595 Ga0495592_0070595_425_1288 283
766 3300046454 Ga0495592_0095183 Ga0495592_0095183_282_1145 283
767 3300046455 Ga0495603_0006560 Ga0495603_0006560_237_1100 283
768 3300046455 Ga0495603_0019060 Ga0495603_0019060_796_1659 283
769 3300046455 Ga0495603_0043319 Ga0495603_0043319_250_1113 283
770 3300046459 Ga0495629_0008449 Ga0495629_0008449_3408_4271 283
771 3300046459 Ga0495629_0050927 Ga0495629_0050927_1358_2221 283
772 3300046459 Ga0495629_0192999 Ga0495629_0192999_62_925 283
773 3300046460 Ga0495638_0008098 Ga0495638_0008098_3050_3913 283
774 3300046461 Ga0495641_0013759 Ga0495641_0013759_2737_3600 283
775 3300046462 Ga0495651_0303722 Ga0495651_0303722_194_1057 283
776 3300046472 Ga0495580_0009943 Ga0495580_0009943_3287_4150 283
777 3300046473 Ga0495582_0004249 Ga0495582_0004249_4987_5850 283
778 3300046475 Ga0495639_0001631 Ga0495639_0001631_2728_3591 283
779 3300046475 Ga0495639_0063123 Ga0495639_0063123_752_1615 283
780 3300046476 Ga0495662_0008011 Ga0495662_0008011_1052_1915 283
781 3300046477 Ga0495664_0040432 Ga0495664_0040432_1814_2677 283
782 3300046477 Ga0495664_0062486 Ga0495664_0062486_1172_2035 283
783 3300046499 Ga0495594_0001269 Ga0495594_0001269_3957_4820 283
784 3300046499 Ga0495594_0107978 Ga0495594_0107978_482_1345 283
785 3300046507 Ga0495606_0199117 Ga0495606_0199117_270_1133 283
786 3300046511 Ga0495608_0353570 Ga0495608_0353570_19_882 283
787 3300046512 Ga0495610_0054907 Ga0495610_0054907_463_1326 283
788 3300046514 Ga0495618_0014515 Ga0495618_0014515_3785_4648 283
789 3300046514 Ga0495618_0080762 Ga0495618_0080762_1128_1991 283
790 3300046515 Ga0495620_0091015 Ga0495620_0091015_297_1160 283
791 3300046516 Ga0495628_0163021 Ga0495628_0163021_176_1039 283
792 3300046516 Ga0495628_0225330 Ga0495628_0225330_456_1319 283
793 3300046517 Ga0495630_0055028 Ga0495630_0055028_90_953 283
794 3300046517 Ga0495630_0056773 Ga0495630_0056773_1733_2596 283
795 3300046519 Ga0495632_0082351 Ga0495632_0082351_164_1027 283
796 3300046519 Ga0495632_0110116 Ga0495632_0110116_417_1280 283
797 3300046520 Ga0495637_0092392 Ga0495637_0092392_95_958 283
798 3300046522 Ga0495643_0091940 Ga0495643_0091940_404_1267 283
799 3300046524 Ga0495648_0008195 Ga0495648_0008195_148_1011 283
800 3300046524 Ga0495648_0029614 Ga0495648_0029614_208_1071 283
801 3300046524 Ga0495648_0049853 Ga0495648_0049853_1560_2423 283
802 3300046524 Ga0495648_0100072 Ga0495648_0100072_75_938 283
803 3300046525 Ga0495663_0053697 Ga0495663_0053697_129_992 283
804 3300046529 Ga0495652_0033765 Ga0495652_0033765_382_1245 283
805 3300046529 Ga0495652_0068069 Ga0495652_0068069_79_942 283
806 3300046529 Ga0495652_0076737 Ga0495652_0076737_292_1155 283
807 3300046530 Ga0495654_0135061 Ga0495654_0135061_57_920 283
808 3300046531 Ga0495665_0001884 Ga0495665_0001884_1000_1863 283
809 3300046531 Ga0495665_0041435 Ga0495665_0041435_954_1817 283
810 3300046533 Ga0495640_0049976 Ga0495640_0049976_187_1050 283
811 3300046533 Ga0495640_0115599 Ga0495640_0115599_424_1287 283
812 3300046536 Ga0495587_0010826 Ga0495587_0010826_488_1351 283
813 3300046536 Ga0495587_0156786 Ga0495587_0156786_240_1103 283
814 3300046537 Ga0495598_0036538 Ga0495598_0036538_229_1092 283
815 3300046538 Ga0495609_0111457 Ga0495609_0111457_52_915 283
816 3300046542 Ga0495597_0078505 Ga0495597_0078505_475_1338 283
817 3300046543 Ga0495645_0030368 Ga0495645_0030368_2135_2998 283
818 3300046543 Ga0495645_0038734 Ga0495645_0038734_2604_3467 283
819 3300046557 Ga0495622_0044786 Ga0495622_0044786_83_946 283
820 3300046557 Ga0495622_0139720 Ga0495622_0139720_127_990 283
821 3300046559 Ga0495667_0017299 Ga0495667_0017299_1934_2797 283
822 3300046559 Ga0495667_0197906 Ga0495667_0197906_234_1097 283
823 3300046616 Ga0495668_0069829 Ga0495668_0069829_629_1492 283
824 3300046642 Ga0495634_0010587 Ga0495634_0010587_3366_4229 283
825 3300046648 Ga0495611_0005006 Ga0495611_0005006_4481_5344 283
826 3300046663 Ga0495635_0015901 Ga0495635_0015901_2069_2932 283
827 3300046663 Ga0495635_0036927 Ga0495635_0036927_423_1286 283
828 3300046663 Ga0495635_0063109 Ga0495635_0063109_23_886 283
