F491699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1209 | 501 | 1204 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100328883|Ga0070714_1003288832 |
| Length | 143 |
| Sequence | VGVNGVWGTEFPSQMVDSESDTGRHLPQPAPIEAYGNGGFRFGGLSHRGSLLCFPDGIWAWPVTSIAELTPATLAPAFARADALDFFLIGGGRDPFVLPEALRQRFRDASLSVDAMATGAAVRTWNVLLAENRRVGAALIATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 5 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 6 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 7 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 8 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 10 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 25 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 26 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 150 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 262 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 263 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 264 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 266 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 267 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 268 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 269 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 270 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 271 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 272 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 280 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 281 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 282 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 283 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 284 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 286 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 287 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 288 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 289 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 291 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 295 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 297 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 301 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 308 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 312 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 317 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 318 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 319 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 322 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 323 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 324 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 325 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 326 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 327 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 330 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 331 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 332 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 333 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 334 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 335 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 336 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 337 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 338 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 339 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 340 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 343 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 344 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 422 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 423 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 424 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 425 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 426 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 427 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 430 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 431 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 432 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 433 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 434 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 435 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 436 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 459 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 463 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 487 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 489 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 492 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 498 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 499 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.25 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.14 |
| Nodule | 0.08 |
| Rhizoplane | 7.03 |
| Rhizosphere | 88.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214800771 | 2209111006 | Bacteria | 10114 |
| 2 | ARSoilYngRDRAFT_c00311 | 3300000042 | Bacteria | 7054 |
| 3 | ARcpr5yngRDRAFT_c000325 | 3300000043 | Bacteria | 6544 |
| 4 | ARSoilOldRDRAFT_c000035 | 3300000044 | Bacteria | 30405 |
| 5 | ARCol0yngRDRAFT_1000039 | 3300000652 | Bacteria | 22019 |
| 6 | JGI24736J21556_1011646 | 3300001904 | Bacteria | 1428 |
| 7 | JGI24746J21847_1001683 | 3300001977 | Bacteria | 3546 |
| 8 | JGI24747J21853_1000078 | 3300001978 | Bacteria | 4144 |
| 9 | JGI24739J22299_10003335 | 3300001989 | Bacteria | 6120 |
| 10 | JGI24737J22298_10000091 | 3300001990 | Bacteria | 26600 |
| 11 | JGI24737J22298_10002689 | 3300001990 | Bacteria | 6285 |
| 12 | JGI24743J22301_10000116 | 3300001991 | Bacteria | 7930 |
| 13 | JGI24735J21928_10070098 | 3300002067 | Bacteria | 1005 |
| 14 | JGI24750J21931_1000403 | 3300002070 | Bacteria | 7215 |
| 15 | JGI24745J21846_1000016 | 3300002073 | Bacteria | 10319 |
| 16 | JGI24748J21848_1003441 | 3300002074 | Bacteria | 1807 |
| 17 | JGI24738J21930_10000701 | 3300002075 | Bacteria | 9657 |
| 18 | JGI24749J21850_1000112 | 3300002076 | Bacteria | 13520 |
| 19 | JGI24744J21845_10004766 | 3300002077 | Bacteria | 2804 |
| 20 | JGI24035J26624_1000063 | 3300002126 | Bacteria | 8415 |
| 21 | JGI24034J26672_10000333 | 3300002239 | Bacteria | 6058 |
| 22 | JGI24742J22300_10000372 | 3300002244 | Bacteria | 6611 |
| 23 | JGI25406J46586_10011553 | 3300003203 | Bacteria | 3871 |
| 24 | JGI25406J46586_10174127 | 3300003203 | Bacteria | 627 |
| 25 | JGI25405J52794_10006686 | 3300003911 | Bacteria | 2110 |
| 26 | JGI25405J52794_10009062 | 3300003911 | Bacteria | 1872 |
| 27 | Ga0065716_1002818 | 3300005277 | Bacteria | 1503 |
| 28 | Ga0065712_10078281 | 3300005290 | Bacteria | 3368 |
| 29 | Ga0065715_10000516 | 3300005293 | Bacteria | 13613 |
| 30 | Ga0065715_10089753 | 3300005293 | Bacteria | 8608 |
| 31 | Ga0065707_10097659 | 3300005295 | Bacteria | 3155 |
| 32 | Ga0065707_10145456 | 3300005295 | Bacteria | 1720 |
| 33 | Ga0065707_10684514 | 3300005295 | Unclassified | 647 |
| 34 | Ga0070658_10102385 | 3300005327 | Bacteria | 2368 |
| 35 | Ga0070658_10228080 | 3300005327 | Bacteria | 1577 |
| 36 | Ga0070658_10237134 | 3300005327 | Bacteria | 1545 |
| 37 | Ga0070658_10635426 | 3300005327 | Bacteria | 926 |
| 38 | Ga0070676_10000364 | 3300005328 | Bacteria | 20754 |
| 39 | Ga0070676_10195938 | 3300005328 | Bacteria | 1322 |
| 40 | Ga0070683_100000748 | 3300005329 | Bacteria | 23796 |
| 41 | Ga0070683_100159387 | 3300005329 | Bacteria | 2140 |
| 42 | Ga0070683_100249305 | 3300005329 | Bacteria | 1689 |
| 43 | Ga0070683_100822410 | 3300005329 | Bacteria | 891 |
| 44 | Ga0070683_101972020 | 3300005329 | Bacteria | 561 |
| 45 | Ga0070690_100002562 | 3300005330 | Bacteria | 9783 |
| 46 | Ga0070690_100017617 | 3300005330 | Bacteria | 4299 |
| 47 | Ga0070690_100166028 | 3300005330 | Bacteria | 1516 |
| 48 | Ga0070670_100011248 | 3300005331 | Bacteria | 7650 |
| 49 | Ga0070670_100142125 | 3300005331 | Bacteria | 2076 |
| 50 | Ga0070677_10000228 | 3300005333 | Bacteria | 19343 |
| 51 | Ga0068869_100016306 | 3300005334 | Bacteria | 5005 |
| 52 | Ga0070666_10032523 | 3300005335 | Bacteria | 3446 |
| 53 | Ga0070666_10129985 | 3300005335 | Bacteria | 1749 |
| 54 | Ga0070680_100006466 | 3300005336 | Bacteria | 8910 |
| 55 | Ga0070680_100010322 | 3300005336 | Bacteria | 7200 |
| 56 | Ga0070680_100015774 | 3300005336 | Bacteria | 5931 |
| 57 | Ga0070680_100026684 | 3300005336 | Bacteria | 4619 |
| 58 | Ga0070680_100186584 | 3300005336 | Bacteria | 1747 |
| 59 | Ga0070680_100248420 | 3300005336 | Bacteria | 1504 |
| 60 | Ga0070680_100639722 | 3300005336 | Bacteria | 914 |
| 61 | Ga0070682_100001379 | 3300005337 | Bacteria | 13705 |
| 62 | Ga0070682_100121886 | 3300005337 | Bacteria | 1752 |
| 63 | Ga0070682_100155975 | 3300005337 | Bacteria | 1572 |
| 64 | Ga0068868_100001339 | 3300005338 | Bacteria | 16997 |
| 65 | Ga0070660_100001616 | 3300005339 | Bacteria | 15489 |
| 66 | Ga0070660_100065012 | 3300005339 | Bacteria | 2839 |
| 67 | Ga0070660_101008387 | 3300005339 | Bacteria | 703 |
| 68 | Ga0070689_100000146 | 3300005340 | Bacteria | 40947 |
| 69 | Ga0070691_10000065 | 3300005341 | Bacteria | 29277 |
| 70 | Ga0070691_10037556 | 3300005341 | Bacteria | 2285 |
| 71 | Ga0070687_100000023 | 3300005343 | Bacteria | 48100 |
| 72 | Ga0070687_100498358 | 3300005343 | Bacteria | 819 |
| 73 | Ga0070661_100000407 | 3300005344 | Bacteria | 33255 |
| 74 | Ga0070661_100409923 | 3300005344 | Bacteria | 1073 |
| 75 | Ga0070661_101872066 | 3300005344 | Bacteria | 510 |
| 76 | Ga0070692_10000270 | 3300005345 | Bacteria | 14505 |
| 77 | Ga0070668_100011009 | 3300005347 | Bacteria | 6732 |
| 78 | Ga0070668_100228949 | 3300005347 | Bacteria | 1536 |
| 79 | Ga0070668_100727666 | 3300005347 | Bacteria | 877 |
| 80 | Ga0070668_100832818 | 3300005347 | Bacteria | 821 |
| 81 | Ga0070669_100004155 | 3300005353 | Bacteria | 10496 |
| 82 | Ga0070669_100041857 | 3300005353 | Bacteria | 3333 |
| 83 | Ga0070675_100000306 | 3300005354 | Bacteria | 32965 |
| 84 | Ga0070675_100317093 | 3300005354 | Bacteria | 1377 |
| 85 | Ga0070675_101391628 | 3300005354 | Unclassified | 647 |
| 86 | Ga0070671_100009840 | 3300005355 | Bacteria | 7677 |
| 87 | Ga0070671_100306428 | 3300005355 | Bacteria | 1352 |
| 88 | Ga0070671_100661942 | 3300005355 | Bacteria | 904 |
| 89 | Ga0070674_100000671 | 3300005356 | Bacteria | 17297 |
| 90 | Ga0070674_100096495 | 3300005356 | Bacteria | 2145 |
| 91 | Ga0070673_100000297 | 3300005364 | Bacteria | 25890 |
| 92 | Ga0070673_100598356 | 3300005364 | Bacteria | 1006 |
| 93 | Ga0070673_100657598 | 3300005364 | Bacteria | 960 |
| 94 | Ga0070688_100004712 | 3300005365 | Bacteria | 7124 |
| 95 | Ga0070659_100001563 | 3300005366 | Bacteria | 16498 |
| 96 | Ga0070659_100156952 | 3300005366 | Bacteria | 1859 |
| 97 | Ga0070659_100684418 | 3300005366 | Bacteria | 886 |
| 98 | Ga0070667_100000745 | 3300005367 | Bacteria | 31113 |
| 99 | Ga0070667_100091711 | 3300005367 | Bacteria | 2613 |
| 100 | Ga0070667_100487063 | 3300005367 | Bacteria | 1129 |
| 101 | Ga0070709_10104162 | 3300005434 | Bacteria | 1896 |
| 102 | Ga0070714_100070353 | 3300005435 | Bacteria | 3025 |
| 103 | Ga0070714_100328883 | 3300005435 | Bacteria | 1431 |
| 104 | Ga0070714_100883425 | 3300005435 | Bacteria | 867 |
| 105 | Ga0070713_100038130 | 3300005436 | Bacteria | 3891 |
| 106 | Ga0070713_100059946 | 3300005436 | Bacteria | 3180 |
| 107 | Ga0070713_100087473 | 3300005436 | Bacteria | 2673 |
| 108 | Ga0070713_100173767 | 3300005436 | Bacteria | 1931 |
| 109 | Ga0070713_100908353 | 3300005436 | Bacteria | 847 |
| 110 | Ga0070710_10039547 | 3300005437 | Bacteria | 2595 |
| 111 | Ga0070710_10135227 | 3300005437 | Bacteria | 1507 |
| 112 | Ga0070710_10895248 | 3300005437 | Unclassified | 640 |
| 113 | Ga0070710_11259451 | 3300005437 | Bacteria | 549 |
| 114 | Ga0070701_10118045 | 3300005438 | Bacteria | 1491 |
| 115 | Ga0070711_100210435 | 3300005439 | Bacteria | 1506 |
| 116 | Ga0070711_100234967 | 3300005439 | Bacteria | 1431 |
| 117 | Ga0070711_100434713 | 3300005439 | Bacteria | 1072 |
| 118 | Ga0070711_100488296 | 3300005439 | Bacteria | 1013 |
| 119 | Ga0070711_100783137 | 3300005439 | Bacteria | 808 |
| 120 | Ga0070711_101731074 | 3300005439 | Bacteria | 548 |
| 121 | Ga0070705_100196065 | 3300005440 | Bacteria | 1381 |
| 122 | Ga0070705_100838066 | 3300005440 | Bacteria | 735 |
| 123 | Ga0070705_100872608 | 3300005440 | Bacteria | 722 |
| 124 | Ga0070700_100004819 | 3300005441 | Bacteria | 7080 |
| 125 | Ga0070700_100603734 | 3300005441 | Bacteria | 860 |
| 126 | Ga0070700_100926914 | 3300005441 | Bacteria | 711 |
| 127 | Ga0070694_100014232 | 3300005444 | Bacteria | 4979 |
| 128 | Ga0070694_100095358 | 3300005444 | Bacteria | 2095 |
| 129 | Ga0070708_100112513 | 3300005445 | Bacteria | 2504 |
| 130 | Ga0070708_100296696 | 3300005445 | Bacteria | 1522 |
| 131 | Ga0070663_100000121 | 3300005455 | Bacteria | 36740 |
| 132 | Ga0070663_100025382 | 3300005455 | Bacteria | 4000 |
| 133 | Ga0070663_100030390 | 3300005455 | Bacteria | 3701 |
| 134 | Ga0070663_100224449 | 3300005455 | Bacteria | 1476 |
| 135 | Ga0070663_100746130 | 3300005455 | Bacteria | 835 |
| 136 | Ga0070678_100089894 | 3300005456 | Bacteria | 2352 |
| 137 | Ga0070678_100400349 | 3300005456 | Bacteria | 1192 |
| 138 | Ga0070662_100007921 | 3300005457 | Bacteria | 6909 |
| 139 | Ga0070662_100011135 | 3300005457 | Bacteria | 5924 |
| 140 | Ga0070662_100410465 | 3300005457 | Bacteria | 1119 |
| 141 | Ga0070662_101167975 | 3300005457 | Bacteria | 661 |
| 142 | Ga0070681_10004011 | 3300005458 | Bacteria | 13893 |
| 143 | Ga0070681_10067881 | 3300005458 | Bacteria | 3533 |
| 144 | Ga0070681_10222980 | 3300005458 | Bacteria | 1800 |
| 145 | Ga0070681_10228885 | 3300005458 | Bacteria | 1773 |
| 146 | Ga0070681_10787947 | 3300005458 | Bacteria | 867 |
| 147 | Ga0068867_100000553 | 3300005459 | Bacteria | 24675 |
| 148 | Ga0068867_100470041 | 3300005459 | Bacteria | 1075 |
| 149 | Ga0070685_10000632 | 3300005466 | Bacteria | 19266 |
| 150 | Ga0070685_10005595 | 3300005466 | Bacteria | 6375 |
| 151 | Ga0074259_10260207 | 3300005507 | Bacteria | 802 |
| 152 | Ga0070699_100134004 | 3300005518 | Bacteria | 2185 |
| 153 | Ga0070679_100005467 | 3300005530 | Bacteria | 11781 |
| 154 | Ga0070679_100064214 | 3300005530 | Bacteria | 3659 |
| 155 | Ga0070679_100117077 | 3300005530 | Bacteria | 2649 |
| 156 | Ga0070679_100125165 | 3300005530 | Bacteria | 2553 |
| 157 | Ga0070679_100226048 | 3300005530 | Bacteria | 1832 |
| 158 | Ga0070679_100252778 | 3300005530 | Bacteria | 1718 |
| 159 | Ga0070679_100377845 | 3300005530 | Bacteria | 1364 |
| 160 | Ga0070679_100526863 | 3300005530 | Bacteria | 1125 |
| 161 | Ga0070679_101023342 | 3300005530 | Bacteria | 770 |
| 162 | Ga0070679_101217576 | 3300005530 | Bacteria | 698 |
| 163 | Ga0070684_100000454 | 3300005535 | Bacteria | 27974 |
| 164 | Ga0070684_100553191 | 3300005535 | Bacteria | 1068 |
| 165 | Ga0070697_100348928 | 3300005536 | Bacteria | 1278 |
| 166 | Ga0070697_100382202 | 3300005536 | Bacteria | 1220 |
| 167 | Ga0070697_101809432 | 3300005536 | Bacteria | 546 |
| 168 | Ga0068853_100116823 | 3300005539 | Bacteria | 2376 |
| 169 | Ga0068853_101095680 | 3300005539 | Bacteria | 768 |
| 170 | Ga0070672_100000045 | 3300005543 | Bacteria | 53368 |
| 171 | Ga0070686_100000480 | 3300005544 | Bacteria | 24146 |
| 172 | Ga0070686_100035382 | 3300005544 | Bacteria | 3084 |
| 173 | Ga0070686_100211338 | 3300005544 | Bacteria | 1397 |
| 174 | Ga0070686_100375582 | 3300005544 | Bacteria | 1075 |
| 175 | Ga0070686_100858666 | 3300005544 | Bacteria | 736 |
| 176 | Ga0070695_100004089 | 3300005545 | Bacteria | 8529 |
| 177 | Ga0070695_100004677 | 3300005545 | Bacteria | 8050 |
| 178 | Ga0070695_100055080 | 3300005545 | Bacteria | 2563 |
| 179 | Ga0070695_100829084 | 3300005545 | Bacteria | 743 |
| 180 | Ga0070696_100004193 | 3300005546 | Bacteria | 9602 |
| 181 | Ga0070696_100385187 | 3300005546 | Bacteria | 1094 |
| 182 | Ga0070696_100818601 | 3300005546 | Bacteria | 767 |
| 183 | Ga0070696_101276047 | 3300005546 | Bacteria | 623 |
| 184 | Ga0070693_100004943 | 3300005547 | Bacteria | 6364 |
| 185 | Ga0070693_100177847 | 3300005547 | Bacteria | 1368 |
| 186 | Ga0070693_100644696 | 3300005547 | Bacteria | 770 |
| 187 | Ga0070665_100054904 | 3300005548 | Bacteria | 3995 |
| 188 | Ga0070665_100574211 | 3300005548 | Bacteria | 1140 |
| 189 | Ga0070665_100621294 | 3300005548 | Bacteria | 1094 |
| 190 | Ga0070704_100000031 | 3300005549 | Bacteria | 45832 |
| 191 | Ga0070704_100067875 | 3300005549 | Bacteria | 2577 |
| 192 | Ga0068855_100006104 | 3300005563 | Bacteria | 14691 |
| 193 | Ga0068855_100021624 | 3300005563 | Bacteria | 7716 |
| 194 | Ga0068855_100214826 | 3300005563 | Bacteria | 2159 |
| 195 | Ga0070664_100000899 | 3300005564 | Bacteria | 23157 |
| 196 | Ga0070664_100165056 | 3300005564 | Bacteria | 1962 |
| 197 | Ga0070664_100222742 | 3300005564 | Bacteria | 1688 |
| 198 | Ga0070664_100359277 | 3300005564 | Bacteria | 1326 |
| 199 | Ga0070664_100638975 | 3300005564 | Bacteria | 989 |
| 200 | Ga0068857_100000623 | 3300005577 | Bacteria | 26056 |
| 201 | Ga0068857_100056322 | 3300005577 | Bacteria | 3489 |
| 202 | Ga0068857_102169256 | 3300005577 | Bacteria | 545 |
| 203 | Ga0068854_100421682 | 3300005578 | Bacteria | 1109 |
| 204 | Ga0068854_100686888 | 3300005578 | Bacteria | 882 |
| 205 | Ga0068856_100004332 | 3300005614 | Bacteria | 14153 |
| 206 | Ga0068856_100016984 | 3300005614 | Bacteria | 7054 |
| 207 | Ga0068856_100698661 | 3300005614 | Bacteria | 1035 |
| 208 | Ga0070702_100000128 | 3300005615 | Bacteria | 23219 |
| 209 | Ga0068852_100051090 | 3300005616 | Bacteria | 3546 |
| 210 | Ga0068852_100195162 | 3300005616 | Bacteria | 1913 |
| 211 | Ga0068852_100203811 | 3300005616 | Bacteria | 1873 |
| 212 | Ga0068852_100577512 | 3300005616 | Bacteria | 1126 |
| 213 | Ga0068852_101702292 | 3300005616 | Bacteria | 653 |
| 214 | Ga0068859_100001291 | 3300005617 | Bacteria | 25582 |
| 215 | Ga0068859_100019144 | 3300005617 | Bacteria | 6875 |
| 216 | Ga0068859_101156887 | 3300005617 | Bacteria | 852 |
| 217 | Ga0068864_100010716 | 3300005618 | Bacteria | 7576 |
| 218 | Ga0068864_100327381 | 3300005618 | Bacteria | 1440 |
| 219 | Ga0068864_100469223 | 3300005618 | Bacteria | 1206 |
| 220 | Ga0068864_100617004 | 3300005618 | Bacteria | 1054 |
| 221 | Ga0068866_10000346 | 3300005718 | Bacteria | 21828 |
| 222 | Ga0068861_100000045 | 3300005719 | Bacteria | 56440 |
| 223 | Ga0068861_102579018 | 3300005719 | Bacteria | 512 |
| 224 | Ga0068851_10167711 | 3300005834 | Bacteria | 1210 |
| 225 | Ga0068870_10000213 | 3300005840 | Bacteria | 20950 |
| 226 | Ga0068863_100001919 | 3300005841 | Bacteria | 20657 |
| 227 | Ga0068863_101861975 | 3300005841 | Bacteria | 611 |
| 228 | Ga0068858_100000307 | 3300005842 | Bacteria | 52034 |
| 229 | Ga0068858_100083063 | 3300005842 | Bacteria | 2978 |
| 230 | Ga0068858_100437323 | 3300005842 | Bacteria | 1259 |
| 231 | Ga0068858_101129463 | 3300005842 | Bacteria | 770 |
| 232 | Ga0068860_100001587 | 3300005843 | Bacteria | 24464 |
| 233 | Ga0068860_100035732 | 3300005843 | Bacteria | 4765 |
| 234 | Ga0068860_100115847 | 3300005843 | Bacteria | 2563 |
| 235 | Ga0068860_100167288 | 3300005843 | Bacteria | 2123 |
| 236 | Ga0068860_100418637 | 3300005843 | Bacteria | 1328 |
| 237 | Ga0068860_100459616 | 3300005843 | Bacteria | 1267 |
| 238 | Ga0068862_100001373 | 3300005844 | Bacteria | 22626 |
| 239 | Ga0081455_10000036 | 3300005937 | Bacteria | 136303 |
| 240 | Ga0081455_10030438 | 3300005937 | Bacteria | 4902 |
| 241 | Ga0081455_10369011 | 3300005937 | Bacteria | 1007 |
| 242 | Ga0081455_10739402 | 3300005937 | Bacteria | 623 |
| 243 | Ga0081540_1013693 | 3300005983 | Bacteria | 5257 |
| 244 | Ga0081540_1167688 | 3300005983 | Bacteria | 842 |
| 245 | Ga0081539_10002576 | 3300005985 | Bacteria | 25031 |
| 246 | Ga0081539_10015291 | 3300005985 | Bacteria | 5588 |
| 247 | Ga0070717_10433692 | 3300006028 | Bacteria | 1183 |
| 248 | Ga0075365_10009225 | 3300006038 | Bacteria | 5659 |
| 249 | Ga0075368_10247047 | 3300006042 | Bacteria | 762 |
| 250 | Ga0075363_100045621 | 3300006048 | Bacteria | 2324 |
| 251 | Ga0075432_10001113 | 3300006058 | Bacteria | 8609 |
| 252 | Ga0075432_10036353 | 3300006058 | Bacteria | 1712 |
| 253 | Ga0075432_10229341 | 3300006058 | Bacteria | 746 |
| 254 | Ga0070716_100018437 | 3300006173 | Bacteria | 3636 |
| 255 | Ga0070712_100131019 | 3300006175 | Bacteria | 1900 |
| 256 | Ga0070712_100227037 | 3300006175 | Bacteria | 1481 |
| 257 | Ga0070712_100532489 | 3300006175 | Bacteria | 988 |
| 258 | Ga0070712_100829224 | 3300006175 | Bacteria | 795 |
| 259 | Ga0075362_10374700 | 3300006177 | Bacteria | 715 |
| 260 | Ga0075367_10019195 | 3300006178 | Bacteria | 3788 |
| 261 | Ga0075367_10049407 | 3300006178 | Bacteria | 2479 |
| 262 | Ga0075369_10003411 | 3300006186 | Bacteria | 5784 |
| 263 | Ga0075427_10001574 | 3300006194 | Bacteria | 2948 |
| 264 | Ga0097621_100002565 | 3300006237 | Bacteria | 12447 |
| 265 | Ga0097621_100071435 | 3300006237 | Bacteria | 2868 |