829 3300046663 Ga0495635_0082411 Ga0495635_0082411_966_1829 283
830 3300046674 Ga0495588_0004512 Ga0495588_0004512_2494_3357 283
831 3300046675 Ga0495657_0070096 Ga0495657_0070096_416_1279 283
832 3300046675 Ga0495657_0074074 Ga0495657_0074074_760_1623 283
833 3300046678 Ga0495599_0129243 Ga0495599_0129243_435_1298 283
834 3300046680 Ga0495646_0198350 Ga0495646_0198350_90_953 283
835 3300046681 Ga0495647_0025999 Ga0495647_0025999_67_930 283
836 3300046683 Ga0495658_0011741 Ga0495658_0011741_681_1544 283
837 3300046683 Ga0495658_0186725 Ga0495658_0186725_210_1073 283
838 3300046689 Ga0495613_0009118 Ga0495613_0009118_4433_5296 283
839 3300046689 Ga0495613_0287713 Ga0495613_0287713_224_1087 283
840 3300046690 Ga0495624_0008474 Ga0495624_0008474_2206_3069 283
841 3300046690 Ga0495624_0215827 Ga0495624_0215827_140_1003 283
842 3300046794 Ga0495589_0158552 Ga0495589_0158552_107_970 283
843 3300046809 Ga0495600_0016852 Ga0495600_0016852_3391_4254 283
844 3300046809 Ga0495600_0230689 Ga0495600_0230689_255_1118 283
845 3300047315 Ga0495581_0012281 Ga0495581_0012281_1897_2760 283
846 3300047315 Ga0495581_0095930 Ga0495581_0095930_763_1626 283
847 3300047315 Ga0495581_0250424 Ga0495581_0250424_111_974 283
848 3300047317 Ga0495604_0031622 Ga0495604_0031622_162_1025 283
849 3300047319 Ga0495674_0003482 Ga0495674_0003482_1300_2163 283
850 3300047319 Ga0495674_0135975 Ga0495674_0135975_1158_2021 283
851 3300047320 Ga0495672_0002709 Ga0495672_0002709_12534_13421 283
852 3300047320 Ga0495672_0017857 Ga0495672_0017857_1208_2071 283
853 3300047320 Ga0495672_0092772 Ga0495672_0092772_761_1624 283
854 3300047321 Ga0495676_0074454 Ga0495676_0074454_591_1454 283
855 3300047321 Ga0495676_0114136 Ga0495676_0114136_546_1409 283
856 3300047322 Ga0495680_0025271 Ga0495680_0025271_1807_2670 283
857 3300047322 Ga0495680_0077191 Ga0495680_0077191_966_1829 283
858 3300047322 Ga0495680_0114293 Ga0495680_0114293_141_1004 283
859 3300047443 Ga0495687_012621 Ga0495687_012621_953_1816 283
860 3300047444 Ga0495675_0209844 Ga0495675_0209844_47_910 283
861 3300047469 Ga0495673_0088746 Ga0495673_0088746_381_1244 283
862 3300047471 Ga0495684_0011768 Ga0495684_0011768_412_1275 283
863 3300047471 Ga0495684_0035799 Ga0495684_0035799_1358_2221 283
864 3300047471 Ga0495684_0073531 Ga0495684_0073531_391_1254 283
865 3300047472 Ga0495686_0031272 Ga0495686_0031272_531_1394 283
866 3300047673 Ga0495593_0004676 Ga0495593_0004676_2409_3272 283
867 3300047673 Ga0495593_0144056 Ga0495593_0144056_62_925 283
868 3300048088 Ga0495602_0109798 Ga0495602_0109798_261_1124 283
869 3300048088 Ga0495602_0153540 Ga0495602_0153540_358_1221 283
870 3300048088 Ga0495602_0157399 Ga0495602_0157399_481_1344 283
871 3300048090 Ga0495615_0079342 Ga0495615_0079342_21_884 283
872 3300048904 Ga0496101_0203576 Ga0496101_0203576_221_1084 283
873 3300048905 Ga0496102_0082886 Ga0496102_0082886_1000_1863 283
874 3300048905 Ga0496102_0204050 Ga0496102_0204050_975_1838 283
875 3300048905 Ga0496102_0413430 Ga0496102_0413430_264_1127 283
876 3300048906 Ga0496103_0032897 Ga0496103_0032897_1706_2569 283
877 3300048907 Ga0496104_0080773 Ga0496104_0080773_1580_2443 283
878 3300048907 Ga0496104_0099795 Ga0496104_0099795_1763_2626 283
879 3300048907 Ga0496104_0319851 Ga0496104_0319851_398_1261 283
880 3300048908 Ga0496105_0077006 Ga0496105_0077006_336_1199 283
881 3300048908 Ga0496105_0167789 Ga0496105_0167789_427_1290 283
882 3300048909 Ga0496106_0000790 Ga0496106_0000790_14207_15070 283
883 3300048910 Ga0496107_0315886 Ga0496107_0315886_237_1100 283
884 3300048911 Ga0496108_0214432 Ga0496108_0214432_777_1640 283
885 3300048911 Ga0496108_0235532 Ga0496108_0235532_160_1023 283
886 3300048911 Ga0496108_0274322 Ga0496108_0274322_497_1360 283
887 3300048912 Ga0496109_0015593 Ga0496109_0015593_854_1717 283
888 3300048912 Ga0496109_0151473 Ga0496109_0151473_55_918 283
889 3300048912 Ga0496109_0246168 Ga0496109_0246168_370_1233 283
890 3300048912 Ga0496109_0618547 Ga0496109_0618547_82_945 283
891 3300048913 Ga0496110_0169397 Ga0496110_0169397_663_1526 283
892 3300048914 Ga0496111_0051321 Ga0496111_0051321_1622_2485 283
893 3300048914 Ga0496111_0053939 Ga0496111_0053939_534_1397 283
894 3300048915 Ga0496112_0000008 Ga0496112_0000008_232968_233831 283
895 3300048915 Ga0496112_0015024 Ga0496112_0015024_6028_6891 283
896 3300048915 Ga0496112_0039667 Ga0496112_0039667_1922_2785 283
897 3300048915 Ga0496112_0254388 Ga0496112_0254388_519_1382 283
898 3300048916 Ga0496113_0018344 Ga0496113_0018344_2958_3821 283
899 3300048917 Ga0496114_0059427 Ga0496114_0059427_1155_2018 283
900 3300048917 Ga0496114_0405843 Ga0496114_0405843_185_1048 283
901 3300048917 Ga0496114_0408694 Ga0496114_0408694_152_1015 283
902 3300048918 Ga0496115_0163009 Ga0496115_0163009_928_1791 283
903 3300048918 Ga0496115_0254346 Ga0496115_0254346_358_1221 283
904 3300048918 Ga0496115_0274765 Ga0496115_0274765_274_1137 283
905 3300048918 Ga0496115_0339463 Ga0496115_0339463_140_1003 283
906 3300048920 Ga0496117_0080969 Ga0496117_0080969_52_915 283
907 3300048920 Ga0496117_0162717 Ga0496117_0162717_102_965 283
908 3300048921 Ga0496118_0011291 Ga0496118_0011291_1538_2401 283
909 3300048921 Ga0496118_0021505 Ga0496118_0021505_3004_3867 283
910 3300048921 Ga0496118_0023093 Ga0496118_0023093_4165_5028 283
911 3300048922 Ga0496119_0095487 Ga0496119_0095487_170_1033 283
912 3300048922 Ga0496119_0120355 Ga0496119_0120355_37_900 283
913 3300048924 Ga0496121_0000774 Ga0496121_0000774_44944_45807 283
914 3300048924 Ga0496121_0001681 Ga0496121_0001681_6091_6954 283
915 3300048924 Ga0496121_0003198 Ga0496121_0003198_7885_8748 283
916 3300048924 Ga0496121_0020289 Ga0496121_0020289_699_1562 283
917 3300048924 Ga0496121_0049511 Ga0496121_0049511_53_916 283
918 3300048924 Ga0496121_0061247 Ga0496121_0061247_2211_3074 283
919 3300048924 Ga0496121_0075015 Ga0496121_0075015_352_1215 283
920 3300048924 Ga0496121_0076458 Ga0496121_0076458_987_1850 283
921 3300048924 Ga0496121_0085056 Ga0496121_0085056_1474_2337 283
922 3300048924 Ga0496121_0161089 Ga0496121_0161089_289_1152 283
923 3300048924 Ga0496121_0231594 Ga0496121_0231594_53_916 283
924 3300048924 Ga0496121_0292714 Ga0496121_0292714_27_890 283
925 3300048925 Ga0496122_0020976 Ga0496122_0020976_4622_5485 283
926 3300048926 Ga0496123_0015113 Ga0496123_0015113_1373_2236 283
927 3300048927 Ga0496124_0002423 Ga0496124_0002423_7796_8659 283
928 3300048927 Ga0496124_0292724 Ga0496124_0292724_28_891 283
929 3300048928 Ga0496125_0012360 Ga0496125_0012360_4552_5415 283
930 3300048928 Ga0496125_0014815 Ga0496125_0014815_3397_4260 283
931 3300048928 Ga0496125_0015380 Ga0496125_0015380_3084_3947 283
932 3300048929 Ga0496126_0002928 Ga0496126_0002928_4851_5714 283
933 3300048929 Ga0496126_0007386 Ga0496126_0007386_4423_5286 283
934 3300048929 Ga0496126_0016425 Ga0496126_0016425_2424_3287 283
935 3300048929 Ga0496126_0018165 Ga0496126_0018165_1288_2151 283
936 3300048929 Ga0496126_0018440 Ga0496126_0018440_2423_3286 283
937 3300048929 Ga0496126_0074838 Ga0496126_0074838_1583_2446 283
938 3300048929 Ga0496126_0110874 Ga0496126_0110874_1042_1905 283
939 3300048929 Ga0496126_0172532 Ga0496126_0172532_185_1048 283
940 3300048929 Ga0496126_0175038 Ga0496126_0175038_59_922 283
941 3300048929 Ga0496126_0255043 Ga0496126_0255043_122_985 283
942 3300049460 Ga0495682_0041853 Ga0495682_0041853_128_991 283
943 3300049460 Ga0495682_0056874 Ga0495682_0056874_522_1385 283
944 3300049568 Ga0501031_0012411 Ga0501031_0012411_3012_3875 283
945 3300049568 Ga0501031_0166768 Ga0501031_0166768_379_1242 283
946 3300049569 Ga0501032_0000683 Ga0501032_0000683_8476_9339 283
947 3300049569 Ga0501032_0025241 Ga0501032_0025241_2285_3148 283
948 3300049569 Ga0501032_0044830 Ga0501032_0044830_1979_2842 283
949 3300049570 Ga0501033_0000645 Ga0501033_0000645_13169_14032 283
950 3300049570 Ga0501033_0041465 Ga0501033_0041465_1559_2422 283
951 3300049570 Ga0501033_0257586 Ga0501033_0257586_181_1044 283
952 3300049571 Ga0501034_0004310 Ga0501034_0004310_14375_15238 283
953 3300049571 Ga0501034_0018499 Ga0501034_0018499_4146_5009 283
954 3300049571 Ga0501034_0456263 Ga0501034_0456263_56_919 283