| 266 | Ga0097621_100811208 | 3300006237 | Bacteria | 867 |
| 267 | Ga0097621_101263713 | 3300006237 | Bacteria | 696 |
| 268 | Ga0075370_10124671 | 3300006353 | Bacteria | 1501 |
| 269 | Ga0075370_10346860 | 3300006353 | Bacteria | 887 |
| 270 | Ga0068871_100000654 | 3300006358 | Bacteria | 23817 |
| 271 | Ga0068871_100141291 | 3300006358 | Bacteria | 2047 |
| 272 | Ga0068871_100276495 | 3300006358 | Bacteria | 1468 |
| 273 | Ga0075428_100075267 | 3300006844 | Bacteria | 3687 |
| 274 | Ga0075430_100001350 | 3300006846 | Bacteria | 19843 |
| 275 | Ga0075431_100001300 | 3300006847 | Bacteria | 22820 |
| 276 | Ga0075433_10000773 | 3300006852 | Bacteria | 22008 |
| 277 | Ga0075433_10071240 | 3300006852 | Bacteria | 3056 |
| 278 | Ga0075433_10239016 | 3300006852 | Bacteria | 1612 |
| 279 | Ga0075434_100001539 | 3300006871 | Bacteria | 19519 |
| 280 | Ga0075434_100010228 | 3300006871 | Bacteria | 8787 |
| 281 | Ga0075434_100079695 | 3300006871 | Bacteria | 3271 |
| 282 | Ga0075434_100114246 | 3300006871 | Bacteria | 2713 |
| 283 | Ga0075434_100370080 | 3300006871 | Bacteria | 1454 |
| 284 | Ga0075434_100880397 | 3300006871 | Bacteria | 911 |
| 285 | Ga0075429_100002588 | 3300006880 | Bacteria | 15248 |
| 286 | Ga0075429_100828443 | 3300006880 | Bacteria | 810 |
| 287 | Ga0068865_100001596 | 3300006881 | Bacteria | 13269 |
| 288 | Ga0068865_100068331 | 3300006881 | Bacteria | 2512 |
| 289 | Ga0068865_100113507 | 3300006881 | Bacteria | 2003 |
| 290 | Ga0075436_100016509 | 3300006914 | Bacteria | 5054 |
| 291 | Ga0075436_100209846 | 3300006914 | Bacteria | 1380 |
| 292 | Ga0075436_100246702 | 3300006914 | Bacteria | 1271 |
| 293 | Ga0075436_100296034 | 3300006914 | Bacteria | 1159 |
| 294 | Ga0075436_100377500 | 3300006914 | Bacteria | 1025 |
| 295 | Ga0097620_100001291 | 3300006931 | Bacteria | 25582 |
| 296 | Ga0097620_100019143 | 3300006931 | Bacteria | 6875 |
| 297 | Ga0097620_101157029 | 3300006931 | Bacteria | 852 |
| 298 | Ga0075435_100080026 | 3300007076 | Bacteria | 2682 |
| 299 | Ga0075435_100109691 | 3300007076 | Bacteria | 2294 |
| 300 | Ga0075435_100158348 | 3300007076 | Bacteria | 1907 |
| 301 | Ga0075435_100305516 | 3300007076 | Bacteria | 1361 |
| 302 | Ga0105251_10017546 | 3300009011 | Bacteria | 3832 |
| 303 | Ga0105244_10028774 | 3300009036 | Bacteria | 2978 |
| 304 | Ga0105250_10077138 | 3300009092 | Bacteria | 1349 |
| 305 | Ga0105240_10214588 | 3300009093 | Bacteria | 2246 |
| 306 | Ga0105240_10230353 | 3300009093 | Bacteria | 2153 |
| 307 | Ga0105240_11182161 | 3300009093 | Bacteria | 811 |
| 308 | Ga0105240_11503080 | 3300009093 | Bacteria | 706 |
| 309 | Ga0111539_10000591 | 3300009094 | Bacteria | 46788 |
| 310 | Ga0111539_10001213 | 3300009094 | Bacteria | 34317 |
| 311 | Ga0111539_10002431 | 3300009094 | Bacteria | 24766 |
| 312 | Ga0111539_10550666 | 3300009094 | Bacteria | 1344 |
| 313 | Ga0105245_10001033 | 3300009098 | Bacteria | 25290 |
| 314 | Ga0105245_10088321 | 3300009098 | Bacteria | 2847 |
| 315 | Ga0105245_10952132 | 3300009098 | Bacteria | 902 |
| 316 | Ga0105247_10028489 | 3300009101 | Bacteria | 3380 |
| 317 | Ga0105247_10058878 | 3300009101 | Bacteria | 2377 |
| 318 | Ga0105247_10158304 | 3300009101 | Bacteria | 1497 |
| 319 | Ga0105247_10273385 | 3300009101 | Bacteria | 1163 |
| 320 | Ga0105247_10453105 | 3300009101 | Bacteria | 925 |
| 321 | Ga0114129_10002229 | 3300009147 | Bacteria | 26735 |
| 322 | Ga0114129_10012044 | 3300009147 | Bacteria | 12301 |
| 323 | Ga0114129_11098779 | 3300009147 | Bacteria | 996 |
| 324 | Ga0105243_10000678 | 3300009148 | Bacteria | 33239 |
| 325 | Ga0105243_10027310 | 3300009148 | Bacteria | 4372 |
| 326 | Ga0105243_10075091 | 3300009148 | Bacteria | 2743 |
| 327 | Ga0105243_10462052 | 3300009148 | Bacteria | 1194 |
| 328 | Ga0105241_10025430 | 3300009174 | Bacteria | 4399 |
| 329 | Ga0105241_10028187 | 3300009174 | Bacteria | 4183 |
| 330 | Ga0105241_11545427 | 3300009174 | Bacteria | 640 |
| 331 | Ga0105242_10002866 | 3300009176 | Bacteria | 13505 |
| 332 | Ga0105242_10015968 | 3300009176 | Bacteria | 5835 |
| 333 | Ga0105242_10391248 | 3300009176 | Bacteria | 1295 |
| 334 | Ga0105248_10000399 | 3300009177 | Bacteria | 50267 |
| 335 | Ga0105248_10017966 | 3300009177 | Bacteria | 7806 |
| 336 | Ga0105248_10087692 | 3300009177 | Bacteria | 3502 |
| 337 | Ga0105248_10313139 | 3300009177 | Bacteria | 1768 |
| 338 | Ga0105248_10382112 | 3300009177 | Bacteria | 1586 |
| 339 | Ga0105237_10015879 | 3300009545 | Bacteria | 7829 |
| 340 | Ga0105237_10196224 | 3300009545 | Bacteria | 2019 |
| 341 | Ga0105237_10780527 | 3300009545 | Bacteria | 962 |
| 342 | Ga0105238_10045890 | 3300009551 | Bacteria | 4413 |
| 343 | Ga0105238_10154050 | 3300009551 | Bacteria | 2273 |
| 344 | Ga0105249_10000540 | 3300009553 | Bacteria | 34962 |
| 345 | Ga0105249_10003822 | 3300009553 | Bacteria | 12997 |
| 346 | Ga0105249_10344665 | 3300009553 | Bacteria | 1508 |
| 347 | Ga0105249_11062943 | 3300009553 | Bacteria | 879 |
| 348 | Ga0105249_13163810 | 3300009553 | Bacteria | 529 |
| 349 | Ga0105239_10018383 | 3300010375 | Bacteria | 7725 |
| 350 | Ga0105239_10357961 | 3300010375 | Bacteria | 1648 |
| 351 | Ga0105239_10818301 | 3300010375 | Bacteria | 1067 |
| 352 | Ga0105246_10000212 | 3300011119 | Bacteria | 29504 |
| 353 | Ga0105246_10132920 | 3300011119 | Bacteria | 1861 |
| 354 | Ga0105246_10287379 | 3300011119 | Bacteria | 1322 |
| 355 | Ga0105246_10428427 | 3300011119 | Bacteria | 1106 |
| 356 | Ga0105246_11089332 | 3300011119 | Bacteria | 729 |
| 357 | Ga0157315_1000632 | 3300012508 | Bacteria | 1685 |
| 358 | Ga0157316_1010643 | 3300012510 | Bacteria | 848 |
| 359 | Ga0157373_10005412 | 3300013100 | Bacteria | 9590 |
| 360 | Ga0157373_10494482 | 3300013100 | Bacteria | 883 |
| 361 | Ga0157371_10037376 | 3300013102 | Bacteria | 3474 |
| 362 | Ga0157371_10130578 | 3300013102 | Bacteria | 1787 |
| 363 | Ga0157371_10429048 | 3300013102 | Bacteria | 970 |
| 364 | Ga0157371_10713237 | 3300013102 | Bacteria | 751 |
| 365 | Ga0157370_10246943 | 3300013104 | Bacteria | 1651 |
| 366 | Ga0157369_10161484 | 3300013105 | Bacteria | 2365 |
| 367 | Ga0157369_10178812 | 3300013105 | Bacteria | 2233 |
| 368 | Ga0157369_10574372 | 3300013105 | Unclassified | 1164 |
| 369 | Ga0157369_11270972 | 3300013105 | Unclassified | 750 |
| 370 | Ga0157369_11983077 | 3300013105 | Bacteria | 591 |
| 371 | Ga0157374_10001186 | 3300013296 | Bacteria | 22265 |
| 372 | Ga0157374_10016564 | 3300013296 | Bacteria | 6482 |
| 373 | Ga0157374_10629689 | 3300013296 | Bacteria | 1084 |
| 374 | Ga0157378_10013662 | 3300013297 | Bacteria | 7100 |
| 375 | Ga0157378_10086710 | 3300013297 | Bacteria | 2838 |
| 376 | Ga0157378_10188949 | 3300013297 | Bacteria | 1942 |
| 377 | Ga0163162_10000762 | 3300013306 | Bacteria | 29970 |
| 378 | Ga0163162_10242845 | 3300013306 | Bacteria | 1932 |
| 379 | Ga0163162_10618693 | 3300013306 | Bacteria | 1208 |
| 380 | Ga0163162_10800021 | 3300013306 | Bacteria | 1060 |
| 381 | Ga0157372_10006437 | 3300013307 | Bacteria | 12502 |
| 382 | Ga0157372_10910997 | 3300013307 | Bacteria | 1020 |
| 383 | Ga0157372_10990306 | 3300013307 | Bacteria | 974 |
| 384 | Ga0157372_11903094 | 3300013307 | Bacteria | 684 |
| 385 | Ga0157372_11916079 | 3300013307 | Bacteria | 681 |
| 386 | Ga0157375_10000177 | 3300013308 | Bacteria | 59436 |
| 387 | Ga0157375_10391459 | 3300013308 | Bacteria | 1556 |
| 388 | Ga0157375_10483849 | 3300013308 | Bacteria | 1403 |
| 389 | Ga0163163_10001917 | 3300014325 | Bacteria | 17610 |
| 390 | Ga0163163_10004152 | 3300014325 | Bacteria | 12341 |
| 391 | Ga0163163_10235321 | 3300014325 | Bacteria | 1881 |
| 392 | Ga0163163_10313858 | 3300014325 | Bacteria | 1621 |
| 393 | Ga0163163_10328068 | 3300014325 | Bacteria | 1584 |
| 394 | Ga0157380_10003066 | 3300014326 | Bacteria | 11383 |
| 395 | Ga0157380_10086328 | 3300014326 | Bacteria | 2578 |
| 396 | Ga0182008_10053772 | 3300014497 | Bacteria | 1993 |
| 397 | Ga0157377_10000178 | 3300014745 | Bacteria | 37090 |
| 398 | Ga0157379_10000135 | 3300014968 | Bacteria | 52814 |
| 399 | Ga0157379_10030636 | 3300014968 | Bacteria | 4791 |
| 400 | Ga0157379_10087467 | 3300014968 | Bacteria | 2794 |
| 401 | Ga0157379_10104256 | 3300014968 | Bacteria | 2545 |
| 402 | Ga0157379_10161685 | 3300014968 | Bacteria | 2021 |
| 403 | Ga0157376_10001353 | 3300014969 | Bacteria | 16134 |
| 404 | Ga0157376_10173614 | 3300014969 | Bacteria | 1965 |
| 405 | Ga0157376_10233540 | 3300014969 | Bacteria | 1710 |
| 406 | Ga0157376_10282374 | 3300014969 | Bacteria | 1564 |
| 407 | Ga0163161_10000867 | 3300017792 | Bacteria | 23543 |
| 408 | Ga0206356_10003349 | 3300020070 | Bacteria | 560 |
| 409 | Ga0206354_10693229 | 3300020081 | Bacteria | 2343 |
| 410 | Ga0206353_10814796 | 3300020082 | Bacteria | 2322 |
| 411 | Ga0209233_1011403 | 3300025261 | Bacteria | 2619 |
| 412 | Ga0207666_1000021 | 3300025271 | Bacteria | 37690 |
| 413 | Ga0207666_1000444 | 3300025271 | Bacteria | 5358 |
| 414 | Ga0207673_1000845 | 3300025290 | Bacteria | 3278 |
| 415 | Ga0207697_10001014 | 3300025315 | Bacteria | 15717 |
| 416 | Ga0207697_10006655 | 3300025315 | Bacteria | 5209 |
| 417 | Ga0207656_10645211 | 3300025321 | Unclassified | 541 |
| 418 | Ga0207653_10005540 | 3300025885 | Bacteria | 3941 |
| 419 | Ga0207682_10000426 | 3300025893 | Bacteria | 19421 |
| 420 | Ga0207692_10054182 | 3300025898 | Bacteria | 2047 |
| 421 | Ga0207692_10113421 | 3300025898 | Bacteria | 1507 |
| 422 | Ga0207692_10124951 | 3300025898 | Bacteria | 1445 |
| 423 | Ga0207692_10379321 | 3300025898 | Bacteria | 877 |
| 424 | Ga0207642_10001961 | 3300025899 | Bacteria | 6349 |
| 425 | Ga0207710_10015779 | 3300025900 | Bacteria | 3194 |
| 426 | Ga0207688_10000017 | 3300025901 | Bacteria | 52729 |
| 427 | Ga0207688_10555207 | 3300025901 | Bacteria | 722 |
| 428 | Ga0207688_10878994 | 3300025901 | Unclassified | 568 |
| 429 | Ga0207680_10015394 | 3300025903 | Bacteria | 3991 |
| 430 | Ga0207680_10030371 | 3300025903 | Bacteria | 3047 |
| 431 | Ga0207647_10005524 | 3300025904 | Bacteria | 9257 |
| 432 | Ga0207685_10021875 | 3300025905 | Bacteria | 2151 |
| 433 | Ga0207699_10115621 | 3300025906 | Bacteria | 1726 |
| 434 | Ga0207699_10201279 | 3300025906 | Bacteria | 1349 |
| 435 | Ga0207699_10259235 | 3300025906 | Bacteria | 1201 |
| 436 | Ga0207645_10000074 | 3300025907 | Bacteria | 71544 |
| 437 | Ga0207645_10385640 | 3300025907 | Bacteria | 941 |
| 438 | Ga0207643_10000058 | 3300025908 | Bacteria | 73498 |
| 439 | Ga0207643_11064081 | 3300025908 | Bacteria | 522 |
| 440 | Ga0207705_10078348 | 3300025909 | Bacteria | 2405 |
| 441 | Ga0207705_10686069 | 3300025909 | Bacteria | 796 |
| 442 | Ga0207705_11131735 | 3300025909 | Bacteria | 602 |
| 443 | Ga0207654_10020901 | 3300025911 | Bacteria | 3475 |
| 444 | Ga0207654_10073983 | 3300025911 | Bacteria | 2032 |
| 445 | Ga0207654_10122366 | 3300025911 | Bacteria | 1636 |
| 446 | Ga0207707_10007073 | 3300025912 | Bacteria | 9781 |
| 447 | Ga0207707_10139708 | 3300025912 | Bacteria | 2118 |
| 448 | Ga0207707_10161129 | 3300025912 | Bacteria | 1961 |
| 449 | Ga0207707_10164931 | 3300025912 | Bacteria | 1936 |
| 450 | Ga0207695_10057979 | 3300025913 | Bacteria | 4021 |
| 451 | Ga0207695_10100177 | 3300025913 | Bacteria | 2894 |
| 452 | Ga0207671_10544356 | 3300025914 | Bacteria | 925 |
| 453 | Ga0207693_10013942 | 3300025915 | Bacteria | 6472 |
| 454 | Ga0207693_10079128 | 3300025915 | Bacteria | 2572 |
| 455 | Ga0207693_10084244 | 3300025915 | Bacteria | 2491 |
| 456 | Ga0207693_10123787 | 3300025915 | Bacteria | 2032 |
| 457 | Ga0207693_10213470 | 3300025915 | Bacteria | 1517 |
| 458 | Ga0207663_10091487 | 3300025916 | Bacteria | 2020 |
| 459 | Ga0207663_10274104 | 3300025916 | Bacteria | 1251 |
| 460 | Ga0207663_10668812 | 3300025916 | Bacteria | 820 |
| 461 | Ga0207663_10999972 | 3300025916 | Bacteria | 671 |
| 462 | Ga0207660_10000578 | 3300025917 | Bacteria | 24655 |
| 463 | Ga0207660_10159000 | 3300025917 | Bacteria | 1742 |
| 464 | Ga0207660_10177736 | 3300025917 | Bacteria | 1651 |
| 465 | Ga0207660_10258975 | 3300025917 | Bacteria | 1375 |
| 466 | Ga0207660_10477817 | 3300025917 | Bacteria | 1010 |
| 467 | Ga0207660_10788597 | 3300025917 | Bacteria | 775 |
| 468 | Ga0207660_10923668 | 3300025917 | Bacteria | 712 |
| 469 | Ga0207662_10000069 | 3300025918 | Bacteria | 45774 |
| 470 | Ga0207662_10005716 | 3300025918 | Bacteria | 6653 |
| 471 | Ga0207662_10577514 | 3300025918 | Bacteria | 780 |
| 472 | Ga0207657_10000721 | 3300025919 | Bacteria | 35100 |
| 473 | Ga0207657_10086818 | 3300025919 | Bacteria | 2618 |
| 474 | Ga0207657_10145048 | 3300025919 | Bacteria | 1937 |
| 475 | Ga0207657_10548307 | 3300025919 | Bacteria | 904 |
| 476 | Ga0207649_10000282 | 3300025920 | Bacteria | 40055 |
| 477 | Ga0207649_11374825 | 3300025920 | Unclassified | 559 |
| 478 | Ga0207652_10009825 | 3300025921 | Bacteria | 7700 |
| 479 | Ga0207652_10011123 | 3300025921 | Bacteria | 7253 |
| 480 | Ga0207652_10101582 | 3300025921 | Bacteria | 2540 |
| 481 | Ga0207652_10116076 | 3300025921 | Bacteria | 2378 |
| 482 | Ga0207652_10143996 | 3300025921 | Bacteria | 2132 |
| 483 | Ga0207652_10265213 | 3300025921 | Bacteria | 1549 |
| 484 | Ga0207681_10000806 | 3300025923 | Bacteria | 20631 |
| 485 | Ga0207681_10120433 | 3300025923 | Bacteria | 1924 |
| 486 | Ga0207694_10020964 | 3300025924 | Bacteria | 4947 |
| 487 | Ga0207650_10004953 | 3300025925 | Bacteria | 9101 |
| 488 | Ga0207650_10050620 | 3300025925 | Bacteria | 3073 |
| 489 | Ga0207659_10000039 | 3300025926 | Bacteria | 91685 |
| 490 | Ga0207659_11260047 | 3300025926 | Bacteria | 635 |
| 491 | Ga0207687_10008561 | 3300025927 | Bacteria | 6691 |
| 492 | Ga0207687_10018052 | 3300025927 | Bacteria | 4654 |
| 493 | Ga0207700_10002144 | 3300025928 | Bacteria | 11295 |
| 494 | Ga0207700_10084024 | 3300025928 | Bacteria | 2494 |
| 495 | Ga0207700_10114255 | 3300025928 | Bacteria | 2178 |
| 496 | Ga0207700_10179797 | 3300025928 | Bacteria | 1770 |
| 497 | Ga0207700_10501396 | 3300025928 | Bacteria | 1074 |
| 498 | Ga0207700_11163582 | 3300025928 | Bacteria | 689 |
| 499 | Ga0207664_10035588 | 3300025929 | Bacteria | 3843 |
| 500 | Ga0207664_10383031 | 3300025929 | Bacteria | 1249 |
| 501 | Ga0207664_11533242 | 3300025929 | Bacteria | 588 |
| 502 | Ga0207644_10006357 | 3300025931 | Bacteria | 7693 |
| 503 | Ga0207644_10034963 | 3300025931 | Bacteria | 3518 |
| 504 | Ga0207644_10034966 | 3300025931 | Bacteria | 3518 |
| 505 | Ga0207644_10049974 | 3300025931 | Bacteria | 2996 |
| 506 | Ga0207690_10000303 | 3300025932 | Bacteria | 34378 |
| 507 | Ga0207690_10434516 | 3300025932 | Bacteria | 1052 |
| 508 | Ga0207690_11362253 | 3300025932 | Unclassified | 593 |
| 509 | Ga0207706_10002511 | 3300025933 | Bacteria | 17885 |
| 510 | Ga0207706_10036762 | 3300025933 | Bacteria | 4350 |
| 511 | Ga0207706_10115647 | 3300025933 | Bacteria | 2359 |
| 512 | Ga0207686_10000540 | 3300025934 | Bacteria | 24486 |
| 513 | Ga0207709_10000970 | 3300025935 | Bacteria | 21414 |
| 514 | Ga0207709_10098509 | 3300025935 | Bacteria | 1928 |
| 515 | Ga0207709_10357161 | 3300025935 | Bacteria | 1105 |
| 516 | Ga0207709_10418480 | 3300025935 | Bacteria | 1029 |
| 517 | Ga0207670_10000200 | 3300025936 | Bacteria | 39476 |
| 518 | Ga0207669_10000098 | 3300025937 | Bacteria | 43800 |
| 519 | Ga0207669_10017634 | 3300025937 | Bacteria | 3669 |
| 520 | Ga0207669_10178040 | 3300025937 | Bacteria | 1521 |
| 521 | Ga0207669_10222883 | 3300025937 | Bacteria | 1385 |
| 522 | Ga0207704_10004239 | 3300025938 | Bacteria | 6553 |
| 523 | Ga0207704_10053256 | 3300025938 | Bacteria | 2459 |
| 524 | Ga0207704_10088865 | 3300025938 | Bacteria | 2023 |
| 525 | Ga0207665_10000905 | 3300025939 | Bacteria | 19985 |
| 526 | Ga0207665_10140093 | 3300025939 | Bacteria | 1724 |
| 527 | Ga0207691_10000169 | 3300025940 | Bacteria | 60909 |
| 528 | Ga0207711_10003735 | 3300025941 | Bacteria | 13126 |
| 529 | Ga0207711_10050482 | 3300025941 | Bacteria | 3561 |
| 530 | Ga0207711_10055122 | 3300025941 | Bacteria | 3413 |
| 531 | Ga0207711_10613047 | 3300025941 | Bacteria | 1015 |
| 532 | Ga0207689_10000363 | 3300025942 | Bacteria | 42824 |
| 533 | Ga0207689_11044547 | 3300025942 | Bacteria | 689 |
| 534 | Ga0207661_10000700 | 3300025944 | Bacteria | 21749 |
| 535 | Ga0207661_10097304 | 3300025944 | Bacteria | 2464 |
| 536 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 537 | Ga0207679_10136920 | 3300025945 | Bacteria | 1973 |
| 538 | Ga0207679_10390036 | 3300025945 | Unclassified | 1223 |
| 539 | Ga0207679_10530522 | 3300025945 | Bacteria | 1054 |
| 540 | Ga0207679_11020508 | 3300025945 | Unclassified | 758 |
| 541 | Ga0207667_10011075 | 3300025949 | Bacteria | 10502 |
| 542 | Ga0207667_10043831 | 3300025949 | Bacteria | 4746 |
| 543 | Ga0207667_10073699 | 3300025949 | Bacteria | 3547 |
| 544 | Ga0207667_10091638 | 3300025949 | Bacteria | 3139 |
| 545 | Ga0207667_10138054 | 3300025949 | Bacteria | 2510 |
| 546 | Ga0207651_10000593 | 3300025960 | Bacteria | 15254 |
| 547 | Ga0207651_10222784 | 3300025960 | Bacteria | 1526 |
| 548 | Ga0207651_10608887 | 3300025960 | Bacteria | 955 |
| 549 | Ga0207712_10000473 | 3300025961 | Bacteria | 33877 |
| 550 | Ga0207712_10044542 | 3300025961 | Bacteria | 3067 |
| 551 | Ga0207712_10117637 | 3300025961 | Bacteria | 2005 |
| 552 | Ga0207712_10756154 | 3300025961 | Bacteria | 852 |
| 553 | Ga0207668_10000220 | 3300025972 | Bacteria | 38677 |
| 554 | Ga0207640_10000379 | 3300025981 | Bacteria | 28614 |
| 555 | Ga0207640_10138435 | 3300025981 | Bacteria | 1771 |
| 556 | Ga0207658_10001133 | 3300025986 | Bacteria | 21430 |
| 557 | Ga0207658_11807562 | 3300025986 | Bacteria | 557 |
| 558 | Ga0207677_10000513 | 3300026023 | Bacteria | 24963 |
| 559 | Ga0207677_10320898 | 3300026023 | Bacteria | 1287 |
| 560 | Ga0207703_10001263 | 3300026035 | Bacteria | 23607 |
| 561 | Ga0207703_10020402 | 3300026035 | Bacteria | 5182 |
| 562 | Ga0207703_10175358 | 3300026035 | Bacteria | 1889 |
| 563 | Ga0207703_10205576 | 3300026035 | Bacteria | 1752 |
| 564 | Ga0207703_10265310 | 3300026035 | Bacteria | 1553 |
| 565 | Ga0207703_10421520 | 3300026035 | Bacteria | 1242 |
| 566 | Ga0207639_10015014 | 3300026041 | Bacteria | 5456 |
| 567 | Ga0207639_10369678 | 3300026041 | Bacteria | 1285 |
| 568 | Ga0207639_10959702 | 3300026041 | Bacteria | 800 |
| 569 | Ga0207678_10003592 | 3300026067 | Bacteria | 13936 |
| 570 | Ga0207678_10075348 | 3300026067 | Bacteria | 2890 |
| 571 | Ga0207678_10096163 | 3300026067 | Bacteria | 2531 |
| 572 | Ga0207678_10197474 | 3300026067 | Bacteria | 1720 |
| 573 | Ga0207678_10280170 | 3300026067 | Bacteria | 1431 |
| 574 | Ga0207678_11369783 | 3300026067 | Bacteria | 626 |
| 575 | Ga0207708_10000428 | 3300026075 | Bacteria | 32826 |
| 576 | Ga0207708_10003371 | 3300026075 | Bacteria | 11782 |
| 577 | Ga0207708_10035252 | 3300026075 | Bacteria | 3808 |
| 578 | Ga0207708_10973385 | 3300026075 | Unclassified | 736 |
| 579 | Ga0207702_10004376 | 3300026078 | Bacteria | 12586 |
| 580 | Ga0207702_10047246 | 3300026078 | Bacteria | 3627 |
| 581 | Ga0207702_10233945 | 3300026078 | Bacteria | 1718 |
| 582 | Ga0207702_11670249 | 3300026078 | Unclassified | 630 |
| 583 | Ga0207641_10001143 | 3300026088 | Bacteria | 26654 |
| 584 | Ga0207641_10087284 | 3300026088 | Bacteria | 2721 |
| 585 | Ga0207648_10000272 | 3300026089 | Bacteria | 56105 |
| 586 | Ga0207648_10095794 | 3300026089 | Bacteria | 2597 |
| 587 | Ga0207648_10386872 | 3300026089 | Bacteria | 1265 |
| 588 | Ga0207676_10009286 | 3300026095 | Bacteria | 6996 |
| 589 | Ga0207676_10349154 | 3300026095 | Bacteria | 1367 |
| 590 | Ga0207676_10369255 | 3300026095 | Bacteria | 1332 |
| 591 | Ga0207674_10000135 | 3300026116 | Bacteria | 85071 |
| 592 | Ga0207674_11862281 | 3300026116 | Bacteria | 568 |
| 593 | Ga0207675_100000245 | 3300026118 | Bacteria | 51737 |
| 594 | Ga0207683_10000136 | 3300026121 | Bacteria | 60910 |
| 595 | Ga0207683_10372807 | 3300026121 | Bacteria | 1311 |
| 596 | Ga0207698_10000828 | 3300026142 | Bacteria | 17909 |
| 597 | Ga0207698_10230967 | 3300026142 | Bacteria | 1679 |
| 598 | Ga0207698_10409684 | 3300026142 | Bacteria | 1298 |
| 599 | Ga0207698_10844193 | 3300026142 | Bacteria | 921 |
| 600 | Ga0209973_1006195 | 3300027252 | Bacteria | 1297 |
| 601 | Ga0209969_1061002 | 3300027360 | Bacteria | 596 |
| 602 | Ga0209996_1007399 | 3300027395 | Bacteria | 1428 |
| 603 | Ga0209968_1043865 | 3300027526 | Bacteria | 768 |
| 604 | Ga0209999_1015941 | 3300027543 | Bacteria | 1367 |
| 605 | Ga0209970_1006005 | 3300027614 | Bacteria | 1992 |
| 606 | Ga0210002_1004082 | 3300027617 | Bacteria | 2167 |
| 607 | Ga0209983_1013802 | 3300027665 | Bacteria | 1662 |
| 608 | Ga0209971_1026726 | 3300027682 | Bacteria | 1379 |
| 609 | Ga0209966_1006735 | 3300027695 | Bacteria | 2000 |
| 610 | Ga0209966_1017712 | 3300027695 | Bacteria | 1360 |
| 611 | Ga0209998_10006808 | 3300027717 | Bacteria | 2371 |
| 612 | Ga0209813_10222301 | 3300027866 | Bacteria | 707 |
| 613 | Ga0209974_10015919 | 3300027876 | Bacteria | 2497 |
| 614 | Ga0207428_10000249 | 3300027907 | Bacteria | 73253 |
| 615 | Ga0207428_10000471 | 3300027907 | Bacteria | 48541 |
| 616 | Ga0207428_10002287 | 3300027907 | Bacteria | 19233 |
| 617 | Ga0207428_10644545 | 3300027907 | Unclassified | 761 |
| 618 | Ga0268266_10452289 | 3300028379 | Bacteria | 1221 |
| 619 | Ga0268266_10738673 | 3300028379 | Bacteria | 949 |
| 620 | Ga0268265_10001888 | 3300028380 | Bacteria | 16660 |
| 621 | Ga0268264_10000693 | 3300028381 | Bacteria | 39190 |
| 622 | Ga0268264_10161724 | 3300028381 | Bacteria | 2018 |
| 623 | Ga0268264_10681003 | 3300028381 | Bacteria | 1020 |
| 624 | Ga0268264_11421126 | 3300028381 | Bacteria | 704 |
| 625 | Ga0268264_11810990 | 3300028381 | Bacteria | 621 |
| 626 | Ga0265337_1156957 | 3300028556 | Bacteria | 617 |
| 627 | Ga0265318_10184582 | 3300028577 | Bacteria | 763 |
| 628 | Ga0265338_10314185 | 3300028800 | Bacteria | 1136 |
| 629 | Ga0265338_10480238 | 3300028800 | Bacteria | 877 |
| 630 | Ga0265338_10500418 | 3300028800 | Bacteria | 855 |
| 631 | Ga0265330_10034754 | 3300031235 | Bacteria | 2250 |
| 632 | Ga0265332_10012678 | 3300031238 | Bacteria | 3738 |
| 633 | Ga0265332_10044370 | 3300031238 | Bacteria | 1918 |
| 634 | Ga0265332_10166816 | 3300031238 | Bacteria | 919 |
| 635 | Ga0265332_10283369 | 3300031238 | Unclassified | 685 |
| 636 | Ga0265328_10046186 | 3300031239 | Bacteria | 1601 |
| 637 | Ga0265320_10064698 | 3300031240 | Bacteria | 1736 |
| 638 | Ga0265325_10000055 | 3300031241 | Bacteria | 77409 |
| 639 | Ga0265325_10009247 | 3300031241 | Bacteria | 5761 |
| 640 | Ga0265325_10044077 | 3300031241 | Bacteria | 2325 |
| 641 | Ga0265325_10087695 | 3300031241 | Bacteria | 1538 |
| 642 | Ga0265325_10127687 | 3300031241 | Bacteria | 1220 |
| 643 | Ga0265329_10009220 | 3300031242 | Bacteria | 3694 |
| 644 | Ga0265340_10009447 | 3300031247 | Bacteria | 5232 |
| 645 | Ga0265340_10036372 | 3300031247 | Bacteria | 2440 |
| 646 | Ga0265340_10164003 | 3300031247 | Bacteria | 1009 |
| 647 | Ga0265339_10002510 | 3300031249 | Bacteria | 13106 |
| 648 | Ga0265339_10008094 | 3300031249 | Bacteria | 6719 |
| 649 | Ga0265339_10102961 | 3300031249 | Bacteria | 1484 |
| 650 | Ga0265339_10274411 | 3300031249 | Bacteria | 810 |
| 651 | Ga0265339_10475157 | 3300031249 | Bacteria | 579 |
| 652 | Ga0265331_10024615 | 3300031250 | Bacteria | 3044 |
| 653 | Ga0265331_10052122 | 3300031250 | Bacteria | 1956 |
| 654 | Ga0265316_10021951 | 3300031344 | Bacteria | 5394 |
| 655 | Ga0265316_10029105 | 3300031344 | Bacteria | 4547 |
| 656 | Ga0307408_100086205 | 3300031548 | Bacteria | 2360 |
| 657 | Ga0265313_10007379 | 3300031595 | Bacteria | 7533 |
| 658 | Ga0265313_10008657 | 3300031595 | Bacteria | 6729 |
| 659 | Ga0265313_10022395 | 3300031595 | Bacteria | 3428 |
| 660 | Ga0316575_10112747 | 3300031665 | Bacteria | 1110 |
| 661 | Ga0316575_10121640 | 3300031665 | Bacteria | 1068 |
| 662 | Ga0316579_10097583 | 3300031691 | Bacteria | 1406 |
| 663 | Ga0265314_10002433 | 3300031711 | Bacteria | 19086 |
| 664 | Ga0265314_10003272 | 3300031711 | Bacteria | 15830 |
| 665 | Ga0265314_10152456 | 3300031711 | Bacteria | 1415 |
| 666 | Ga0265342_10000100 | 3300031712 | Bacteria | 94554 |
| 667 | Ga0265342_10000760 | 3300031712 | Bacteria | 32963 |
| 668 | Ga0265342_10011993 | 3300031712 | Bacteria | 5888 |
| 669 | Ga0265342_10053265 | 3300031712 | Bacteria | 2408 |
| 670 | Ga0307405_10219875 | 3300031731 | Bacteria | 1393 |
| 671 | Ga0307413_10533738 | 3300031824 | Bacteria | 948 |
| 672 | Ga0307413_12017283 | 3300031824 | Bacteria | 520 |
| 673 | Ga0307406_11760322 | 3300031901 | Bacteria | 550 |
| 674 | Ga0307409_100170433 | 3300031995 | Bacteria | 1915 |
| 675 | Ga0307411_10106315 | 3300032005 | Bacteria | 1997 |
| 676 | Ga0307415_102076388 | 3300032126 | Bacteria | 554 |
| 677 | Ga0316583_10001350 | 3300032133 | Bacteria | 8126 |
| 678 | Ga0373930_0000940 | 3300034816 | Bacteria | 4167 |
| 679 | Ga0373930_0004040 | 3300034816 | Bacteria | 2365 |
| 680 | Ga0373930_0060393 | 3300034816 | Unclassified | 844 |
| 681 | Ga0373948_0000536 | 3300034817 | Bacteria | 4771 |
| 682 | Ga0373948_0134631 | 3300034817 | Bacteria | 607 |
| 683 | Ga0373950_0001447 | 3300034818 | Bacteria | 3107 |
| 684 | Ga0373950_0005561 | 3300034818 | Bacteria | 1888 |
| 685 | Ga0373958_0000870 | 3300034819 | Bacteria | 3881 |
| 686 | Ga0373958_0002779 | 3300034819 | Bacteria | 2482 |
| 687 | Ga0373959_0001430 | 3300034820 | Bacteria | 3814 |
| 688 | Ga0373959_0016991 | 3300034820 | Bacteria | 1354 |
| 689 | Ga0373938_0000293 | 3300034957 | Bacteria | 8061 |
| 690 | Ga0373938_0061213 | 3300034957 | Bacteria | 881 |
| 691 | Ga0373926_0077596 | 3300035083 | Bacteria | 1225 |
| 692 | Ga0373928_0037557 | 3300035084 | Bacteria | 1099 |
| 693 | Ga0373929_0001712 | 3300035085 | Bacteria | 4123 |
| 694 | Ga0373929_0001899 | 3300035085 | Bacteria | 3915 |
| 695 | Ga0373934_0025591 | 3300035086 | Bacteria | 2287 |
| 696 | Ga0373940_0008719 | 3300035088 | Bacteria | 2338 |
| 697 | Ga0373940_0029033 | 3300035088 | Bacteria | 1463 |
| 698 | Ga0373940_0079432 | 3300035088 | Bacteria | 967 |
| 699 | Ga0373944_0025385 | 3300035089 | Bacteria | 1743 |
| 700 | Ga0373944_0045119 | 3300035089 | Bacteria | 1374 |
| 701 | Ga0373949_0000797 | 3300035090 | Bacteria | 10077 |
| 702 | Ga0373949_0002468 | 3300035090 | Bacteria | 4745 |
| 703 | Ga0373949_0068148 | 3300035090 | Bacteria | 927 |
| 704 | Ga0373951_0012685 | 3300035091 | Bacteria | 1894 |
| 705 | Ga0373952_0007256 | 3300035092 | Bacteria | 2071 |
| 706 | Ga0373952_0026490 | 3300035092 | Bacteria | 1260 |
| 707 | Ga0373923_0011716 | 3300035111 | Bacteria | 3227 |
| 708 | Ga0373923_0015860 | 3300035111 | Bacteria | 2851 |
| 709 | Ga0373932_0001341 | 3300035112 | Bacteria | 6886 |
| 710 | Ga0373932_0001774 | 3300035112 | Bacteria | 5812 |
| 711 | Ga0373932_0023817 | 3300035112 | Bacteria | 1642 |
| 712 | Ga0373936_0005884 | 3300035113 | Bacteria | 4616 |
| 713 | Ga0373936_0039644 | 3300035113 | Bacteria | 1885 |
| 714 | Ga0373939_0005695 | 3300035114 | Bacteria | 2970 |
| 715 | Ga0373939_0008647 | 3300035114 | Bacteria | 2501 |
| 716 | Ga0373939_0016869 | 3300035114 | Bacteria | 1931 |
| 717 | Ga0373939_0376558 | 3300035114 | Bacteria | 583 |
| 718 | Ga0373941_0000410 | 3300035115 | Bacteria | 8486 |
| 719 | Ga0373941_0133631 | 3300035115 | Bacteria | 896 |
| 720 | Ga0373945_0017444 | 3300035116 | Bacteria | 2431 |
| 721 | Ga0373953_0057174 | 3300035117 | Bacteria | 1588 |
| 722 | Ga0373953_0332158 | 3300035117 | Bacteria | 665 |
| 723 | Ga0373954_0012230 | 3300035118 | Bacteria | 3816 |
| 724 | Ga0373954_0046542 | 3300035118 | Bacteria | 2028 |
| 725 | Ga0373954_0151141 | 3300035118 | Bacteria | 1134 |
| 726 | Ga0373956_0178031 | 3300035119 | Bacteria | 1005 |
| 727 | Ga0373956_0417073 | 3300035119 | Bacteria | 641 |
| 728 | Ga0373960_0001361 | 3300035121 | Bacteria | 5390 |
| 729 | Ga0373943_0001756 | 3300035170 | Bacteria | 9811 |
| 730 | Ga0373943_0018728 | 3300035170 | Bacteria | 3182 |
| 731 | Ga0373943_0179633 | 3300035170 | Bacteria | 1162 |
| 732 | Ga0373946_0068622 | 3300035171 | Bacteria | 1525 |
| 733 | Ga0373946_0154967 | 3300035171 | Bacteria | 1071 |
| 734 | Ga0373946_0178767 | 3300035171 | Bacteria | 1006 |
| 735 | Ga0373946_0270679 | 3300035171 | Bacteria | 833 |
| 736 | Ga0373955_0010447 | 3300035172 | Bacteria | 4386 |
| 737 | Ga0373955_0016087 | 3300035172 | Bacteria | 3676 |
| 738 | Ga0373955_0019549 | 3300035172 | Bacteria | 3388 |
| 739 | Ga0373955_0135867 | 3300035172 | Bacteria | 1438 |
| 740 | Ga0373955_0334504 | 3300035172 | Bacteria | 916 |
| 741 | Ga0373955_0750873 | 3300035172 | Bacteria | 599 |
| 742 | Ga0373942_0006328 | 3300035207 | Bacteria | 2735 |
| 743 | Ga0373961_0004108 | 3300035241 | Bacteria | 3540 |
| 744 | Ga0373961_0005274 | 3300035241 | Bacteria | 3109 |
| 745 | Ga0373962_0003406 | 3300035242 | Bacteria | 3822 |
| 746 | Ga0373962_0005753 | 3300035242 | Bacteria | 2993 |
| 747 | Ga0373962_0027678 | 3300035242 | Bacteria | 1534 |
| 748 | Ga0373962_0296490 | 3300035242 | Bacteria | 573 |
| 749 | Ga0373962_0383716 | 3300035242 | Unclassified | 514 |
| 750 | Ga0373924_0020653 | 3300035410 | Bacteria | 2562 |
| 751 | Ga0373924_0234712 | 3300035410 | Bacteria | 811 |
| 752 | Ga0373924_0479461 | 3300035410 | Bacteria | 558 |
| 753 | Ga0373931_0000853 | 3300035691 | Bacteria | 12846 |
| 754 | Ga0373931_0010380 | 3300035691 | Bacteria | 4475 |
| 755 | Ga0373931_0066193 | 3300035691 | Bacteria | 1960 |
| 756 | Ga0373931_0071581 | 3300035691 | Bacteria | 1894 |
| 757 | Ga0373931_0171350 | 3300035691 | Bacteria | 1279 |
| 758 | Ga0373935_0011348 | 3300035692 | Bacteria | 5350 |
| 759 | Ga0373935_0021300 | 3300035692 | Bacteria | 3967 |
| 760 | Ga0373935_0054419 | 3300035692 | Bacteria | 2548 |
| 761 | Ga0373935_0166496 | 3300035692 | Bacteria | 1505 |
| 762 | Ga0373935_0268586 | 3300035692 | Bacteria | 1198 |
| 763 | Ga0373935_0302696 | 3300035692 | Bacteria | 1130 |
| 764 | Ga0373927_0042609 | 3300035695 | Bacteria | 2941 |
| 765 | Ga0373927_0048857 | 3300035695 | Bacteria | 2736 |
| 766 | Ga0373933_0007033 | 3300035724 | Bacteria | 6133 |
| 767 | Ga0373933_0027449 | 3300035724 | Bacteria | 3278 |
| 768 | Ga0373933_0027713 | 3300035724 | Bacteria | 3265 |
| 769 | Ga0373947_0043464 | 3300035725 | Bacteria | 2684 |
| 770 | Ga0373947_0241315 | 3300035725 | Bacteria | 1192 |
| 771 | Ga0373947_0402488 | 3300035725 | Bacteria | 923 |
| 772 | Ga0373937_0010852 | 3300036401 | Bacteria | 7974 |
| 773 | Ga0373937_0095541 | 3300036401 | Bacteria | 2756 |
| 774 | Ga0373937_0135019 | 3300036401 | Bacteria | 2306 |
| 775 | Ga0373937_1288524 | 3300036401 | Unclassified | 679 |
| 776 | Ga0373925_0012204 | 3300037068 | Bacteria | 6218 |
| 777 | Ga0373925_0049123 | 3300037068 | Bacteria | 3144 |
| 778 | Ga0373925_0079963 | 3300037068 | Bacteria | 2484 |
| 779 | Ga0373925_0498873 | 3300037068 | Bacteria | 999 |
| 780 | Ga0395899_0051228 | 3300037312 | Bacteria | 3064 |
| 781 | Ga0395900_0010327 | 3300037418 | Bacteria | 9553 |
| 782 | Ga0395900_0043459 | 3300037418 | Bacteria | 4631 |
| 783 | Ga0395900_0387634 | 3300037418 | Bacteria | 1364 |
| 784 | Ga0395900_0526432 | 3300037418 | Bacteria | 1129 |
| 785 | Ga0395898_0002494 | 3300037466 | Bacteria | 21650 |
| 786 | Ga0395898_0003815 | 3300037466 | Bacteria | 16691 |
| 787 | Ga0395898_0304507 | 3300037466 | Bacteria | 1520 |
| 788 | Ga0395898_0377021 | 3300037466 | Bacteria | 1353 |
| 789 | Ga0436364_0165904 | 3300037853 | Bacteria | 8751 |
| 790 | Ga0395901_0018402 | 3300038443 | Bacteria | 7130 |
| 791 | Ga0395901_0025517 | 3300038443 | Bacteria | 6068 |
| 792 | Ga0395901_0202740 | 3300038443 | Bacteria | 2079 |
| 793 | Ga0395901_0237239 | 3300038443 | Bacteria | 1903 |
| 794 | Ga0395901_0971502 | 3300038443 | Bacteria | 827 |
| 795 | Ga0395901_1025629 | 3300038443 | Bacteria | 799 |
| 796 | Ga0242419_018407 | 3300038698 | Bacteria | 574 |
| 797 | Ga0242420_009830 | 3300038996 | Bacteria | 1578 |
| 798 | Ga0436365_0286964 | 3300039437 | Bacteria | 64806 |
| 799 | Ga0436365_0526917 | 3300039437 | Bacteria | 756 |
| 800 | Ga0436365_1049521 | 3300039437 | Bacteria | 1437 |
| 801 | Ga0436365_1087662 | 3300039437 | Bacteria | 20046 |
| 802 | Ga0436365_1220299 | 3300039437 | Bacteria | 1996 |
| 803 | Ga0436360_0529845 | 3300039438 | Bacteria | 1032 |
| 804 | Ga0436361_0361045 | 3300039447 | Bacteria | 2837 |
| 805 | Ga0436362_0888596 | 3300039453 | Bacteria | 1618 |
| 806 | Ga0439465_0163510 | 3300041413 | Bacteria | 799 |
| 807 | Ga0439450_012559 | 3300042008 | Bacteria | 1683 |
| 808 | Ga0439464_0005686 | 3300042439 | Bacteria | 3231 |
| 809 | Ga0439460_0026965 | 3300042461 | Bacteria | 1611 |
| 810 | Ga0451577_1970918 | 3300042876 | Bacteria | 511 |
| 811 | Ga0439440_0027245 | 3300042993 | Bacteria | 1327 |
| 812 | Ga0466965_0101696 | 3300044683 | Bacteria | 1470 |
| 813 | Ga0466966_0066734 | 3300044684 | Bacteria | 2261 |
| 814 | Ga0466963_0045141 | 3300044694 | Bacteria | 2902 |
| 815 | Ga0466963_0580176 | 3300044694 | Bacteria | 792 |
| 816 | Ga0466963_0815059 | 3300044694 | Bacteria | 658 |
| 817 | Ga0466963_0877065 | 3300044694 | Bacteria | 632 |
| 818 | Ga0453684_2258685 | 3300044712 | Bacteria | 542 |
| 819 | Ga0466971_0348406 | 3300044719 | Bacteria | 716 |
| 820 | Ga0466957_0055366 | 3300044842 | Bacteria | 2424 |
| 821 | Ga0466957_0163849 | 3300044842 | Bacteria | 1445 |
| 822 | Ga0466957_0620959 | 3300044842 | Bacteria | 758 |
| 823 | Ga0466957_0691794 | 3300044842 | Bacteria | 719 |
| 824 | Ga0466960_0123051 | 3300044901 | Bacteria | 1361 |
| 825 | Ga0466959_1181814 | 3300045049 | Bacteria | 508 |
| 826 | Ga0451576_0035228 | 3300045051 | Bacteria | 5312 |
| 827 | Ga0466958_0030567 | 3300045836 | Bacteria | 3200 |
| 828 | Ga0466958_0131965 | 3300045836 | Bacteria | 1569 |
| 829 | Ga0466958_0467783 | 3300045836 | Bacteria | 817 |
| 830 | Ga0466967_0003577 | 3300045976 | Bacteria | 10195 |
| 831 | Ga0466967_1229181 | 3300045976 | Bacteria | 746 |
| 832 | Ga0495617_016986 | 3300046452 | Bacteria | 2459 |
| 833 | Ga0495592_0007525 | 3300046454 | Bacteria | 8154 |
| 834 | Ga0495592_0010371 | 3300046454 | Bacteria | 7028 |
| 835 | Ga0495592_0119940 | 3300046454 | Bacteria | 1851 |
| 836 | Ga0495603_0007148 | 3300046455 | Bacteria | 6703 |
| 837 | Ga0495603_0044070 | 3300046455 | Bacteria | 2662 |
| 838 | Ga0495603_0077397 | 3300046455 | Bacteria | 1951 |
| 839 | Ga0495590_0114198 | 3300046457 | Bacteria | 965 |
| 840 | Ga0495629_0001477 | 3300046459 | Bacteria | 18546 |
| 841 | Ga0495629_0350234 | 3300046459 | Bacteria | 1007 |
| 842 | Ga0495629_0377067 | 3300046459 | Bacteria | 965 |
| 843 | Ga0495629_0561460 | 3300046459 | Unclassified | 765 |
| 844 | Ga0495638_0050928 | 3300046460 | Bacteria | 2585 |
| 845 | Ga0495638_0654827 | 3300046460 | Bacteria | 510 |
| 846 | Ga0495641_0039881 | 3300046461 | Bacteria | 2186 |
| 847 | Ga0495641_0167335 | 3300046461 | Bacteria | 983 |
| 848 | Ga0495651_0001224 | 3300046462 | Bacteria | 19839 |
| 849 | Ga0495651_0005238 | 3300046462 | Bacteria | 9883 |
| 850 | Ga0495651_0021305 | 3300046462 | Bacteria | 5038 |
| 851 | Ga0495653_0022871 | 3300046463 | Bacteria | 5055 |
| 852 | Ga0495653_0042382 | 3300046463 | Bacteria | 3545 |
| 853 | Ga0495653_0083798 | 3300046463 | Bacteria | 2350 |
| 854 | Ga0495653_0172473 | 3300046463 | Bacteria | 1492 |
| 855 | Ga0495653_0464076 | 3300046463 | Bacteria | 794 |
| 856 | Ga0495580_0017328 | 3300046472 | Bacteria | 5388 |
| 857 | Ga0495580_0223459 | 3300046472 | Bacteria | 1294 |
| 858 | Ga0495582_0006537 | 3300046473 | Bacteria | 6470 |
| 859 | Ga0495582_0659262 | 3300046473 | Bacteria | 605 |
| 860 | Ga0495582_0702959 | 3300046473 | Unclassified | 585 |
| 861 | Ga0495605_0255393 | 3300046474 | Bacteria | 749 |
| 862 | Ga0495639_0027411 | 3300046475 | Bacteria | 2521 |
| 863 | Ga0495639_0046153 | 3300046475 | Bacteria | 1972 |
| 864 | Ga0495662_0048387 | 3300046476 | Bacteria | 2052 |
| 865 | Ga0495662_0050106 | 3300046476 | Bacteria | 2015 |
| 866 | Ga0495664_0004186 | 3300046477 | Bacteria | 7881 |
| 867 | Ga0495664_0101750 | 3300046477 | Bacteria | 1731 |
| 868 | Ga0495664_0106162 | 3300046477 | Bacteria | 1693 |
| 869 | Ga0495584_0024671 | 3300046491 | Bacteria | 3049 |
| 870 | Ga0495584_0349846 | 3300046491 | Bacteria | 750 |
| 871 | Ga0495585_0001120 | 3300046492 | Bacteria | 21980 |
| 872 | Ga0495594_0026443 | 3300046499 | Bacteria | 3122 |
| 873 | Ga0495594_0043621 | 3300046499 | Bacteria | 2458 |
| 874 | Ga0495607_0009551 | 3300046501 | Bacteria | 6555 |
| 875 | Ga0495583_0202343 | 3300046506 | Bacteria | 806 |
| 876 | Ga0495608_0000894 | 3300046511 | Bacteria | 20903 |
| 877 | Ga0495616_0137912 | 3300046513 | Bacteria | 1113 |
| 878 | Ga0495618_0007468 | 3300046514 | Bacteria | 6611 |
| 879 | Ga0495618_0016463 | 3300046514 | Bacteria | 4523 |
| 880 | Ga0495618_0216138 | 3300046514 | Bacteria | 1210 |
| 881 | Ga0495628_0001643 | 3300046516 | Bacteria | 20468 |
| 882 | Ga0495628_0005224 | 3300046516 | Bacteria | 11396 |
| 883 | Ga0495628_0079867 | 3300046516 | Bacteria | 2543 |
| 884 | Ga0495628_0316951 | 3300046516 | Bacteria | 1151 |
| 885 | Ga0495630_0090226 | 3300046517 | Bacteria | 2315 |
| 886 | Ga0495630_0265767 | 3300046517 | Bacteria | 1310 |
| 887 | Ga0495631_0461178 | 3300046518 | Bacteria | 541 |
| 888 | Ga0495637_0247086 | 3300046520 | Bacteria | 643 |
| 889 | Ga0495644_0000276 | 3300046523 | Bacteria | 23546 |
| 890 | Ga0495663_0003625 | 3300046525 | Bacteria | 4425 |
| 891 | Ga0495666_0030261 | 3300046526 | Bacteria | 2658 |
| 892 | Ga0495666_0071263 | 3300046526 | Bacteria | 1652 |
| 893 | Ga0495652_0005225 | 3300046529 | Bacteria | 12267 |
| 894 | Ga0495652_0013895 | 3300046529 | Bacteria | 7241 |
| 895 | Ga0495652_0054951 | 3300046529 | Bacteria | 3388 |
| 896 | Ga0495652_0182600 | 3300046529 | Bacteria | 1608 |
| 897 | Ga0495652_0256266 | 3300046529 | Bacteria | 1294 |
| 898 | Ga0495665_0005432 | 3300046531 | Bacteria | 6867 |
| 899 | Ga0495665_0108659 | 3300046531 | Bacteria | 1455 |
| 900 | Ga0495640_0009470 | 3300046533 | Bacteria | 7588 |
| 901 | Ga0495640_0188521 | 3300046533 | Bacteria | 1312 |
| 902 | Ga0495640_0190803 | 3300046533 | Bacteria | 1302 |
| 903 | Ga0495640_0301469 | 3300046533 | Bacteria | 995 |
| 904 | Ga0495640_0313416 | 3300046533 | Bacteria | 972 |
| 905 | Ga0495586_0034648 | 3300046535 | Bacteria | 2712 |
| 906 | Ga0495587_0002982 | 3300046536 | Bacteria | 11315 |
| 907 | Ga0495587_0019533 | 3300046536 | Bacteria | 4191 |
| 908 | Ga0495587_0020752 | 3300046536 | Bacteria | 4053 |
| 909 | Ga0495598_0010089 | 3300046537 | Bacteria | 2253 |
| 910 | Ga0495645_0007183 | 3300046543 | Bacteria | 7750 |
| 911 | Ga0495645_0051654 | 3300046543 | Bacteria | 2991 |
| 912 | Ga0495622_0012450 | 3300046557 | Bacteria | 3938 |
| 913 | Ga0495622_0037807 | 3300046557 | Bacteria | 2248 |
| 914 | Ga0495633_0006390 | 3300046558 | Bacteria | 6994 |
| 915 | Ga0495667_0006825 | 3300046559 | Bacteria | 7750 |
| 916 | Ga0495667_0020138 | 3300046559 | Bacteria | 4499 |
| 917 | Ga0495667_0050526 | 3300046559 | Bacteria | 2744 |
| 918 | Ga0495656_0000754 | 3300046615 | Bacteria | 10446 |
| 919 | Ga0495634_0112115 | 3300046642 | Bacteria | 1753 |
| 920 | Ga0495634_0204657 | 3300046642 | Bacteria | 1224 |
| 921 | Ga0495634_0218569 | 3300046642 | Unclassified | 1177 |
| 922 | Ga0495611_0003788 | 3300046648 | Bacteria | 6602 |
| 923 | Ga0495635_0026238 | 3300046663 | Bacteria | 4056 |
| 924 | Ga0495635_0044778 | 3300046663 | Bacteria | 3052 |
| 925 | Ga0495635_0100441 | 3300046663 | Bacteria | 1977 |
| 926 | Ga0495635_0121067 | 3300046663 | Bacteria | 1785 |
| 927 | Ga0495635_0123809 | 3300046663 | Bacteria | 1763 |
| 928 | Ga0495659_0000313 | 3300046664 | Bacteria | 19327 |
| 929 | Ga0495588_0081088 | 3300046674 | Bacteria | 1693 |
| 930 | Ga0495657_0007186 | 3300046675 | Bacteria | 8637 |
| 931 | Ga0495657_0504829 | 3300046675 | Bacteria | 705 |
| 932 | Ga0495657_0623366 | 3300046675 | Bacteria | 623 |
| 933 | Ga0495599_0003276 | 3300046678 | Bacteria | 9434 |
| 934 | Ga0495599_0095990 | 3300046678 | Bacteria | 1849 |
| 935 | Ga0495623_0004045 | 3300046679 | Bacteria | 9654 |
| 936 | Ga0495623_0010576 | 3300046679 | Bacteria | 5971 |
| 937 | Ga0495646_0002740 | 3300046680 | Bacteria | 10888 |
| 938 | Ga0495646_0010561 | 3300046680 | Bacteria | 5866 |
| 939 | Ga0495646_0113630 | 3300046680 | Bacteria | 1539 |
| 940 | Ga0495647_0032878 | 3300046681 | Bacteria | 1935 |
| 941 | Ga0495647_0043528 | 3300046681 | Bacteria | 1718 |
| 942 | Ga0495647_0057038 | 3300046681 | Bacteria | 1532 |
| 943 | Ga0495658_0001518 | 3300046683 | Bacteria | 12169 |
| 944 | Ga0495658_0010651 | 3300046683 | Bacteria | 4602 |
| 945 | Ga0495658_0052367 | 3300046683 | Bacteria | 2315 |
| 946 | Ga0495658_0211672 | 3300046683 | Bacteria | 1211 |
| 947 | Ga0495658_0472600 | 3300046683 | Bacteria | 801 |
| 948 | Ga0495669_0174490 | 3300046684 | Bacteria | 1023 |
| 949 | Ga0495613_0192980 | 3300046689 | Bacteria | 1439 |
| 950 | Ga0495613_0634045 | 3300046689 | Bacteria | 708 |
| 951 | Ga0495624_0196456 | 3300046690 | Bacteria | 1226 |
| 952 | Ga0495624_0422902 | 3300046690 | Bacteria | 799 |
| 953 | Ga0495670_0000678 | 3300046691 | Bacteria | 16157 |
| 954 | Ga0495589_0147333 | 3300046794 | Bacteria | 1125 |
| 955 | Ga0495600_0015965 | 3300046809 | Bacteria | 4758 |
| 956 | Ga0495600_0021509 | 3300046809 | Bacteria | 4132 |
| 957 | Ga0495600_0037916 | 3300046809 | Bacteria | 3135 |
| 958 | Ga0495581_0005389 | 3300047315 | Bacteria | 7399 |
| 959 | Ga0495581_0054350 | 3300047315 | Bacteria | 2312 |
| 960 | Ga0495581_0337183 | 3300047315 | Bacteria | 880 |
| 961 | Ga0495604_0005224 | 3300047317 | Bacteria | 10283 |
| 962 | Ga0495604_0020077 | 3300047317 | Bacteria | 5340 |
| 963 | Ga0495604_0036373 | 3300047317 | Bacteria | 3882 |
| 964 | Ga0495604_0046839 | 3300047317 | Bacteria | 3370 |
| 965 | Ga0495674_0065440 | 3300047319 | Bacteria | 3157 |
| 966 | Ga0495674_0074183 | 3300047319 | Bacteria | 2931 |
| 967 | Ga0495674_0131245 | 3300047319 | Bacteria | 2111 |
| 968 | Ga0495674_0203312 | 3300047319 | Bacteria | 1642 |
| 969 | Ga0495674_0266832 | 3300047319 | Bacteria | 1405 |