955 3300049572 Ga0501036_0002022 Ga0501036_0002022_2260_3123 283
956 3300049572 Ga0501036_0175017 Ga0501036_0175017_210_1073 283
957 3300049573 Ga0501037_0000484 Ga0501037_0000484_13169_14032 283
958 3300049573 Ga0501037_0043321 Ga0501037_0043321_1606_2469 283
959 3300049573 Ga0501037_0064760 Ga0501037_0064760_1012_1875 283
960 3300049574 Ga0501038_0003716 Ga0501038_0003716_4528_5391 283
961 3300049574 Ga0501038_0012105 Ga0501038_0012105_3886_4749 283
962 3300049575 Ga0501039_0001484 Ga0501039_0001484_13106_13969 283
963 3300049575 Ga0501039_0058706 Ga0501039_0058706_1402_2265 283
964 3300049575 Ga0501039_0091357 Ga0501039_0091357_1432_2295 283
965 3300049579 Ga0501043_0000593 Ga0501043_0000593_17580_18443 283
966 3300049579 Ga0501043_0005035 Ga0501043_0005035_4007_4870 283
967 3300049579 Ga0501043_0051221 Ga0501043_0051221_1722_2573 283
968 3300049580 Ga0501046_0000499 Ga0501046_0000499_20639_21502 283
969 3300049580 Ga0501046_0049205 Ga0501046_0049205_1927_2790 283
970 3300049580 Ga0501046_0139669 Ga0501046_0139669_330_1193 283
971 3300049581 Ga0501047_0001042 Ga0501047_0001042_18243_19106 283
972 3300049581 Ga0501047_0204652 Ga0501047_0204652_637_1500 283
973 3300049581 Ga0501047_0487877 Ga0501047_0487877_143_1006 283
974 3300049582 Ga0501048_0029959 Ga0501048_0029959_584_1447 283
975 3300049582 Ga0501048_0221807 Ga0501048_0221807_391_1254 283
976 3300049584 Ga0501068_0004322 Ga0501068_0004322_4083_4946 283
977 3300049585 Ga0501069_0002891 Ga0501069_0002891_4190_5053 283
978 3300049586 Ga0501070_0000773 Ga0501070_0000773_24724_25587 283
979 3300049589 Ga0501073_0009539 Ga0501073_0009539_4264_5127 283
980 3300049589 Ga0501073_0010870 Ga0501073_0010870_542_1405 283
981 3300049589 Ga0501073_0155097 Ga0501073_0155097_657_1520 283
982 3300049589 Ga0501073_0158622 Ga0501073_0158622_308_1171 283
983 3300049590 Ga0501074_0015366 Ga0501074_0015366_215_1078 283
984 3300049663 Ga0501223_033078 Ga0501223_033078_83_949 283
985 3300049664 Ga0501224_015249 Ga0501224_015249_162_1028 283
986 3300049679 Ga0501249_000124 Ga0501249_000124_5005_5871 283
987 3300049679 Ga0501249_000246 Ga0501249_000246_10037_10921 283
988 3300049741 Ga0501079_0046250 Ga0501079_0046250_1392_2255 283
989 3300049741 Ga0501079_0335621 Ga0501079_0335621_33_896 283
990 3300049742 Ga0501080_0000326 Ga0501080_0000326_17367_18230 283
991 3300049742 Ga0501080_0130087 Ga0501080_0130087_813_1676 283
992 3300049822 Ga0501035_0009126 Ga0501035_0009126_3983_4846 283
993 3300049822 Ga0501035_0136964 Ga0501035_0136964_434_1297 283
994 3300049822 Ga0501035_0174477 Ga0501035_0174477_163_1026 283
995 3300049823 Ga0501044_0003564 Ga0501044_0003564_3983_4846 283
996 3300049823 Ga0501044_0006626 Ga0501044_0006626_8238_9101 283
997 3300049823 Ga0501044_0373593 Ga0501044_0373593_345_1208 283
998 3300049824 Ga0501045_0448897 Ga0501045_0448897_42_905 283
999 3300049850 Ga0501204_005645 Ga0501204_005645_423_1289 283
1000 3300050489 nmdc:mga03683_134383_c1 nmdc:mga03683_134383_c1_215_1078 283
1001 3300050490 nmdc:mga03n38_154959_c1 nmdc:mga03n38_154959_c1_229_1092 283
1002 3300050491 nmdc:mga00v17_177787_c1 nmdc:mga00v17_177787_c1_432_1295 283
1003 3300050492 nmdc:mga0yw44_11896_c1 nmdc:mga0yw44_11896_c1_1814_2677 283
1004 3300050492 nmdc:mga0yw44_122864_c1 nmdc:mga0yw44_122864_c1_353_1216 283
1005 3300050492 nmdc:mga0yw44_21958_c1 nmdc:mga0yw44_21958_c1_2025_2888 283
1006 3300050493 nmdc:mga0k408_83011_c1 nmdc:mga0k408_83011_c1_517_1380 283
1007 3300050494 nmdc:mga06z11_17981_c1 nmdc:mga06z11_17981_c1_801_1664 283
1008 3300050495 nmdc:mga04h51_14163_c1 nmdc:mga04h51_14163_c1_1305_2168 283
1009 3300050496 nmdc:mga07m45_65899_c1 nmdc:mga07m45_65899_c1_875_1738 283
1010 3300050509 nmdc:mga0qj67_276810_c1 nmdc:mga0qj67_276810_c1_335_1198 283
1011 3300050512 nmdc:mga0n895_46682_c1 nmdc:mga0n895_46682_c1_2092_2955 283
1012 3300050513 nmdc:mga0rr50_259288_c1 nmdc:mga0rr50_259288_c1_569_1432 283
1013 3300050516 nmdc:mga0sz30_16554_c1 nmdc:mga0sz30_16554_c1_1769_2632 283
1014 3300050516 nmdc:mga0sz30_28004_c1 nmdc:mga0sz30_28004_c1_720_1583 283