| 970 | Ga0495676_0084467 | 3300047321 | Bacteria | 2395 |
| 971 | Ga0495676_0094678 | 3300047321 | Bacteria | 2224 |
| 972 | Ga0495676_0453639 | 3300047321 | Bacteria | 845 |
| 973 | Ga0495680_0010223 | 3300047322 | Bacteria | 8378 |
| 974 | Ga0495680_0012624 | 3300047322 | Bacteria | 7422 |
| 975 | Ga0495680_0030552 | 3300047322 | Bacteria | 4398 |
| 976 | Ga0495680_0098448 | 3300047322 | Bacteria | 2182 |
| 977 | Ga0495675_0001149 | 3300047444 | Bacteria | 16078 |
| 978 | Ga0495675_0780306 | 3300047444 | Bacteria | 530 |
| 979 | Ga0495677_0057187 | 3300047445 | Bacteria | 1441 |
| 980 | Ga0495679_020206 | 3300047446 | Bacteria | 2323 |
| 981 | Ga0495684_0003052 | 3300047471 | Bacteria | 13171 |
| 982 | Ga0495684_0107074 | 3300047471 | Bacteria | 2112 |
| 983 | Ga0495684_0129052 | 3300047471 | Bacteria | 1900 |
| 984 | Ga0495593_0025793 | 3300047673 | Bacteria | 3252 |
| 985 | Ga0495593_0259740 | 3300047673 | Bacteria | 869 |
| 986 | Ga0495602_0009459 | 3300048088 | Bacteria | 10135 |
| 987 | Ga0495602_0019879 | 3300048088 | Bacteria | 6652 |
| 988 | Ga0495602_0882401 | 3300048088 | Bacteria | 596 |
| 989 | Ga0495614_0027957 | 3300048089 | Bacteria | 2431 |
| 990 | Ga0495614_0061537 | 3300048089 | Bacteria | 1613 |
| 991 | Ga0495614_0494616 | 3300048089 | Unclassified | 582 |
| 992 | Ga0496100_0003970 | 3300048903 | Bacteria | 7776 |
| 993 | Ga0496100_0164294 | 3300048903 | Bacteria | 1593 |
| 994 | Ga0496100_0610600 | 3300048903 | Unclassified | 847 |
| 995 | Ga0496101_0001569 | 3300048904 | Bacteria | 13711 |
| 996 | Ga0496101_0020202 | 3300048904 | Bacteria | 4554 |
| 997 | Ga0496101_0050260 | 3300048904 | Bacteria | 3000 |
| 998 | Ga0496101_0250973 | 3300048904 | Bacteria | 1378 |
| 999 | Ga0496101_0642548 | 3300048904 | Bacteria | 838 |
| 1000 | Ga0496102_0004673 | 3300048905 | Bacteria | 11584 |
| 1001 | Ga0496102_0018222 | 3300048905 | Bacteria | 6164 |
| 1002 | Ga0496102_0081843 | 3300048905 | Bacteria | 2977 |
| 1003 | Ga0496102_0113730 | 3300048905 | Bacteria | 2525 |
| 1004 | Ga0496102_0414458 | 3300048905 | Bacteria | 1265 |
| 1005 | Ga0496102_0938567 | 3300048905 | Unclassified | 786 |
| 1006 | Ga0496103_0000430 | 3300048906 | Bacteria | 36512 |
| 1007 | Ga0496103_0008308 | 3300048906 | Bacteria | 6166 |
| 1008 | Ga0496103_0039270 | 3300048906 | Bacteria | 2908 |
| 1009 | Ga0496103_0045716 | 3300048906 | Bacteria | 2701 |
| 1010 | Ga0496103_0115786 | 3300048906 | Bacteria | 1705 |
| 1011 | Ga0496103_0120597 | 3300048906 | Bacteria | 1670 |
| 1012 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 1013 | Ga0496104_0130526 | 3300048907 | Bacteria | 2413 |
| 1014 | Ga0496104_0167267 | 3300048907 | Bacteria | 2108 |
| 1015 | Ga0496104_0208475 | 3300048907 | Bacteria | 1866 |
| 1016 | Ga0496104_0306891 | 3300048907 | Bacteria | 1499 |
| 1017 | Ga0496104_0433438 | 3300048907 | Bacteria | 1226 |
| 1018 | Ga0496105_0036668 | 3300048908 | Bacteria | 4040 |
| 1019 | Ga0496105_0064401 | 3300048908 | Bacteria | 3025 |
| 1020 | Ga0496105_0066007 | 3300048908 | Bacteria | 2986 |
| 1021 | Ga0496105_0171353 | 3300048908 | Bacteria | 1779 |
| 1022 | Ga0496105_0278071 | 3300048908 | Bacteria | 1350 |
| 1023 | Ga0496105_0392059 | 3300048908 | Bacteria | 1103 |
| 1024 | Ga0496106_0003028 | 3300048909 | Bacteria | 12522 |
| 1025 | Ga0496106_0007444 | 3300048909 | Bacteria | 8090 |
| 1026 | Ga0496106_0018178 | 3300048909 | Bacteria | 5199 |
| 1027 | Ga0496106_0065164 | 3300048909 | Bacteria | 2773 |
| 1028 | Ga0496106_0092461 | 3300048909 | Bacteria | 2336 |
| 1029 | Ga0496106_0248627 | 3300048909 | Bacteria | 1421 |
| 1030 | Ga0496107_0001324 | 3300048910 | Bacteria | 15192 |
| 1031 | Ga0496107_0011160 | 3300048910 | Bacteria | 6253 |
| 1032 | Ga0496107_0011716 | 3300048910 | Bacteria | 6115 |
| 1033 | Ga0496107_0755280 | 3300048910 | Unclassified | 713 |
| 1034 | Ga0496108_0003835 | 3300048911 | Bacteria | 12056 |
| 1035 | Ga0496108_0103714 | 3300048911 | Bacteria | 2426 |
| 1036 | Ga0496108_0146984 | 3300048911 | Bacteria | 2032 |
| 1037 | Ga0496108_0173049 | 3300048911 | Bacteria | 1868 |
| 1038 | Ga0496109_0000338 | 3300048912 | Bacteria | 43692 |
| 1039 | Ga0496109_0211106 | 3300048912 | Bacteria | 1826 |
| 1040 | Ga0496109_0265648 | 3300048912 | Bacteria | 1616 |
| 1041 | Ga0496109_0407527 | 3300048912 | Bacteria | 1284 |
| 1042 | Ga0496109_0769848 | 3300048912 | Bacteria | 900 |
| 1043 | Ga0496110_0055234 | 3300048913 | Bacteria | 3494 |
| 1044 | Ga0496110_0063385 | 3300048913 | Bacteria | 3266 |
| 1045 | Ga0496110_0099831 | 3300048913 | Bacteria | 2602 |
| 1046 | Ga0496110_0134508 | 3300048913 | Bacteria | 2234 |
| 1047 | Ga0496110_0330086 | 3300048913 | Bacteria | 1389 |
| 1048 | Ga0496110_0334522 | 3300048913 | Bacteria | 1379 |
| 1049 | Ga0496110_0334533 | 3300048913 | Bacteria | 1379 |
| 1050 | Ga0496111_0012615 | 3300048914 | Bacteria | 5725 |
| 1051 | Ga0496111_0066000 | 3300048914 | Bacteria | 2627 |
| 1052 | Ga0496111_0397003 | 3300048914 | Bacteria | 1019 |
| 1053 | Ga0496111_0524722 | 3300048914 | Bacteria | 870 |
| 1054 | Ga0496111_0709182 | 3300048914 | Bacteria | 731 |
| 1055 | Ga0496112_0005440 | 3300048915 | Bacteria | 11016 |
| 1056 | Ga0496112_0069073 | 3300048915 | Bacteria | 3490 |
| 1057 | Ga0496112_0069190 | 3300048915 | Bacteria | 3487 |
| 1058 | Ga0496112_0096794 | 3300048915 | Bacteria | 2922 |
| 1059 | Ga0496112_0111044 | 3300048915 | Bacteria | 2711 |
| 1060 | Ga0496112_0117700 | 3300048915 | Bacteria | 2627 |
| 1061 | Ga0496112_0426531 | 3300048915 | Bacteria | 1264 |
| 1062 | Ga0496112_0999933 | 3300048915 | Bacteria | 756 |
| 1063 | Ga0496113_0010323 | 3300048916 | Bacteria | 6171 |
| 1064 | Ga0496113_0131711 | 3300048916 | Bacteria | 1963 |
| 1065 | Ga0496113_0262535 | 3300048916 | Bacteria | 1379 |
| 1066 | Ga0496113_0383164 | 3300048916 | Bacteria | 1128 |
| 1067 | Ga0496114_0005514 | 3300048917 | Bacteria | 9912 |
| 1068 | Ga0496114_0009307 | 3300048917 | Bacteria | 7796 |
| 1069 | Ga0496115_0004496 | 3300048918 | Bacteria | 10090 |
| 1070 | Ga0496115_0036924 | 3300048918 | Bacteria | 3869 |
| 1071 | Ga0496115_0045977 | 3300048918 | Bacteria | 3486 |
| 1072 | Ga0496115_0087837 | 3300048918 | Bacteria | 2537 |
| 1073 | Ga0496115_0100371 | 3300048918 | Bacteria | 2372 |
| 1074 | Ga0496115_0129008 | 3300048918 | Bacteria | 2083 |
| 1075 | Ga0496115_0423279 | 3300048918 | Bacteria | 1079 |
| 1076 | Ga0496115_0465645 | 3300048918 | Bacteria | 1019 |
| 1077 | Ga0496117_0192034 | 3300048920 | Bacteria | 1162 |
| 1078 | Ga0496118_0287560 | 3300048921 | Bacteria | 911 |
| 1079 | Ga0496125_0656793 | 3300048928 | Bacteria | 563 |
| 1080 | Ga0496126_0553084 | 3300048929 | Bacteria | 913 |
| 1081 | Ga0496126_0640667 | 3300048929 | Bacteria | 833 |
| 1082 | Ga0501031_0213486 | 3300049568 | Bacteria | 1257 |
| 1083 | Ga0501032_0239703 | 3300049569 | Bacteria | 1178 |
| 1084 | Ga0501033_0481433 | 3300049570 | Bacteria | 860 |
| 1085 | Ga0501034_0029113 | 3300049571 | Bacteria | 5615 |
| 1086 | Ga0501034_0473555 | 3300049571 | Bacteria | 1168 |
| 1087 | Ga0501037_0619680 | 3300049573 | Bacteria | 725 |
| 1088 | Ga0501038_0017167 | 3300049574 | Bacteria | 6544 |
| 1089 | Ga0501039_0481395 | 3300049575 | Bacteria | 975 |
| 1090 | Ga0501039_1369715 | 3300049575 | Unclassified | 545 |
| 1091 | Ga0501040_0242180 | 3300049576 | Bacteria | 1286 |
| 1092 | Ga0501043_0916399 | 3300049579 | Bacteria | 628 |
| 1093 | Ga0501046_0661581 | 3300049580 | Bacteria | 738 |
| 1094 | Ga0501047_0035044 | 3300049581 | Bacteria | 4847 |
| 1095 | Ga0501047_0085402 | 3300049581 | Bacteria | 3032 |
| 1096 | Ga0501047_0309500 | 3300049581 | Bacteria | 1420 |
| 1097 | Ga0501048_0451129 | 3300049582 | Bacteria | 921 |
| 1098 | Ga0501069_0248163 | 3300049585 | Bacteria | 1038 |
| 1099 | Ga0501069_0419835 | 3300049585 | Bacteria | 793 |
| 1100 | Ga0501070_0015452 | 3300049586 | Bacteria | 6423 |
| 1101 | Ga0501070_0086824 | 3300049586 | Bacteria | 2590 |
| 1102 | Ga0501071_1261250 | 3300049587 | Bacteria | 571 |
| 1103 | Ga0501072_0037872 | 3300049588 | Bacteria | 3783 |
| 1104 | Ga0501072_0548700 | 3300049588 | Bacteria | 913 |
| 1105 | Ga0501073_0013366 | 3300049589 | Bacteria | 5976 |
| 1106 | Ga0501074_0179347 | 3300049590 | Bacteria | 1511 |
| 1107 | Ga0501074_0294528 | 3300049590 | Bacteria | 1153 |
| 1108 | Ga0501074_0674977 | 3300049590 | Bacteria | 730 |
| 1109 | Ga0501077_0061042 | 3300049593 | Bacteria | 2392 |
| 1110 | Ga0501225_0220064 | 3300049705 | Bacteria | 611 |
| 1111 | Ga0501079_1623864 | 3300049741 | Bacteria | 508 |
| 1112 | Ga0501081_0418876 | 3300049743 | Bacteria | 993 |
| 1113 | Ga0501083_0113453 | 3300049744 | Bacteria | 1780 |
| 1114 | Ga0501083_0154700 | 3300049744 | Bacteria | 1501 |
| 1115 | Ga0501083_0760287 | 3300049744 | Bacteria | 630 |
| 1116 | Ga0501270_088430 | 3300049767 | Bacteria | 628 |
| 1117 | Ga0501044_0158608 | 3300049823 | Bacteria | 2241 |
| 1118 | Ga0501044_0367280 | 3300049823 | Bacteria | 1356 |
| 1119 | Ga0501044_0623399 | 3300049823 | Bacteria | 970 |
| 1120 | Ga0501044_0761432 | 3300049823 | Bacteria | 850 |
| 1121 | Ga0501044_0846455 | 3300049823 | Bacteria | 792 |
| 1122 | Ga0501045_0564976 | 3300049824 | Bacteria | 843 |
| 1123 | Ga0501212_098559 | 3300049851 | Bacteria | 547 |
| 1124 | nmdc:mga03683_663126_c1 | 3300050489 | Bacteria | 514 |
| 1125 | nmdc:mga03n38_227168_c1 | 3300050490 | Bacteria | 977 |
| 1126 | nmdc:mga03n38_679272_c1 | 3300050490 | Unclassified | 592 |
| 1127 | nmdc:mga00v17_114829_c1 | 3300050491 | Bacteria | 1711 |
| 1128 | nmdc:mga00v17_75166_c1 | 3300050491 | Bacteria | 2100 |
| 1129 | nmdc:mga00v17_785071_c1 | 3300050491 | Bacteria | 607 |
| 1130 | nmdc:mga0yw44_44376_c1 | 3300050492 | Bacteria | 2659 |
| 1131 | nmdc:mga06z11_15118_c1 | 3300050494 | Bacteria | 3437 |
| 1132 | nmdc:mga06z11_277840_c1 | 3300050494 | Bacteria | 992 |
| 1133 | nmdc:mga07m45_195205_c1 | 3300050496 | Bacteria | 1177 |
| 1134 | nmdc:mga07m45_601319_c1 | 3300050496 | Bacteria | 635 |
| 1135 | nmdc:mga05p37_1602_c1 | 3300050507 | Bacteria | 26254 |
| 1136 | nmdc:mga09592_7132_c1 | 3300050508 | Bacteria | 9086 |
| 1137 | nmdc:mga0qj67_556_c1 | 3300050509 | Bacteria | 25387 |
| 1138 | nmdc:mga06r32_8190_c1 | 3300050510 | Bacteria | 9408 |
| 1139 | nmdc:mga08y16_2018_c1 | 3300050511 | Bacteria | 20760 |
| 1140 | nmdc:mga08y16_4650_c1 | 3300050511 | Bacteria | 14290 |
| 1141 | nmdc:mga08y16_659742_c1 | 3300050511 | Bacteria | 1049 |
| 1142 | nmdc:mga08y16_66505_c1 | 3300050511 | Bacteria | 3762 |
| 1143 | nmdc:mga0n895_1478_c1 | 3300050512 | Bacteria | 17626 |
| 1144 | nmdc:mga0n895_389772_c1 | 3300050512 | Bacteria | 1409 |
| 1145 | nmdc:mga0n895_45434_c1 | 3300050512 | Bacteria | 4286 |
| 1146 | nmdc:mga0n895_51021_c1 | 3300050512 | Bacteria | 4058 |
| 1147 | nmdc:mga0n895_543_c1 | 3300050512 | Bacteria | 25826 |
| 1148 | nmdc:mga0n895_673468_c1 | 3300050512 | Bacteria | 1032 |
| 1149 | nmdc:mga0rr50_21800_c1 | 3300050513 | Bacteria | 4382 |
| 1150 | nmdc:mga0rr50_30768_c1 | 3300050513 | Bacteria | 1970 |
| 1151 | nmdc:mga0rr50_812_c1 | 3300050513 | Bacteria | 16808 |
| 1152 | nmdc:mga08x19_10925_c1 | 3300050514 | Bacteria | 5461 |
| 1153 | nmdc:mga08x19_281324_c1 | 3300050514 | Bacteria | 1153 |
| 1154 | nmdc:mga0a205_22992_c1 | 3300050515 | Bacteria | 5911 |
| 1155 | nmdc:mga0a205_416_c1 | 3300050515 | Bacteria | 32776 |
| 1156 | nmdc:mga0a205_80693_c1 | 3300050515 | Bacteria | 3143 |
| 1157 | nmdc:mga0sz30_105526_c1 | 3300050516 | Bacteria | 1233 |
| 1158 | Ga0495601_0000421 | 3300053077 | Bacteria | 22215 |
| 1159 | Ga0495601_0000432 | 3300053077 | Bacteria | 21914 |
| 1160 | Ga0495601_0002128 | 3300053077 | Bacteria | 11136 |
| 1161 | Ga0495601_0003953 | 3300053077 | Bacteria | 8536 |
| 1162 | Ga0495601_0319739 | 3300053077 | Bacteria | 1010 |
| 1163 | Ga0495601_0559152 | 3300053077 | Unclassified | 736 |
| 1164 | Ga0495601_0581046 | 3300053077 | Bacteria | 720 |
| 1165 | Ga0495612_0000870 | 3300053078 | Bacteria | 12306 |
| 1166 | Ga0495612_0003173 | 3300053078 | Bacteria | 6811 |
| 1167 | Ga0495612_0005259 | 3300053078 | Bacteria | 5346 |
| 1168 | Ga0495612_0026808 | 3300053078 | Bacteria | 2315 |
| 1169 | Ga0495612_0204412 | 3300053078 | Bacteria | 872 |
| 1170 | Ga0495595_0001669 | 3300053084 | Bacteria | 8687 |
| 1171 | Ga0495595_0033305 | 3300053084 | Bacteria | 2324 |
| 1172 | Ga0495595_0035941 | 3300053084 | Bacteria | 2246 |
| 1173 | Ga0495595_0069696 | 3300053084 | Bacteria | 1660 |
| 1174 | Ga0495595_0252704 | 3300053084 | Bacteria | 883 |
| 1175 | Ga0495619_0000290 | 3300053085 | Bacteria | 35735 |
| 1176 | Ga0495619_0000646 | 3300053085 | Bacteria | 22914 |
| 1177 | Ga0495619_0001716 | 3300053085 | Bacteria | 14533 |
| 1178 | Ga0495619_0009254 | 3300053085 | Bacteria | 6224 |
| 1179 | Ga0495619_0026265 | 3300053085 | Bacteria | 3745 |
| 1180 | Ga0495619_0035384 | 3300053085 | Bacteria | 3247 |
| 1181 | Ga0495619_0053709 | 3300053085 | Bacteria | 2666 |
| 1182 | Ga0500643_005975 | 3300053087 | Bacteria | 5156 |
| 1183 | Ga0500644_0001048 | 3300053088 | Bacteria | 8242 |
| 1184 | Ga0500651_0001317 | 3300053093 | Bacteria | 12398 |
| 1185 | Ga0500566_0225643 | 3300053094 | Bacteria | 928 |
| 1186 | Ga0500641_0015143 | 3300053096 | Bacteria | 2856 |
| 1187 | Ga0500650_0456857 | 3300053098 | Bacteria | 547 |
| 1188 | Ga0500595_000207 | 3300053119 | Bacteria | 39920 |
| 1189 | Ga0500595_008759 | 3300053119 | Bacteria | 4115 |
| 1190 | Ga0500642_0086259 | 3300053130 | Bacteria | 1447 |
| 1191 | Ga0500652_000015 | 3300053131 | Bacteria | 131012 |
| 1192 | Ga0500652_101713 | 3300053131 | Bacteria | 1201 |
| 1193 | Ga0500568_0014119 | 3300053139 | Bacteria | 3618 |
| 1194 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1195 | Ga0500657_073848 | 3300053728 | Bacteria | 1485 |
| 1196 | Ga0500645_000809 | 3300053730 | Bacteria | 18764 |
| 1197 | Ga0501084_0039406 | 3300054114 | Bacteria | 3952 |
| 1198 | Ga0501084_0357365 | 3300054114 | Bacteria | 1234 |
| 1199 | Ga0501084_0937779 | 3300054114 | Bacteria | 728 |
| 1200 | Ga0501082_0005955 | 3300060353 | Bacteria | 10578 |
| 1201 | Ga0501082_0038197 | 3300060353 | Bacteria | 4142 |
| 1202 | Ga0501082_0040568 | 3300060353 | Bacteria | 4014 |
| 1203 | Ga0501082_0377372 | 3300060353 | Bacteria | 1237 |
| 1204 | Ga0466962_0238867 | 3300061719 | Bacteria | 892 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0242180 | Ga0501040_0242180_280_633 | 117 |
| 2 | 3300049582 | Ga0501048_0451129 | Ga0501048_0451129_44_397 | 117 |
| 3 | 3300054114 | Ga0501084_0937779 | Ga0501084_0937779_299_652 | 117 |
| 4 | 3300039437 | Ga0436365_1087662 | Ga0436365_1087662_8419_8808 | 122 |
| 5 | 3300039453 | Ga0436362_0888596 | Ga0436362_0888596_1050_1439 | 122 |
| 6 | 3300005436 | Ga0070713_100087473 | Ga0070713_1000874731 | 123 |
| 7 | 3300005548 | Ga0070665_100621294 | Ga0070665_1006212942 | 123 |
| 8 | 3300005577 | Ga0068857_102169256 | Ga0068857_1021692561 | 123 |
| 9 | 3300005983 | Ga0081540_1167688 | Ga0081540_11676881 | 123 |
| 10 | 3300006038 | Ga0075365_10009225 | Ga0075365_100092253 | 123 |
| 11 | 3300006042 | Ga0075368_10247047 | Ga0075368_102470472 | 123 |
| 12 | 3300006048 | Ga0075363_100045621 | Ga0075363_1000456213 | 123 |
| 13 | 3300006175 | Ga0070712_100227037 | Ga0070712_1002270372 | 123 |
| 14 | 3300006177 | Ga0075362_10374700 | Ga0075362_103747002 | 123 |
| 15 | 3300006178 | Ga0075367_10049407 | Ga0075367_100494073 | 123 |
| 16 | 3300006186 | Ga0075369_10003411 | Ga0075369_100034117 | 123 |
| 17 | 3300006353 | Ga0075370_10124671 | Ga0075370_101246712 | 123 |
| 18 | 3300006358 | Ga0068871_100276495 | Ga0068871_1002764951 | 123 |
| 19 | 3300011119 | Ga0105246_10428427 | Ga0105246_104284272 | 123 |
| 20 | 3300014969 | Ga0157376_10282374 | Ga0157376_102823742 | 123 |
| 21 | 3300025915 | Ga0207693_10123787 | Ga0207693_101237873 | 123 |
| 22 | 3300025928 | Ga0207700_10084024 | Ga0207700_100840242 | 123 |
| 23 | 3300025928 | Ga0207700_10179797 | Ga0207700_101797973 | 123 |
| 24 | 3300026116 | Ga0207674_11862281 | Ga0207674_118622812 | 123 |
| 25 | 3300027866 | Ga0209813_10222301 | Ga0209813_102223012 | 123 |
| 26 | 3300028379 | Ga0268266_10452289 | Ga0268266_104522892 | 123 |
| 27 | 3300028381 | Ga0268264_11810990 | Ga0268264_118109902 | 123 |
| 28 | 3300031238 | Ga0265332_10012678 | Ga0265332_100126784 | 123 |
| 29 | 3300031247 | Ga0265340_10009447 | Ga0265340_100094475 | 123 |
| 30 | 3300031249 | Ga0265339_10002510 | Ga0265339_100025102 | 123 |
| 31 | 3300031250 | Ga0265331_10052122 | Ga0265331_100521222 | 123 |
| 32 | 3300031712 | Ga0265342_10000100 | Ga0265342_1000010081 | 123 |
| 33 | 3300036401 | Ga0373937_1288524 | Ga0373937_1288524_42_413 | 123 |
| 34 | 3300039437 | Ga0436365_1049521 | Ga0436365_1049521_464_835 | 123 |
| 35 | 3300039438 | Ga0436360_0529845 | Ga0436360_0529845_74_448 | 123 |
| 36 | 3300039447 | Ga0436361_0361045 | Ga0436361_0361045_658_1035 | 123 |
| 37 | 3300044712 | Ga0453684_2258685 | Ga0453684_2258685_70_447 | 123 |
| 38 | 3300050489 | nmdc:mga03683_663126_c1 | nmdc:mga03683_663126_c1_127_501 | 123 |
| 39 | 3300050490 | nmdc:mga03n38_227168_c1 | nmdc:mga03n38_227168_c1_200_574 | 123 |
| 40 | 3300050491 | nmdc:mga00v17_114829_c1 | nmdc:mga00v17_114829_c1_270_644 | 123 |
| 41 | 3300050491 | nmdc:mga00v17_785071_c1 | nmdc:mga00v17_785071_c1_32_406 | 123 |
| 42 | 3300050492 | nmdc:mga0yw44_44376_c1 | nmdc:mga0yw44_44376_c1_1030_1404 | 123 |
| 43 | 3300050494 | nmdc:mga06z11_277840_c1 | nmdc:mga06z11_277840_c1_555_929 | 123 |
| 44 | 3300050516 | nmdc:mga0sz30_105526_c1 | nmdc:mga0sz30_105526_c1_463_837 | 123 |
| 45 | 3300053077 | Ga0495601_0581046 | Ga0495601_0581046_205_585 | 123 |
| 46 | 3300053119 | Ga0500595_008759 | Ga0500595_008759_1024_1413 | 123 |
| 47 | 3300053131 | Ga0500652_000015 | Ga0500652_000015_95954_96343 | 123 |
| 48 | iso_pu_bacteria | 2775506901 | 2776259674 | 123 |
| 49 | iso_pu_bacteria | 2894232714 | 2894239712 | 123 |
| 50 | 3300003203 | JGI25406J46586_10011553 | JGI25406J46586_100115535 | 124 |
| 51 | 3300003203 | JGI25406J46586_10174127 | JGI25406J46586_101741271 | 124 |
| 52 | 3300005327 | Ga0070658_10102385 | Ga0070658_101023853 | 124 |
| 53 | 3300005329 | Ga0070683_100159387 | Ga0070683_1001593872 | 124 |
| 54 | 3300005336 | Ga0070680_100015774 | Ga0070680_1000157746 | 124 |
| 55 | 3300005336 | Ga0070680_100248420 | Ga0070680_1002484202 | 124 |
| 56 | 3300005458 | Ga0070681_10787947 | Ga0070681_107879472 | 124 |
| 57 | 3300005530 | Ga0070679_100226048 | Ga0070679_1002260482 | 124 |
| 58 | 3300005530 | Ga0070679_100526863 | Ga0070679_1005268632 | 124 |
| 59 | 3300005578 | Ga0068854_100421682 | Ga0068854_1004216822 | 124 |
| 60 | 3300005616 | Ga0068852_101702292 | Ga0068852_1017022921 | 124 |
| 61 | 3300005985 | Ga0081539_10002576 | Ga0081539_100025762 | 124 |
| 62 | 3300005985 | Ga0081539_10015291 | Ga0081539_100152912 | 124 |
| 63 | 3300009093 | Ga0105240_10230353 | Ga0105240_102303532 | 124 |
| 64 | 3300013102 | Ga0157371_10130578 | Ga0157371_101305781 | 124 |
| 65 | 3300013104 | Ga0157370_10246943 | Ga0157370_102469432 | 124 |
| 66 | 3300013105 | Ga0157369_10161484 | Ga0157369_101614843 | 124 |
| 67 | 3300020070 | Ga0206356_10003349 | Ga0206356_100033491 | 124 |
| 68 | 3300020081 | Ga0206354_10693229 | Ga0206354_106932293 | 124 |
| 69 | 3300020082 | Ga0206353_10814796 | Ga0206353_108147963 | 124 |
| 70 | 3300025909 | Ga0207705_11131735 | Ga0207705_111317352 | 124 |
| 71 | 3300025912 | Ga0207707_10164931 | Ga0207707_101649312 | 124 |
| 72 | 3300025913 | Ga0207695_10100177 | Ga0207695_101001772 | 124 |
| 73 | 3300025917 | Ga0207660_10177736 | Ga0207660_101777362 | 124 |
| 74 | 3300025917 | Ga0207660_10788597 | Ga0207660_107885972 | 124 |
| 75 | 3300025919 | Ga0207657_10548307 | Ga0207657_105483072 | 124 |
| 76 | 3300025921 | Ga0207652_10116076 | Ga0207652_101160763 | 124 |
| 77 | 3300025949 | Ga0207667_10091638 | Ga0207667_100916383 | 124 |
| 78 | 3300025981 | Ga0207640_10138435 | Ga0207640_101384352 | 124 |
| 79 | 3300026078 | Ga0207702_10233945 | Ga0207702_102339452 | 124 |
| 80 | 3300026142 | Ga0207698_10844193 | Ga0207698_108441932 | 124 |
| 81 | 3300035114 | Ga0373939_0016869 | Ga0373939_0016869_724_1104 | 124 |
| 82 | 3300039437 | Ga0436365_0526917 | Ga0436365_0526917_215_589 | 124 |
| 83 | 3300049823 | Ga0501044_0846455 | Ga0501044_0846455_147_521 | 124 |
| 84 | 3300060353 | Ga0501082_0040568 | Ga0501082_0040568_1763_2137 | 124 |
| 85 | 3300005327 | Ga0070658_10228080 | Ga0070658_102280802 | 125 |
| 86 | 3300005327 | Ga0070658_10635426 | Ga0070658_106354262 | 125 |
| 87 | 3300005329 | Ga0070683_100822410 | Ga0070683_1008224102 | 125 |
| 88 | 3300005344 | Ga0070661_101872066 | Ga0070661_1018720661 | 125 |
| 89 | 3300005439 | Ga0070711_100434713 | Ga0070711_1004347132 | 125 |
| 90 | 3300005530 | Ga0070679_100377845 | Ga0070679_1003778452 | 125 |
| 91 | 3300005530 | Ga0070679_101023342 | Ga0070679_1010233422 | 125 |
| 92 | 3300005535 | Ga0070684_100553191 | Ga0070684_1005531912 | 125 |
| 93 | 3300005563 | Ga0068855_100021624 | Ga0068855_1000216243 | 125 |
| 94 | 3300005563 | Ga0068855_100214826 | Ga0068855_1002148263 | 125 |
| 95 | 3300005577 | Ga0068857_100056322 | Ga0068857_1000563222 | 125 |
| 96 | 3300005614 | Ga0068856_100016984 | Ga0068856_1000169843 | 125 |
| 97 | 3300005616 | Ga0068852_100195162 | Ga0068852_1001951623 | 125 |
| 98 | 3300005616 | Ga0068852_100577512 | Ga0068852_1005775122 | 125 |
| 99 | 3300009093 | Ga0105240_11503080 | Ga0105240_115030801 | 125 |
| 100 | 3300013102 | Ga0157371_10713237 | Ga0157371_107132372 | 125 |
| 101 | 3300013105 | Ga0157369_10178812 | Ga0157369_101788123 | 125 |
| 102 | 3300013105 | Ga0157369_11983077 | Ga0157369_119830772 | 125 |
| 103 | 3300013307 | Ga0157372_11903094 | Ga0157372_119030942 | 125 |
| 104 | 3300013307 | Ga0157372_11916079 | Ga0157372_119160791 | 125 |
| 105 | 3300025909 | Ga0207705_10078348 | Ga0207705_100783482 | 125 |
| 106 | 3300025909 | Ga0207705_10686069 | Ga0207705_106860692 | 125 |
| 107 | 3300025921 | Ga0207652_10143996 | Ga0207652_101439962 | 125 |
| 108 | 3300025929 | Ga0207664_11533242 | Ga0207664_115332421 | 125 |
| 109 | 3300025949 | Ga0207667_10138054 | Ga0207667_101380543 | 125 |
| 110 | 3300026078 | Ga0207702_10047246 | Ga0207702_100472464 | 125 |
| 111 | 3300026142 | Ga0207698_10230967 | Ga0207698_102309672 | 125 |
| 112 | 3300028800 | Ga0265338_10314185 | Ga0265338_103141852 | 125 |
| 113 | 3300031241 | Ga0265325_10127687 | Ga0265325_101276872 | 125 |
| 114 | 3300031247 | Ga0265340_10164003 | Ga0265340_101640032 | 125 |
| 115 | 3300031249 | Ga0265339_10102961 | Ga0265339_101029611 | 125 |
| 116 | 3300031344 | Ga0265316_10029105 | Ga0265316_100291053 | 125 |
| 117 | 3300048920 | Ga0496117_0192034 | Ga0496117_0192034_487_867 | 125 |
| 118 | 3300048921 | Ga0496118_0287560 | Ga0496118_0287560_316_696 | 125 |
| 119 | 3300048929 | Ga0496126_0553084 | Ga0496126_0553084_28_414 | 125 |
| 120 | 3300048929 | Ga0496126_0640667 | Ga0496126_0640667_100_486 | 125 |
| 121 | 3300049588 | Ga0501072_0037872 | Ga0501072_0037872_2963_3340 | 125 |
| 122 | 3300053098 | Ga0500650_0456857 | Ga0500650_0456857_153_536 | 125 |
| 123 | 3300054114 | Ga0501084_0039406 | Ga0501084_0039406_1213_1590 | 125 |
| 124 | iso_pu_bacteria | 2643221547 | 2643756491 | 125 |
| 125 | 3300005329 | Ga0070683_101972020 | Ga0070683_1019720201 | 126 |
| 126 | 3300005336 | Ga0070680_100639722 | Ga0070680_1006397222 | 126 |
| 127 | 3300005435 | Ga0070714_100070353 | Ga0070714_1000703533 | 126 |
| 128 | 3300005439 | Ga0070711_101731074 | Ga0070711_1017310741 | 126 |
| 129 | 3300005614 | Ga0068856_100698661 | Ga0068856_1006986612 | 126 |
| 130 | 3300014497 | Ga0182008_10053772 | Ga0182008_100537723 | 126 |
| 131 | 3300025916 | Ga0207663_10999972 | Ga0207663_109999722 | 126 |
| 132 | 3300025917 | Ga0207660_10477817 | Ga0207660_104778172 | 126 |
| 133 | 3300025929 | Ga0207664_10035588 | Ga0207664_100355882 | 126 |
| 134 | 3300028800 | Ga0265338_10480238 | Ga0265338_104802382 | 126 |
| 135 | 3300031241 | Ga0265325_10087695 | Ga0265325_100876953 | 126 |
| 136 | 3300035171 | Ga0373946_0178767 | Ga0373946_0178767_510_893 | 126 |
| 137 | 3300037312 | Ga0395899_0051228 | Ga0395899_0051228_1667_2053 | 126 |
| 138 | 3300037418 | Ga0395900_0010327 | Ga0395900_0010327_1490_1876 | 126 |
| 139 | 3300037418 | Ga0395900_0043459 | Ga0395900_0043459_3830_4216 | 126 |
| 140 | 3300037418 | Ga0395900_0387634 | Ga0395900_0387634_260_646 | 126 |
| 141 | 3300037418 | Ga0395900_0526432 | Ga0395900_0526432_631_1017 | 126 |
| 142 | 3300037466 | Ga0395898_0002494 | Ga0395898_0002494_13305_13691 | 126 |
| 143 | 3300037466 | Ga0395898_0003815 | Ga0395898_0003815_9335_9721 | 126 |
| 144 | 3300037466 | Ga0395898_0304507 | Ga0395898_0304507_671_1057 | 126 |
| 145 | 3300037466 | Ga0395898_0377021 | Ga0395898_0377021_468_854 | 126 |
| 146 | 3300038443 | Ga0395901_0018402 | Ga0395901_0018402_3524_3910 | 126 |
| 147 | 3300038443 | Ga0395901_0025517 | Ga0395901_0025517_5199_5585 | 126 |
| 148 | 3300038443 | Ga0395901_0202740 | Ga0395901_0202740_1645_2031 | 126 |
| 149 | 3300038443 | Ga0395901_0971502 | Ga0395901_0971502_181_567 | 126 |
| 150 | 3300038443 | Ga0395901_1025629 | Ga0395901_1025629_260_646 | 126 |
| 151 | 3300039437 | Ga0436365_1220299 | Ga0436365_1220299_840_1223 | 126 |
| 152 | 3300044684 | Ga0466966_0066734 | Ga0466966_0066734_823_1209 | 126 |
| 153 | 3300044694 | Ga0466963_0045141 | Ga0466963_0045141_1293_1679 | 126 |
| 154 | 3300044694 | Ga0466963_0815059 | Ga0466963_0815059_248_628 | 126 |
| 155 | 3300044694 | Ga0466963_0877065 | Ga0466963_0877065_114_500 | 126 |
| 156 | 3300044719 | Ga0466971_0348406 | Ga0466971_0348406_160_546 | 126 |
| 157 | 3300044842 | Ga0466957_0055366 | Ga0466957_0055366_1847_2233 | 126 |
| 158 | 3300044842 | Ga0466957_0163849 | Ga0466957_0163849_23_409 | 126 |
| 159 | 3300044842 | Ga0466957_0620959 | Ga0466957_0620959_91_477 | 126 |
| 160 | 3300045049 | Ga0466959_1181814 | Ga0466959_1181814_112_498 | 126 |
| 161 | 3300045836 | Ga0466958_0030567 | Ga0466958_0030567_160_546 | 126 |
| 162 | 3300045836 | Ga0466958_0131965 | Ga0466958_0131965_199_585 | 126 |
| 163 | 3300045976 | Ga0466967_0003577 | Ga0466967_0003577_4608_4994 | 126 |
| 164 | 3300045976 | Ga0466967_1229181 | Ga0466967_1229181_303_689 | 126 |
| 165 | 3300053084 | Ga0495595_0035941 | Ga0495595_0035941_1672_2058 | 126 |
| 166 | 3300053085 | Ga0495619_0053709 | Ga0495619_0053709_1919_2305 | 126 |
| 167 | 3300061719 | Ga0466962_0238867 | Ga0466962_0238867_310_696 | 126 |
| 168 | 3300005366 | Ga0070659_100684418 | Ga0070659_1006844182 | 127 |
| 169 | 3300005457 | Ga0070662_101167975 | Ga0070662_1011679751 | 127 |
| 170 | 3300006175 | Ga0070712_100532489 | Ga0070712_1005324892 | 127 |
| 171 | 3300009148 | Ga0105243_10075091 | Ga0105243_100750913 | 127 |
| 172 | 3300009553 | Ga0105249_11062943 | Ga0105249_110629432 | 127 |
| 173 | 3300009553 | Ga0105249_13163810 | Ga0105249_131638101 | 127 |
| 174 | 3300011119 | Ga0105246_11089332 | Ga0105246_110893322 | 127 |
| 175 | 3300014326 | Ga0157380_10086328 | Ga0157380_100863282 | 127 |
| 176 | 3300025935 | Ga0207709_10357161 | Ga0207709_103571611 | 127 |
| 177 | 3300025961 | Ga0207712_10756154 | Ga0207712_107561542 | 127 |
| 178 | 3300028577 | Ga0265318_10184582 | Ga0265318_101845822 | 127 |
| 179 | 3300031238 | Ga0265332_10166816 | Ga0265332_101668162 | 127 |
| 180 | 3300031239 | Ga0265328_10046186 | Ga0265328_100461862 | 127 |
| 181 | 3300031240 | Ga0265320_10064698 | Ga0265320_100646982 | 127 |
| 182 | 3300031241 | Ga0265325_10009247 | Ga0265325_100092473 | 127 |
| 183 | 3300031242 | Ga0265329_10009220 | Ga0265329_100092203 | 127 |
| 184 | 3300031247 | Ga0265340_10036372 | Ga0265340_100363723 | 127 |
| 185 | 3300031249 | Ga0265339_10274411 | Ga0265339_102744112 | 127 |
| 186 | 3300031250 | Ga0265331_10024615 | Ga0265331_100246153 | 127 |
| 187 | 3300031344 | Ga0265316_10021951 | Ga0265316_100219515 | 127 |
| 188 | 3300031548 | Ga0307408_100086205 | Ga0307408_1000862052 | 127 |
| 189 | 3300031595 | Ga0265313_10007379 | Ga0265313_100073796 | 127 |
| 190 | 3300031711 | Ga0265314_10002433 | Ga0265314_1000243312 | 127 |
| 191 | 3300031711 | Ga0265314_10003272 | Ga0265314_100032725 | 127 |
| 192 | 3300031711 | Ga0265314_10152456 | Ga0265314_101524562 | 127 |
| 193 | 3300031712 | Ga0265342_10053265 | Ga0265342_100532653 | 127 |
| 194 | 3300031731 | Ga0307405_10219875 | Ga0307405_102198751 | 127 |
| 195 | 3300031824 | Ga0307413_10533738 | Ga0307413_105337382 | 127 |
| 196 | 3300031824 | Ga0307413_12017283 | Ga0307413_120172832 | 127 |
| 197 | 3300031901 | Ga0307406_11760322 | Ga0307406_117603221 | 127 |
| 198 | 3300031995 | Ga0307409_100170433 | Ga0307409_1001704333 | 127 |
| 199 | 3300032005 | Ga0307411_10106315 | Ga0307411_101063153 | 127 |
| 200 | 3300032126 | Ga0307415_102076388 | Ga0307415_1020763882 | 127 |
| 201 | 3300035114 | Ga0373939_0376558 | Ga0373939_0376558_85_471 | 127 |
| 202 | 3300037853 | Ga0436364_0165904 | Ga0436364_0165904_5890_6276 | 127 |
| 203 | 3300038443 | Ga0395901_0237239 | Ga0395901_0237239_49_432 | 127 |
| 204 | 3300039437 | Ga0436365_0286964 | Ga0436365_0286964_19879_20265 | 127 |
| 205 | 3300041413 | Ga0439465_0163510 | Ga0439465_0163510_115_501 | 127 |
| 206 | 3300044683 | Ga0466965_0101696 | Ga0466965_0101696_188_574 | 127 |
| 207 | 3300044694 | Ga0466963_0580176 | Ga0466963_0580176_378_767 | 127 |
| 208 | 3300044842 | Ga0466957_0691794 | Ga0466957_0691794_213_596 | 127 |
| 209 | 3300044901 | Ga0466960_0123051 | Ga0466960_0123051_282_668 | 127 |
| 210 | 3300049568 | Ga0501031_0213486 | Ga0501031_0213486_716_1099 | 127 |
| 211 | 3300049569 | Ga0501032_0239703 | Ga0501032_0239703_205_588 | 127 |
| 212 | 3300049570 | Ga0501033_0481433 | Ga0501033_0481433_414_797 | 127 |
| 213 | 3300049571 | Ga0501034_0029113 | Ga0501034_0029113_1737_2120 | 127 |
| 214 | 3300049571 | Ga0501034_0473555 | Ga0501034_0473555_590_973 | 127 |
| 215 | 3300049573 | Ga0501037_0619680 | Ga0501037_0619680_198_581 | 127 |
| 216 | 3300049574 | Ga0501038_0017167 | Ga0501038_0017167_329_712 | 127 |
| 217 | 3300049579 | Ga0501043_0916399 | Ga0501043_0916399_149_532 | 127 |
| 218 | 3300049581 | Ga0501047_0035044 | Ga0501047_0035044_1877_2260 | 127 |
| 219 | 3300049585 | Ga0501069_0248163 | Ga0501069_0248163_366_749 | 127 |
| 220 | 3300049586 | Ga0501070_0086824 | Ga0501070_0086824_1609_1992 | 127 |
| 221 | 3300049588 | Ga0501072_0548700 | Ga0501072_0548700_210_593 | 127 |
| 222 | 3300049589 | Ga0501073_0013366 | Ga0501073_0013366_1838_2221 | 127 |
| 223 | 3300049590 | Ga0501074_0179347 | Ga0501074_0179347_552_935 | 127 |
| 224 | 3300049705 | Ga0501225_0220064 | Ga0501225_0220064_131_517 | 127 |
| 225 | 3300049744 | Ga0501083_0113453 | Ga0501083_0113453_862_1245 | 127 |
| 226 | 3300049744 | Ga0501083_0760287 | Ga0501083_0760287_62_448 | 127 |
| 227 | 3300049767 | Ga0501270_088430 | Ga0501270_088430_48_434 | 127 |
| 228 | 3300049823 | Ga0501044_0367280 | Ga0501044_0367280_719_1102 | 127 |
| 229 | 3300049851 | Ga0501212_098559 | Ga0501212_098559_92_478 | 127 |
| 230 | 3300053139 | Ga0500568_0014119 | Ga0500568_0014119_769_1155 | 127 |
| 231 | 3300054114 | Ga0501084_0357365 | Ga0501084_0357365_280_663 | 127 |
| 232 | 3300060353 | Ga0501082_0038197 | Ga0501082_0038197_2321_2704 | 127 |
| 233 | 3300060353 | Ga0501082_0377372 | Ga0501082_0377372_683_1069 | 127 |
| 234 | 3300031665 | Ga0316575_10121640 | Ga0316575_101216401 | 128 |
| 235 | 3300031691 | Ga0316579_10097583 | Ga0316579_100975832 | 128 |
| 236 | 3300034818 | Ga0373950_0005561 | Ga0373950_0005561_398_784 | 128 |
| 237 | 3300035172 | Ga0373955_0135867 | Ga0373955_0135867_479_865 | 128 |
| 238 | 3300035172 | Ga0373955_0750873 | Ga0373955_0750873_76_462 | 128 |
| 239 | 3300035242 | Ga0373962_0383716 | Ga0373962_0383716_52_438 | 128 |
| 240 | 3300035692 | Ga0373935_0268586 | Ga0373935_0268586_142_528 | 128 |
| 241 | 3300036401 | Ga0373937_0095541 | Ga0373937_0095541_834_1220 | 128 |
| 242 | 3300046459 | Ga0495629_0561460 | Ga0495629_0561460_354_740 | 128 |
| 243 | 3300046463 | Ga0495653_0172473 | Ga0495653_0172473_16_402 | 128 |
| 244 | 3300046473 | Ga0495582_0702959 | Ga0495582_0702959_57_443 | 128 |
| 245 | 3300046516 | Ga0495628_0316951 | Ga0495628_0316951_755_1141 | 128 |
| 246 | 3300046529 | Ga0495652_0256266 | Ga0495652_0256266_824_1210 | 128 |
| 247 | 3300046533 | Ga0495640_0188521 | Ga0495640_0188521_911_1297 | 128 |
| 248 | 3300046642 | Ga0495634_0218569 | Ga0495634_0218569_28_414 | 128 |
| 249 | 3300046663 | Ga0495635_0123809 | Ga0495635_0123809_1225_1611 | 128 |
| 250 | 3300046678 | Ga0495599_0095990 | Ga0495599_0095990_521_907 | 128 |
| 251 | 3300046683 | Ga0495658_0052367 | Ga0495658_0052367_98_484 | 128 |
| 252 | 3300046809 | Ga0495600_0037916 | Ga0495600_0037916_1006_1392 | 128 |
| 253 | 3300047317 | Ga0495604_0046839 | Ga0495604_0046839_500_886 | 128 |
| 254 | 3300047319 | Ga0495674_0074183 | Ga0495674_0074183_1269_1655 | 128 |
| 255 | 3300047471 | Ga0495684_0107074 | Ga0495684_0107074_1059_1445 | 128 |
| 256 | 3300049575 | Ga0501039_1369715 | Ga0501039_1369715_87_479 | 128 |
| 257 | 3300049744 | Ga0501083_0154700 | Ga0501083_0154700_1029_1415 | 128 |
| 258 | 3300050491 | nmdc:mga00v17_75166_c1 | nmdc:mga00v17_75166_c1_1676_2065 | 128 |
| 259 | 3300053077 | Ga0495601_0000421 | Ga0495601_0000421_7557_7943 | 128 |
| 260 | 3300053077 | Ga0495601_0559152 | Ga0495601_0559152_13_399 | 128 |
| 261 | 3300053078 | Ga0495612_0204412 | Ga0495612_0204412_299_685 | 128 |
| 262 | 3300053084 | Ga0495595_0033305 | Ga0495595_0033305_626_1012 | 128 |
| 263 | 3300053085 | Ga0495619_0000290 | Ga0495619_0000290_707_1093 | 128 |
| 264 | 3300053096 | Ga0500641_0015143 | Ga0500641_0015143_1166_1552 | 128 |
| 265 | 2209111006 | 2214800771 | 2213830235 | 129 |
| 266 | 3300000042 | ARSoilYngRDRAFT_c00311 | ARSoilYngRDRAFT_003117 | 129 |
| 267 | 3300000043 | ARcpr5yngRDRAFT_c000325 | ARcpr5yngRDRAFT_0003253 | 129 |
| 268 | 3300000044 | ARSoilOldRDRAFT_c000035 | ARSoilOldRDRAFT_00003529 | 129 |
| 269 | 3300000652 | ARCol0yngRDRAFT_1000039 | ARCol0yngRDRAFT_10000393 | 129 |
| 270 | 3300001904 | JGI24736J21556_1011646 | JGI24736J21556_10116462 | 129 |
| 271 | 3300001977 | JGI24746J21847_1001683 | JGI24746J21847_10016833 | 129 |
| 272 | 3300001978 | JGI24747J21853_1000078 | JGI24747J21853_10000783 | 129 |
| 273 | 3300001989 | JGI24739J22299_10003335 | JGI24739J22299_100033356 | 129 |
| 274 | 3300001990 | JGI24737J22298_10000091 | JGI24737J22298_100000913 | 129 |
| 275 | 3300001990 | JGI24737J22298_10002689 | JGI24737J22298_100026892 | 129 |
| 276 | 3300001991 | JGI24743J22301_10000116 | JGI24743J22301_100001164 | 129 |
| 277 | 3300002067 | JGI24735J21928_10070098 | JGI24735J21928_100700982 | 129 |
| 278 | 3300002070 | JGI24750J21931_1000403 | JGI24750J21931_100040310 | 129 |
| 279 | 3300002073 | JGI24745J21846_1000016 | JGI24745J21846_10000167 | 129 |
| 280 | 3300002074 | JGI24748J21848_1003441 | JGI24748J21848_10034412 | 129 |
| 281 | 3300002075 | JGI24738J21930_10000701 | JGI24738J21930_1000070110 | 129 |
| 282 | 3300002076 | JGI24749J21850_1000112 | JGI24749J21850_100011218 | 129 |
| 283 | 3300002077 | JGI24744J21845_10004766 | JGI24744J21845_100047663 | 129 |
| 284 | 3300002126 | JGI24035J26624_1000063 | JGI24035J26624_10000634 | 129 |
| 285 | 3300002239 | JGI24034J26672_10000333 | JGI24034J26672_100003333 | 129 |
| 286 | 3300002244 | JGI24742J22300_10000372 | JGI24742J22300_100003723 | 129 |
| 287 | 3300003911 | JGI25405J52794_10006686 | JGI25405J52794_100066862 | 129 |
| 288 | 3300003911 | JGI25405J52794_10009062 | JGI25405J52794_100090622 | 129 |
| 289 | 3300005277 | Ga0065716_1002818 | Ga0065716_10028182 | 129 |
| 290 | 3300005290 | Ga0065712_10078281 | Ga0065712_100782814 | 129 |
| 291 | 3300005293 | Ga0065715_10000516 | Ga0065715_1000051612 | 129 |
| 292 | 3300005293 | Ga0065715_10089753 | Ga0065715_100897536 | 129 |
| 293 | 3300005295 | Ga0065707_10097659 | Ga0065707_100976593 | 129 |
| 294 | 3300005295 | Ga0065707_10145456 | Ga0065707_101454563 | 129 |
| 295 | 3300005295 | Ga0065707_10684514 | Ga0065707_106845141 | 129 |
| 296 | 3300005327 | Ga0070658_10237134 | Ga0070658_102371342 | 129 |
| 297 | 3300005328 | Ga0070676_10000364 | Ga0070676_1000036415 | 129 |
| 298 | 3300005328 | Ga0070676_10195938 | Ga0070676_101959382 | 129 |
| 299 | 3300005329 | Ga0070683_100000748 | Ga0070683_10000074824 | 129 |
| 300 | 3300005329 | Ga0070683_100249305 | Ga0070683_1002493052 | 129 |
| 301 | 3300005330 | Ga0070690_100002562 | Ga0070690_1000025623 | 129 |
| 302 | 3300005330 | Ga0070690_100017617 | Ga0070690_1000176173 | 129 |
| 303 | 3300005330 | Ga0070690_100166028 | Ga0070690_1001660282 | 129 |
| 304 | 3300005331 | Ga0070670_100011248 | Ga0070670_10001124810 | 129 |
| 305 | 3300005331 | Ga0070670_100142125 | Ga0070670_1001421252 | 129 |
| 306 | 3300005333 | Ga0070677_10000228 | Ga0070677_100002289 | 129 |
| 307 | 3300005334 | Ga0068869_100016306 | Ga0068869_1000163065 | 129 |
| 308 | 3300005335 | Ga0070666_10032523 | Ga0070666_100325232 | 129 |
| 309 | 3300005335 | Ga0070666_10129985 | Ga0070666_101299852 | 129 |
| 310 | 3300005336 | Ga0070680_100006466 | Ga0070680_1000064662 | 129 |
| 311 | 3300005336 | Ga0070680_100010322 | Ga0070680_1000103226 | 129 |
| 312 | 3300005336 | Ga0070680_100026684 | Ga0070680_1000266845 | 129 |
| 313 | 3300005336 | Ga0070680_100186584 | Ga0070680_1001865843 | 129 |
| 314 | 3300005337 | Ga0070682_100001379 | Ga0070682_10000137912 | 129 |
| 315 | 3300005337 | Ga0070682_100121886 | Ga0070682_1001218862 | 129 |
| 316 | 3300005337 | Ga0070682_100155975 | Ga0070682_1001559753 | 129 |
| 317 | 3300005338 | Ga0068868_100001339 | Ga0068868_10000133910 | 129 |
| 318 | 3300005339 | Ga0070660_100001616 | Ga0070660_10000161614 | 129 |
| 319 | 3300005339 | Ga0070660_100065012 | Ga0070660_1000650123 | 129 |
| 320 | 3300005339 | Ga0070660_101008387 | Ga0070660_1010083871 | 129 |
| 321 | 3300005340 | Ga0070689_100000146 | Ga0070689_10000014613 | 129 |
| 322 | 3300005341 | Ga0070691_10000065 | Ga0070691_100000659 | 129 |
| 323 | 3300005341 | Ga0070691_10037556 | Ga0070691_100375562 | 129 |
| 324 | 3300005343 | Ga0070687_100000023 | Ga0070687_10000002341 | 129 |
| 325 | 3300005343 | Ga0070687_100498358 | Ga0070687_1004983582 | 129 |
| 326 | 3300005344 | Ga0070661_100000407 | Ga0070661_10000040716 | 129 |
| 327 | 3300005344 | Ga0070661_100409923 | Ga0070661_1004099232 | 129 |
| 328 | 3300005345 | Ga0070692_10000270 | Ga0070692_100002706 | 129 |
| 329 | 3300005347 | Ga0070668_100011009 | Ga0070668_1000110096 | 129 |
| 330 | 3300005347 | Ga0070668_100228949 | Ga0070668_1002289493 | 129 |
| 331 | 3300005347 | Ga0070668_100727666 | Ga0070668_1007276662 | 129 |
| 332 | 3300005347 | Ga0070668_100832818 | Ga0070668_1008328182 | 129 |
| 333 | 3300005353 | Ga0070669_100004155 | Ga0070669_1000041558 | 129 |
| 334 | 3300005353 | Ga0070669_100041857 | Ga0070669_1000418572 | 129 |
| 335 | 3300005354 | Ga0070675_100000306 | Ga0070675_10000030625 | 129 |
| 336 | 3300005354 | Ga0070675_100317093 | Ga0070675_1003170932 | 129 |
| 337 | 3300005354 | Ga0070675_101391628 | Ga0070675_1013916281 | 129 |
| 338 | 3300005355 | Ga0070671_100009840 | Ga0070671_1000098402 | 129 |
| 339 | 3300005355 | Ga0070671_100306428 | Ga0070671_1003064282 | 129 |
| 340 | 3300005355 | Ga0070671_100661942 | Ga0070671_1006619421 | 129 |
| 341 | 3300005356 | Ga0070674_100000671 | Ga0070674_1000006713 | 129 |
| 342 | 3300005356 | Ga0070674_100096495 | Ga0070674_1000964952 | 129 |
| 343 | 3300005364 | Ga0070673_100000297 | Ga0070673_1000002976 | 129 |
| 344 | 3300005364 | Ga0070673_100598356 | Ga0070673_1005983562 | 129 |
| 345 | 3300005364 | Ga0070673_100657598 | Ga0070673_1006575982 | 129 |
| 346 | 3300005365 | Ga0070688_100004712 | Ga0070688_1000047126 | 129 |
| 347 | 3300005366 | Ga0070659_100001563 | Ga0070659_1000015639 | 129 |
| 348 | 3300005366 | Ga0070659_100156952 | Ga0070659_1001569522 | 129 |
| 349 | 3300005367 | Ga0070667_100000745 | Ga0070667_10000074514 | 129 |
| 350 | 3300005367 | Ga0070667_100091711 | Ga0070667_1000917111 | 129 |
| 351 | 3300005367 | Ga0070667_100487063 | Ga0070667_1004870632 | 129 |
| 352 | 3300005434 | Ga0070709_10104162 | Ga0070709_101041623 | 129 |
| 353 | 3300005435 | Ga0070714_100328883 | Ga0070714_1003288832 | 129 |
| 354 | 3300005435 | Ga0070714_100883425 | Ga0070714_1008834252 | 129 |
| 355 | 3300005436 | Ga0070713_100038130 | Ga0070713_1000381305 | 129 |
| 356 | 3300005436 | Ga0070713_100059946 | Ga0070713_1000599462 | 129 |
| 357 | 3300005436 | Ga0070713_100173767 | Ga0070713_1001737672 | 129 |
| 358 | 3300005436 | Ga0070713_100908353 | Ga0070713_1009083532 | 129 |
| 359 | 3300005437 | Ga0070710_10039547 | Ga0070710_100395472 | 129 |
| 360 | 3300005437 | Ga0070710_10135227 | Ga0070710_101352272 | 129 |
| 361 | 3300005437 | Ga0070710_10895248 | Ga0070710_108952481 | 129 |
| 362 | 3300005437 | Ga0070710_11259451 | Ga0070710_112594511 | 129 |
| 363 | 3300005438 | Ga0070701_10118045 | Ga0070701_101180451 | 129 |
| 364 | 3300005439 | Ga0070711_100210435 | Ga0070711_1002104352 | 129 |
| 365 | 3300005439 | Ga0070711_100234967 | Ga0070711_1002349672 | 129 |
| 366 | 3300005439 | Ga0070711_100488296 | Ga0070711_1004882962 | 129 |
| 367 | 3300005439 | Ga0070711_100783137 | Ga0070711_1007831372 | 129 |
| 368 | 3300005440 | Ga0070705_100196065 | Ga0070705_1001960652 | 129 |
| 369 | 3300005440 | Ga0070705_100838066 | Ga0070705_1008380661 | 129 |
| 370 | 3300005440 | Ga0070705_100872608 | Ga0070705_1008726082 | 129 |
| 371 | 3300005441 | Ga0070700_100004819 | Ga0070700_1000048196 | 129 |
| 372 | 3300005441 | Ga0070700_100603734 | Ga0070700_1006037342 | 129 |
| 373 | 3300005441 | Ga0070700_100926914 | Ga0070700_1009269142 | 129 |
| 374 | 3300005444 | Ga0070694_100014232 | Ga0070694_1000142323 | 129 |
| 375 | 3300005444 | Ga0070694_100095358 | Ga0070694_1000953583 | 129 |
| 376 | 3300005445 | Ga0070708_100112513 | Ga0070708_1001125132 | 129 |
| 377 | 3300005445 | Ga0070708_100296696 | Ga0070708_1002966962 | 129 |
| 378 | 3300005455 | Ga0070663_100000121 | Ga0070663_10000012133 | 129 |
| 379 | 3300005455 | Ga0070663_100025382 | Ga0070663_1000253823 | 129 |
| 380 | 3300005455 | Ga0070663_100030390 | Ga0070663_1000303903 | 129 |
| 381 | 3300005455 | Ga0070663_100224449 | Ga0070663_1002244492 | 129 |