1015 3300050516 nmdc:mga0sz30_5917_c1 nmdc:mga0sz30_5917_c1_2796_3659 283
1016 3300053077 Ga0495601_0024411 Ga0495601_0024411_1677_2540 283
1017 3300053080 Ga0500635_0002397 Ga0500635_0002397_1340_2203 283
1018 3300053080 Ga0500635_0012314 Ga0500635_0012314_913_1776 283
1019 3300053085 Ga0495619_0077617 Ga0495619_0077617_643_1506 283
1020 3300053085 Ga0495619_0171841 Ga0495619_0171841_130_993 283
1021 3300053086 Ga0500578_0090485 Ga0500578_0090485_771_1634 283
1022 3300053087 Ga0500643_000060 Ga0500643_000060_74505_75368 283
1023 3300053091 Ga0500647_0010576 Ga0500647_0010576_2032_2895 283
1024 3300053093 Ga0500651_0013537 Ga0500651_0013537_2062_2925 283
1025 3300053093 Ga0500651_0086930 Ga0500651_0086930_330_1193 283
1026 3300053094 Ga0500566_0000232 Ga0500566_0000232_16001_16864 283
1027 3300053094 Ga0500566_0000433 Ga0500566_0000433_14279_15142 283
1028 3300053094 Ga0500566_0197350 Ga0500566_0197350_137_1000 283
1029 3300053096 Ga0500641_0025576 Ga0500641_0025576_511_1374 283
1030 3300053096 Ga0500641_0042983 Ga0500641_0042983_748_1611 283
1031 3300053096 Ga0500641_0128644 Ga0500641_0128644_197_1060 283
1032 3300053098 Ga0500650_0011541 Ga0500650_0011541_660_1523 283
1033 3300053102 Ga0500554_043149 Ga0500554_043149_295_1158 283
1034 3300053103 Ga0500555_001000 Ga0500555_001000_6998_7861 283
1035 3300053105 Ga0500557_000007 Ga0500557_000007_51496_52359 283
1036 3300053111 Ga0500572_000629 Ga0500572_000629_2105_2968 283
1037 3300053111 Ga0500572_001647 Ga0500572_001647_50_913 283
1038 3300053119 Ga0500595_023394 Ga0500595_023394_235_1098 283
1039 3300053121 Ga0500607_059418 Ga0500607_059418_321_1184 283
1040 3300053123 Ga0500614_001108 Ga0500614_001108_2829_3692 283
1041 3300053130 Ga0500642_0004617 Ga0500642_0004617_1840_2703 283
1042 3300053136 Ga0500559_0001723 Ga0500559_0001723_5053_5916 283
1043 3300053136 Ga0500559_0007012 Ga0500559_0007012_3056_3919 283
1044 3300053137 Ga0500561_0038078 Ga0500561_0038078_281_1144 283
1045 3300053150 Ga0500603_001060 Ga0500603_001060_1775_2638 283
1046 3300053150 Ga0500603_003471 Ga0500603_003471_1284_2147 283
1047 3300053159 Ga0500630_005547 Ga0500630_005547_2823_3686 283
1048 3300053163 Ga0500639_010254 Ga0500639_010254_3056_3919 283
1049 3300053163 Ga0500639_054758 Ga0500639_054758_1159_2022 283
1050 3300053177 Ga0500636_0025996 Ga0500636_0025996_1231_2094 283
1051 3300053178 Ga0500637_0026010 Ga0500637_0026010_1377_2240 283
1052 3300053725 Ga0500576_014386 Ga0500576_014386_765_1628 283
1053 3300053729 Ga0500625_004431 Ga0500625_004431_2965_3828 283
1054 3300053730 Ga0500645_049289 Ga0500645_049289_248_1111 283
1055 3300053731 Ga0500609_000708 Ga0500609_000708_19_882 283
1056 3300053735 Ga0500596_001871 Ga0500596_001871_2068_2931 283
1057 3300053735 Ga0500596_002960 Ga0500596_002960_336_1199 283
1058 3300053737 Ga0500601_000071 Ga0500601_000071_17944_18834 283
1059 3300053737 Ga0500601_003391 Ga0500601_003391_571_1434 283
1060 3300055283 Ga0500661_000283 Ga0500661_000283_1569_2432 283
1061 3300055283 Ga0500661_004156 Ga0500661_004156_1378_2241 283
1062 3300061719 Ga0466962_0032764 Ga0466962_0032764_1177_2040 283
1063 iso_pu_bacteria 2602042107 2603861335 283
1064 iso_pu_bacteria 2885409591 2885414076 283
1065 iso_pu_bacteria 2935638405 2935646880 283
1066 iso_pu_bacteria 2935827899 2935836147 283
1067 iso_pu_bacteria 3005506211 3005512272 283
1068 3300005335 Ga0070666_10016850 Ga0070666_100168501 284
1069 3300005347 Ga0070668_100011527 Ga0070668_1000115276 284
1070 3300005353 Ga0070669_100073590 Ga0070669_1000735902 284
1071 3300005367 Ga0070667_100000013 Ga0070667_1000000131 284
1072 3300005841 Ga0068863_100000192 Ga0068863_1000001924 284
1073 3300005843 Ga0068860_100001343 Ga0068860_1000013432 284
1074 3300006051 Ga0075364_10059723 Ga0075364_100597232 284
1075 3300006186 Ga0075369_10009297 Ga0075369_100092975 284
1076 3300009545 Ga0105237_10116230 Ga0105237_101162304 284
1077 3300025294 Ga0209025_1006289 Ga0209025_10062897 284
1078 3300025923 Ga0207681_10072592 Ga0207681_100725923 284
1079 3300025972 Ga0207668_10012810 Ga0207668_100128103 284