| 382 | 3300005455 | Ga0070663_100746130 | Ga0070663_1007461302 | 129 |
| 383 | 3300005456 | Ga0070678_100089894 | Ga0070678_1000898942 | 129 |
| 384 | 3300005456 | Ga0070678_100400349 | Ga0070678_1004003492 | 129 |
| 385 | 3300005457 | Ga0070662_100007921 | Ga0070662_1000079215 | 129 |
| 386 | 3300005457 | Ga0070662_100011135 | Ga0070662_1000111352 | 129 |
| 387 | 3300005457 | Ga0070662_100410465 | Ga0070662_1004104652 | 129 |
| 388 | 3300005458 | Ga0070681_10004011 | Ga0070681_100040115 | 129 |
| 389 | 3300005458 | Ga0070681_10067881 | Ga0070681_100678812 | 129 |
| 390 | 3300005458 | Ga0070681_10222980 | Ga0070681_102229802 | 129 |
| 391 | 3300005458 | Ga0070681_10228885 | Ga0070681_102288852 | 129 |
| 392 | 3300005459 | Ga0068867_100000553 | Ga0068867_10000055323 | 129 |
| 393 | 3300005459 | Ga0068867_100470041 | Ga0068867_1004700412 | 129 |
| 394 | 3300005466 | Ga0070685_10000632 | Ga0070685_100006323 | 129 |
| 395 | 3300005466 | Ga0070685_10005595 | Ga0070685_100055956 | 129 |
| 396 | 3300005507 | Ga0074259_10260207 | Ga0074259_102602072 | 129 |
| 397 | 3300005518 | Ga0070699_100134004 | Ga0070699_1001340042 | 129 |
| 398 | 3300005530 | Ga0070679_100005467 | Ga0070679_10000546714 | 129 |
| 399 | 3300005530 | Ga0070679_100064214 | Ga0070679_1000642142 | 129 |
| 400 | 3300005530 | Ga0070679_100117077 | Ga0070679_1001170772 | 129 |
| 401 | 3300005530 | Ga0070679_100125165 | Ga0070679_1001251651 | 129 |
| 402 | 3300005530 | Ga0070679_100252778 | Ga0070679_1002527782 | 129 |
| 403 | 3300005530 | Ga0070679_101217576 | Ga0070679_1012175762 | 129 |
| 404 | 3300005535 | Ga0070684_100000454 | Ga0070684_10000045423 | 129 |
| 405 | 3300005536 | Ga0070697_100348928 | Ga0070697_1003489282 | 129 |
| 406 | 3300005536 | Ga0070697_100382202 | Ga0070697_1003822022 | 129 |
| 407 | 3300005536 | Ga0070697_101809432 | Ga0070697_1018094321 | 129 |
| 408 | 3300005539 | Ga0068853_100116823 | Ga0068853_1001168232 | 129 |
| 409 | 3300005539 | Ga0068853_101095680 | Ga0068853_1010956801 | 129 |
| 410 | 3300005543 | Ga0070672_100000045 | Ga0070672_10000004528 | 129 |
| 411 | 3300005544 | Ga0070686_100000480 | Ga0070686_1000004805 | 129 |
| 412 | 3300005544 | Ga0070686_100035382 | Ga0070686_1000353823 | 129 |
| 413 | 3300005544 | Ga0070686_100211338 | Ga0070686_1002113382 | 129 |
| 414 | 3300005544 | Ga0070686_100375582 | Ga0070686_1003755822 | 129 |
| 415 | 3300005544 | Ga0070686_100858666 | Ga0070686_1008586662 | 129 |
| 416 | 3300005545 | Ga0070695_100004089 | Ga0070695_1000040894 | 129 |
| 417 | 3300005545 | Ga0070695_100004677 | Ga0070695_1000046777 | 129 |
| 418 | 3300005545 | Ga0070695_100055080 | Ga0070695_1000550803 | 129 |
| 419 | 3300005545 | Ga0070695_100829084 | Ga0070695_1008290842 | 129 |
| 420 | 3300005546 | Ga0070696_100004193 | Ga0070696_1000041937 | 129 |
| 421 | 3300005546 | Ga0070696_100385187 | Ga0070696_1003851872 | 129 |
| 422 | 3300005546 | Ga0070696_100818601 | Ga0070696_1008186011 | 129 |
| 423 | 3300005546 | Ga0070696_101276047 | Ga0070696_1012760471 | 129 |
| 424 | 3300005547 | Ga0070693_100004943 | Ga0070693_1000049437 | 129 |
| 425 | 3300005547 | Ga0070693_100177847 | Ga0070693_1001778472 | 129 |
| 426 | 3300005547 | Ga0070693_100644696 | Ga0070693_1006446961 | 129 |
| 427 | 3300005548 | Ga0070665_100054904 | Ga0070665_1000549043 | 129 |
| 428 | 3300005548 | Ga0070665_100574211 | Ga0070665_1005742112 | 129 |
| 429 | 3300005549 | Ga0070704_100000031 | Ga0070704_1000000315 | 129 |
| 430 | 3300005549 | Ga0070704_100067875 | Ga0070704_1000678753 | 129 |
| 431 | 3300005563 | Ga0068855_100006104 | Ga0068855_1000061044 | 129 |
| 432 | 3300005564 | Ga0070664_100000899 | Ga0070664_1000008996 | 129 |
| 433 | 3300005564 | Ga0070664_100165056 | Ga0070664_1001650563 | 129 |
| 434 | 3300005564 | Ga0070664_100222742 | Ga0070664_1002227422 | 129 |
| 435 | 3300005564 | Ga0070664_100359277 | Ga0070664_1003592771 | 129 |
| 436 | 3300005564 | Ga0070664_100638975 | Ga0070664_1006389752 | 129 |
| 437 | 3300005577 | Ga0068857_100000623 | Ga0068857_10000062322 | 129 |
| 438 | 3300005578 | Ga0068854_100686888 | Ga0068854_1006868882 | 129 |
| 439 | 3300005614 | Ga0068856_100004332 | Ga0068856_10000433217 | 129 |
| 440 | 3300005615 | Ga0070702_100000128 | Ga0070702_1000001284 | 129 |
| 441 | 3300005616 | Ga0068852_100051090 | Ga0068852_1000510902 | 129 |
| 442 | 3300005616 | Ga0068852_100203811 | Ga0068852_1002038112 | 129 |
| 443 | 3300005617 | Ga0068859_100001291 | Ga0068859_10000129126 | 129 |
| 444 | 3300005617 | Ga0068859_100019144 | Ga0068859_1000191446 | 129 |
| 445 | 3300005617 | Ga0068859_101156887 | Ga0068859_1011568872 | 129 |
| 446 | 3300005618 | Ga0068864_100010716 | Ga0068864_1000107166 | 129 |
| 447 | 3300005618 | Ga0068864_100327381 | Ga0068864_1003273812 | 129 |
| 448 | 3300005618 | Ga0068864_100469223 | Ga0068864_1004692232 | 129 |
| 449 | 3300005618 | Ga0068864_100617004 | Ga0068864_1006170042 | 129 |
| 450 | 3300005718 | Ga0068866_10000346 | Ga0068866_1000034616 | 129 |
| 451 | 3300005719 | Ga0068861_100000045 | Ga0068861_10000004536 | 129 |
| 452 | 3300005719 | Ga0068861_102579018 | Ga0068861_1025790181 | 129 |
| 453 | 3300005834 | Ga0068851_10167711 | Ga0068851_101677112 | 129 |
| 454 | 3300005840 | Ga0068870_10000213 | Ga0068870_1000021320 | 129 |
| 455 | 3300005841 | Ga0068863_100001919 | Ga0068863_10000191919 | 129 |
| 456 | 3300005841 | Ga0068863_101861975 | Ga0068863_1018619752 | 129 |
| 457 | 3300005842 | Ga0068858_100000307 | Ga0068858_10000030749 | 129 |
| 458 | 3300005842 | Ga0068858_100083063 | Ga0068858_1000830634 | 129 |
| 459 | 3300005842 | Ga0068858_100437323 | Ga0068858_1004373232 | 129 |
| 460 | 3300005842 | Ga0068858_101129463 | Ga0068858_1011294632 | 129 |
| 461 | 3300005843 | Ga0068860_100001587 | Ga0068860_10000158720 | 129 |
| 462 | 3300005843 | Ga0068860_100035732 | Ga0068860_1000357325 | 129 |
| 463 | 3300005843 | Ga0068860_100115847 | Ga0068860_1001158473 | 129 |
| 464 | 3300005843 | Ga0068860_100167288 | Ga0068860_1001672883 | 129 |
| 465 | 3300005843 | Ga0068860_100418637 | Ga0068860_1004186372 | 129 |
| 466 | 3300005843 | Ga0068860_100459616 | Ga0068860_1004596162 | 129 |
| 467 | 3300005844 | Ga0068862_100001373 | Ga0068862_1000013732 | 129 |
| 468 | 3300005937 | Ga0081455_10000036 | Ga0081455_1000003628 | 129 |
| 469 | 3300005937 | Ga0081455_10030438 | Ga0081455_100304383 | 129 |
| 470 | 3300005937 | Ga0081455_10369011 | Ga0081455_103690112 | 129 |
| 471 | 3300005937 | Ga0081455_10739402 | Ga0081455_107394022 | 129 |
| 472 | 3300005983 | Ga0081540_1013693 | Ga0081540_10136932 | 129 |
| 473 | 3300006028 | Ga0070717_10433692 | Ga0070717_104336922 | 129 |
| 474 | 3300006058 | Ga0075432_10001113 | Ga0075432_1000111310 | 129 |
| 475 | 3300006058 | Ga0075432_10036353 | Ga0075432_100363532 | 129 |
| 476 | 3300006058 | Ga0075432_10229341 | Ga0075432_102293412 | 129 |
| 477 | 3300006173 | Ga0070716_100018437 | Ga0070716_1000184373 | 129 |
| 478 | 3300006175 | Ga0070712_100131019 | Ga0070712_1001310192 | 129 |
| 479 | 3300006175 | Ga0070712_100829224 | Ga0070712_1008292242 | 129 |
| 480 | 3300006178 | Ga0075367_10019195 | Ga0075367_100191952 | 129 |
| 481 | 3300006194 | Ga0075427_10001574 | Ga0075427_100015742 | 129 |
| 482 | 3300006237 | Ga0097621_100002565 | Ga0097621_1000025655 | 129 |
| 483 | 3300006237 | Ga0097621_100071435 | Ga0097621_1000714353 | 129 |
| 484 | 3300006237 | Ga0097621_100811208 | Ga0097621_1008112081 | 129 |
| 485 | 3300006237 | Ga0097621_101263713 | Ga0097621_1012637132 | 129 |
| 486 | 3300006353 | Ga0075370_10346860 | Ga0075370_103468602 | 129 |
| 487 | 3300006358 | Ga0068871_100000654 | Ga0068871_1000006543 | 129 |
| 488 | 3300006358 | Ga0068871_100141291 | Ga0068871_1001412912 | 129 |
| 489 | 3300006844 | Ga0075428_100075267 | Ga0075428_1000752672 | 129 |
| 490 | 3300006846 | Ga0075430_100001350 | Ga0075430_10000135019 | 129 |
| 491 | 3300006847 | Ga0075431_100001300 | Ga0075431_10000130020 | 129 |
| 492 | 3300006852 | Ga0075433_10000773 | Ga0075433_1000077312 | 129 |
| 493 | 3300006852 | Ga0075433_10071240 | Ga0075433_100712403 | 129 |
| 494 | 3300006852 | Ga0075433_10239016 | Ga0075433_102390162 | 129 |
| 495 | 3300006871 | Ga0075434_100001539 | Ga0075434_10000153915 | 129 |
| 496 | 3300006871 | Ga0075434_100010228 | Ga0075434_1000102287 | 129 |
| 497 | 3300006871 | Ga0075434_100079695 | Ga0075434_1000796953 | 129 |
| 498 | 3300006871 | Ga0075434_100114246 | Ga0075434_1001142463 | 129 |
| 499 | 3300006871 | Ga0075434_100370080 | Ga0075434_1003700802 | 129 |
| 500 | 3300006871 | Ga0075434_100880397 | Ga0075434_1008803972 | 129 |
| 501 | 3300006880 | Ga0075429_100002588 | Ga0075429_1000025884 | 129 |
| 502 | 3300006880 | Ga0075429_100828443 | Ga0075429_1008284432 | 129 |
| 503 | 3300006881 | Ga0068865_100001596 | Ga0068865_10000159613 | 129 |
| 504 | 3300006881 | Ga0068865_100068331 | Ga0068865_1000683313 | 129 |
| 505 | 3300006881 | Ga0068865_100113507 | Ga0068865_1001135072 | 129 |
| 506 | 3300006914 | Ga0075436_100016509 | Ga0075436_1000165092 | 129 |
| 507 | 3300006914 | Ga0075436_100209846 | Ga0075436_1002098462 | 129 |
| 508 | 3300006914 | Ga0075436_100246702 | Ga0075436_1002467022 | 129 |
| 509 | 3300006914 | Ga0075436_100296034 | Ga0075436_1002960342 | 129 |
| 510 | 3300006914 | Ga0075436_100377500 | Ga0075436_1003775002 | 129 |
| 511 | 3300006931 | Ga0097620_100001291 | Ga0097620_10000129126 | 129 |
| 512 | 3300006931 | Ga0097620_100019143 | Ga0097620_1000191436 | 129 |
| 513 | 3300006931 | Ga0097620_101157029 | Ga0097620_1011570292 | 129 |
| 514 | 3300007076 | Ga0075435_100080026 | Ga0075435_1000800263 | 129 |
| 515 | 3300007076 | Ga0075435_100109691 | Ga0075435_1001096913 | 129 |
| 516 | 3300007076 | Ga0075435_100158348 | Ga0075435_1001583483 | 129 |
| 517 | 3300007076 | Ga0075435_100305516 | Ga0075435_1003055161 | 129 |
| 518 | 3300009011 | Ga0105251_10017546 | Ga0105251_100175464 | 129 |
| 519 | 3300009036 | Ga0105244_10028774 | Ga0105244_100287743 | 129 |
| 520 | 3300009092 | Ga0105250_10077138 | Ga0105250_100771382 | 129 |
| 521 | 3300009093 | Ga0105240_10214588 | Ga0105240_102145883 | 129 |
| 522 | 3300009093 | Ga0105240_11182161 | Ga0105240_111821611 | 129 |
| 523 | 3300009094 | Ga0111539_10000591 | Ga0111539_1000059135 | 129 |
| 524 | 3300009094 | Ga0111539_10001213 | Ga0111539_1000121314 | 129 |
| 525 | 3300009094 | Ga0111539_10002431 | Ga0111539_100024314 | 129 |
| 526 | 3300009094 | Ga0111539_10550666 | Ga0111539_105506662 | 129 |
| 527 | 3300009098 | Ga0105245_10001033 | Ga0105245_1000103319 | 129 |
| 528 | 3300009098 | Ga0105245_10088321 | Ga0105245_100883212 | 129 |
| 529 | 3300009098 | Ga0105245_10952132 | Ga0105245_109521322 | 129 |
| 530 | 3300009101 | Ga0105247_10028489 | Ga0105247_100284893 | 129 |
| 531 | 3300009101 | Ga0105247_10058878 | Ga0105247_100588782 | 129 |
| 532 | 3300009101 | Ga0105247_10158304 | Ga0105247_101583043 | 129 |
| 533 | 3300009101 | Ga0105247_10273385 | Ga0105247_102733852 | 129 |
| 534 | 3300009101 | Ga0105247_10453105 | Ga0105247_104531052 | 129 |
| 535 | 3300009147 | Ga0114129_10002229 | Ga0114129_100022295 | 129 |
| 536 | 3300009147 | Ga0114129_10012044 | Ga0114129_100120444 | 129 |
| 537 | 3300009147 | Ga0114129_11098779 | Ga0114129_110987792 | 129 |
| 538 | 3300009148 | Ga0105243_10000678 | Ga0105243_1000067823 | 129 |
| 539 | 3300009148 | Ga0105243_10027310 | Ga0105243_100273105 | 129 |
| 540 | 3300009148 | Ga0105243_10462052 | Ga0105243_104620522 | 129 |
| 541 | 3300009174 | Ga0105241_10025430 | Ga0105241_100254303 | 129 |
| 542 | 3300009174 | Ga0105241_10028187 | Ga0105241_100281875 | 129 |
| 543 | 3300009174 | Ga0105241_11545427 | Ga0105241_115454272 | 129 |
| 544 | 3300009176 | Ga0105242_10002866 | Ga0105242_1000286614 | 129 |
| 545 | 3300009176 | Ga0105242_10015968 | Ga0105242_100159682 | 129 |
| 546 | 3300009176 | Ga0105242_10391248 | Ga0105242_103912482 | 129 |
| 547 | 3300009177 | Ga0105248_10000399 | Ga0105248_1000039951 | 129 |
| 548 | 3300009177 | Ga0105248_10017966 | Ga0105248_100179663 | 129 |
| 549 | 3300009177 | Ga0105248_10087692 | Ga0105248_100876924 | 129 |
| 550 | 3300009177 | Ga0105248_10313139 | Ga0105248_103131392 | 129 |
| 551 | 3300009177 | Ga0105248_10382112 | Ga0105248_103821122 | 129 |
| 552 | 3300009545 | Ga0105237_10015879 | Ga0105237_100158795 | 129 |
| 553 | 3300009545 | Ga0105237_10196224 | Ga0105237_101962243 | 129 |
| 554 | 3300009545 | Ga0105237_10780527 | Ga0105237_107805272 | 129 |
| 555 | 3300009551 | Ga0105238_10045890 | Ga0105238_100458903 | 129 |
| 556 | 3300009551 | Ga0105238_10154050 | Ga0105238_101540502 | 129 |
| 557 | 3300009553 | Ga0105249_10000540 | Ga0105249_1000054014 | 129 |
| 558 | 3300009553 | Ga0105249_10003822 | Ga0105249_1000382214 | 129 |
| 559 | 3300009553 | Ga0105249_10344665 | Ga0105249_103446652 | 129 |
| 560 | 3300010375 | Ga0105239_10018383 | Ga0105239_100183833 | 129 |
| 561 | 3300010375 | Ga0105239_10357961 | Ga0105239_103579612 | 129 |
| 562 | 3300010375 | Ga0105239_10818301 | Ga0105239_108183012 | 129 |
| 563 | 3300011119 | Ga0105246_10000212 | Ga0105246_1000021228 | 129 |
| 564 | 3300011119 | Ga0105246_10132920 | Ga0105246_101329202 | 129 |
| 565 | 3300011119 | Ga0105246_10287379 | Ga0105246_102873792 | 129 |
| 566 | 3300012508 | Ga0157315_1000632 | Ga0157315_10006321 | 129 |
| 567 | 3300012510 | Ga0157316_1010643 | Ga0157316_10106432 | 129 |
| 568 | 3300013100 | Ga0157373_10005412 | Ga0157373_1000541211 | 129 |
| 569 | 3300013100 | Ga0157373_10494482 | Ga0157373_104944822 | 129 |
| 570 | 3300013102 | Ga0157371_10037376 | Ga0157371_100373762 | 129 |
| 571 | 3300013102 | Ga0157371_10429048 | Ga0157371_104290482 | 129 |
| 572 | 3300013105 | Ga0157369_10574372 | Ga0157369_105743722 | 129 |
| 573 | 3300013105 | Ga0157369_11270972 | Ga0157369_112709722 | 129 |
| 574 | 3300013296 | Ga0157374_10001186 | Ga0157374_1000118625 | 129 |
| 575 | 3300013296 | Ga0157374_10016564 | Ga0157374_100165645 | 129 |
| 576 | 3300013296 | Ga0157374_10629689 | Ga0157374_106296892 | 129 |
| 577 | 3300013297 | Ga0157378_10013662 | Ga0157378_100136625 | 129 |
| 578 | 3300013297 | Ga0157378_10086710 | Ga0157378_100867103 | 129 |
| 579 | 3300013297 | Ga0157378_10188949 | Ga0157378_101889492 | 129 |
| 580 | 3300013306 | Ga0163162_10000762 | Ga0163162_100007627 | 129 |
| 581 | 3300013306 | Ga0163162_10242845 | Ga0163162_102428452 | 129 |
| 582 | 3300013306 | Ga0163162_10618693 | Ga0163162_106186932 | 129 |
| 583 | 3300013306 | Ga0163162_10800021 | Ga0163162_108000212 | 129 |
| 584 | 3300013307 | Ga0157372_10006437 | Ga0157372_1000643715 | 129 |
| 585 | 3300013307 | Ga0157372_10910997 | Ga0157372_109109972 | 129 |
| 586 | 3300013307 | Ga0157372_10990306 | Ga0157372_109903062 | 129 |
| 587 | 3300013308 | Ga0157375_10000177 | Ga0157375_1000017761 | 129 |
| 588 | 3300013308 | Ga0157375_10391459 | Ga0157375_103914592 | 129 |
| 589 | 3300013308 | Ga0157375_10483849 | Ga0157375_104838492 | 129 |
| 590 | 3300014325 | Ga0163163_10001917 | Ga0163163_100019173 | 129 |
| 591 | 3300014325 | Ga0163163_10004152 | Ga0163163_1000415217 | 129 |
| 592 | 3300014325 | Ga0163163_10235321 | Ga0163163_102353213 | 129 |
| 593 | 3300014325 | Ga0163163_10313858 | Ga0163163_103138582 | 129 |
| 594 | 3300014325 | Ga0163163_10328068 | Ga0163163_103280682 | 129 |
| 595 | 3300014326 | Ga0157380_10003066 | Ga0157380_1000306610 | 129 |
| 596 | 3300014745 | Ga0157377_10000178 | Ga0157377_100001783 | 129 |
| 597 | 3300014968 | Ga0157379_10000135 | Ga0157379_1000013548 | 129 |
| 598 | 3300014968 | Ga0157379_10030636 | Ga0157379_100306366 | 129 |
| 599 | 3300014968 | Ga0157379_10087467 | Ga0157379_100874672 | 129 |
| 600 | 3300014968 | Ga0157379_10104256 | Ga0157379_101042563 | 129 |
| 601 | 3300014968 | Ga0157379_10161685 | Ga0157379_101616852 | 129 |
| 602 | 3300014969 | Ga0157376_10001353 | Ga0157376_100013533 | 129 |
| 603 | 3300014969 | Ga0157376_10173614 | Ga0157376_101736143 | 129 |
| 604 | 3300014969 | Ga0157376_10233540 | Ga0157376_102335402 | 129 |
| 605 | 3300017792 | Ga0163161_10000867 | Ga0163161_100008674 | 129 |
| 606 | 3300025261 | Ga0209233_1011403 | Ga0209233_10114033 | 129 |
| 607 | 3300025271 | Ga0207666_1000021 | Ga0207666_100002130 | 129 |
| 608 | 3300025271 | Ga0207666_1000444 | Ga0207666_10004444 | 129 |
| 609 | 3300025290 | Ga0207673_1000845 | Ga0207673_10008453 | 129 |
| 610 | 3300025315 | Ga0207697_10001014 | Ga0207697_100010148 | 129 |
| 611 | 3300025315 | Ga0207697_10006655 | Ga0207697_100066556 | 129 |
| 612 | 3300025321 | Ga0207656_10645211 | Ga0207656_106452112 | 129 |
| 613 | 3300025885 | Ga0207653_10005540 | Ga0207653_100055403 | 129 |
| 614 | 3300025893 | Ga0207682_10000426 | Ga0207682_1000042618 | 129 |
| 615 | 3300025898 | Ga0207692_10054182 | Ga0207692_100541823 | 129 |
| 616 | 3300025898 | Ga0207692_10113421 | Ga0207692_101134212 | 129 |
| 617 | 3300025898 | Ga0207692_10124951 | Ga0207692_101249511 | 129 |
| 618 | 3300025898 | Ga0207692_10379321 | Ga0207692_103793212 | 129 |
| 619 | 3300025899 | Ga0207642_10001961 | Ga0207642_100019613 | 129 |
| 620 | 3300025900 | Ga0207710_10015779 | Ga0207710_100157793 | 129 |
| 621 | 3300025901 | Ga0207688_10000017 | Ga0207688_1000001714 | 129 |
| 622 | 3300025901 | Ga0207688_10555207 | Ga0207688_105552072 | 129 |
| 623 | 3300025901 | Ga0207688_10878994 | Ga0207688_108789942 | 129 |
| 624 | 3300025903 | Ga0207680_10015394 | Ga0207680_100153943 | 129 |
| 625 | 3300025903 | Ga0207680_10030371 | Ga0207680_100303712 | 129 |
| 626 | 3300025904 | Ga0207647_10005524 | Ga0207647_100055246 | 129 |
| 627 | 3300025905 | Ga0207685_10021875 | Ga0207685_100218752 | 129 |
| 628 | 3300025906 | Ga0207699_10115621 | Ga0207699_101156212 | 129 |
| 629 | 3300025906 | Ga0207699_10201279 | Ga0207699_102012792 | 129 |
| 630 | 3300025906 | Ga0207699_10259235 | Ga0207699_102592352 | 129 |
| 631 | 3300025907 | Ga0207645_10000074 | Ga0207645_1000007418 | 129 |
| 632 | 3300025907 | Ga0207645_10385640 | Ga0207645_103856402 | 129 |
| 633 | 3300025908 | Ga0207643_10000058 | Ga0207643_1000005827 | 129 |
| 634 | 3300025908 | Ga0207643_11064081 | Ga0207643_110640811 | 129 |
| 635 | 3300025911 | Ga0207654_10020901 | Ga0207654_100209011 | 129 |
| 636 | 3300025911 | Ga0207654_10073983 | Ga0207654_100739833 | 129 |
| 637 | 3300025911 | Ga0207654_10122366 | Ga0207654_101223662 | 129 |
| 638 | 3300025912 | Ga0207707_10007073 | Ga0207707_100070735 | 129 |
| 639 | 3300025912 | Ga0207707_10139708 | Ga0207707_101397083 | 129 |
| 640 | 3300025912 | Ga0207707_10161129 | Ga0207707_101611292 | 129 |
| 641 | 3300025913 | Ga0207695_10057979 | Ga0207695_100579792 | 129 |
| 642 | 3300025914 | Ga0207671_10544356 | Ga0207671_105443562 | 129 |
| 643 | 3300025915 | Ga0207693_10013942 | Ga0207693_100139427 | 129 |
| 644 | 3300025915 | Ga0207693_10079128 | Ga0207693_100791282 | 129 |
| 645 | 3300025915 | Ga0207693_10084244 | Ga0207693_100842443 | 129 |
| 646 | 3300025915 | Ga0207693_10213470 | Ga0207693_102134702 | 129 |
| 647 | 3300025916 | Ga0207663_10091487 | Ga0207663_100914872 | 129 |
| 648 | 3300025916 | Ga0207663_10274104 | Ga0207663_102741042 | 129 |
| 649 | 3300025916 | Ga0207663_10668812 | Ga0207663_106688122 | 129 |
| 650 | 3300025917 | Ga0207660_10000578 | Ga0207660_1000057816 | 129 |
| 651 | 3300025917 | Ga0207660_10159000 | Ga0207660_101590003 | 129 |
| 652 | 3300025917 | Ga0207660_10258975 | Ga0207660_102589753 | 129 |
| 653 | 3300025917 | Ga0207660_10923668 | Ga0207660_109236682 | 129 |
| 654 | 3300025918 | Ga0207662_10000069 | Ga0207662_1000006912 | 129 |
| 655 | 3300025918 | Ga0207662_10005716 | Ga0207662_100057166 | 129 |
| 656 | 3300025918 | Ga0207662_10577514 | Ga0207662_105775142 | 129 |
| 657 | 3300025919 | Ga0207657_10000721 | Ga0207657_1000072128 | 129 |
| 658 | 3300025919 | Ga0207657_10086818 | Ga0207657_100868183 | 129 |
| 659 | 3300025919 | Ga0207657_10145048 | Ga0207657_101450482 | 129 |
| 660 | 3300025920 | Ga0207649_10000282 | Ga0207649_1000028232 | 129 |
| 661 | 3300025920 | Ga0207649_11374825 | Ga0207649_113748251 | 129 |
| 662 | 3300025921 | Ga0207652_10009825 | Ga0207652_100098257 | 129 |
| 663 | 3300025921 | Ga0207652_10011123 | Ga0207652_100111235 | 129 |
| 664 | 3300025921 | Ga0207652_10101582 | Ga0207652_101015823 | 129 |
| 665 | 3300025921 | Ga0207652_10265213 | Ga0207652_102652133 | 129 |
| 666 | 3300025923 | Ga0207681_10000806 | Ga0207681_100008063 | 129 |
| 667 | 3300025923 | Ga0207681_10120433 | Ga0207681_101204332 | 129 |
| 668 | 3300025924 | Ga0207694_10020964 | Ga0207694_100209643 | 129 |
| 669 | 3300025925 | Ga0207650_10004953 | Ga0207650_100049534 | 129 |
| 670 | 3300025925 | Ga0207650_10050620 | Ga0207650_100506203 | 129 |
| 671 | 3300025926 | Ga0207659_10000039 | Ga0207659_1000003968 | 129 |
| 672 | 3300025926 | Ga0207659_11260047 | Ga0207659_112600472 | 129 |
| 673 | 3300025927 | Ga0207687_10008561 | Ga0207687_100085613 | 129 |
| 674 | 3300025927 | Ga0207687_10018052 | Ga0207687_100180523 | 129 |
| 675 | 3300025928 | Ga0207700_10002144 | Ga0207700_100021443 | 129 |
| 676 | 3300025928 | Ga0207700_10114255 | Ga0207700_101142553 | 129 |
| 677 | 3300025928 | Ga0207700_10501396 | Ga0207700_105013962 | 129 |