1080 3300025986 Ga0207658_10000068 Ga0207658_100000681 284
1081 3300026088 Ga0207641_10000074 Ga0207641_100000745 284
1082 3300027357 Ga0209589_1000004 Ga0209589_100000483 284
1083 3300027361 Ga0209489_100004 Ga0209489_10000483 284
1084 3300027363 Ga0209700_100004 Ga0209700_10000483 284
1085 3300028381 Ga0268264_10018779 Ga0268264_100187791 284
1086 3300046471 Ga0495650_0002809 Ga0495650_0002809_10383_11270 284
1087 3300048921 Ga0496118_0035179 Ga0496118_0035179_168_1043 284
1088 3300049570 Ga0501033_0043903 Ga0501033_0043903_936_1913 284
1089 3300049592 Ga0501076_0173607 Ga0501076_0173607_500_1402 284
1090 3300050491 nmdc:mga00v17_76850_c1 nmdc:mga00v17_76850_c1_757_1632 284
1091 3300050516 nmdc:mga0sz30_27264_c1 nmdc:mga0sz30_27264_c1_668_1543 284
1092 3300053094 Ga0500566_0000445 Ga0500566_0000445_20547_21422 284
1093 3300053136 Ga0500559_0002898 Ga0500559_0002898_55_930 284
1094 3300053145 Ga0500586_004250 Ga0500586_004250_544_1419 284
1095 3300053153 Ga0500616_0000031 Ga0500616_0000031_179027_179902 284
1096 3300053177 Ga0500636_0003689 Ga0500636_0003689_4245_5120 284
1097 3300001990 JGI24737J22298_10007014 JGI24737J22298_100070143 285
1098 3300003203 JGI25406J46586_10000014 JGI25406J46586_1000001411 285
1099 3300003203 JGI25406J46586_10002347 JGI25406J46586_100023473 285
1100 3300003794 Ga0055531_10001282 Ga0055531_1000128220 285
1101 3300003794 Ga0055531_10014943 Ga0055531_100149433 285
1102 3300005344 Ga0070661_100129304 Ga0070661_1001293042 285
1103 3300005455 Ga0070663_100019091 Ga0070663_1000190914 285
1104 3300005617 Ga0068859_100026770 Ga0068859_1000267703 285
1105 3300006931 Ga0097620_100026770 Ga0097620_1000267703 285
1106 3300009093 Ga0105240_10028339 Ga0105240_100283393 285
1107 3300009551 Ga0105238_10011639 Ga0105238_100116394 285
1108 3300009551 Ga0105238_10172449 Ga0105238_101724492 285
1109 3300010375 Ga0105239_10016664 Ga0105239_100166646 285
1110 3300010375 Ga0105239_10040575 Ga0105239_100405753 285
1111 3300025299 Ga0209256_1004202 Ga0209256_10042023 285
1112 3300025304 Ga0209257_1001906 Ga0209257_100190611 285
1113 3300025906 Ga0207699_10001145 Ga0207699_100011459 285
1114 3300025915 Ga0207693_10049791 Ga0207693_100497914 285
1115 3300031665 Ga0316575_10012581 Ga0316575_100125813 285
1116 3300031728 Ga0316578_10172332 Ga0316578_101723321 285
1117 3300035116 Ga0373945_0066435 Ga0373945_0066435_143_1066 285
1118 3300035398 Ga0316574_0000500 Ga0316574_0000500_7437_8363 285
1119 3300037471 Ga0395905_0117070 Ga0395905_0117070_591_1529 285
1120 3300039437 Ga0436365_0260840 Ga0436365_0260840_20086_21006 285
1121 3300039450 Ga0436363_0604370 Ga0436363_0604370_989_1909 285
1122 3300039453 Ga0436362_0119752 Ga0436362_0119752_73_993 285
1123 3300039453 Ga0436362_0907410 Ga0436362_0907410_843_1772 285
1124 3300046507 Ga0495606_0001096 Ga0495606_0001096_33347_34321 285
1125 3300048918 Ga0496115_0254856 Ga0496115_0254856_11_1015 285
1126 3300048928 Ga0496125_0027633 Ga0496125_0027633_359_1264 285
1127 3300049569 Ga0501032_0021357 Ga0501032_0021357_2562_3425 285
1128 3300049569 Ga0501032_0149285 Ga0501032_0149285_458_1378 285
1129 3300049571 Ga0501034_0012439 Ga0501034_0012439_5894_6757 285
1130 3300049573 Ga0501037_0076969 Ga0501037_0076969_807_1670 285
1131 3300049574 Ga0501038_0374584 Ga0501038_0374584_201_1064 285
1132 3300049575 Ga0501039_0136704 Ga0501039_0136704_559_1479 285
1133 3300049579 Ga0501043_0078301 Ga0501043_0078301_1106_1969 285
1134 3300049580 Ga0501046_0046091 Ga0501046_0046091_667_1530 285
1135 3300049580 Ga0501046_0055557 Ga0501046_0055557_1670_2590 285
1136 3300049582 Ga0501048_0081143 Ga0501048_0081143_200_1120 285
1137 3300049583 Ga0501067_0003275 Ga0501067_0003275_5570_6490 285
1138 3300049586 Ga0501070_0126861 Ga0501070_0126861_352_1272 285
1139 3300049589 Ga0501073_0041356 Ga0501073_0041356_1195_2115 285
1140 3300049590 Ga0501074_0086189 Ga0501074_0086189_630_1550 285
1141 3300049822 Ga0501035_0292098 Ga0501035_0292098_10_930 285
1142 3300049823 Ga0501044_0475838 Ga0501044_0475838_167_1030 285
1143 3300050490 nmdc:mga03n38_32318_c1 nmdc:mga03n38_32318_c1_631_1620 285
1144 3300053085 Ga0495619_0156690 Ga0495619_0156690_223_1227 285
1145 iso_pu_bacteria 2517093001 2517105648 285
1146 iso_pu_bacteria 2738543024 2739305789 285
1147 3300001989 JGI24739J22299_10035312 JGI24739J22299_100353121 286
1148 3300002737 JGI25162J39368_1003562 JGI25162J39368_10035622 286
1149 3300002741 JGI25157J39369_1004272 JGI25157J39369_10042722 286
1150 3300002741 JGI25157J39369_1004469 JGI25157J39369_10044693 286
1151 3300002771 JGI25163J39215_1000989 JGI25163J39215_10009897 286
1152 3300002771 JGI25163J39215_1001956 JGI25163J39215_10019563 286
1153 3300002772 JGI25164J39214_1001231 JGI25164J39214_10012313 286
1154 3300003214 JGI25165J46597_1002202 JGI25165J46597_10022028 286
1155 3300003751 Ga0055538_1002542 Ga0055538_10025423 286
1156 3300003751 Ga0055538_1002885 Ga0055538_10028853 286
1157 3300003756 Ga0055533_1000545 Ga0055533_10005451 286
1158 3300003761 Ga0055535_1002327 Ga0055535_10023278 286
1159 3300003761 Ga0055535_1018064 Ga0055535_10180641 286
1160 3300003762 Ga0055542_1000744 Ga0055542_10007443 286
1161 3300003762 Ga0055542_1003371 Ga0055542_10033712 286
1162 3300003763 Ga0055529_1001508 Ga0055529_10015083 286
1163 3300005340 Ga0070689_100000503 Ga0070689_1000005033 286
1164 3300005344 Ga0070661_100258404 Ga0070661_1002584042 286
1165 3300005455 Ga0070663_100019789 Ga0070663_1000197893 286
1166 3300013105 Ga0157369_10087630 Ga0157369_100876303 286
1167 3300014969 Ga0157376_10255422 Ga0157376_102554222 286
1168 3300015687 Ga0183368_1003 Ga0183368_1003717 286
1169 3300025206 Ga0209435_105841 Ga0209435_1058411 286
1170 3300025206 Ga0209435_107683 Ga0209435_1076832 286
1171 3300025207 Ga0209760_100585 Ga0209760_1005852 286
1172 3300025224 Ga0209784_100709 Ga0209784_1007098 286
1173 3300025226 Ga0209674_100012 Ga0209674_100012468 286
1174 3300025228 Ga0209672_101666 Ga0209672_1016667 286
1175 3300025231 Ga0207427_100156 Ga0207427_1001568 286
1176 3300025231 Ga0207427_102344 Ga0207427_1023446 286
1177 3300025233 Ga0209437_100147 Ga0209437_1001478 286
1178 3300025233 Ga0209437_100224 Ga0209437_10022449 286
1179 3300025242 Ga0209258_100049 Ga0209258_100049100 286
1180 3300025242 Ga0209258_101060 Ga0209258_1010601 286
1181 3300025246 Ga0209646_1005630 Ga0209646_10056301 286
1182 3300025250 Ga0209026_1000099 Ga0209026_1000099163 286
1183 3300025254 Ga0209148_1000005 Ga0209148_1000005995 286
1184 3300025254 Ga0209148_1000010 Ga0209148_1000010920 286
1185 3300025256 Ga0209759_1001568 Ga0209759_10015688 286
1186 3300025256 Ga0209759_1007024 Ga0209759_10070243 286
1187 3300025261 Ga0209233_1000009 Ga0209233_1000009250 286
1188 3300025261 Ga0209233_1024000 Ga0209233_10240002 286
1189 3300025272 Ga0209455_1000086 Ga0209455_1000086251 286
1190 3300025272 Ga0209455_1009241 Ga0209455_10092412 286
1191 3300025904 Ga0207647_10011712 Ga0207647_100117123 286
1192 3300025920 Ga0207649_10137710 Ga0207649_101377101 286
1193 3300025936 Ga0207670_10009585 Ga0207670_100095853 286
1194 3300026067 Ga0207678_10010017 Ga0207678_100100177 286
1195 3300039447 Ga0436361_0560308 Ga0436361_0560308_307_1182 286
1196 3300046460 Ga0495638_0002596 Ga0495638_0002596_2647_3507 286
1197 3300046460 Ga0495638_0023075 Ga0495638_0023075_2537_3397 286
1198 3300046471 Ga0495650_0000337 Ga0495650_0000337_82020_82880 286
1199 3300046507 Ga0495606_0000401 Ga0495606_0000401_31155_32015 286
1200 3300046557 Ga0495622_0039639 Ga0495622_0039639_857_1717 286
1201 3300046660 Ga0495625_0028749 Ga0495625_0028749_695_1555 286
1202 3300046694 Ga0495649_0001571 Ga0495649_0001571_11201_12061 286
1203 3300048916 Ga0496113_0002731 Ga0496113_0002731_3628_4488 286
1204 3300048917 Ga0496114_0238993 Ga0496114_0238993_25_885 286
1205 3300048918 Ga0496115_0000182 Ga0496115_0000182_2805_3665 286
1206 3300048918 Ga0496115_0000503 Ga0496115_0000503_15589_16449 286
1207 3300048918 Ga0496115_0123259 Ga0496115_0123259_241_1101 286
1208 3300048929 Ga0496126_0316652 Ga0496126_0316652_248_1108 286
1209 3300048929 Ga0496126_0479714 Ga0496126_0479714_50_910 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

136

314

0.95

PF13740

ACT_6

ACT domain

51

130

0.9

PF01842

ACT

ACT domain

53

113

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3obi-assembly1.cif.gz_A crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution 0.9608 5 286
3n0v-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9488 6 284
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9483 5 285
3n0v-assembly1.cif.gz_B crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9481 6 284
3obi-assembly1.cif.gz_A crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution 0.9478 5 286
ID Description Score Start End Superfamily
3nrbA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9372 5 87 3.30.70.260
3obiD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9334 5 87 3.30.70.260
3n0vB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9169 6 87 3.30.70.260
af_Q58953_1_90_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9132 5 85 3.30.70.260
3nrbB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9127 90 286 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A258Q1R9-F1-model_v4 Formyltetrahydrofolate deformylase 0.9928 4 117 GO:0006189
GO:0008864
AF-A0A4V1UA86-F1-model_v4 deleted 0.9793 5 113
AF-A0A3M2U885-F1-model_v4 Formyltetrahydrofolate deformylase 0.9739 6 113 GO:0006189
GO:0008864
AF-A0A258Q1R9-F1-model_v4 Formyltetrahydrofolate deformylase 0.9673 4 117 GO:0006189
GO:0008864
AF-C5TBB0-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) (Formyl-FH(4) hydrolase) 0.9651 4 285 GO:0006189
GO:0006730
GO:0008864

Feature Viewer

pLDDT pTM Quality
94.05 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map