| 678 | 3300025928 | Ga0207700_11163582 | Ga0207700_111635821 | 129 |
| 679 | 3300025929 | Ga0207664_10383031 | Ga0207664_103830312 | 129 |
| 680 | 3300025931 | Ga0207644_10006357 | Ga0207644_100063572 | 129 |
| 681 | 3300025931 | Ga0207644_10034963 | Ga0207644_100349634 | 129 |
| 682 | 3300025931 | Ga0207644_10034966 | Ga0207644_100349664 | 129 |
| 683 | 3300025931 | Ga0207644_10049974 | Ga0207644_100499742 | 129 |
| 684 | 3300025932 | Ga0207690_10000303 | Ga0207690_1000030312 | 129 |
| 685 | 3300025932 | Ga0207690_10434516 | Ga0207690_104345162 | 129 |
| 686 | 3300025932 | Ga0207690_11362253 | Ga0207690_113622531 | 129 |
| 687 | 3300025933 | Ga0207706_10002511 | Ga0207706_1000251111 | 129 |
| 688 | 3300025933 | Ga0207706_10036762 | Ga0207706_100367624 | 129 |
| 689 | 3300025933 | Ga0207706_10115647 | Ga0207706_101156473 | 129 |
| 690 | 3300025934 | Ga0207686_10000540 | Ga0207686_1000054023 | 129 |
| 691 | 3300025935 | Ga0207709_10000970 | Ga0207709_1000097021 | 129 |
| 692 | 3300025935 | Ga0207709_10098509 | Ga0207709_100985093 | 129 |
| 693 | 3300025935 | Ga0207709_10418480 | Ga0207709_104184802 | 129 |
| 694 | 3300025936 | Ga0207670_10000200 | Ga0207670_1000020016 | 129 |
| 695 | 3300025937 | Ga0207669_10000098 | Ga0207669_1000009821 | 129 |
| 696 | 3300025937 | Ga0207669_10017634 | Ga0207669_100176342 | 129 |
| 697 | 3300025937 | Ga0207669_10178040 | Ga0207669_101780402 | 129 |
| 698 | 3300025937 | Ga0207669_10222883 | Ga0207669_102228833 | 129 |
| 699 | 3300025938 | Ga0207704_10004239 | Ga0207704_100042393 | 129 |
| 700 | 3300025938 | Ga0207704_10053256 | Ga0207704_100532562 | 129 |
| 701 | 3300025938 | Ga0207704_10088865 | Ga0207704_100888653 | 129 |
| 702 | 3300025939 | Ga0207665_10000905 | Ga0207665_100009051 | 129 |
| 703 | 3300025939 | Ga0207665_10140093 | Ga0207665_101400932 | 129 |
| 704 | 3300025940 | Ga0207691_10000169 | Ga0207691_1000016912 | 129 |
| 705 | 3300025941 | Ga0207711_10003735 | Ga0207711_1000373512 | 129 |
| 706 | 3300025941 | Ga0207711_10050482 | Ga0207711_100504823 | 129 |
| 707 | 3300025941 | Ga0207711_10055122 | Ga0207711_100551224 | 129 |
| 708 | 3300025941 | Ga0207711_10613047 | Ga0207711_106130472 | 129 |
| 709 | 3300025942 | Ga0207689_10000363 | Ga0207689_1000036348 | 129 |
| 710 | 3300025942 | Ga0207689_11044547 | Ga0207689_110445472 | 129 |
| 711 | 3300025944 | Ga0207661_10000700 | Ga0207661_100007007 | 129 |
| 712 | 3300025944 | Ga0207661_10097304 | Ga0207661_100973043 | 129 |
| 713 | 3300025945 | Ga0207679_10000030 | Ga0207679_1000003042 | 129 |
| 714 | 3300025945 | Ga0207679_10136920 | Ga0207679_101369203 | 129 |
| 715 | 3300025945 | Ga0207679_10390036 | Ga0207679_103900361 | 129 |
| 716 | 3300025945 | Ga0207679_10530522 | Ga0207679_105305222 | 129 |
| 717 | 3300025945 | Ga0207679_11020508 | Ga0207679_110205082 | 129 |
| 718 | 3300025949 | Ga0207667_10011075 | Ga0207667_100110759 | 129 |
| 719 | 3300025949 | Ga0207667_10043831 | Ga0207667_100438312 | 129 |
| 720 | 3300025949 | Ga0207667_10073699 | Ga0207667_100736993 | 129 |
| 721 | 3300025960 | Ga0207651_10000593 | Ga0207651_1000059316 | 129 |
| 722 | 3300025960 | Ga0207651_10222784 | Ga0207651_102227841 | 129 |
| 723 | 3300025960 | Ga0207651_10608887 | Ga0207651_106088872 | 129 |
| 724 | 3300025961 | Ga0207712_10000473 | Ga0207712_1000047327 | 129 |
| 725 | 3300025961 | Ga0207712_10044542 | Ga0207712_100445422 | 129 |
| 726 | 3300025961 | Ga0207712_10117637 | Ga0207712_101176373 | 129 |
| 727 | 3300025972 | Ga0207668_10000220 | Ga0207668_1000022022 | 129 |
| 728 | 3300025981 | Ga0207640_10000379 | Ga0207640_100003798 | 129 |
| 729 | 3300025986 | Ga0207658_10001133 | Ga0207658_1000113319 | 129 |
| 730 | 3300025986 | Ga0207658_11807562 | Ga0207658_118075621 | 129 |
| 731 | 3300026023 | Ga0207677_10000513 | Ga0207677_1000051313 | 129 |
| 732 | 3300026023 | Ga0207677_10320898 | Ga0207677_103208982 | 129 |
| 733 | 3300026035 | Ga0207703_10001263 | Ga0207703_1000126326 | 129 |
| 734 | 3300026035 | Ga0207703_10020402 | Ga0207703_100204025 | 129 |
| 735 | 3300026035 | Ga0207703_10175358 | Ga0207703_101753583 | 129 |
| 736 | 3300026035 | Ga0207703_10205576 | Ga0207703_102055763 | 129 |
| 737 | 3300026035 | Ga0207703_10265310 | Ga0207703_102653102 | 129 |
| 738 | 3300026035 | Ga0207703_10421520 | Ga0207703_104215202 | 129 |
| 739 | 3300026041 | Ga0207639_10015014 | Ga0207639_100150147 | 129 |
| 740 | 3300026041 | Ga0207639_10369678 | Ga0207639_103696781 | 129 |
| 741 | 3300026041 | Ga0207639_10959702 | Ga0207639_109597022 | 129 |
| 742 | 3300026067 | Ga0207678_10003592 | Ga0207678_100035925 | 129 |
| 743 | 3300026067 | Ga0207678_10075348 | Ga0207678_100753483 | 129 |
| 744 | 3300026067 | Ga0207678_10096163 | Ga0207678_100961632 | 129 |
| 745 | 3300026067 | Ga0207678_10197474 | Ga0207678_101974742 | 129 |
| 746 | 3300026067 | Ga0207678_10280170 | Ga0207678_102801702 | 129 |
| 747 | 3300026067 | Ga0207678_11369783 | Ga0207678_113697832 | 129 |
| 748 | 3300026075 | Ga0207708_10000428 | Ga0207708_1000042814 | 129 |
| 749 | 3300026075 | Ga0207708_10003371 | Ga0207708_1000337111 | 129 |
| 750 | 3300026075 | Ga0207708_10035252 | Ga0207708_100352523 | 129 |
| 751 | 3300026075 | Ga0207708_10973385 | Ga0207708_109733852 | 129 |
| 752 | 3300026078 | Ga0207702_10004376 | Ga0207702_100043767 | 129 |
| 753 | 3300026078 | Ga0207702_11670249 | Ga0207702_116702492 | 129 |
| 754 | 3300026088 | Ga0207641_10001143 | Ga0207641_1000114325 | 129 |
| 755 | 3300026088 | Ga0207641_10087284 | Ga0207641_100872842 | 129 |
| 756 | 3300026089 | Ga0207648_10000272 | Ga0207648_100002726 | 129 |
| 757 | 3300026089 | Ga0207648_10095794 | Ga0207648_100957943 | 129 |
| 758 | 3300026089 | Ga0207648_10386872 | Ga0207648_103868722 | 129 |
| 759 | 3300026095 | Ga0207676_10009286 | Ga0207676_100092864 | 129 |
| 760 | 3300026095 | Ga0207676_10349154 | Ga0207676_103491542 | 129 |
| 761 | 3300026095 | Ga0207676_10369255 | Ga0207676_103692552 | 129 |
| 762 | 3300026116 | Ga0207674_10000135 | Ga0207674_1000013560 | 129 |
| 763 | 3300026118 | Ga0207675_100000245 | Ga0207675_10000024548 | 129 |
| 764 | 3300026121 | Ga0207683_10000136 | Ga0207683_1000013657 | 129 |
| 765 | 3300026121 | Ga0207683_10372807 | Ga0207683_103728072 | 129 |
| 766 | 3300026142 | Ga0207698_10000828 | Ga0207698_1000082817 | 129 |
| 767 | 3300026142 | Ga0207698_10409684 | Ga0207698_104096842 | 129 |
| 768 | 3300027252 | Ga0209973_1006195 | Ga0209973_10061952 | 129 |
| 769 | 3300027360 | Ga0209969_1061002 | Ga0209969_10610021 | 129 |
| 770 | 3300027395 | Ga0209996_1007399 | Ga0209996_10073992 | 129 |
| 771 | 3300027526 | Ga0209968_1043865 | Ga0209968_10438652 | 129 |
| 772 | 3300027543 | Ga0209999_1015941 | Ga0209999_10159412 | 129 |
| 773 | 3300027614 | Ga0209970_1006005 | Ga0209970_10060052 | 129 |
| 774 | 3300027617 | Ga0210002_1004082 | Ga0210002_10040822 | 129 |
| 775 | 3300027665 | Ga0209983_1013802 | Ga0209983_10138023 | 129 |
| 776 | 3300027682 | Ga0209971_1026726 | Ga0209971_10267262 | 129 |
| 777 | 3300027695 | Ga0209966_1006735 | Ga0209966_10067353 | 129 |
| 778 | 3300027695 | Ga0209966_1017712 | Ga0209966_10177122 | 129 |
| 779 | 3300027717 | Ga0209998_10006808 | Ga0209998_100068083 | 129 |
| 780 | 3300027876 | Ga0209974_10015919 | Ga0209974_100159193 | 129 |
| 781 | 3300027907 | Ga0207428_10000249 | Ga0207428_1000024945 | 129 |
| 782 | 3300027907 | Ga0207428_10000471 | Ga0207428_1000047124 | 129 |
| 783 | 3300027907 | Ga0207428_10002287 | Ga0207428_100022876 | 129 |
| 784 | 3300027907 | Ga0207428_10644545 | Ga0207428_106445452 | 129 |
| 785 | 3300028379 | Ga0268266_10738673 | Ga0268266_107386732 | 129 |
| 786 | 3300028380 | Ga0268265_10001888 | Ga0268265_1000188813 | 129 |
| 787 | 3300028381 | Ga0268264_10000693 | Ga0268264_1000069324 | 129 |
| 788 | 3300028381 | Ga0268264_10161724 | Ga0268264_101617242 | 129 |
| 789 | 3300028381 | Ga0268264_10681003 | Ga0268264_106810032 | 129 |
| 790 | 3300028381 | Ga0268264_11421126 | Ga0268264_114211262 | 129 |
| 791 | 3300028556 | Ga0265337_1156957 | Ga0265337_11569572 | 129 |
| 792 | 3300028800 | Ga0265338_10500418 | Ga0265338_105004181 | 129 |
| 793 | 3300031235 | Ga0265330_10034754 | Ga0265330_100347542 | 129 |
| 794 | 3300031238 | Ga0265332_10044370 | Ga0265332_100443703 | 129 |
| 795 | 3300031238 | Ga0265332_10283369 | Ga0265332_102833692 | 129 |
| 796 | 3300031241 | Ga0265325_10000055 | Ga0265325_1000005527 | 129 |
| 797 | 3300031241 | Ga0265325_10044077 | Ga0265325_100440772 | 129 |
| 798 | 3300031249 | Ga0265339_10008094 | Ga0265339_100080945 | 129 |
| 799 | 3300031249 | Ga0265339_10475157 | Ga0265339_104751571 | 129 |
| 800 | 3300031595 | Ga0265313_10008657 | Ga0265313_100086576 | 129 |
| 801 | 3300031595 | Ga0265313_10022395 | Ga0265313_100223953 | 129 |
| 802 | 3300031665 | Ga0316575_10112747 | Ga0316575_101127472 | 129 |
| 803 | 3300031712 | Ga0265342_10000760 | Ga0265342_1000076018 | 129 |
| 804 | 3300031712 | Ga0265342_10011993 | Ga0265342_100119931 | 129 |
| 805 | 3300032133 | Ga0316583_10001350 | Ga0316583_100013505 | 129 |
| 806 | 3300034816 | Ga0373930_0000940 | Ga0373930_0000940_1890_2279 | 129 |
| 807 | 3300034816 | Ga0373930_0004040 | Ga0373930_0004040_1243_1632 | 129 |
| 808 | 3300034816 | Ga0373930_0060393 | Ga0373930_0060393_48_437 | 129 |
| 809 | 3300034817 | Ga0373948_0000536 | Ga0373948_0000536_3688_4077 | 129 |
| 810 | 3300034817 | Ga0373948_0134631 | Ga0373948_0134631_17_406 | 129 |
| 811 | 3300034818 | Ga0373950_0001447 | Ga0373950_0001447_288_677 | 129 |
| 812 | 3300034819 | Ga0373958_0000870 | Ga0373958_0000870_2331_2720 | 129 |
| 813 | 3300034819 | Ga0373958_0002779 | Ga0373958_0002779_1426_1815 | 129 |
| 814 | 3300034820 | Ga0373959_0001430 | Ga0373959_0001430_883_1272 | 129 |
| 815 | 3300034820 | Ga0373959_0016991 | Ga0373959_0016991_47_436 | 129 |
| 816 | 3300034957 | Ga0373938_0000293 | Ga0373938_0000293_895_1284 | 129 |
| 817 | 3300034957 | Ga0373938_0061213 | Ga0373938_0061213_248_637 | 129 |
| 818 | 3300035083 | Ga0373926_0077596 | Ga0373926_0077596_309_698 | 129 |
| 819 | 3300035084 | Ga0373928_0037557 | Ga0373928_0037557_200_589 | 129 |
| 820 | 3300035085 | Ga0373929_0001712 | Ga0373929_0001712_866_1255 | 129 |
| 821 | 3300035085 | Ga0373929_0001899 | Ga0373929_0001899_2489_2878 | 129 |
| 822 | 3300035086 | Ga0373934_0025591 | Ga0373934_0025591_1599_1988 | 129 |
| 823 | 3300035088 | Ga0373940_0008719 | Ga0373940_0008719_1080_1469 | 129 |
| 824 | 3300035088 | Ga0373940_0029033 | Ga0373940_0029033_791_1180 | 129 |
| 825 | 3300035088 | Ga0373940_0079432 | Ga0373940_0079432_521_910 | 129 |
| 826 | 3300035089 | Ga0373944_0025385 | Ga0373944_0025385_1079_1468 | 129 |
| 827 | 3300035089 | Ga0373944_0045119 | Ga0373944_0045119_779_1168 | 129 |
| 828 | 3300035090 | Ga0373949_0000797 | Ga0373949_0000797_4060_4449 | 129 |
| 829 | 3300035090 | Ga0373949_0002468 | Ga0373949_0002468_3450_3839 | 129 |
| 830 | 3300035090 | Ga0373949_0068148 | Ga0373949_0068148_231_620 | 129 |
| 831 | 3300035091 | Ga0373951_0012685 | Ga0373951_0012685_993_1382 | 129 |
| 832 | 3300035092 | Ga0373952_0007256 | Ga0373952_0007256_832_1221 | 129 |
| 833 | 3300035092 | Ga0373952_0026490 | Ga0373952_0026490_487_876 | 129 |
| 834 | 3300035111 | Ga0373923_0011716 | Ga0373923_0011716_2294_2683 | 129 |
| 835 | 3300035111 | Ga0373923_0015860 | Ga0373923_0015860_1188_1577 | 129 |
| 836 | 3300035112 | Ga0373932_0001341 | Ga0373932_0001341_895_1284 | 129 |
| 837 | 3300035112 | Ga0373932_0001774 | Ga0373932_0001774_5304_5693 | 129 |
| 838 | 3300035112 | Ga0373932_0023817 | Ga0373932_0023817_601_990 | 129 |
| 839 | 3300035113 | Ga0373936_0005884 | Ga0373936_0005884_1882_2271 | 129 |
| 840 | 3300035113 | Ga0373936_0039644 | Ga0373936_0039644_383_772 | 129 |
| 841 | 3300035114 | Ga0373939_0005695 | Ga0373939_0005695_818_1207 | 129 |
| 842 | 3300035114 | Ga0373939_0008647 | Ga0373939_0008647_976_1365 | 129 |
| 843 | 3300035115 | Ga0373941_0000410 | Ga0373941_0000410_1134_1523 | 129 |
| 844 | 3300035115 | Ga0373941_0133631 | Ga0373941_0133631_377_766 | 129 |
| 845 | 3300035116 | Ga0373945_0017444 | Ga0373945_0017444_679_1068 | 129 |
| 846 | 3300035117 | Ga0373953_0057174 | Ga0373953_0057174_244_633 | 129 |
| 847 | 3300035117 | Ga0373953_0332158 | Ga0373953_0332158_265_654 | 129 |
| 848 | 3300035118 | Ga0373954_0012230 | Ga0373954_0012230_1294_1683 | 129 |
| 849 | 3300035118 | Ga0373954_0046542 | Ga0373954_0046542_472_861 | 129 |
| 850 | 3300035118 | Ga0373954_0151141 | Ga0373954_0151141_680_1069 | 129 |
| 851 | 3300035119 | Ga0373956_0178031 | Ga0373956_0178031_100_489 | 129 |
| 852 | 3300035119 | Ga0373956_0417073 | Ga0373956_0417073_64_453 | 129 |
| 853 | 3300035121 | Ga0373960_0001361 | Ga0373960_0001361_2431_2820 | 129 |
| 854 | 3300035170 | Ga0373943_0001756 | Ga0373943_0001756_4358_4747 | 129 |
| 855 | 3300035170 | Ga0373943_0018728 | Ga0373943_0018728_2647_3036 | 129 |
| 856 | 3300035170 | Ga0373943_0179633 | Ga0373943_0179633_548_937 | 129 |
| 857 | 3300035171 | Ga0373946_0068622 | Ga0373946_0068622_449_838 | 129 |
| 858 | 3300035171 | Ga0373946_0154967 | Ga0373946_0154967_278_667 | 129 |
| 859 | 3300035171 | Ga0373946_0270679 | Ga0373946_0270679_201_590 | 129 |
| 860 | 3300035172 | Ga0373955_0010447 | Ga0373955_0010447_281_670 | 129 |
| 861 | 3300035172 | Ga0373955_0016087 | Ga0373955_0016087_1779_2168 | 129 |
| 862 | 3300035172 | Ga0373955_0019549 | Ga0373955_0019549_485_874 | 129 |
| 863 | 3300035172 | Ga0373955_0334504 | Ga0373955_0334504_76_465 | 129 |
| 864 | 3300035207 | Ga0373942_0006328 | Ga0373942_0006328_265_654 | 129 |
| 865 | 3300035241 | Ga0373961_0004108 | Ga0373961_0004108_1894_2283 | 129 |
| 866 | 3300035241 | Ga0373961_0005274 | Ga0373961_0005274_16_405 | 129 |
| 867 | 3300035242 | Ga0373962_0003406 | Ga0373962_0003406_2801_3190 | 129 |
| 868 | 3300035242 | Ga0373962_0005753 | Ga0373962_0005753_1139_1528 | 129 |
| 869 | 3300035242 | Ga0373962_0027678 | Ga0373962_0027678_934_1323 | 129 |
| 870 | 3300035242 | Ga0373962_0296490 | Ga0373962_0296490_17_406 | 129 |
| 871 | 3300035410 | Ga0373924_0020653 | Ga0373924_0020653_2107_2496 | 129 |
| 872 | 3300035410 | Ga0373924_0234712 | Ga0373924_0234712_146_535 | 129 |
| 873 | 3300035410 | Ga0373924_0479461 | Ga0373924_0479461_128_517 | 129 |
| 874 | 3300035691 | Ga0373931_0000853 | Ga0373931_0000853_5037_5426 | 129 |
| 875 | 3300035691 | Ga0373931_0010380 | Ga0373931_0010380_3220_3609 | 129 |
| 876 | 3300035691 | Ga0373931_0066193 | Ga0373931_0066193_1100_1489 | 129 |
| 877 | 3300035691 | Ga0373931_0071581 | Ga0373931_0071581_530_919 | 129 |
| 878 | 3300035691 | Ga0373931_0171350 | Ga0373931_0171350_11_400 | 129 |
| 879 | 3300035692 | Ga0373935_0011348 | Ga0373935_0011348_2234_2623 | 129 |
| 880 | 3300035692 | Ga0373935_0021300 | Ga0373935_0021300_2406_2795 | 129 |
| 881 | 3300035692 | Ga0373935_0054419 | Ga0373935_0054419_217_606 | 129 |
| 882 | 3300035692 | Ga0373935_0166496 | Ga0373935_0166496_624_1013 | 129 |
| 883 | 3300035692 | Ga0373935_0302696 | Ga0373935_0302696_471_860 | 129 |
| 884 | 3300035695 | Ga0373927_0042609 | Ga0373927_0042609_1363_1752 | 129 |
| 885 | 3300035695 | Ga0373927_0048857 | Ga0373927_0048857_267_656 | 129 |
| 886 | 3300035724 | Ga0373933_0007033 | Ga0373933_0007033_4868_5257 | 129 |
| 887 | 3300035724 | Ga0373933_0027449 | Ga0373933_0027449_1647_2036 | 129 |
| 888 | 3300035724 | Ga0373933_0027713 | Ga0373933_0027713_999_1388 | 129 |
| 889 | 3300035725 | Ga0373947_0043464 | Ga0373947_0043464_2016_2405 | 129 |
| 890 | 3300035725 | Ga0373947_0241315 | Ga0373947_0241315_472_861 | 129 |
| 891 | 3300035725 | Ga0373947_0402488 | Ga0373947_0402488_278_667 | 129 |
| 892 | 3300036401 | Ga0373937_0010852 | Ga0373937_0010852_478_867 | 129 |
| 893 | 3300036401 | Ga0373937_0135019 | Ga0373937_0135019_952_1341 | 129 |
| 894 | 3300037068 | Ga0373925_0012204 | Ga0373925_0012204_5375_5764 | 129 |
| 895 | 3300037068 | Ga0373925_0049123 | Ga0373925_0049123_2466_2855 | 129 |
| 896 | 3300037068 | Ga0373925_0079963 | Ga0373925_0079963_1530_1919 | 129 |
| 897 | 3300037068 | Ga0373925_0498873 | Ga0373925_0498873_244_633 | 129 |
| 898 | 3300038698 | Ga0242419_018407 | Ga0242419_018407_142_531 | 129 |
| 899 | 3300038996 | Ga0242420_009830 | Ga0242420_009830_15_404 | 129 |
| 900 | 3300042008 | Ga0439450_012559 | Ga0439450_012559_1195_1584 | 129 |
| 901 | 3300042439 | Ga0439464_0005686 | Ga0439464_0005686_901_1290 | 129 |
| 902 | 3300042461 | Ga0439460_0026965 | Ga0439460_0026965_870_1259 | 129 |
| 903 | 3300042876 | Ga0451577_1970918 | Ga0451577_1970918_100_489 | 129 |
| 904 | 3300042993 | Ga0439440_0027245 | Ga0439440_0027245_703_1092 | 129 |
| 905 | 3300045051 | Ga0451576_0035228 | Ga0451576_0035228_2245_2634 | 129 |
| 906 | 3300045836 | Ga0466958_0467783 | Ga0466958_0467783_160_552 | 129 |
| 907 | 3300046452 | Ga0495617_016986 | Ga0495617_016986_585_974 | 129 |
| 908 | 3300046454 | Ga0495592_0007525 | Ga0495592_0007525_425_814 | 129 |
| 909 | 3300046454 | Ga0495592_0010371 | Ga0495592_0010371_105_494 | 129 |
| 910 | 3300046454 | Ga0495592_0119940 | Ga0495592_0119940_830_1219 | 129 |
| 911 | 3300046455 | Ga0495603_0007148 | Ga0495603_0007148_3820_4209 | 129 |
| 912 | 3300046455 | Ga0495603_0044070 | Ga0495603_0044070_1943_2332 | 129 |
| 913 | 3300046455 | Ga0495603_0077397 | Ga0495603_0077397_263_652 | 129 |
| 914 | 3300046457 | Ga0495590_0114198 | Ga0495590_0114198_88_477 | 129 |
| 915 | 3300046459 | Ga0495629_0001477 | Ga0495629_0001477_2505_2894 | 129 |
| 916 | 3300046459 | Ga0495629_0350234 | Ga0495629_0350234_147_536 | 129 |
| 917 | 3300046459 | Ga0495629_0377067 | Ga0495629_0377067_509_898 | 129 |
| 918 | 3300046460 | Ga0495638_0050928 | Ga0495638_0050928_218_607 | 129 |
| 919 | 3300046460 | Ga0495638_0654827 | Ga0495638_0654827_58_447 | 129 |
| 920 | 3300046461 | Ga0495641_0039881 | Ga0495641_0039881_1485_1874 | 129 |
| 921 | 3300046461 | Ga0495641_0167335 | Ga0495641_0167335_79_468 | 129 |
| 922 | 3300046462 | Ga0495651_0001224 | Ga0495651_0001224_15030_15419 | 129 |
| 923 | 3300046462 | Ga0495651_0005238 | Ga0495651_0005238_6571_6960 | 129 |
| 924 | 3300046462 | Ga0495651_0021305 | Ga0495651_0021305_2826_3215 | 129 |
| 925 | 3300046463 | Ga0495653_0022871 | Ga0495653_0022871_3028_3417 | 129 |
| 926 | 3300046463 | Ga0495653_0042382 | Ga0495653_0042382_630_1019 | 129 |
| 927 | 3300046463 | Ga0495653_0083798 | Ga0495653_0083798_749_1138 | 129 |
| 928 | 3300046463 | Ga0495653_0464076 | Ga0495653_0464076_212_601 | 129 |
| 929 | 3300046472 | Ga0495580_0017328 | Ga0495580_0017328_978_1367 | 129 |
| 930 | 3300046472 | Ga0495580_0223459 | Ga0495580_0223459_27_416 | 129 |
| 931 | 3300046473 | Ga0495582_0006537 | Ga0495582_0006537_1636_2025 | 129 |
| 932 | 3300046473 | Ga0495582_0659262 | Ga0495582_0659262_160_549 | 129 |
| 933 | 3300046474 | Ga0495605_0255393 | Ga0495605_0255393_133_522 | 129 |
| 934 | 3300046475 | Ga0495639_0027411 | Ga0495639_0027411_147_536 | 129 |
| 935 | 3300046475 | Ga0495639_0046153 | Ga0495639_0046153_1118_1507 | 129 |
| 936 | 3300046476 | Ga0495662_0048387 | Ga0495662_0048387_144_533 | 129 |
| 937 | 3300046476 | Ga0495662_0050106 | Ga0495662_0050106_174_563 | 129 |
| 938 | 3300046477 | Ga0495664_0004186 | Ga0495664_0004186_3285_3674 | 129 |
| 939 | 3300046477 | Ga0495664_0101750 | Ga0495664_0101750_1095_1484 | 129 |
| 940 | 3300046477 | Ga0495664_0106162 | Ga0495664_0106162_650_1039 | 129 |
| 941 | 3300046491 | Ga0495584_0024671 | Ga0495584_0024671_2415_2804 | 129 |
| 942 | 3300046491 | Ga0495584_0349846 | Ga0495584_0349846_346_735 | 129 |
| 943 | 3300046492 | Ga0495585_0001120 | Ga0495585_0001120_12265_12654 | 129 |
| 944 | 3300046499 | Ga0495594_0026443 | Ga0495594_0026443_527_916 | 129 |
| 945 | 3300046499 | Ga0495594_0043621 | Ga0495594_0043621_332_721 | 129 |
| 946 | 3300046501 | Ga0495607_0009551 | Ga0495607_0009551_5280_5669 | 129 |
| 947 | 3300046506 | Ga0495583_0202343 | Ga0495583_0202343_91_480 | 129 |
| 948 | 3300046511 | Ga0495608_0000894 | Ga0495608_0000894_10455_10844 | 129 |
| 949 | 3300046513 | Ga0495616_0137912 | Ga0495616_0137912_466_855 | 129 |
| 950 | 3300046514 | Ga0495618_0007468 | Ga0495618_0007468_5997_6386 | 129 |
| 951 | 3300046514 | Ga0495618_0016463 | Ga0495618_0016463_1215_1604 | 129 |
| 952 | 3300046514 | Ga0495618_0216138 | Ga0495618_0216138_277_666 | 129 |
| 953 | 3300046516 | Ga0495628_0001643 | Ga0495628_0001643_3599_3988 | 129 |
| 954 | 3300046516 | Ga0495628_0005224 | Ga0495628_0005224_7557_7946 | 129 |
| 955 | 3300046516 | Ga0495628_0079867 | Ga0495628_0079867_1737_2126 | 129 |
| 956 | 3300046517 | Ga0495630_0090226 | Ga0495630_0090226_1332_1721 | 129 |
| 957 | 3300046517 | Ga0495630_0265767 | Ga0495630_0265767_632_1021 | 129 |
| 958 | 3300046518 | Ga0495631_0461178 | Ga0495631_0461178_34_423 | 129 |
| 959 | 3300046520 | Ga0495637_0247086 | Ga0495637_0247086_75_464 | 129 |
| 960 | 3300046523 | Ga0495644_0000276 | Ga0495644_0000276_17637_18026 | 129 |
| 961 | 3300046525 | Ga0495663_0003625 | Ga0495663_0003625_2146_2535 | 129 |
| 962 | 3300046526 | Ga0495666_0030261 | Ga0495666_0030261_2074_2463 | 129 |
| 963 | 3300046526 | Ga0495666_0071263 | Ga0495666_0071263_1188_1577 | 129 |
| 964 | 3300046529 | Ga0495652_0005225 | Ga0495652_0005225_553_942 | 129 |
| 965 | 3300046529 | Ga0495652_0013895 | Ga0495652_0013895_2802_3191 | 129 |
| 966 | 3300046529 | Ga0495652_0054951 | Ga0495652_0054951_1286_1675 | 129 |
| 967 | 3300046529 | Ga0495652_0182600 | Ga0495652_0182600_896_1285 | 129 |
| 968 | 3300046531 | Ga0495665_0005432 | Ga0495665_0005432_5527_5916 | 129 |
| 969 | 3300046531 | Ga0495665_0108659 | Ga0495665_0108659_194_583 | 129 |
| 970 | 3300046533 | Ga0495640_0009470 | Ga0495640_0009470_1541_1930 | 129 |
| 971 | 3300046533 | Ga0495640_0190803 | Ga0495640_0190803_458_847 | 129 |
| 972 | 3300046533 | Ga0495640_0301469 | Ga0495640_0301469_57_446 | 129 |
| 973 | 3300046533 | Ga0495640_0313416 | Ga0495640_0313416_147_536 | 129 |
| 974 | 3300046535 | Ga0495586_0034648 | Ga0495586_0034648_25_414 | 129 |
| 975 | 3300046536 | Ga0495587_0002982 | Ga0495587_0002982_6937_7326 | 129 |
| 976 | 3300046536 | Ga0495587_0019533 | Ga0495587_0019533_2194_2583 | 129 |
| 977 | 3300046536 | Ga0495587_0020752 | Ga0495587_0020752_1263_1652 | 129 |
| 978 | 3300046537 | Ga0495598_0010089 | Ga0495598_0010089_416_805 | 129 |
| 979 | 3300046543 | Ga0495645_0007183 | Ga0495645_0007183_6937_7326 | 129 |
| 980 | 3300046543 | Ga0495645_0051654 | Ga0495645_0051654_1991_2380 | 129 |
| 981 | 3300046557 | Ga0495622_0012450 | Ga0495622_0012450_1091_1480 | 129 |
| 982 | 3300046557 | Ga0495622_0037807 | Ga0495622_0037807_422_811 | 129 |
| 983 | 3300046558 | Ga0495633_0006390 | Ga0495633_0006390_3405_3794 | 129 |
| 984 | 3300046559 | Ga0495667_0006825 | Ga0495667_0006825_5332_5721 | 129 |
| 985 | 3300046559 | Ga0495667_0020138 | Ga0495667_0020138_977_1366 | 129 |
| 986 | 3300046559 | Ga0495667_0050526 | Ga0495667_0050526_1706_2095 | 129 |
| 987 | 3300046615 | Ga0495656_0000754 | Ga0495656_0000754_7516_7905 | 129 |
| 988 | 3300046642 | Ga0495634_0112115 | Ga0495634_0112115_476_865 | 129 |
| 989 | 3300046642 | Ga0495634_0204657 | Ga0495634_0204657_309_698 | 129 |
| 990 | 3300046648 | Ga0495611_0003788 | Ga0495611_0003788_3201_3590 | 129 |
| 991 | 3300046663 | Ga0495635_0026238 | Ga0495635_0026238_1523_1912 | 129 |
| 992 | 3300046663 | Ga0495635_0044778 | Ga0495635_0044778_2581_2970 | 129 |
| 993 | 3300046663 | Ga0495635_0100441 | Ga0495635_0100441_192_581 | 129 |
| 994 | 3300046663 | Ga0495635_0121067 | Ga0495635_0121067_511_900 | 129 |
| 995 | 3300046664 | Ga0495659_0000313 | Ga0495659_0000313_14246_14635 | 129 |
| 996 | 3300046674 | Ga0495588_0081088 | Ga0495588_0081088_965_1354 | 129 |
| 997 | 3300046675 | Ga0495657_0007186 | Ga0495657_0007186_4885_5274 | 129 |
| 998 | 3300046675 | Ga0495657_0504829 | Ga0495657_0504829_273_662 | 129 |
| 999 | 3300046675 | Ga0495657_0623366 | Ga0495657_0623366_85_474 | 129 |
| 1000 | 3300046678 | Ga0495599_0003276 | Ga0495599_0003276_7213_7602 | 129 |
| 1001 | 3300046679 | Ga0495623_0004045 | Ga0495623_0004045_2328_2717 | 129 |
| 1002 | 3300046679 | Ga0495623_0010576 | Ga0495623_0010576_3470_3859 | 129 |
| 1003 | 3300046680 | Ga0495646_0002740 | Ga0495646_0002740_3445_3834 | 129 |
| 1004 | 3300046680 | Ga0495646_0010561 | Ga0495646_0010561_5415_5804 | 129 |
| 1005 | 3300046680 | Ga0495646_0113630 | Ga0495646_0113630_62_451 | 129 |
| 1006 | 3300046681 | Ga0495647_0032878 | Ga0495647_0032878_27_416 | 129 |
| 1007 | 3300046681 | Ga0495647_0043528 | Ga0495647_0043528_1121_1510 | 129 |
| 1008 | 3300046681 | Ga0495647_0057038 | Ga0495647_0057038_177_566 | 129 |
| 1009 | 3300046683 | Ga0495658_0001518 | Ga0495658_0001518_6318_6707 | 129 |
| 1010 | 3300046683 | Ga0495658_0010651 | Ga0495658_0010651_3974_4363 | 129 |
| 1011 | 3300046683 | Ga0495658_0211672 | Ga0495658_0211672_533_922 | 129 |
| 1012 | 3300046683 | Ga0495658_0472600 | Ga0495658_0472600_59_448 | 129 |
| 1013 | 3300046684 | Ga0495669_0174490 | Ga0495669_0174490_387_776 | 129 |
| 1014 | 3300046689 | Ga0495613_0192980 | Ga0495613_0192980_194_583 | 129 |
| 1015 | 3300046689 | Ga0495613_0634045 | Ga0495613_0634045_78_467 | 129 |
| 1016 | 3300046690 | Ga0495624_0196456 | Ga0495624_0196456_253_642 | 129 |
| 1017 | 3300046690 | Ga0495624_0422902 | Ga0495624_0422902_57_446 | 129 |
| 1018 | 3300046691 | Ga0495670_0000678 | Ga0495670_0000678_12026_12415 | 129 |
| 1019 | 3300046794 | Ga0495589_0147333 | Ga0495589_0147333_657_1046 | 129 |
| 1020 | 3300046809 | Ga0495600_0015965 | Ga0495600_0015965_190_579 | 129 |
| 1021 | 3300046809 | Ga0495600_0021509 | Ga0495600_0021509_2625_3014 | 129 |
| 1022 | 3300047315 | Ga0495581_0005389 | Ga0495581_0005389_1794_2183 | 129 |
| 1023 | 3300047315 | Ga0495581_0054350 | Ga0495581_0054350_28_417 | 129 |
| 1024 | 3300047315 | Ga0495581_0337183 | Ga0495581_0337183_123_512 | 129 |
| 1025 | 3300047317 | Ga0495604_0005224 | Ga0495604_0005224_2338_2727 | 129 |
| 1026 | 3300047317 | Ga0495604_0020077 | Ga0495604_0020077_1778_2167 | 129 |
| 1027 | 3300047317 | Ga0495604_0036373 | Ga0495604_0036373_198_587 | 129 |
| 1028 | 3300047319 | Ga0495674_0065440 | Ga0495674_0065440_596_985 | 129 |
| 1029 | 3300047319 | Ga0495674_0131245 | Ga0495674_0131245_580_969 | 129 |
| 1030 | 3300047319 | Ga0495674_0203312 | Ga0495674_0203312_844_1233 | 129 |
| 1031 | 3300047319 | Ga0495674_0266832 | Ga0495674_0266832_512_901 | 129 |
| 1032 | 3300047321 | Ga0495676_0084467 | Ga0495676_0084467_978_1367 | 129 |
| 1033 | 3300047321 | Ga0495676_0094678 | Ga0495676_0094678_26_415 | 129 |
| 1034 | 3300047321 | Ga0495676_0453639 | Ga0495676_0453639_394_783 | 129 |
| 1035 | 3300047322 | Ga0495680_0010223 | Ga0495680_0010223_803_1192 | 129 |
| 1036 | 3300047322 | Ga0495680_0012624 | Ga0495680_0012624_2975_3364 | 129 |
| 1037 | 3300047322 | Ga0495680_0030552 | Ga0495680_0030552_3476_3865 | 129 |
| 1038 | 3300047322 | Ga0495680_0098448 | Ga0495680_0098448_147_536 | 129 |
| 1039 | 3300047444 | Ga0495675_0001149 | Ga0495675_0001149_7340_7729 | 129 |
| 1040 | 3300047444 | Ga0495675_0780306 | Ga0495675_0780306_14_403 | 129 |
| 1041 | 3300047445 | Ga0495677_0057187 | Ga0495677_0057187_940_1329 | 129 |
| 1042 | 3300047446 | Ga0495679_020206 | Ga0495679_020206_1729_2118 | 129 |
| 1043 | 3300047471 | Ga0495684_0003052 | Ga0495684_0003052_12505_12894 | 129 |
| 1044 | 3300047471 | Ga0495684_0129052 | Ga0495684_0129052_179_568 | 129 |
| 1045 | 3300047673 | Ga0495593_0025793 | Ga0495593_0025793_972_1361 | 129 |
| 1046 | 3300047673 | Ga0495593_0259740 | Ga0495593_0259740_41_430 | 129 |
| 1047 | 3300048088 | Ga0495602_0009459 | Ga0495602_0009459_7187_7576 | 129 |
| 1048 | 3300048088 | Ga0495602_0019879 | Ga0495602_0019879_1428_1817 | 129 |
| 1049 | 3300048088 | Ga0495602_0882401 | Ga0495602_0882401_89_478 | 129 |
| 1050 | 3300048089 | Ga0495614_0027957 | Ga0495614_0027957_355_744 | 129 |
| 1051 | 3300048089 | Ga0495614_0061537 | Ga0495614_0061537_599_988 | 129 |
| 1052 | 3300048089 | Ga0495614_0494616 | Ga0495614_0494616_82_471 | 129 |
| 1053 | 3300048903 | Ga0496100_0003970 | Ga0496100_0003970_3767_4156 | 129 |
| 1054 | 3300048903 | Ga0496100_0164294 | Ga0496100_0164294_647_1036 | 129 |
| 1055 | 3300048903 | Ga0496100_0610600 | Ga0496100_0610600_116_505 | 129 |
| 1056 | 3300048904 | Ga0496101_0001569 | Ga0496101_0001569_10012_10401 | 129 |
| 1057 | 3300048904 | Ga0496101_0020202 | Ga0496101_0020202_2555_2944 | 129 |
| 1058 | 3300048904 | Ga0496101_0050260 | Ga0496101_0050260_28_417 | 129 |
| 1059 | 3300048904 | Ga0496101_0250973 | Ga0496101_0250973_325_714 | 129 |
| 1060 | 3300048904 | Ga0496101_0642548 | Ga0496101_0642548_65_454 | 129 |
| 1061 | 3300048905 | Ga0496102_0004673 | Ga0496102_0004673_11059_11448 | 129 |
| 1062 | 3300048905 | Ga0496102_0018222 | Ga0496102_0018222_561_950 | 129 |
| 1063 | 3300048905 | Ga0496102_0081843 | Ga0496102_0081843_2028_2417 | 129 |
| 1064 | 3300048905 | Ga0496102_0113730 | Ga0496102_0113730_1532_1921 | 129 |
| 1065 | 3300048905 | Ga0496102_0414458 | Ga0496102_0414458_662_1051 | 129 |
| 1066 | 3300048905 | Ga0496102_0938567 | Ga0496102_0938567_104_493 | 129 |
| 1067 | 3300048906 | Ga0496103_0000430 | Ga0496103_0000430_23308_23697 | 129 |
| 1068 | 3300048906 | Ga0496103_0008308 | Ga0496103_0008308_532_921 | 129 |
| 1069 | 3300048906 | Ga0496103_0039270 | Ga0496103_0039270_102_491 | 129 |
| 1070 | 3300048906 | Ga0496103_0045716 | Ga0496103_0045716_1172_1561 | 129 |
| 1071 | 3300048906 | Ga0496103_0115786 | Ga0496103_0115786_119_508 | 129 |
| 1072 | 3300048906 | Ga0496103_0120597 | Ga0496103_0120597_725_1114 | 129 |
| 1073 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_3635_4024 | 129 |
| 1074 | 3300048907 | Ga0496104_0130526 | Ga0496104_0130526_1611_2000 | 129 |
| 1075 | 3300048907 | Ga0496104_0167267 | Ga0496104_0167267_1187_1576 | 129 |
| 1076 | 3300048907 | Ga0496104_0208475 | Ga0496104_0208475_364_753 | 129 |
| 1077 | 3300048907 | Ga0496104_0306891 | Ga0496104_0306891_28_417 | 129 |
| 1078 | 3300048907 | Ga0496104_0433438 | Ga0496104_0433438_684_1073 | 129 |
| 1079 | 3300048908 | Ga0496105_0036668 | Ga0496105_0036668_928_1317 | 129 |
| 1080 | 3300048908 | Ga0496105_0064401 | Ga0496105_0064401_112_501 | 129 |
| 1081 | 3300048908 | Ga0496105_0066007 | Ga0496105_0066007_1005_1394 | 129 |
| 1082 | 3300048908 | Ga0496105_0171353 | Ga0496105_0171353_330_719 | 129 |
| 1083 | 3300048908 | Ga0496105_0278071 | Ga0496105_0278071_430_819 | 129 |
| 1084 | 3300048908 | Ga0496105_0392059 | Ga0496105_0392059_430_819 | 129 |
| 1085 | 3300048909 | Ga0496106_0003028 | Ga0496106_0003028_11290_11679 | 129 |
| 1086 | 3300048909 | Ga0496106_0007444 | Ga0496106_0007444_901_1290 | 129 |
| 1087 | 3300048909 | Ga0496106_0018178 | Ga0496106_0018178_552_941 | 129 |
| 1088 | 3300048909 | Ga0496106_0065164 | Ga0496106_0065164_1500_1889 | 129 |
| 1089 | 3300048909 | Ga0496106_0092461 | Ga0496106_0092461_935_1324 | 129 |
| 1090 | 3300048909 | Ga0496106_0248627 | Ga0496106_0248627_855_1244 | 129 |
| 1091 | 3300048910 | Ga0496107_0001324 | Ga0496107_0001324_8689_9078 | 129 |
| 1092 | 3300048910 | Ga0496107_0011160 | Ga0496107_0011160_5792_6181 | 129 |
| 1093 | 3300048910 | Ga0496107_0011716 | Ga0496107_0011716_3880_4269 | 129 |
| 1094 | 3300048910 | Ga0496107_0755280 | Ga0496107_0755280_255_644 | 129 |
| 1095 | 3300048911 | Ga0496108_0003835 | Ga0496108_0003835_4002_4391 | 129 |
| 1096 | 3300048911 | Ga0496108_0103714 | Ga0496108_0103714_427_816 | 129 |
| 1097 | 3300048911 | Ga0496108_0146984 | Ga0496108_0146984_1518_1907 | 129 |
| 1098 | 3300048911 | Ga0496108_0173049 | Ga0496108_0173049_561_950 | 129 |
| 1099 | 3300048912 | Ga0496109_0000338 | Ga0496109_0000338_12869_13258 | 129 |
| 1100 | 3300048912 | Ga0496109_0211106 | Ga0496109_0211106_519_908 | 129 |
| 1101 | 3300048912 | Ga0496109_0265648 | Ga0496109_0265648_175_564 | 129 |
| 1102 | 3300048912 | Ga0496109_0407527 | Ga0496109_0407527_474_863 | 129 |
| 1103 | 3300048912 | Ga0496109_0769848 | Ga0496109_0769848_411_800 | 129 |
| 1104 | 3300048913 | Ga0496110_0055234 | Ga0496110_0055234_3061_3450 | 129 |
| 1105 | 3300048913 | Ga0496110_0063385 | Ga0496110_0063385_1205_1594 | 129 |
| 1106 | 3300048913 | Ga0496110_0099831 | Ga0496110_0099831_1839_2228 | 129 |
| 1107 | 3300048913 | Ga0496110_0134508 | Ga0496110_0134508_1512_1901 | 129 |
| 1108 | 3300048913 | Ga0496110_0330086 | Ga0496110_0330086_110_499 | 129 |
| 1109 | 3300048913 | Ga0496110_0334522 | Ga0496110_0334522_430_819 | 129 |
| 1110 | 3300048913 | Ga0496110_0334533 | Ga0496110_0334533_561_950 | 129 |
| 1111 | 3300048914 | Ga0496111_0012615 | Ga0496111_0012615_555_944 | 129 |
| 1112 | 3300048914 | Ga0496111_0066000 | Ga0496111_0066000_1617_2006 | 129 |
| 1113 | 3300048914 | Ga0496111_0397003 | Ga0496111_0397003_142_531 | 129 |
| 1114 | 3300048914 | Ga0496111_0524722 | Ga0496111_0524722_67_456 | 129 |
| 1115 | 3300048914 | Ga0496111_0709182 | Ga0496111_0709182_209_598 | 129 |
| 1116 | 3300048915 | Ga0496112_0005440 | Ga0496112_0005440_430_819 | 129 |
| 1117 | 3300048915 | Ga0496112_0069073 | Ga0496112_0069073_250_639 | 129 |
| 1118 | 3300048915 | Ga0496112_0069190 | Ga0496112_0069190_1488_1877 | 129 |
| 1119 | 3300048915 | Ga0496112_0096794 | Ga0496112_0096794_726_1115 | 129 |
| 1120 | 3300048915 | Ga0496112_0111044 | Ga0496112_0111044_277_666 | 129 |
| 1121 | 3300048915 | Ga0496112_0117700 | Ga0496112_0117700_860_1249 | 129 |
| 1122 | 3300048915 | Ga0496112_0426531 | Ga0496112_0426531_430_819 | 129 |
| 1123 | 3300048915 | Ga0496112_0999933 | Ga0496112_0999933_88_480 | 129 |
| 1124 | 3300048916 | Ga0496113_0010323 | Ga0496113_0010323_1920_2309 | 129 |
| 1125 | 3300048916 | Ga0496113_0131711 | Ga0496113_0131711_415_804 | 129 |
| 1126 | 3300048916 | Ga0496113_0262535 | Ga0496113_0262535_561_950 | 129 |
| 1127 | 3300048916 | Ga0496113_0383164 | Ga0496113_0383164_430_819 | 129 |
| 1128 | 3300048917 | Ga0496114_0005514 | Ga0496114_0005514_4084_4473 | 129 |
| 1129 | 3300048917 | Ga0496114_0009307 | Ga0496114_0009307_559_948 | 129 |
| 1130 | 3300048918 | Ga0496115_0004496 | Ga0496115_0004496_6390_6779 | 129 |
| 1131 | 3300048918 | Ga0496115_0036924 | Ga0496115_0036924_1611_2000 | 129 |
| 1132 | 3300048918 | Ga0496115_0045977 | Ga0496115_0045977_150_539 | 129 |
| 1133 | 3300048918 | Ga0496115_0087837 | Ga0496115_0087837_1140_1529 | 129 |
| 1134 | 3300048918 | Ga0496115_0100371 | Ga0496115_0100371_1536_1925 | 129 |
| 1135 | 3300048918 | Ga0496115_0129008 | Ga0496115_0129008_53_442 | 129 |
| 1136 | 3300048918 | Ga0496115_0423279 | Ga0496115_0423279_114_503 | 129 |
| 1137 | 3300048918 | Ga0496115_0465645 | Ga0496115_0465645_389_778 | 129 |
| 1138 | 3300048928 | Ga0496125_0656793 | Ga0496125_0656793_133_522 | 129 |
| 1139 | 3300049575 | Ga0501039_0481395 | Ga0501039_0481395_419_808 | 129 |
| 1140 | 3300049580 | Ga0501046_0661581 | Ga0501046_0661581_183_572 | 129 |
| 1141 | 3300049581 | Ga0501047_0085402 | Ga0501047_0085402_1953_2342 | 129 |
| 1142 | 3300049581 | Ga0501047_0309500 | Ga0501047_0309500_549_938 | 129 |
| 1143 | 3300049585 | Ga0501069_0419835 | Ga0501069_0419835_204_596 | 129 |
| 1144 | 3300049586 | Ga0501070_0015452 | Ga0501070_0015452_4352_4741 | 129 |
| 1145 | 3300049587 | Ga0501071_1261250 | Ga0501071_1261250_104_493 | 129 |
| 1146 | 3300049590 | Ga0501074_0294528 | Ga0501074_0294528_58_447 | 129 |
| 1147 | 3300049590 | Ga0501074_0674977 | Ga0501074_0674977_273_662 | 129 |
| 1148 | 3300049593 | Ga0501077_0061042 | Ga0501077_0061042_1936_2325 | 129 |
| 1149 | 3300049741 | Ga0501079_1623864 | Ga0501079_1623864_52_441 | 129 |
| 1150 | 3300049743 | Ga0501081_0418876 | Ga0501081_0418876_305_694 | 129 |
| 1151 | 3300049823 | Ga0501044_0158608 | Ga0501044_0158608_1193_1582 | 129 |
| 1152 | 3300049823 | Ga0501044_0623399 | Ga0501044_0623399_213_602 | 129 |
| 1153 | 3300049823 | Ga0501044_0761432 | Ga0501044_0761432_157_546 | 129 |
| 1154 | 3300049824 | Ga0501045_0564976 | Ga0501045_0564976_96_485 | 129 |
| 1155 | 3300050490 | nmdc:mga03n38_679272_c1 | nmdc:mga03n38_679272_c1_68_460 | 129 |
| 1156 | 3300050494 | nmdc:mga06z11_15118_c1 | nmdc:mga06z11_15118_c1_2145_2534 | 129 |
| 1157 | 3300050496 | nmdc:mga07m45_195205_c1 | nmdc:mga07m45_195205_c1_544_933 | 129 |
| 1158 | 3300050496 | nmdc:mga07m45_601319_c1 | nmdc:mga07m45_601319_c1_141_533 | 129 |
| 1159 | 3300050507 | nmdc:mga05p37_1602_c1 | nmdc:mga05p37_1602_c1_6956_7345 | 129 |
| 1160 | 3300050508 | nmdc:mga09592_7132_c1 | nmdc:mga09592_7132_c1_275_664 | 129 |
| 1161 | 3300050509 | nmdc:mga0qj67_556_c1 | nmdc:mga0qj67_556_c1_18514_18903 | 129 |
| 1162 | 3300050510 | nmdc:mga06r32_8190_c1 | nmdc:mga06r32_8190_c1_2190_2579 | 129 |
| 1163 | 3300050511 | nmdc:mga08y16_2018_c1 | nmdc:mga08y16_2018_c1_14535_14924 | 129 |
| 1164 | 3300050511 | nmdc:mga08y16_4650_c1 | nmdc:mga08y16_4650_c1_13499_13888 | 129 |
| 1165 | 3300050511 | nmdc:mga08y16_659742_c1 | nmdc:mga08y16_659742_c1_246_635 | 129 |
| 1166 | 3300050511 | nmdc:mga08y16_66505_c1 | nmdc:mga08y16_66505_c1_234_623 | 129 |
| 1167 | 3300050512 | nmdc:mga0n895_1478_c1 | nmdc:mga0n895_1478_c1_3525_3914 | 129 |
| 1168 | 3300050512 | nmdc:mga0n895_389772_c1 | nmdc:mga0n895_389772_c1_827_1216 | 129 |
| 1169 | 3300050512 | nmdc:mga0n895_45434_c1 | nmdc:mga0n895_45434_c1_2459_2848 | 129 |
| 1170 | 3300050512 | nmdc:mga0n895_51021_c1 | nmdc:mga0n895_51021_c1_2623_3012 | 129 |
| 1171 | 3300050512 | nmdc:mga0n895_543_c1 | nmdc:mga0n895_543_c1_21690_22079 | 129 |
| 1172 | 3300050512 | nmdc:mga0n895_673468_c1 | nmdc:mga0n895_673468_c1_624_1013 | 129 |
| 1173 | 3300050513 | nmdc:mga0rr50_21800_c1 | nmdc:mga0rr50_21800_c1_2638_3027 | 129 |
| 1174 | 3300050513 | nmdc:mga0rr50_30768_c1 | nmdc:mga0rr50_30768_c1_509_898 | 129 |
| 1175 | 3300050513 | nmdc:mga0rr50_812_c1 | nmdc:mga0rr50_812_c1_12396_12785 | 129 |
| 1176 | 3300050514 | nmdc:mga08x19_10925_c1 | nmdc:mga08x19_10925_c1_4054_4443 | 129 |
| 1177 | 3300050514 | nmdc:mga08x19_281324_c1 | nmdc:mga08x19_281324_c1_506_895 | 129 |
| 1178 | 3300050515 | nmdc:mga0a205_22992_c1 | nmdc:mga0a205_22992_c1_4011_4400 | 129 |
| 1179 | 3300050515 | nmdc:mga0a205_416_c1 | nmdc:mga0a205_416_c1_1924_2313 | 129 |
| 1180 | 3300050515 | nmdc:mga0a205_80693_c1 | nmdc:mga0a205_80693_c1_2463_2852 | 129 |
| 1181 | 3300053077 | Ga0495601_0000432 | Ga0495601_0000432_13313_13702 | 129 |
| 1182 | 3300053077 | Ga0495601_0002128 | Ga0495601_0002128_553_942 | 129 |
| 1183 | 3300053077 | Ga0495601_0003953 | Ga0495601_0003953_3722_4111 | 129 |
| 1184 | 3300053077 | Ga0495601_0319739 | Ga0495601_0319739_290_679 | 129 |
| 1185 | 3300053078 | Ga0495612_0000870 | Ga0495612_0000870_553_942 | 129 |
| 1186 | 3300053078 | Ga0495612_0003173 | Ga0495612_0003173_148_537 | 129 |
| 1187 | 3300053078 | Ga0495612_0005259 | Ga0495612_0005259_3993_4382 | 129 |
| 1188 | 3300053078 | Ga0495612_0026808 | Ga0495612_0026808_816_1205 | 129 |
| 1189 | 3300053084 | Ga0495595_0001669 | Ga0495595_0001669_7549_7938 | 129 |
| 1190 | 3300053084 | Ga0495595_0069696 | Ga0495595_0069696_1114_1503 | 129 |
| 1191 | 3300053084 | Ga0495595_0252704 | Ga0495595_0252704_450_839 | 129 |
| 1192 | 3300053085 | Ga0495619_0000646 | Ga0495619_0000646_3548_3937 | 129 |
| 1193 | 3300053085 | Ga0495619_0001716 | Ga0495619_0001716_730_1119 | 129 |
| 1194 | 3300053085 | Ga0495619_0009254 | Ga0495619_0009254_5446_5835 | 129 |
| 1195 | 3300053085 | Ga0495619_0026265 | Ga0495619_0026265_1913_2302 | 129 |
| 1196 | 3300053085 | Ga0495619_0035384 | Ga0495619_0035384_966_1355 | 129 |
| 1197 | 3300053087 | Ga0500643_005975 | Ga0500643_005975_3636_4025 | 129 |
| 1198 | 3300053088 | Ga0500644_0001048 | Ga0500644_0001048_4110_4499 | 129 |
| 1199 | 3300053093 | Ga0500651_0001317 | Ga0500651_0001317_4499_4888 | 129 |
| 1200 | 3300053094 | Ga0500566_0225643 | Ga0500566_0225643_16_405 | 129 |
| 1201 | 3300053119 | Ga0500595_000207 | Ga0500595_000207_36786_37175 | 129 |
| 1202 | 3300053130 | Ga0500642_0086259 | Ga0500642_0086259_17_406 | 129 |
| 1203 | 3300053131 | Ga0500652_101713 | Ga0500652_101713_85_474 | 129 |
| 1204 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_918519_918908 | 129 |
| 1205 | 3300053728 | Ga0500657_073848 | Ga0500657_073848_145_534 | 129 |
| 1206 | 3300053730 | Ga0500645_000809 | Ga0500645_000809_4248_4637 | 129 |
| 1207 | 3300060353 | Ga0501082_0005955 | Ga0501082_0005955_1254_1643 | 129 |
| 1208 | iso_pu_bacteria | 2523231067 | 2523467226 | 129 |
| 1209 | iso_pu_bacteria | 2738543031 | 2739347735 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fi9-assembly1.cif.gz_A | the crystal structure of an outer membrane protein from the bartonella henselae | 0.9626 | 11 | 129 |
| 2fi9-assembly1.cif.gz_A | the crystal structure of an outer membrane protein from the bartonella henselae | 0.9548 | 11 | 129 |
| 3cpk-assembly1.cif.gz_A | crystal structure of the q7w7n7_borpa protein from bordetella parapertussis. northeast structural genomics consortium target ber31 | 0.8955 | 14 | 127 |
| 2fvt-assembly1.cif.gz_A | nmr structure of the rpa2829 protein from rhodopseudomonas palustris: northeast structural genomics target rpr43 | 0.8833 | 10 | 129 |
| 2k2e-assembly1.cif.gz_A | solution nmr structure of bordetella pertussis protein bp2786, a mth938-like domain. northeast structural genomics consortium target ber31 | 0.8655 | 16 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0VZT1_1_69_3.40.50.10190 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain | 0.9658 | 69 | 129 | 3.40.50.10190 |
| 2fi9A00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like | 0.9626 | 11 | 129 | 3.40.1230.10 |
| 2fi9A00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like | 0.9548 | 11 | 129 | 3.40.1230.10 |
| af_Q9BU61_55_171_3.40.1230.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like | 0.9264 | 14 | 129 | 3.40.1230.10 |
| af_A0A1D6P6M4_78_189_3.40.1230.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like | 0.9165 | 20 | 127 | 3.40.1230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A812UYF5-F1-model_v4 | deleted | 0.9869 | 30 | 127 |
|
| AF-A0A436CPS0-F1-model_v4 | Uncharacterized protein | 0.9856 | 64 | 129 |
|
| AF-A0A4D7QNA1-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9842 | 31 | 129 |
|
| AF-A0A4R3G007-F1-model_v4 | Uncharacterized protein DUF498/DUF598 | 0.9839 | 55 | 128 |
|
| AF-A0A7U3E1F9-F1-model_v4 | deleted | 0.9797 | 12 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar