F491699

General Info

Members Datasets Scaffolds Average Seq Length
1209 501 1204 128

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100328883|Ga0070714_1003288832
Length 143
Sequence VGVNGVWGTEFPSQMVDSESDTGRHLPQPAPIEAYGNGGFRFGGLSHRGSLLCFPDGIWAWPVTSIAELTPATLAPAFARADALDFFLIGGGRDPFVLPEALRQRFRDASLSVDAMATGAAVRTWNVLLAENRRVGAALIATA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
150 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
171 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
251 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
257 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
258 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
259 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
260 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
261 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
262 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
263 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
264 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
265 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
266 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
267 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
268 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
269 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
270 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
271 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
272 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
280 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
281 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
282 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
283 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
284 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
285 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
286 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
287 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
288 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
289 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
290 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
291 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
292 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
293 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
294 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
295 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
296 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
297 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
299 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
301 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
302 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
303 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
307 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
308 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
309 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
310 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
311 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
312 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
315 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
319 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
324 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
325 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
326 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
327 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
330 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
331 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
332 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
333 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
334 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
335 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
336 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
337 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
338 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
355 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
356 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
357 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
365 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
366 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
372 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
373 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
374 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
375 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
378 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
379 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
380 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
381 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
382 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
383 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
384 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
385 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
386 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
387 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
388 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
389 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
390 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
391 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
395 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
396 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
397 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
398 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
399 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
400 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
401 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
402 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
403 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
404 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
405 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
406 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
407 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
408 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
411 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
412 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
413 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
414 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
415 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
418 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
419 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
423 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
426 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
427 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
428 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
429 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
430 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
431 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
432 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
452 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
453 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
454 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
455 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
456 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
457 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
458 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
459 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
460 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
461 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
462 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
463 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
474 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
475 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
476 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
477 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
478 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
479 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
480 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
481 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
484 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
485 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
486 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
487 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
488 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
489 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
490 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
491 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
492 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
493 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
494 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
497 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
498 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
501 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.25
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0.08
Rhizoplane 7.03
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800771 2209111006 Bacteria 10114
2 ARSoilYngRDRAFT_c00311 3300000042 Bacteria 7054
3 ARcpr5yngRDRAFT_c000325 3300000043 Bacteria 6544
4 ARSoilOldRDRAFT_c000035 3300000044 Bacteria 30405
5 ARCol0yngRDRAFT_1000039 3300000652 Bacteria 22019
6 JGI24736J21556_1011646 3300001904 Bacteria 1428
7 JGI24746J21847_1001683 3300001977 Bacteria 3546
8 JGI24747J21853_1000078 3300001978 Bacteria 4144
9 JGI24739J22299_10003335 3300001989 Bacteria 6120
10 JGI24737J22298_10000091 3300001990 Bacteria 26600
11 JGI24737J22298_10002689 3300001990 Bacteria 6285
12 JGI24743J22301_10000116 3300001991 Bacteria 7930
13 JGI24735J21928_10070098 3300002067 Bacteria 1005
14 JGI24750J21931_1000403 3300002070 Bacteria 7215
15 JGI24745J21846_1000016 3300002073 Bacteria 10319
16 JGI24748J21848_1003441 3300002074 Bacteria 1807
17 JGI24738J21930_10000701 3300002075 Bacteria 9657
18 JGI24749J21850_1000112 3300002076 Bacteria 13520
19 JGI24744J21845_10004766 3300002077 Bacteria 2804
20 JGI24035J26624_1000063 3300002126 Bacteria 8415
21 JGI24034J26672_10000333 3300002239 Bacteria 6058
22 JGI24742J22300_10000372 3300002244 Bacteria 6611
23 JGI25406J46586_10011553 3300003203 Bacteria 3871
24 JGI25406J46586_10174127 3300003203 Bacteria 627
25 JGI25405J52794_10006686 3300003911 Bacteria 2110
26 JGI25405J52794_10009062 3300003911 Bacteria 1872
27 Ga0065716_1002818 3300005277 Bacteria 1503
28 Ga0065712_10078281 3300005290 Bacteria 3368
29 Ga0065715_10000516 3300005293 Bacteria 13613
30 Ga0065715_10089753 3300005293 Bacteria 8608
31 Ga0065707_10097659 3300005295 Bacteria 3155
32 Ga0065707_10145456 3300005295 Bacteria 1720
33 Ga0065707_10684514 3300005295 Unclassified 647
34 Ga0070658_10102385 3300005327 Bacteria 2368
35 Ga0070658_10228080 3300005327 Bacteria 1577
36 Ga0070658_10237134 3300005327 Bacteria 1545
37 Ga0070658_10635426 3300005327 Bacteria 926
38 Ga0070676_10000364 3300005328 Bacteria 20754
39 Ga0070676_10195938 3300005328 Bacteria 1322
40 Ga0070683_100000748 3300005329 Bacteria 23796
41 Ga0070683_100159387 3300005329 Bacteria 2140
42 Ga0070683_100249305 3300005329 Bacteria 1689
43 Ga0070683_100822410 3300005329 Bacteria 891
44 Ga0070683_101972020 3300005329 Bacteria 561
45 Ga0070690_100002562 3300005330 Bacteria 9783
46 Ga0070690_100017617 3300005330 Bacteria 4299
47 Ga0070690_100166028 3300005330 Bacteria 1516
48 Ga0070670_100011248 3300005331 Bacteria 7650
49 Ga0070670_100142125 3300005331 Bacteria 2076
50 Ga0070677_10000228 3300005333 Bacteria 19343
51 Ga0068869_100016306 3300005334 Bacteria 5005
52 Ga0070666_10032523 3300005335 Bacteria 3446
53 Ga0070666_10129985 3300005335 Bacteria 1749
54 Ga0070680_100006466 3300005336 Bacteria 8910
55 Ga0070680_100010322 3300005336 Bacteria 7200
56 Ga0070680_100015774 3300005336 Bacteria 5931
57 Ga0070680_100026684 3300005336 Bacteria 4619
58 Ga0070680_100186584 3300005336 Bacteria 1747
59 Ga0070680_100248420 3300005336 Bacteria 1504
60 Ga0070680_100639722 3300005336 Bacteria 914
61 Ga0070682_100001379 3300005337 Bacteria 13705
62 Ga0070682_100121886 3300005337 Bacteria 1752
63 Ga0070682_100155975 3300005337 Bacteria 1572
64 Ga0068868_100001339 3300005338 Bacteria 16997
65 Ga0070660_100001616 3300005339 Bacteria 15489
66 Ga0070660_100065012 3300005339 Bacteria 2839
67 Ga0070660_101008387 3300005339 Bacteria 703
68 Ga0070689_100000146 3300005340 Bacteria 40947
69 Ga0070691_10000065 3300005341 Bacteria 29277
70 Ga0070691_10037556 3300005341 Bacteria 2285
71 Ga0070687_100000023 3300005343 Bacteria 48100
72 Ga0070687_100498358 3300005343 Bacteria 819
73 Ga0070661_100000407 3300005344 Bacteria 33255
74 Ga0070661_100409923 3300005344 Bacteria 1073
75 Ga0070661_101872066 3300005344 Bacteria 510
76 Ga0070692_10000270 3300005345 Bacteria 14505
77 Ga0070668_100011009 3300005347 Bacteria 6732
78 Ga0070668_100228949 3300005347 Bacteria 1536
79 Ga0070668_100727666 3300005347 Bacteria 877
80 Ga0070668_100832818 3300005347 Bacteria 821
81 Ga0070669_100004155 3300005353 Bacteria 10496
82 Ga0070669_100041857 3300005353 Bacteria 3333
83 Ga0070675_100000306 3300005354 Bacteria 32965
84 Ga0070675_100317093 3300005354 Bacteria 1377
85 Ga0070675_101391628 3300005354 Unclassified 647
86 Ga0070671_100009840 3300005355 Bacteria 7677
87 Ga0070671_100306428 3300005355 Bacteria 1352
88 Ga0070671_100661942 3300005355 Bacteria 904
89 Ga0070674_100000671 3300005356 Bacteria 17297
90 Ga0070674_100096495 3300005356 Bacteria 2145
91 Ga0070673_100000297 3300005364 Bacteria 25890
92 Ga0070673_100598356 3300005364 Bacteria 1006
93 Ga0070673_100657598 3300005364 Bacteria 960
94 Ga0070688_100004712 3300005365 Bacteria 7124
95 Ga0070659_100001563 3300005366 Bacteria 16498
96 Ga0070659_100156952 3300005366 Bacteria 1859
97 Ga0070659_100684418 3300005366 Bacteria 886
98 Ga0070667_100000745 3300005367 Bacteria 31113
99 Ga0070667_100091711 3300005367 Bacteria 2613
100 Ga0070667_100487063 3300005367 Bacteria 1129
101 Ga0070709_10104162 3300005434 Bacteria 1896
102 Ga0070714_100070353 3300005435 Bacteria 3025
103 Ga0070714_100328883 3300005435 Bacteria 1431
104 Ga0070714_100883425 3300005435 Bacteria 867
105 Ga0070713_100038130 3300005436 Bacteria 3891
106 Ga0070713_100059946 3300005436 Bacteria 3180
107 Ga0070713_100087473 3300005436 Bacteria 2673
108 Ga0070713_100173767 3300005436 Bacteria 1931
109 Ga0070713_100908353 3300005436 Bacteria 847
110 Ga0070710_10039547 3300005437 Bacteria 2595
111 Ga0070710_10135227 3300005437 Bacteria 1507
112 Ga0070710_10895248 3300005437 Unclassified 640
113 Ga0070710_11259451 3300005437 Bacteria 549
114 Ga0070701_10118045 3300005438 Bacteria 1491
115 Ga0070711_100210435 3300005439 Bacteria 1506
116 Ga0070711_100234967 3300005439 Bacteria 1431
117 Ga0070711_100434713 3300005439 Bacteria 1072
118 Ga0070711_100488296 3300005439 Bacteria 1013
119 Ga0070711_100783137 3300005439 Bacteria 808
120 Ga0070711_101731074 3300005439 Bacteria 548
121 Ga0070705_100196065 3300005440 Bacteria 1381
122 Ga0070705_100838066 3300005440 Bacteria 735
123 Ga0070705_100872608 3300005440 Bacteria 722
124 Ga0070700_100004819 3300005441 Bacteria 7080
125 Ga0070700_100603734 3300005441 Bacteria 860
126 Ga0070700_100926914 3300005441 Bacteria 711
127 Ga0070694_100014232 3300005444 Bacteria 4979
128 Ga0070694_100095358 3300005444 Bacteria 2095
129 Ga0070708_100112513 3300005445 Bacteria 2504
130 Ga0070708_100296696 3300005445 Bacteria 1522
131 Ga0070663_100000121 3300005455 Bacteria 36740
132 Ga0070663_100025382 3300005455 Bacteria 4000
133 Ga0070663_100030390 3300005455 Bacteria 3701
134 Ga0070663_100224449 3300005455 Bacteria 1476
135 Ga0070663_100746130 3300005455 Bacteria 835
136 Ga0070678_100089894 3300005456 Bacteria 2352
137 Ga0070678_100400349 3300005456 Bacteria 1192
138 Ga0070662_100007921 3300005457 Bacteria 6909
139 Ga0070662_100011135 3300005457 Bacteria 5924
140 Ga0070662_100410465 3300005457 Bacteria 1119
141 Ga0070662_101167975 3300005457 Bacteria 661
142 Ga0070681_10004011 3300005458 Bacteria 13893
143 Ga0070681_10067881 3300005458 Bacteria 3533
144 Ga0070681_10222980 3300005458 Bacteria 1800
145 Ga0070681_10228885 3300005458 Bacteria 1773
146 Ga0070681_10787947 3300005458 Bacteria 867
147 Ga0068867_100000553 3300005459 Bacteria 24675
148 Ga0068867_100470041 3300005459 Bacteria 1075
149 Ga0070685_10000632 3300005466 Bacteria 19266
150 Ga0070685_10005595 3300005466 Bacteria 6375
151 Ga0074259_10260207 3300005507 Bacteria 802
152 Ga0070699_100134004 3300005518 Bacteria 2185
153 Ga0070679_100005467 3300005530 Bacteria 11781
154 Ga0070679_100064214 3300005530 Bacteria 3659
155 Ga0070679_100117077 3300005530 Bacteria 2649
156 Ga0070679_100125165 3300005530 Bacteria 2553
157 Ga0070679_100226048 3300005530 Bacteria 1832
158 Ga0070679_100252778 3300005530 Bacteria 1718
159 Ga0070679_100377845 3300005530 Bacteria 1364
160 Ga0070679_100526863 3300005530 Bacteria 1125
161 Ga0070679_101023342 3300005530 Bacteria 770
162 Ga0070679_101217576 3300005530 Bacteria 698
163 Ga0070684_100000454 3300005535 Bacteria 27974
164 Ga0070684_100553191 3300005535 Bacteria 1068
165 Ga0070697_100348928 3300005536 Bacteria 1278
166 Ga0070697_100382202 3300005536 Bacteria 1220
167 Ga0070697_101809432 3300005536 Bacteria 546
168 Ga0068853_100116823 3300005539 Bacteria 2376
169 Ga0068853_101095680 3300005539 Bacteria 768
170 Ga0070672_100000045 3300005543 Bacteria 53368
171 Ga0070686_100000480 3300005544 Bacteria 24146
172 Ga0070686_100035382 3300005544 Bacteria 3084
173 Ga0070686_100211338 3300005544 Bacteria 1397
174 Ga0070686_100375582 3300005544 Bacteria 1075
175 Ga0070686_100858666 3300005544 Bacteria 736
176 Ga0070695_100004089 3300005545 Bacteria 8529
177 Ga0070695_100004677 3300005545 Bacteria 8050
178 Ga0070695_100055080 3300005545 Bacteria 2563
179 Ga0070695_100829084 3300005545 Bacteria 743
180 Ga0070696_100004193 3300005546 Bacteria 9602
181 Ga0070696_100385187 3300005546 Bacteria 1094
182 Ga0070696_100818601 3300005546 Bacteria 767
183 Ga0070696_101276047 3300005546 Bacteria 623
184 Ga0070693_100004943 3300005547 Bacteria 6364
185 Ga0070693_100177847 3300005547 Bacteria 1368
186 Ga0070693_100644696 3300005547 Bacteria 770
187 Ga0070665_100054904 3300005548 Bacteria 3995
188 Ga0070665_100574211 3300005548 Bacteria 1140
189 Ga0070665_100621294 3300005548 Bacteria 1094
190 Ga0070704_100000031 3300005549 Bacteria 45832
191 Ga0070704_100067875 3300005549 Bacteria 2577
192 Ga0068855_100006104 3300005563 Bacteria 14691
193 Ga0068855_100021624 3300005563 Bacteria 7716
194 Ga0068855_100214826 3300005563 Bacteria 2159
195 Ga0070664_100000899 3300005564 Bacteria 23157
196 Ga0070664_100165056 3300005564 Bacteria 1962
197 Ga0070664_100222742 3300005564 Bacteria 1688
198 Ga0070664_100359277 3300005564 Bacteria 1326
199 Ga0070664_100638975 3300005564 Bacteria 989
200 Ga0068857_100000623 3300005577 Bacteria 26056
201 Ga0068857_100056322 3300005577 Bacteria 3489
202 Ga0068857_102169256 3300005577 Bacteria 545
203 Ga0068854_100421682 3300005578 Bacteria 1109
204 Ga0068854_100686888 3300005578 Bacteria 882
205 Ga0068856_100004332 3300005614 Bacteria 14153
206 Ga0068856_100016984 3300005614 Bacteria 7054
207 Ga0068856_100698661 3300005614 Bacteria 1035
208 Ga0070702_100000128 3300005615 Bacteria 23219
209 Ga0068852_100051090 3300005616 Bacteria 3546
210 Ga0068852_100195162 3300005616 Bacteria 1913
211 Ga0068852_100203811 3300005616 Bacteria 1873
212 Ga0068852_100577512 3300005616 Bacteria 1126
213 Ga0068852_101702292 3300005616 Bacteria 653
214 Ga0068859_100001291 3300005617 Bacteria 25582
215 Ga0068859_100019144 3300005617 Bacteria 6875
216 Ga0068859_101156887 3300005617 Bacteria 852
217 Ga0068864_100010716 3300005618 Bacteria 7576
218 Ga0068864_100327381 3300005618 Bacteria 1440
219 Ga0068864_100469223 3300005618 Bacteria 1206
220 Ga0068864_100617004 3300005618 Bacteria 1054
221 Ga0068866_10000346 3300005718 Bacteria 21828
222 Ga0068861_100000045 3300005719 Bacteria 56440
223 Ga0068861_102579018 3300005719 Bacteria 512
224 Ga0068851_10167711 3300005834 Bacteria 1210
225 Ga0068870_10000213 3300005840 Bacteria 20950
226 Ga0068863_100001919 3300005841 Bacteria 20657
227 Ga0068863_101861975 3300005841 Bacteria 611
228 Ga0068858_100000307 3300005842 Bacteria 52034
229 Ga0068858_100083063 3300005842 Bacteria 2978
230 Ga0068858_100437323 3300005842 Bacteria 1259
231 Ga0068858_101129463 3300005842 Bacteria 770
232 Ga0068860_100001587 3300005843 Bacteria 24464
233 Ga0068860_100035732 3300005843 Bacteria 4765
234 Ga0068860_100115847 3300005843 Bacteria 2563
235 Ga0068860_100167288 3300005843 Bacteria 2123
236 Ga0068860_100418637 3300005843 Bacteria 1328
237 Ga0068860_100459616 3300005843 Bacteria 1267
238 Ga0068862_100001373 3300005844 Bacteria 22626
239 Ga0081455_10000036 3300005937 Bacteria 136303
240 Ga0081455_10030438 3300005937 Bacteria 4902
241 Ga0081455_10369011 3300005937 Bacteria 1007
242 Ga0081455_10739402 3300005937 Bacteria 623
243 Ga0081540_1013693 3300005983 Bacteria 5257
244 Ga0081540_1167688 3300005983 Bacteria 842
245 Ga0081539_10002576 3300005985 Bacteria 25031
246 Ga0081539_10015291 3300005985 Bacteria 5588
247 Ga0070717_10433692 3300006028 Bacteria 1183
248 Ga0075365_10009225 3300006038 Bacteria 5659
249 Ga0075368_10247047 3300006042 Bacteria 762
250 Ga0075363_100045621 3300006048 Bacteria 2324
251 Ga0075432_10001113 3300006058 Bacteria 8609
252 Ga0075432_10036353 3300006058 Bacteria 1712
253 Ga0075432_10229341 3300006058 Bacteria 746
254 Ga0070716_100018437 3300006173 Bacteria 3636
255 Ga0070712_100131019 3300006175 Bacteria 1900
256 Ga0070712_100227037 3300006175 Bacteria 1481
257 Ga0070712_100532489 3300006175 Bacteria 988
258 Ga0070712_100829224 3300006175 Bacteria 795
259 Ga0075362_10374700 3300006177 Bacteria 715
260 Ga0075367_10019195 3300006178 Bacteria 3788
261 Ga0075367_10049407 3300006178 Bacteria 2479
262 Ga0075369_10003411 3300006186 Bacteria 5784
263 Ga0075427_10001574 3300006194 Bacteria 2948
264 Ga0097621_100002565 3300006237 Bacteria 12447
265 Ga0097621_100071435 3300006237 Bacteria 2868
266 Ga0097621_100811208 3300006237 Bacteria 867
267 Ga0097621_101263713 3300006237 Bacteria 696
268 Ga0075370_10124671 3300006353 Bacteria 1501
269 Ga0075370_10346860 3300006353 Bacteria 887
270 Ga0068871_100000654 3300006358 Bacteria 23817
271 Ga0068871_100141291 3300006358 Bacteria 2047
272 Ga0068871_100276495 3300006358 Bacteria 1468
273 Ga0075428_100075267 3300006844 Bacteria 3687
274 Ga0075430_100001350 3300006846 Bacteria 19843
275 Ga0075431_100001300 3300006847 Bacteria 22820
276 Ga0075433_10000773 3300006852 Bacteria 22008
277 Ga0075433_10071240 3300006852 Bacteria 3056
278 Ga0075433_10239016 3300006852 Bacteria 1612
279 Ga0075434_100001539 3300006871 Bacteria 19519
280 Ga0075434_100010228 3300006871 Bacteria 8787
281 Ga0075434_100079695 3300006871 Bacteria 3271
282 Ga0075434_100114246 3300006871 Bacteria 2713
283 Ga0075434_100370080 3300006871 Bacteria 1454
284 Ga0075434_100880397 3300006871 Bacteria 911
285 Ga0075429_100002588 3300006880 Bacteria 15248
286 Ga0075429_100828443 3300006880 Bacteria 810
287 Ga0068865_100001596 3300006881 Bacteria 13269
288 Ga0068865_100068331 3300006881 Bacteria 2512
289 Ga0068865_100113507 3300006881 Bacteria 2003
290 Ga0075436_100016509 3300006914 Bacteria 5054
291 Ga0075436_100209846 3300006914 Bacteria 1380
292 Ga0075436_100246702 3300006914 Bacteria 1271
293 Ga0075436_100296034 3300006914 Bacteria 1159
294 Ga0075436_100377500 3300006914 Bacteria 1025
295 Ga0097620_100001291 3300006931 Bacteria 25582
296 Ga0097620_100019143 3300006931 Bacteria 6875
297 Ga0097620_101157029 3300006931 Bacteria 852
298 Ga0075435_100080026 3300007076 Bacteria 2682
299 Ga0075435_100109691 3300007076 Bacteria 2294
300 Ga0075435_100158348 3300007076 Bacteria 1907
301 Ga0075435_100305516 3300007076 Bacteria 1361
302 Ga0105251_10017546 3300009011 Bacteria 3832
303 Ga0105244_10028774 3300009036 Bacteria 2978
304 Ga0105250_10077138 3300009092 Bacteria 1349
305 Ga0105240_10214588 3300009093 Bacteria 2246
306 Ga0105240_10230353 3300009093 Bacteria 2153
307 Ga0105240_11182161 3300009093 Bacteria 811
308 Ga0105240_11503080 3300009093 Bacteria 706
309 Ga0111539_10000591 3300009094 Bacteria 46788
310 Ga0111539_10001213 3300009094 Bacteria 34317
311 Ga0111539_10002431 3300009094 Bacteria 24766
312 Ga0111539_10550666 3300009094 Bacteria 1344
313 Ga0105245_10001033 3300009098 Bacteria 25290
314 Ga0105245_10088321 3300009098 Bacteria 2847
315 Ga0105245_10952132 3300009098 Bacteria 902
316 Ga0105247_10028489 3300009101 Bacteria 3380
317 Ga0105247_10058878 3300009101 Bacteria 2377
318 Ga0105247_10158304 3300009101 Bacteria 1497
319 Ga0105247_10273385 3300009101 Bacteria 1163
320 Ga0105247_10453105 3300009101 Bacteria 925
321 Ga0114129_10002229 3300009147 Bacteria 26735
322 Ga0114129_10012044 3300009147 Bacteria 12301
323 Ga0114129_11098779 3300009147 Bacteria 996
324 Ga0105243_10000678 3300009148 Bacteria 33239
325 Ga0105243_10027310 3300009148 Bacteria 4372
326 Ga0105243_10075091 3300009148 Bacteria 2743
327 Ga0105243_10462052 3300009148 Bacteria 1194
328 Ga0105241_10025430 3300009174 Bacteria 4399
329 Ga0105241_10028187 3300009174 Bacteria 4183
330 Ga0105241_11545427 3300009174 Bacteria 640
331 Ga0105242_10002866 3300009176 Bacteria 13505
332 Ga0105242_10015968 3300009176 Bacteria 5835
333 Ga0105242_10391248 3300009176 Bacteria 1295
334 Ga0105248_10000399 3300009177 Bacteria 50267
335 Ga0105248_10017966 3300009177 Bacteria 7806
336 Ga0105248_10087692 3300009177 Bacteria 3502
337 Ga0105248_10313139 3300009177 Bacteria 1768
338 Ga0105248_10382112 3300009177 Bacteria 1586
339 Ga0105237_10015879 3300009545 Bacteria 7829
340 Ga0105237_10196224 3300009545 Bacteria 2019
341 Ga0105237_10780527 3300009545 Bacteria 962
342 Ga0105238_10045890 3300009551 Bacteria 4413
343 Ga0105238_10154050 3300009551 Bacteria 2273
344 Ga0105249_10000540 3300009553 Bacteria 34962
345 Ga0105249_10003822 3300009553 Bacteria 12997
346 Ga0105249_10344665 3300009553 Bacteria 1508
347 Ga0105249_11062943 3300009553 Bacteria 879
348 Ga0105249_13163810 3300009553 Bacteria 529
349 Ga0105239_10018383 3300010375 Bacteria 7725
350 Ga0105239_10357961 3300010375 Bacteria 1648
351 Ga0105239_10818301 3300010375 Bacteria 1067
352 Ga0105246_10000212 3300011119 Bacteria 29504
353 Ga0105246_10132920 3300011119 Bacteria 1861
354 Ga0105246_10287379 3300011119 Bacteria 1322
355 Ga0105246_10428427 3300011119 Bacteria 1106
356 Ga0105246_11089332 3300011119 Bacteria 729
357 Ga0157315_1000632 3300012508 Bacteria 1685
358 Ga0157316_1010643 3300012510 Bacteria 848
359 Ga0157373_10005412 3300013100 Bacteria 9590
360 Ga0157373_10494482 3300013100 Bacteria 883
361 Ga0157371_10037376 3300013102 Bacteria 3474
362 Ga0157371_10130578 3300013102 Bacteria 1787
363 Ga0157371_10429048 3300013102 Bacteria 970
364 Ga0157371_10713237 3300013102 Bacteria 751
365 Ga0157370_10246943 3300013104 Bacteria 1651
366 Ga0157369_10161484 3300013105 Bacteria 2365
367 Ga0157369_10178812 3300013105 Bacteria 2233
368 Ga0157369_10574372 3300013105 Unclassified 1164
369 Ga0157369_11270972 3300013105 Unclassified 750
370 Ga0157369_11983077 3300013105 Bacteria 591
371 Ga0157374_10001186 3300013296 Bacteria 22265
372 Ga0157374_10016564 3300013296 Bacteria 6482
373 Ga0157374_10629689 3300013296 Bacteria 1084
374 Ga0157378_10013662 3300013297 Bacteria 7100
375 Ga0157378_10086710 3300013297 Bacteria 2838
376 Ga0157378_10188949 3300013297 Bacteria 1942
377 Ga0163162_10000762 3300013306 Bacteria 29970
378 Ga0163162_10242845 3300013306 Bacteria 1932
379 Ga0163162_10618693 3300013306 Bacteria 1208
380 Ga0163162_10800021 3300013306 Bacteria 1060
381 Ga0157372_10006437 3300013307 Bacteria 12502
382 Ga0157372_10910997 3300013307 Bacteria 1020
383 Ga0157372_10990306 3300013307 Bacteria 974
384 Ga0157372_11903094 3300013307 Bacteria 684
385 Ga0157372_11916079 3300013307 Bacteria 681
386 Ga0157375_10000177 3300013308 Bacteria 59436
387 Ga0157375_10391459 3300013308 Bacteria 1556
388 Ga0157375_10483849 3300013308 Bacteria 1403
389 Ga0163163_10001917 3300014325 Bacteria 17610
390 Ga0163163_10004152 3300014325 Bacteria 12341
391 Ga0163163_10235321 3300014325 Bacteria 1881
392 Ga0163163_10313858 3300014325 Bacteria 1621
393 Ga0163163_10328068 3300014325 Bacteria 1584
394 Ga0157380_10003066 3300014326 Bacteria 11383
395 Ga0157380_10086328 3300014326 Bacteria 2578
396 Ga0182008_10053772 3300014497 Bacteria 1993
397 Ga0157377_10000178 3300014745 Bacteria 37090
398 Ga0157379_10000135 3300014968 Bacteria 52814
399 Ga0157379_10030636 3300014968 Bacteria 4791
400 Ga0157379_10087467 3300014968 Bacteria 2794
401 Ga0157379_10104256 3300014968 Bacteria 2545
402 Ga0157379_10161685 3300014968 Bacteria 2021
403 Ga0157376_10001353 3300014969 Bacteria 16134
404 Ga0157376_10173614 3300014969 Bacteria 1965
405 Ga0157376_10233540 3300014969 Bacteria 1710
406 Ga0157376_10282374 3300014969 Bacteria 1564
407 Ga0163161_10000867 3300017792 Bacteria 23543
408 Ga0206356_10003349 3300020070 Bacteria 560
409 Ga0206354_10693229 3300020081 Bacteria 2343
410 Ga0206353_10814796 3300020082 Bacteria 2322
411 Ga0209233_1011403 3300025261 Bacteria 2619
412 Ga0207666_1000021 3300025271 Bacteria 37690
413 Ga0207666_1000444 3300025271 Bacteria 5358
414 Ga0207673_1000845 3300025290 Bacteria 3278
415 Ga0207697_10001014 3300025315 Bacteria 15717
416 Ga0207697_10006655 3300025315 Bacteria 5209
417 Ga0207656_10645211 3300025321 Unclassified 541
418 Ga0207653_10005540 3300025885 Bacteria 3941
419 Ga0207682_10000426 3300025893 Bacteria 19421
420 Ga0207692_10054182 3300025898 Bacteria 2047
421 Ga0207692_10113421 3300025898 Bacteria 1507
422 Ga0207692_10124951 3300025898 Bacteria 1445
423 Ga0207692_10379321 3300025898 Bacteria 877
424 Ga0207642_10001961 3300025899 Bacteria 6349
425 Ga0207710_10015779 3300025900 Bacteria 3194
426 Ga0207688_10000017 3300025901 Bacteria 52729
427 Ga0207688_10555207 3300025901 Bacteria 722
428 Ga0207688_10878994 3300025901 Unclassified 568
429 Ga0207680_10015394 3300025903 Bacteria 3991
430 Ga0207680_10030371 3300025903 Bacteria 3047
431 Ga0207647_10005524 3300025904 Bacteria 9257
432 Ga0207685_10021875 3300025905 Bacteria 2151
433 Ga0207699_10115621 3300025906 Bacteria 1726
434 Ga0207699_10201279 3300025906 Bacteria 1349
435 Ga0207699_10259235 3300025906 Bacteria 1201
436 Ga0207645_10000074 3300025907 Bacteria 71544
437 Ga0207645_10385640 3300025907 Bacteria 941
438 Ga0207643_10000058 3300025908 Bacteria 73498
439 Ga0207643_11064081 3300025908 Bacteria 522
440 Ga0207705_10078348 3300025909 Bacteria 2405
441 Ga0207705_10686069 3300025909 Bacteria 796
442 Ga0207705_11131735 3300025909 Bacteria 602
443 Ga0207654_10020901 3300025911 Bacteria 3475
444 Ga0207654_10073983 3300025911 Bacteria 2032
445 Ga0207654_10122366 3300025911 Bacteria 1636
446 Ga0207707_10007073 3300025912 Bacteria 9781
447 Ga0207707_10139708 3300025912 Bacteria 2118
448 Ga0207707_10161129 3300025912 Bacteria 1961
449 Ga0207707_10164931 3300025912 Bacteria 1936
450 Ga0207695_10057979 3300025913 Bacteria 4021
451 Ga0207695_10100177 3300025913 Bacteria 2894
452 Ga0207671_10544356 3300025914 Bacteria 925
453 Ga0207693_10013942 3300025915 Bacteria 6472
454 Ga0207693_10079128 3300025915 Bacteria 2572
455 Ga0207693_10084244 3300025915 Bacteria 2491
456 Ga0207693_10123787 3300025915 Bacteria 2032
457 Ga0207693_10213470 3300025915 Bacteria 1517
458 Ga0207663_10091487 3300025916 Bacteria 2020
459 Ga0207663_10274104 3300025916 Bacteria 1251
460 Ga0207663_10668812 3300025916 Bacteria 820
461 Ga0207663_10999972 3300025916 Bacteria 671
462 Ga0207660_10000578 3300025917 Bacteria 24655
463 Ga0207660_10159000 3300025917 Bacteria 1742
464 Ga0207660_10177736 3300025917 Bacteria 1651
465 Ga0207660_10258975 3300025917 Bacteria 1375
466 Ga0207660_10477817 3300025917 Bacteria 1010
467 Ga0207660_10788597 3300025917 Bacteria 775
468 Ga0207660_10923668 3300025917 Bacteria 712
469 Ga0207662_10000069 3300025918 Bacteria 45774
470 Ga0207662_10005716 3300025918 Bacteria 6653
471 Ga0207662_10577514 3300025918 Bacteria 780
472 Ga0207657_10000721 3300025919 Bacteria 35100
473 Ga0207657_10086818 3300025919 Bacteria 2618
474 Ga0207657_10145048 3300025919 Bacteria 1937
475 Ga0207657_10548307 3300025919 Bacteria 904
476 Ga0207649_10000282 3300025920 Bacteria 40055
477 Ga0207649_11374825 3300025920 Unclassified 559
478 Ga0207652_10009825 3300025921 Bacteria 7700
479 Ga0207652_10011123 3300025921 Bacteria 7253
480 Ga0207652_10101582 3300025921 Bacteria 2540
481 Ga0207652_10116076 3300025921 Bacteria 2378
482 Ga0207652_10143996 3300025921 Bacteria 2132
483 Ga0207652_10265213 3300025921 Bacteria 1549
484 Ga0207681_10000806 3300025923 Bacteria 20631
485 Ga0207681_10120433 3300025923 Bacteria 1924
486 Ga0207694_10020964 3300025924 Bacteria 4947
487 Ga0207650_10004953 3300025925 Bacteria 9101
488 Ga0207650_10050620 3300025925 Bacteria 3073
489 Ga0207659_10000039 3300025926 Bacteria 91685
490 Ga0207659_11260047 3300025926 Bacteria 635
491 Ga0207687_10008561 3300025927 Bacteria 6691
492 Ga0207687_10018052 3300025927 Bacteria 4654
493 Ga0207700_10002144 3300025928 Bacteria 11295
494 Ga0207700_10084024 3300025928 Bacteria 2494
495 Ga0207700_10114255 3300025928 Bacteria 2178
496 Ga0207700_10179797 3300025928 Bacteria 1770
497 Ga0207700_10501396 3300025928 Bacteria 1074
498 Ga0207700_11163582 3300025928 Bacteria 689
499 Ga0207664_10035588 3300025929 Bacteria 3843
500 Ga0207664_10383031 3300025929 Bacteria 1249
501 Ga0207664_11533242 3300025929 Bacteria 588
502 Ga0207644_10006357 3300025931 Bacteria 7693
503 Ga0207644_10034963 3300025931 Bacteria 3518
504 Ga0207644_10034966 3300025931 Bacteria 3518
505 Ga0207644_10049974 3300025931 Bacteria 2996
506 Ga0207690_10000303 3300025932 Bacteria 34378
507 Ga0207690_10434516 3300025932 Bacteria 1052
508 Ga0207690_11362253 3300025932 Unclassified 593
509 Ga0207706_10002511 3300025933 Bacteria 17885
510 Ga0207706_10036762 3300025933 Bacteria 4350
511 Ga0207706_10115647 3300025933 Bacteria 2359
512 Ga0207686_10000540 3300025934 Bacteria 24486
513 Ga0207709_10000970 3300025935 Bacteria 21414
514 Ga0207709_10098509 3300025935 Bacteria 1928
515 Ga0207709_10357161 3300025935 Bacteria 1105
516 Ga0207709_10418480 3300025935 Bacteria 1029
517 Ga0207670_10000200 3300025936 Bacteria 39476
518 Ga0207669_10000098 3300025937 Bacteria 43800
519 Ga0207669_10017634 3300025937 Bacteria 3669
520 Ga0207669_10178040 3300025937 Bacteria 1521
521 Ga0207669_10222883 3300025937 Bacteria 1385
522 Ga0207704_10004239 3300025938 Bacteria 6553
523 Ga0207704_10053256 3300025938 Bacteria 2459
524 Ga0207704_10088865 3300025938 Bacteria 2023
525 Ga0207665_10000905 3300025939 Bacteria 19985
526 Ga0207665_10140093 3300025939 Bacteria 1724
527 Ga0207691_10000169 3300025940 Bacteria 60909
528 Ga0207711_10003735 3300025941 Bacteria 13126
529 Ga0207711_10050482 3300025941 Bacteria 3561
530 Ga0207711_10055122 3300025941 Bacteria 3413
531 Ga0207711_10613047 3300025941 Bacteria 1015
532 Ga0207689_10000363 3300025942 Bacteria 42824
533 Ga0207689_11044547 3300025942 Bacteria 689
534 Ga0207661_10000700 3300025944 Bacteria 21749
535 Ga0207661_10097304 3300025944 Bacteria 2464
536 Ga0207679_10000030 3300025945 Bacteria 169351
537 Ga0207679_10136920 3300025945 Bacteria 1973
538 Ga0207679_10390036 3300025945 Unclassified 1223
539 Ga0207679_10530522 3300025945 Bacteria 1054
540 Ga0207679_11020508 3300025945 Unclassified 758
541 Ga0207667_10011075 3300025949 Bacteria 10502
542 Ga0207667_10043831 3300025949 Bacteria 4746
543 Ga0207667_10073699 3300025949 Bacteria 3547
544 Ga0207667_10091638 3300025949 Bacteria 3139
545 Ga0207667_10138054 3300025949 Bacteria 2510
546 Ga0207651_10000593 3300025960 Bacteria 15254
547 Ga0207651_10222784 3300025960 Bacteria 1526
548 Ga0207651_10608887 3300025960 Bacteria 955
549 Ga0207712_10000473 3300025961 Bacteria 33877
550 Ga0207712_10044542 3300025961 Bacteria 3067
551 Ga0207712_10117637 3300025961 Bacteria 2005
552 Ga0207712_10756154 3300025961 Bacteria 852
553 Ga0207668_10000220 3300025972 Bacteria 38677
554 Ga0207640_10000379 3300025981 Bacteria 28614
555 Ga0207640_10138435 3300025981 Bacteria 1771
556 Ga0207658_10001133 3300025986 Bacteria 21430
557 Ga0207658_11807562 3300025986 Bacteria 557
558 Ga0207677_10000513 3300026023 Bacteria 24963
559 Ga0207677_10320898 3300026023 Bacteria 1287
560 Ga0207703_10001263 3300026035 Bacteria 23607
561 Ga0207703_10020402 3300026035 Bacteria 5182
562 Ga0207703_10175358 3300026035 Bacteria 1889
563 Ga0207703_10205576 3300026035 Bacteria 1752
564 Ga0207703_10265310 3300026035 Bacteria 1553
565 Ga0207703_10421520 3300026035 Bacteria 1242
566 Ga0207639_10015014 3300026041 Bacteria 5456
567 Ga0207639_10369678 3300026041 Bacteria 1285
568 Ga0207639_10959702 3300026041 Bacteria 800
569 Ga0207678_10003592 3300026067 Bacteria 13936
570 Ga0207678_10075348 3300026067 Bacteria 2890
571 Ga0207678_10096163 3300026067 Bacteria 2531
572 Ga0207678_10197474 3300026067 Bacteria 1720
573 Ga0207678_10280170 3300026067 Bacteria 1431
574 Ga0207678_11369783 3300026067 Bacteria 626
575 Ga0207708_10000428 3300026075 Bacteria 32826
576 Ga0207708_10003371 3300026075 Bacteria 11782
577 Ga0207708_10035252 3300026075 Bacteria 3808
578 Ga0207708_10973385 3300026075 Unclassified 736
579 Ga0207702_10004376 3300026078 Bacteria 12586
580 Ga0207702_10047246 3300026078 Bacteria 3627
581 Ga0207702_10233945 3300026078 Bacteria 1718
582 Ga0207702_11670249 3300026078 Unclassified 630
583 Ga0207641_10001143 3300026088 Bacteria 26654
584 Ga0207641_10087284 3300026088 Bacteria 2721
585 Ga0207648_10000272 3300026089 Bacteria 56105
586 Ga0207648_10095794 3300026089 Bacteria 2597
587 Ga0207648_10386872 3300026089 Bacteria 1265
588 Ga0207676_10009286 3300026095 Bacteria 6996
589 Ga0207676_10349154 3300026095 Bacteria 1367
590 Ga0207676_10369255 3300026095 Bacteria 1332
591 Ga0207674_10000135 3300026116 Bacteria 85071
592 Ga0207674_11862281 3300026116 Bacteria 568
593 Ga0207675_100000245 3300026118 Bacteria 51737
594 Ga0207683_10000136 3300026121 Bacteria 60910
595 Ga0207683_10372807 3300026121 Bacteria 1311
596 Ga0207698_10000828 3300026142 Bacteria 17909
597 Ga0207698_10230967 3300026142 Bacteria 1679
598 Ga0207698_10409684 3300026142 Bacteria 1298
599 Ga0207698_10844193 3300026142 Bacteria 921
600 Ga0209973_1006195 3300027252 Bacteria 1297
601 Ga0209969_1061002 3300027360 Bacteria 596
602 Ga0209996_1007399 3300027395 Bacteria 1428
603 Ga0209968_1043865 3300027526 Bacteria 768
604 Ga0209999_1015941 3300027543 Bacteria 1367
605 Ga0209970_1006005 3300027614 Bacteria 1992
606 Ga0210002_1004082 3300027617 Bacteria 2167
607 Ga0209983_1013802 3300027665 Bacteria 1662
608 Ga0209971_1026726 3300027682 Bacteria 1379
609 Ga0209966_1006735 3300027695 Bacteria 2000
610 Ga0209966_1017712 3300027695 Bacteria 1360
611 Ga0209998_10006808 3300027717 Bacteria 2371
612 Ga0209813_10222301 3300027866 Bacteria 707
613 Ga0209974_10015919 3300027876 Bacteria 2497
614 Ga0207428_10000249 3300027907 Bacteria 73253
615 Ga0207428_10000471 3300027907 Bacteria 48541
616 Ga0207428_10002287 3300027907 Bacteria 19233
617 Ga0207428_10644545 3300027907 Unclassified 761
618 Ga0268266_10452289 3300028379 Bacteria 1221
619 Ga0268266_10738673 3300028379 Bacteria 949
620 Ga0268265_10001888 3300028380 Bacteria 16660
621 Ga0268264_10000693 3300028381 Bacteria 39190
622 Ga0268264_10161724 3300028381 Bacteria 2018
623 Ga0268264_10681003 3300028381 Bacteria 1020
624 Ga0268264_11421126 3300028381 Bacteria 704
625 Ga0268264_11810990 3300028381 Bacteria 621
626 Ga0265337_1156957 3300028556 Bacteria 617
627 Ga0265318_10184582 3300028577 Bacteria 763
628 Ga0265338_10314185 3300028800 Bacteria 1136
629 Ga0265338_10480238 3300028800 Bacteria 877
630 Ga0265338_10500418 3300028800 Bacteria 855
631 Ga0265330_10034754 3300031235 Bacteria 2250
632 Ga0265332_10012678 3300031238 Bacteria 3738
633 Ga0265332_10044370 3300031238 Bacteria 1918
634 Ga0265332_10166816 3300031238 Bacteria 919
635 Ga0265332_10283369 3300031238 Unclassified 685
636 Ga0265328_10046186 3300031239 Bacteria 1601
637 Ga0265320_10064698 3300031240 Bacteria 1736
638 Ga0265325_10000055 3300031241 Bacteria 77409
639 Ga0265325_10009247 3300031241 Bacteria 5761
640 Ga0265325_10044077 3300031241 Bacteria 2325
641 Ga0265325_10087695 3300031241 Bacteria 1538
642 Ga0265325_10127687 3300031241 Bacteria 1220
643 Ga0265329_10009220 3300031242 Bacteria 3694
644 Ga0265340_10009447 3300031247 Bacteria 5232
645 Ga0265340_10036372 3300031247 Bacteria 2440
646 Ga0265340_10164003 3300031247 Bacteria 1009
647 Ga0265339_10002510 3300031249 Bacteria 13106
648 Ga0265339_10008094 3300031249 Bacteria 6719
649 Ga0265339_10102961 3300031249 Bacteria 1484
650 Ga0265339_10274411 3300031249 Bacteria 810
651 Ga0265339_10475157 3300031249 Bacteria 579
652 Ga0265331_10024615 3300031250 Bacteria 3044
653 Ga0265331_10052122 3300031250 Bacteria 1956
654 Ga0265316_10021951 3300031344 Bacteria 5394
655 Ga0265316_10029105 3300031344 Bacteria 4547
656 Ga0307408_100086205 3300031548 Bacteria 2360
657 Ga0265313_10007379 3300031595 Bacteria 7533
658 Ga0265313_10008657 3300031595 Bacteria 6729
659 Ga0265313_10022395 3300031595 Bacteria 3428
660 Ga0316575_10112747 3300031665 Bacteria 1110
661 Ga0316575_10121640 3300031665 Bacteria 1068
662 Ga0316579_10097583 3300031691 Bacteria 1406
663 Ga0265314_10002433 3300031711 Bacteria 19086
664 Ga0265314_10003272 3300031711 Bacteria 15830
665 Ga0265314_10152456 3300031711 Bacteria 1415
666 Ga0265342_10000100 3300031712 Bacteria 94554
667 Ga0265342_10000760 3300031712 Bacteria 32963
668 Ga0265342_10011993 3300031712 Bacteria 5888
669 Ga0265342_10053265 3300031712 Bacteria 2408
670 Ga0307405_10219875 3300031731 Bacteria 1393
671 Ga0307413_10533738 3300031824 Bacteria 948
672 Ga0307413_12017283 3300031824 Bacteria 520
673 Ga0307406_11760322 3300031901 Bacteria 550
674 Ga0307409_100170433 3300031995 Bacteria 1915
675 Ga0307411_10106315 3300032005 Bacteria 1997
676 Ga0307415_102076388 3300032126 Bacteria 554
677 Ga0316583_10001350 3300032133 Bacteria 8126
678 Ga0373930_0000940 3300034816 Bacteria 4167
679 Ga0373930_0004040 3300034816 Bacteria 2365
680 Ga0373930_0060393 3300034816 Unclassified 844
681 Ga0373948_0000536 3300034817 Bacteria 4771
682 Ga0373948_0134631 3300034817 Bacteria 607
683 Ga0373950_0001447 3300034818 Bacteria 3107
684 Ga0373950_0005561 3300034818 Bacteria 1888
685 Ga0373958_0000870 3300034819 Bacteria 3881
686 Ga0373958_0002779 3300034819 Bacteria 2482
687 Ga0373959_0001430 3300034820 Bacteria 3814
688 Ga0373959_0016991 3300034820 Bacteria 1354
689 Ga0373938_0000293 3300034957 Bacteria 8061
690 Ga0373938_0061213 3300034957 Bacteria 881
691 Ga0373926_0077596 3300035083 Bacteria 1225
692 Ga0373928_0037557 3300035084 Bacteria 1099
693 Ga0373929_0001712 3300035085 Bacteria 4123
694 Ga0373929_0001899 3300035085 Bacteria 3915
695 Ga0373934_0025591 3300035086 Bacteria 2287
696 Ga0373940_0008719 3300035088 Bacteria 2338
697 Ga0373940_0029033 3300035088 Bacteria 1463
698 Ga0373940_0079432 3300035088 Bacteria 967
699 Ga0373944_0025385 3300035089 Bacteria 1743
700 Ga0373944_0045119 3300035089 Bacteria 1374
701 Ga0373949_0000797 3300035090 Bacteria 10077
702 Ga0373949_0002468 3300035090 Bacteria 4745
703 Ga0373949_0068148 3300035090 Bacteria 927
704 Ga0373951_0012685 3300035091 Bacteria 1894
705 Ga0373952_0007256 3300035092 Bacteria 2071
706 Ga0373952_0026490 3300035092 Bacteria 1260
707 Ga0373923_0011716 3300035111 Bacteria 3227
708 Ga0373923_0015860 3300035111 Bacteria 2851
709 Ga0373932_0001341 3300035112 Bacteria 6886
710 Ga0373932_0001774 3300035112 Bacteria 5812
711 Ga0373932_0023817 3300035112 Bacteria 1642
712 Ga0373936_0005884 3300035113 Bacteria 4616
713 Ga0373936_0039644 3300035113 Bacteria 1885
714 Ga0373939_0005695 3300035114 Bacteria 2970
715 Ga0373939_0008647 3300035114 Bacteria 2501
716 Ga0373939_0016869 3300035114 Bacteria 1931
717 Ga0373939_0376558 3300035114 Bacteria 583
718 Ga0373941_0000410 3300035115 Bacteria 8486
719 Ga0373941_0133631 3300035115 Bacteria 896
720 Ga0373945_0017444 3300035116 Bacteria 2431
721 Ga0373953_0057174 3300035117 Bacteria 1588
722 Ga0373953_0332158 3300035117 Bacteria 665
723 Ga0373954_0012230 3300035118 Bacteria 3816
724 Ga0373954_0046542 3300035118 Bacteria 2028
725 Ga0373954_0151141 3300035118 Bacteria 1134
726 Ga0373956_0178031 3300035119 Bacteria 1005
727 Ga0373956_0417073 3300035119 Bacteria 641
728 Ga0373960_0001361 3300035121 Bacteria 5390
729 Ga0373943_0001756 3300035170 Bacteria 9811
730 Ga0373943_0018728 3300035170 Bacteria 3182
731 Ga0373943_0179633 3300035170 Bacteria 1162
732 Ga0373946_0068622 3300035171 Bacteria 1525
733 Ga0373946_0154967 3300035171 Bacteria 1071
734 Ga0373946_0178767 3300035171 Bacteria 1006
735 Ga0373946_0270679 3300035171 Bacteria 833
736 Ga0373955_0010447 3300035172 Bacteria 4386
737 Ga0373955_0016087 3300035172 Bacteria 3676
738 Ga0373955_0019549 3300035172 Bacteria 3388
739 Ga0373955_0135867 3300035172 Bacteria 1438
740 Ga0373955_0334504 3300035172 Bacteria 916
741 Ga0373955_0750873 3300035172 Bacteria 599
742 Ga0373942_0006328 3300035207 Bacteria 2735
743 Ga0373961_0004108 3300035241 Bacteria 3540
744 Ga0373961_0005274 3300035241 Bacteria 3109
745 Ga0373962_0003406 3300035242 Bacteria 3822
746 Ga0373962_0005753 3300035242 Bacteria 2993
747 Ga0373962_0027678 3300035242 Bacteria 1534
748 Ga0373962_0296490 3300035242 Bacteria 573
749 Ga0373962_0383716 3300035242 Unclassified 514
750 Ga0373924_0020653 3300035410 Bacteria 2562
751 Ga0373924_0234712 3300035410 Bacteria 811
752 Ga0373924_0479461 3300035410 Bacteria 558
753 Ga0373931_0000853 3300035691 Bacteria 12846
754 Ga0373931_0010380 3300035691 Bacteria 4475
755 Ga0373931_0066193 3300035691 Bacteria 1960
756 Ga0373931_0071581 3300035691 Bacteria 1894
757 Ga0373931_0171350 3300035691 Bacteria 1279
758 Ga0373935_0011348 3300035692 Bacteria 5350
759 Ga0373935_0021300 3300035692 Bacteria 3967
760 Ga0373935_0054419 3300035692 Bacteria 2548
761 Ga0373935_0166496 3300035692 Bacteria 1505
762 Ga0373935_0268586 3300035692 Bacteria 1198
763 Ga0373935_0302696 3300035692 Bacteria 1130
764 Ga0373927_0042609 3300035695 Bacteria 2941
765 Ga0373927_0048857 3300035695 Bacteria 2736
766 Ga0373933_0007033 3300035724 Bacteria 6133
767 Ga0373933_0027449 3300035724 Bacteria 3278
768 Ga0373933_0027713 3300035724 Bacteria 3265
769 Ga0373947_0043464 3300035725 Bacteria 2684
770 Ga0373947_0241315 3300035725 Bacteria 1192
771 Ga0373947_0402488 3300035725 Bacteria 923
772 Ga0373937_0010852 3300036401 Bacteria 7974
773 Ga0373937_0095541 3300036401 Bacteria 2756
774 Ga0373937_0135019 3300036401 Bacteria 2306
775 Ga0373937_1288524 3300036401 Unclassified 679
776 Ga0373925_0012204 3300037068 Bacteria 6218
777 Ga0373925_0049123 3300037068 Bacteria 3144
778 Ga0373925_0079963 3300037068 Bacteria 2484
779 Ga0373925_0498873 3300037068 Bacteria 999
780 Ga0395899_0051228 3300037312 Bacteria 3064
781 Ga0395900_0010327 3300037418 Bacteria 9553
782 Ga0395900_0043459 3300037418 Bacteria 4631
783 Ga0395900_0387634 3300037418 Bacteria 1364
784 Ga0395900_0526432 3300037418 Bacteria 1129
785 Ga0395898_0002494 3300037466 Bacteria 21650
786 Ga0395898_0003815 3300037466 Bacteria 16691
787 Ga0395898_0304507 3300037466 Bacteria 1520
788 Ga0395898_0377021 3300037466 Bacteria 1353
789 Ga0436364_0165904 3300037853 Bacteria 8751
790 Ga0395901_0018402 3300038443 Bacteria 7130
791 Ga0395901_0025517 3300038443 Bacteria 6068
792 Ga0395901_0202740 3300038443 Bacteria 2079
793 Ga0395901_0237239 3300038443 Bacteria 1903
794 Ga0395901_0971502 3300038443 Bacteria 827
795 Ga0395901_1025629 3300038443 Bacteria 799
796 Ga0242419_018407 3300038698 Bacteria 574
797 Ga0242420_009830 3300038996 Bacteria 1578
798 Ga0436365_0286964 3300039437 Bacteria 64806
799 Ga0436365_0526917 3300039437 Bacteria 756
800 Ga0436365_1049521 3300039437 Bacteria 1437
801 Ga0436365_1087662 3300039437 Bacteria 20046
802 Ga0436365_1220299 3300039437 Bacteria 1996
803 Ga0436360_0529845 3300039438 Bacteria 1032
804 Ga0436361_0361045 3300039447 Bacteria 2837
805 Ga0436362_0888596 3300039453 Bacteria 1618
806 Ga0439465_0163510 3300041413 Bacteria 799
807 Ga0439450_012559 3300042008 Bacteria 1683
808 Ga0439464_0005686 3300042439 Bacteria 3231
809 Ga0439460_0026965 3300042461 Bacteria 1611
810 Ga0451577_1970918 3300042876 Bacteria 511
811 Ga0439440_0027245 3300042993 Bacteria 1327
812 Ga0466965_0101696 3300044683 Bacteria 1470
813 Ga0466966_0066734 3300044684 Bacteria 2261
814 Ga0466963_0045141 3300044694 Bacteria 2902
815 Ga0466963_0580176 3300044694 Bacteria 792
816 Ga0466963_0815059 3300044694 Bacteria 658
817 Ga0466963_0877065 3300044694 Bacteria 632
818 Ga0453684_2258685 3300044712 Bacteria 542
819 Ga0466971_0348406 3300044719 Bacteria 716
820 Ga0466957_0055366 3300044842 Bacteria 2424
821 Ga0466957_0163849 3300044842 Bacteria 1445
822 Ga0466957_0620959 3300044842 Bacteria 758
823 Ga0466957_0691794 3300044842 Bacteria 719
824 Ga0466960_0123051 3300044901 Bacteria 1361
825 Ga0466959_1181814 3300045049 Bacteria 508
826 Ga0451576_0035228 3300045051 Bacteria 5312
827 Ga0466958_0030567 3300045836 Bacteria 3200
828 Ga0466958_0131965 3300045836 Bacteria 1569
829 Ga0466958_0467783 3300045836 Bacteria 817
830 Ga0466967_0003577 3300045976 Bacteria 10195
831 Ga0466967_1229181 3300045976 Bacteria 746
832 Ga0495617_016986 3300046452 Bacteria 2459
833 Ga0495592_0007525 3300046454 Bacteria 8154
834 Ga0495592_0010371 3300046454 Bacteria 7028
835 Ga0495592_0119940 3300046454 Bacteria 1851
836 Ga0495603_0007148 3300046455 Bacteria 6703
837 Ga0495603_0044070 3300046455 Bacteria 2662
838 Ga0495603_0077397 3300046455 Bacteria 1951
839 Ga0495590_0114198 3300046457 Bacteria 965
840 Ga0495629_0001477 3300046459 Bacteria 18546
841 Ga0495629_0350234 3300046459 Bacteria 1007
842 Ga0495629_0377067 3300046459 Bacteria 965
843 Ga0495629_0561460 3300046459 Unclassified 765
844 Ga0495638_0050928 3300046460 Bacteria 2585
845 Ga0495638_0654827 3300046460 Bacteria 510
846 Ga0495641_0039881 3300046461 Bacteria 2186
847 Ga0495641_0167335 3300046461 Bacteria 983
848 Ga0495651_0001224 3300046462 Bacteria 19839
849 Ga0495651_0005238 3300046462 Bacteria 9883
850 Ga0495651_0021305 3300046462 Bacteria 5038
851 Ga0495653_0022871 3300046463 Bacteria 5055
852 Ga0495653_0042382 3300046463 Bacteria 3545
853 Ga0495653_0083798 3300046463 Bacteria 2350
854 Ga0495653_0172473 3300046463 Bacteria 1492
855 Ga0495653_0464076 3300046463 Bacteria 794
856 Ga0495580_0017328 3300046472 Bacteria 5388
857 Ga0495580_0223459 3300046472 Bacteria 1294
858 Ga0495582_0006537 3300046473 Bacteria 6470
859 Ga0495582_0659262 3300046473 Bacteria 605
860 Ga0495582_0702959 3300046473 Unclassified 585
861 Ga0495605_0255393 3300046474 Bacteria 749
862 Ga0495639_0027411 3300046475 Bacteria 2521
863 Ga0495639_0046153 3300046475 Bacteria 1972
864 Ga0495662_0048387 3300046476 Bacteria 2052
865 Ga0495662_0050106 3300046476 Bacteria 2015
866 Ga0495664_0004186 3300046477 Bacteria 7881
867 Ga0495664_0101750 3300046477 Bacteria 1731
868 Ga0495664_0106162 3300046477 Bacteria 1693
869 Ga0495584_0024671 3300046491 Bacteria 3049
870 Ga0495584_0349846 3300046491 Bacteria 750
871 Ga0495585_0001120 3300046492 Bacteria 21980
872 Ga0495594_0026443 3300046499 Bacteria 3122
873 Ga0495594_0043621 3300046499 Bacteria 2458
874 Ga0495607_0009551 3300046501 Bacteria 6555
875 Ga0495583_0202343 3300046506 Bacteria 806
876 Ga0495608_0000894 3300046511 Bacteria 20903
877 Ga0495616_0137912 3300046513 Bacteria 1113
878 Ga0495618_0007468 3300046514 Bacteria 6611
879 Ga0495618_0016463 3300046514 Bacteria 4523
880 Ga0495618_0216138 3300046514 Bacteria 1210
881 Ga0495628_0001643 3300046516 Bacteria 20468
882 Ga0495628_0005224 3300046516 Bacteria 11396
883 Ga0495628_0079867 3300046516 Bacteria 2543
884 Ga0495628_0316951 3300046516 Bacteria 1151
885 Ga0495630_0090226 3300046517 Bacteria 2315
886 Ga0495630_0265767 3300046517 Bacteria 1310
887 Ga0495631_0461178 3300046518 Bacteria 541
888 Ga0495637_0247086 3300046520 Bacteria 643
889 Ga0495644_0000276 3300046523 Bacteria 23546
890 Ga0495663_0003625 3300046525 Bacteria 4425
891 Ga0495666_0030261 3300046526 Bacteria 2658
892 Ga0495666_0071263 3300046526 Bacteria 1652
893 Ga0495652_0005225 3300046529 Bacteria 12267
894 Ga0495652_0013895 3300046529 Bacteria 7241
895 Ga0495652_0054951 3300046529 Bacteria 3388
896 Ga0495652_0182600 3300046529 Bacteria 1608
897 Ga0495652_0256266 3300046529 Bacteria 1294
898 Ga0495665_0005432 3300046531 Bacteria 6867
899 Ga0495665_0108659 3300046531 Bacteria 1455
900 Ga0495640_0009470 3300046533 Bacteria 7588
901 Ga0495640_0188521 3300046533 Bacteria 1312
902 Ga0495640_0190803 3300046533 Bacteria 1302
903 Ga0495640_0301469 3300046533 Bacteria 995
904 Ga0495640_0313416 3300046533 Bacteria 972
905 Ga0495586_0034648 3300046535 Bacteria 2712
906 Ga0495587_0002982 3300046536 Bacteria 11315
907 Ga0495587_0019533 3300046536 Bacteria 4191
908 Ga0495587_0020752 3300046536 Bacteria 4053
909 Ga0495598_0010089 3300046537 Bacteria 2253
910 Ga0495645_0007183 3300046543 Bacteria 7750
911 Ga0495645_0051654 3300046543 Bacteria 2991
912 Ga0495622_0012450 3300046557 Bacteria 3938
913 Ga0495622_0037807 3300046557 Bacteria 2248
914 Ga0495633_0006390 3300046558 Bacteria 6994
915 Ga0495667_0006825 3300046559 Bacteria 7750
916 Ga0495667_0020138 3300046559 Bacteria 4499
917 Ga0495667_0050526 3300046559 Bacteria 2744
918 Ga0495656_0000754 3300046615 Bacteria 10446
919 Ga0495634_0112115 3300046642 Bacteria 1753
920 Ga0495634_0204657 3300046642 Bacteria 1224
921 Ga0495634_0218569 3300046642 Unclassified 1177
922 Ga0495611_0003788 3300046648 Bacteria 6602
923 Ga0495635_0026238 3300046663 Bacteria 4056
924 Ga0495635_0044778 3300046663 Bacteria 3052
925 Ga0495635_0100441 3300046663 Bacteria 1977
926 Ga0495635_0121067 3300046663 Bacteria 1785
927 Ga0495635_0123809 3300046663 Bacteria 1763
928 Ga0495659_0000313 3300046664 Bacteria 19327
929 Ga0495588_0081088 3300046674 Bacteria 1693
930 Ga0495657_0007186 3300046675 Bacteria 8637
931 Ga0495657_0504829 3300046675 Bacteria 705
932 Ga0495657_0623366 3300046675 Bacteria 623
933 Ga0495599_0003276 3300046678 Bacteria 9434
934 Ga0495599_0095990 3300046678 Bacteria 1849
935 Ga0495623_0004045 3300046679 Bacteria 9654
936 Ga0495623_0010576 3300046679 Bacteria 5971
937 Ga0495646_0002740 3300046680 Bacteria 10888
938 Ga0495646_0010561 3300046680 Bacteria 5866
939 Ga0495646_0113630 3300046680 Bacteria 1539
940 Ga0495647_0032878 3300046681 Bacteria 1935
941 Ga0495647_0043528 3300046681 Bacteria 1718
942 Ga0495647_0057038 3300046681 Bacteria 1532
943 Ga0495658_0001518 3300046683 Bacteria 12169
944 Ga0495658_0010651 3300046683 Bacteria 4602
945 Ga0495658_0052367 3300046683 Bacteria 2315
946 Ga0495658_0211672 3300046683 Bacteria 1211
947 Ga0495658_0472600 3300046683 Bacteria 801
948 Ga0495669_0174490 3300046684 Bacteria 1023
949 Ga0495613_0192980 3300046689 Bacteria 1439
950 Ga0495613_0634045 3300046689 Bacteria 708
951 Ga0495624_0196456 3300046690 Bacteria 1226
952 Ga0495624_0422902 3300046690 Bacteria 799
953 Ga0495670_0000678 3300046691 Bacteria 16157
954 Ga0495589_0147333 3300046794 Bacteria 1125
955 Ga0495600_0015965 3300046809 Bacteria 4758
956 Ga0495600_0021509 3300046809 Bacteria 4132
957 Ga0495600_0037916 3300046809 Bacteria 3135
958 Ga0495581_0005389 3300047315 Bacteria 7399
959 Ga0495581_0054350 3300047315 Bacteria 2312
960 Ga0495581_0337183 3300047315 Bacteria 880
961 Ga0495604_0005224 3300047317 Bacteria 10283
962 Ga0495604_0020077 3300047317 Bacteria 5340
963 Ga0495604_0036373 3300047317 Bacteria 3882
964 Ga0495604_0046839 3300047317 Bacteria 3370
965 Ga0495674_0065440 3300047319 Bacteria 3157
966 Ga0495674_0074183 3300047319 Bacteria 2931
967 Ga0495674_0131245 3300047319 Bacteria 2111
968 Ga0495674_0203312 3300047319 Bacteria 1642
969 Ga0495674_0266832 3300047319 Bacteria 1405
970 Ga0495676_0084467 3300047321 Bacteria 2395
971 Ga0495676_0094678 3300047321 Bacteria 2224
972 Ga0495676_0453639 3300047321 Bacteria 845
973 Ga0495680_0010223 3300047322 Bacteria 8378
974 Ga0495680_0012624 3300047322 Bacteria 7422
975 Ga0495680_0030552 3300047322 Bacteria 4398
976 Ga0495680_0098448 3300047322 Bacteria 2182
977 Ga0495675_0001149 3300047444 Bacteria 16078
978 Ga0495675_0780306 3300047444 Bacteria 530
979 Ga0495677_0057187 3300047445 Bacteria 1441
980 Ga0495679_020206 3300047446 Bacteria 2323
981 Ga0495684_0003052 3300047471 Bacteria 13171
982 Ga0495684_0107074 3300047471 Bacteria 2112
983 Ga0495684_0129052 3300047471 Bacteria 1900
984 Ga0495593_0025793 3300047673 Bacteria 3252
985 Ga0495593_0259740 3300047673 Bacteria 869
986 Ga0495602_0009459 3300048088 Bacteria 10135
987 Ga0495602_0019879 3300048088 Bacteria 6652
988 Ga0495602_0882401 3300048088 Bacteria 596
989 Ga0495614_0027957 3300048089 Bacteria 2431
990 Ga0495614_0061537 3300048089 Bacteria 1613
991 Ga0495614_0494616 3300048089 Unclassified 582
992 Ga0496100_0003970 3300048903 Bacteria 7776
993 Ga0496100_0164294 3300048903 Bacteria 1593
994 Ga0496100_0610600 3300048903 Unclassified 847
995 Ga0496101_0001569 3300048904 Bacteria 13711
996 Ga0496101_0020202 3300048904 Bacteria 4554
997 Ga0496101_0050260 3300048904 Bacteria 3000
998 Ga0496101_0250973 3300048904 Bacteria 1378
999 Ga0496101_0642548 3300048904 Bacteria 838
1000 Ga0496102_0004673 3300048905 Bacteria 11584
1001 Ga0496102_0018222 3300048905 Bacteria 6164
1002 Ga0496102_0081843 3300048905 Bacteria 2977
1003 Ga0496102_0113730 3300048905 Bacteria 2525
1004 Ga0496102_0414458 3300048905 Bacteria 1265
1005 Ga0496102_0938567 3300048905 Unclassified 786
1006 Ga0496103_0000430 3300048906 Bacteria 36512
1007 Ga0496103_0008308 3300048906 Bacteria 6166
1008 Ga0496103_0039270 3300048906 Bacteria 2908
1009 Ga0496103_0045716 3300048906 Bacteria 2701
1010 Ga0496103_0115786 3300048906 Bacteria 1705
1011 Ga0496103_0120597 3300048906 Bacteria 1670
1012 Ga0496104_0000090 3300048907 Bacteria 87877
1013 Ga0496104_0130526 3300048907 Bacteria 2413
1014 Ga0496104_0167267 3300048907 Bacteria 2108
1015 Ga0496104_0208475 3300048907 Bacteria 1866
1016 Ga0496104_0306891 3300048907 Bacteria 1499
1017 Ga0496104_0433438 3300048907 Bacteria 1226
1018 Ga0496105_0036668 3300048908 Bacteria 4040
1019 Ga0496105_0064401 3300048908 Bacteria 3025
1020 Ga0496105_0066007 3300048908 Bacteria 2986
1021 Ga0496105_0171353 3300048908 Bacteria 1779
1022 Ga0496105_0278071 3300048908 Bacteria 1350
1023 Ga0496105_0392059 3300048908 Bacteria 1103
1024 Ga0496106_0003028 3300048909 Bacteria 12522
1025 Ga0496106_0007444 3300048909 Bacteria 8090
1026 Ga0496106_0018178 3300048909 Bacteria 5199
1027 Ga0496106_0065164 3300048909 Bacteria 2773
1028 Ga0496106_0092461 3300048909 Bacteria 2336
1029 Ga0496106_0248627 3300048909 Bacteria 1421
1030 Ga0496107_0001324 3300048910 Bacteria 15192
1031 Ga0496107_0011160 3300048910 Bacteria 6253
1032 Ga0496107_0011716 3300048910 Bacteria 6115
1033 Ga0496107_0755280 3300048910 Unclassified 713
1034 Ga0496108_0003835 3300048911 Bacteria 12056
1035 Ga0496108_0103714 3300048911 Bacteria 2426
1036 Ga0496108_0146984 3300048911 Bacteria 2032
1037 Ga0496108_0173049 3300048911 Bacteria 1868
1038 Ga0496109_0000338 3300048912 Bacteria 43692
1039 Ga0496109_0211106 3300048912 Bacteria 1826
1040 Ga0496109_0265648 3300048912 Bacteria 1616
1041 Ga0496109_0407527 3300048912 Bacteria 1284
1042 Ga0496109_0769848 3300048912 Bacteria 900
1043 Ga0496110_0055234 3300048913 Bacteria 3494
1044 Ga0496110_0063385 3300048913 Bacteria 3266
1045 Ga0496110_0099831 3300048913 Bacteria 2602
1046 Ga0496110_0134508 3300048913 Bacteria 2234
1047 Ga0496110_0330086 3300048913 Bacteria 1389
1048 Ga0496110_0334522 3300048913 Bacteria 1379
1049 Ga0496110_0334533 3300048913 Bacteria 1379
1050 Ga0496111_0012615 3300048914 Bacteria 5725
1051 Ga0496111_0066000 3300048914 Bacteria 2627
1052 Ga0496111_0397003 3300048914 Bacteria 1019
1053 Ga0496111_0524722 3300048914 Bacteria 870
1054 Ga0496111_0709182 3300048914 Bacteria 731
1055 Ga0496112_0005440 3300048915 Bacteria 11016
1056 Ga0496112_0069073 3300048915 Bacteria 3490
1057 Ga0496112_0069190 3300048915 Bacteria 3487
1058 Ga0496112_0096794 3300048915 Bacteria 2922
1059 Ga0496112_0111044 3300048915 Bacteria 2711
1060 Ga0496112_0117700 3300048915 Bacteria 2627
1061 Ga0496112_0426531 3300048915 Bacteria 1264
1062 Ga0496112_0999933 3300048915 Bacteria 756
1063 Ga0496113_0010323 3300048916 Bacteria 6171
1064 Ga0496113_0131711 3300048916 Bacteria 1963
1065 Ga0496113_0262535 3300048916 Bacteria 1379
1066 Ga0496113_0383164 3300048916 Bacteria 1128
1067 Ga0496114_0005514 3300048917 Bacteria 9912
1068 Ga0496114_0009307 3300048917 Bacteria 7796
1069 Ga0496115_0004496 3300048918 Bacteria 10090
1070 Ga0496115_0036924 3300048918 Bacteria 3869
1071 Ga0496115_0045977 3300048918 Bacteria 3486
1072 Ga0496115_0087837 3300048918 Bacteria 2537
1073 Ga0496115_0100371 3300048918 Bacteria 2372
1074 Ga0496115_0129008 3300048918 Bacteria 2083
1075 Ga0496115_0423279 3300048918 Bacteria 1079
1076 Ga0496115_0465645 3300048918 Bacteria 1019
1077 Ga0496117_0192034 3300048920 Bacteria 1162
1078 Ga0496118_0287560 3300048921 Bacteria 911
1079 Ga0496125_0656793 3300048928 Bacteria 563
1080 Ga0496126_0553084 3300048929 Bacteria 913
1081 Ga0496126_0640667 3300048929 Bacteria 833
1082 Ga0501031_0213486 3300049568 Bacteria 1257
1083 Ga0501032_0239703 3300049569 Bacteria 1178
1084 Ga0501033_0481433 3300049570 Bacteria 860
1085 Ga0501034_0029113 3300049571 Bacteria 5615
1086 Ga0501034_0473555 3300049571 Bacteria 1168
1087 Ga0501037_0619680 3300049573 Bacteria 725
1088 Ga0501038_0017167 3300049574 Bacteria 6544
1089 Ga0501039_0481395 3300049575 Bacteria 975
1090 Ga0501039_1369715 3300049575 Unclassified 545
1091 Ga0501040_0242180 3300049576 Bacteria 1286
1092 Ga0501043_0916399 3300049579 Bacteria 628
1093 Ga0501046_0661581 3300049580 Bacteria 738
1094 Ga0501047_0035044 3300049581 Bacteria 4847
1095 Ga0501047_0085402 3300049581 Bacteria 3032
1096 Ga0501047_0309500 3300049581 Bacteria 1420
1097 Ga0501048_0451129 3300049582 Bacteria 921
1098 Ga0501069_0248163 3300049585 Bacteria 1038
1099 Ga0501069_0419835 3300049585 Bacteria 793
1100 Ga0501070_0015452 3300049586 Bacteria 6423
1101 Ga0501070_0086824 3300049586 Bacteria 2590
1102 Ga0501071_1261250 3300049587 Bacteria 571
1103 Ga0501072_0037872 3300049588 Bacteria 3783
1104 Ga0501072_0548700 3300049588 Bacteria 913
1105 Ga0501073_0013366 3300049589 Bacteria 5976
1106 Ga0501074_0179347 3300049590 Bacteria 1511
1107 Ga0501074_0294528 3300049590 Bacteria 1153
1108 Ga0501074_0674977 3300049590 Bacteria 730
1109 Ga0501077_0061042 3300049593 Bacteria 2392
1110 Ga0501225_0220064 3300049705 Bacteria 611
1111 Ga0501079_1623864 3300049741 Bacteria 508
1112 Ga0501081_0418876 3300049743 Bacteria 993
1113 Ga0501083_0113453 3300049744 Bacteria 1780
1114 Ga0501083_0154700 3300049744 Bacteria 1501
1115 Ga0501083_0760287 3300049744 Bacteria 630
1116 Ga0501270_088430 3300049767 Bacteria 628
1117 Ga0501044_0158608 3300049823 Bacteria 2241
1118 Ga0501044_0367280 3300049823 Bacteria 1356
1119 Ga0501044_0623399 3300049823 Bacteria 970
1120 Ga0501044_0761432 3300049823 Bacteria 850
1121 Ga0501044_0846455 3300049823 Bacteria 792
1122 Ga0501045_0564976 3300049824 Bacteria 843
1123 Ga0501212_098559 3300049851 Bacteria 547
1124 nmdc:mga03683_663126_c1 3300050489 Bacteria 514
1125 nmdc:mga03n38_227168_c1 3300050490 Bacteria 977
1126 nmdc:mga03n38_679272_c1 3300050490 Unclassified 592
1127 nmdc:mga00v17_114829_c1 3300050491 Bacteria 1711
1128 nmdc:mga00v17_75166_c1 3300050491 Bacteria 2100
1129 nmdc:mga00v17_785071_c1 3300050491 Bacteria 607
1130 nmdc:mga0yw44_44376_c1 3300050492 Bacteria 2659
1131 nmdc:mga06z11_15118_c1 3300050494 Bacteria 3437
1132 nmdc:mga06z11_277840_c1 3300050494 Bacteria 992
1133 nmdc:mga07m45_195205_c1 3300050496 Bacteria 1177
1134 nmdc:mga07m45_601319_c1 3300050496 Bacteria 635
1135 nmdc:mga05p37_1602_c1 3300050507 Bacteria 26254
1136 nmdc:mga09592_7132_c1 3300050508 Bacteria 9086
1137 nmdc:mga0qj67_556_c1 3300050509 Bacteria 25387
1138 nmdc:mga06r32_8190_c1 3300050510 Bacteria 9408
1139 nmdc:mga08y16_2018_c1 3300050511 Bacteria 20760
1140 nmdc:mga08y16_4650_c1 3300050511 Bacteria 14290
1141 nmdc:mga08y16_659742_c1 3300050511 Bacteria 1049
1142 nmdc:mga08y16_66505_c1 3300050511 Bacteria 3762
1143 nmdc:mga0n895_1478_c1 3300050512 Bacteria 17626
1144 nmdc:mga0n895_389772_c1 3300050512 Bacteria 1409
1145 nmdc:mga0n895_45434_c1 3300050512 Bacteria 4286
1146 nmdc:mga0n895_51021_c1 3300050512 Bacteria 4058
1147 nmdc:mga0n895_543_c1 3300050512 Bacteria 25826
1148 nmdc:mga0n895_673468_c1 3300050512 Bacteria 1032
1149 nmdc:mga0rr50_21800_c1 3300050513 Bacteria 4382
1150 nmdc:mga0rr50_30768_c1 3300050513 Bacteria 1970
1151 nmdc:mga0rr50_812_c1 3300050513 Bacteria 16808
1152 nmdc:mga08x19_10925_c1 3300050514 Bacteria 5461
1153 nmdc:mga08x19_281324_c1 3300050514 Bacteria 1153
1154 nmdc:mga0a205_22992_c1 3300050515 Bacteria 5911
1155 nmdc:mga0a205_416_c1 3300050515 Bacteria 32776
1156 nmdc:mga0a205_80693_c1 3300050515 Bacteria 3143
1157 nmdc:mga0sz30_105526_c1 3300050516 Bacteria 1233
1158 Ga0495601_0000421 3300053077 Bacteria 22215
1159 Ga0495601_0000432 3300053077 Bacteria 21914
1160 Ga0495601_0002128 3300053077 Bacteria 11136
1161 Ga0495601_0003953 3300053077 Bacteria 8536
1162 Ga0495601_0319739 3300053077 Bacteria 1010
1163 Ga0495601_0559152 3300053077 Unclassified 736
1164 Ga0495601_0581046 3300053077 Bacteria 720
1165 Ga0495612_0000870 3300053078 Bacteria 12306
1166 Ga0495612_0003173 3300053078 Bacteria 6811
1167 Ga0495612_0005259 3300053078 Bacteria 5346
1168 Ga0495612_0026808 3300053078 Bacteria 2315
1169 Ga0495612_0204412 3300053078 Bacteria 872
1170 Ga0495595_0001669 3300053084 Bacteria 8687
1171 Ga0495595_0033305 3300053084 Bacteria 2324
1172 Ga0495595_0035941 3300053084 Bacteria 2246
1173 Ga0495595_0069696 3300053084 Bacteria 1660
1174 Ga0495595_0252704 3300053084 Bacteria 883
1175 Ga0495619_0000290 3300053085 Bacteria 35735
1176 Ga0495619_0000646 3300053085 Bacteria 22914
1177 Ga0495619_0001716 3300053085 Bacteria 14533
1178 Ga0495619_0009254 3300053085 Bacteria 6224
1179 Ga0495619_0026265 3300053085 Bacteria 3745
1180 Ga0495619_0035384 3300053085 Bacteria 3247
1181 Ga0495619_0053709 3300053085 Bacteria 2666
1182 Ga0500643_005975 3300053087 Bacteria 5156
1183 Ga0500644_0001048 3300053088 Bacteria 8242
1184 Ga0500651_0001317 3300053093 Bacteria 12398
1185 Ga0500566_0225643 3300053094 Bacteria 928
1186 Ga0500641_0015143 3300053096 Bacteria 2856
1187 Ga0500650_0456857 3300053098 Bacteria 547
1188 Ga0500595_000207 3300053119 Bacteria 39920
1189 Ga0500595_008759 3300053119 Bacteria 4115
1190 Ga0500642_0086259 3300053130 Bacteria 1447
1191 Ga0500652_000015 3300053131 Bacteria 131012
1192 Ga0500652_101713 3300053131 Bacteria 1201
1193 Ga0500568_0014119 3300053139 Bacteria 3618
1194 Ga0500616_0000006 3300053153 Bacteria 944738
1195 Ga0500657_073848 3300053728 Bacteria 1485
1196 Ga0500645_000809 3300053730 Bacteria 18764
1197 Ga0501084_0039406 3300054114 Bacteria 3952
1198 Ga0501084_0357365 3300054114 Bacteria 1234
1199 Ga0501084_0937779 3300054114 Bacteria 728
1200 Ga0501082_0005955 3300060353 Bacteria 10578
1201 Ga0501082_0038197 3300060353 Bacteria 4142
1202 Ga0501082_0040568 3300060353 Bacteria 4014
1203 Ga0501082_0377372 3300060353 Bacteria 1237
1204 Ga0466962_0238867 3300061719 Bacteria 892

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0242180 Ga0501040_0242180_280_633 117
2 3300049582 Ga0501048_0451129 Ga0501048_0451129_44_397 117
3 3300054114 Ga0501084_0937779 Ga0501084_0937779_299_652 117
4 3300039437 Ga0436365_1087662 Ga0436365_1087662_8419_8808 122
5 3300039453 Ga0436362_0888596 Ga0436362_0888596_1050_1439 122
6 3300005436 Ga0070713_100087473 Ga0070713_1000874731 123
7 3300005548 Ga0070665_100621294 Ga0070665_1006212942 123
8 3300005577 Ga0068857_102169256 Ga0068857_1021692561 123
9 3300005983 Ga0081540_1167688 Ga0081540_11676881 123
10 3300006038 Ga0075365_10009225 Ga0075365_100092253 123
11 3300006042 Ga0075368_10247047 Ga0075368_102470472 123
12 3300006048 Ga0075363_100045621 Ga0075363_1000456213 123
13 3300006175 Ga0070712_100227037 Ga0070712_1002270372 123
14 3300006177 Ga0075362_10374700 Ga0075362_103747002 123
15 3300006178 Ga0075367_10049407 Ga0075367_100494073 123
16 3300006186 Ga0075369_10003411 Ga0075369_100034117 123
17 3300006353 Ga0075370_10124671 Ga0075370_101246712 123
18 3300006358 Ga0068871_100276495 Ga0068871_1002764951 123
19 3300011119 Ga0105246_10428427 Ga0105246_104284272 123
20 3300014969 Ga0157376_10282374 Ga0157376_102823742 123
21 3300025915 Ga0207693_10123787 Ga0207693_101237873 123
22 3300025928 Ga0207700_10084024 Ga0207700_100840242 123
23 3300025928 Ga0207700_10179797 Ga0207700_101797973 123
24 3300026116 Ga0207674_11862281 Ga0207674_118622812 123
25 3300027866 Ga0209813_10222301 Ga0209813_102223012 123
26 3300028379 Ga0268266_10452289 Ga0268266_104522892 123
27 3300028381 Ga0268264_11810990 Ga0268264_118109902 123
28 3300031238 Ga0265332_10012678 Ga0265332_100126784 123
29 3300031247 Ga0265340_10009447 Ga0265340_100094475 123
30 3300031249 Ga0265339_10002510 Ga0265339_100025102 123
31 3300031250 Ga0265331_10052122 Ga0265331_100521222 123
32 3300031712 Ga0265342_10000100 Ga0265342_1000010081 123
33 3300036401 Ga0373937_1288524 Ga0373937_1288524_42_413 123
34 3300039437 Ga0436365_1049521 Ga0436365_1049521_464_835 123
35 3300039438 Ga0436360_0529845 Ga0436360_0529845_74_448 123
36 3300039447 Ga0436361_0361045 Ga0436361_0361045_658_1035 123
37 3300044712 Ga0453684_2258685 Ga0453684_2258685_70_447 123
38 3300050489 nmdc:mga03683_663126_c1 nmdc:mga03683_663126_c1_127_501 123
39 3300050490 nmdc:mga03n38_227168_c1 nmdc:mga03n38_227168_c1_200_574 123
40 3300050491 nmdc:mga00v17_114829_c1 nmdc:mga00v17_114829_c1_270_644 123
41 3300050491 nmdc:mga00v17_785071_c1 nmdc:mga00v17_785071_c1_32_406 123
42 3300050492 nmdc:mga0yw44_44376_c1 nmdc:mga0yw44_44376_c1_1030_1404 123
43 3300050494 nmdc:mga06z11_277840_c1 nmdc:mga06z11_277840_c1_555_929 123
44 3300050516 nmdc:mga0sz30_105526_c1 nmdc:mga0sz30_105526_c1_463_837 123
45 3300053077 Ga0495601_0581046 Ga0495601_0581046_205_585 123
46 3300053119 Ga0500595_008759 Ga0500595_008759_1024_1413 123
47 3300053131 Ga0500652_000015 Ga0500652_000015_95954_96343 123
48 iso_pu_bacteria 2775506901 2776259674 123
49 iso_pu_bacteria 2894232714 2894239712 123
50 3300003203 JGI25406J46586_10011553 JGI25406J46586_100115535 124
51 3300003203 JGI25406J46586_10174127 JGI25406J46586_101741271 124
52 3300005327 Ga0070658_10102385 Ga0070658_101023853 124
53 3300005329 Ga0070683_100159387 Ga0070683_1001593872 124
54 3300005336 Ga0070680_100015774 Ga0070680_1000157746 124
55 3300005336 Ga0070680_100248420 Ga0070680_1002484202 124
56 3300005458 Ga0070681_10787947 Ga0070681_107879472 124
57 3300005530 Ga0070679_100226048 Ga0070679_1002260482 124
58 3300005530 Ga0070679_100526863 Ga0070679_1005268632 124
59 3300005578 Ga0068854_100421682 Ga0068854_1004216822 124
60 3300005616 Ga0068852_101702292 Ga0068852_1017022921 124
61 3300005985 Ga0081539_10002576 Ga0081539_100025762 124
62 3300005985 Ga0081539_10015291 Ga0081539_100152912 124
63 3300009093 Ga0105240_10230353 Ga0105240_102303532 124
64 3300013102 Ga0157371_10130578 Ga0157371_101305781 124
65 3300013104 Ga0157370_10246943 Ga0157370_102469432 124
66 3300013105 Ga0157369_10161484 Ga0157369_101614843 124
67 3300020070 Ga0206356_10003349 Ga0206356_100033491 124
68 3300020081 Ga0206354_10693229 Ga0206354_106932293 124
69 3300020082 Ga0206353_10814796 Ga0206353_108147963 124
70 3300025909 Ga0207705_11131735 Ga0207705_111317352 124
71 3300025912 Ga0207707_10164931 Ga0207707_101649312 124
72 3300025913 Ga0207695_10100177 Ga0207695_101001772 124
73 3300025917 Ga0207660_10177736 Ga0207660_101777362 124
74 3300025917 Ga0207660_10788597 Ga0207660_107885972 124
75 3300025919 Ga0207657_10548307 Ga0207657_105483072 124
76 3300025921 Ga0207652_10116076 Ga0207652_101160763 124
77 3300025949 Ga0207667_10091638 Ga0207667_100916383 124
78 3300025981 Ga0207640_10138435 Ga0207640_101384352 124
79 3300026078 Ga0207702_10233945 Ga0207702_102339452 124
80 3300026142 Ga0207698_10844193 Ga0207698_108441932 124
81 3300035114 Ga0373939_0016869 Ga0373939_0016869_724_1104 124
82 3300039437 Ga0436365_0526917 Ga0436365_0526917_215_589 124
83 3300049823 Ga0501044_0846455 Ga0501044_0846455_147_521 124
84 3300060353 Ga0501082_0040568 Ga0501082_0040568_1763_2137 124
85 3300005327 Ga0070658_10228080 Ga0070658_102280802 125
86 3300005327 Ga0070658_10635426 Ga0070658_106354262 125
87 3300005329 Ga0070683_100822410 Ga0070683_1008224102 125
88 3300005344 Ga0070661_101872066 Ga0070661_1018720661 125
89 3300005439 Ga0070711_100434713 Ga0070711_1004347132 125
90 3300005530 Ga0070679_100377845 Ga0070679_1003778452 125
91 3300005530 Ga0070679_101023342 Ga0070679_1010233422 125
92 3300005535 Ga0070684_100553191 Ga0070684_1005531912 125
93 3300005563 Ga0068855_100021624 Ga0068855_1000216243 125
94 3300005563 Ga0068855_100214826 Ga0068855_1002148263 125
95 3300005577 Ga0068857_100056322 Ga0068857_1000563222 125
96 3300005614 Ga0068856_100016984 Ga0068856_1000169843 125
97 3300005616 Ga0068852_100195162 Ga0068852_1001951623 125
98 3300005616 Ga0068852_100577512 Ga0068852_1005775122 125
99 3300009093 Ga0105240_11503080 Ga0105240_115030801 125
100 3300013102 Ga0157371_10713237 Ga0157371_107132372 125
101 3300013105 Ga0157369_10178812 Ga0157369_101788123 125
102 3300013105 Ga0157369_11983077 Ga0157369_119830772 125
103 3300013307 Ga0157372_11903094 Ga0157372_119030942 125
104 3300013307 Ga0157372_11916079 Ga0157372_119160791 125
105 3300025909 Ga0207705_10078348 Ga0207705_100783482 125
106 3300025909 Ga0207705_10686069 Ga0207705_106860692 125
107 3300025921 Ga0207652_10143996 Ga0207652_101439962 125
108 3300025929 Ga0207664_11533242 Ga0207664_115332421 125
109 3300025949 Ga0207667_10138054 Ga0207667_101380543 125
110 3300026078 Ga0207702_10047246 Ga0207702_100472464 125
111 3300026142 Ga0207698_10230967 Ga0207698_102309672 125
112 3300028800 Ga0265338_10314185 Ga0265338_103141852 125
113 3300031241 Ga0265325_10127687 Ga0265325_101276872 125
114 3300031247 Ga0265340_10164003 Ga0265340_101640032 125
115 3300031249 Ga0265339_10102961 Ga0265339_101029611 125
116 3300031344 Ga0265316_10029105 Ga0265316_100291053 125
117 3300048920 Ga0496117_0192034 Ga0496117_0192034_487_867 125
118 3300048921 Ga0496118_0287560 Ga0496118_0287560_316_696 125
119 3300048929 Ga0496126_0553084 Ga0496126_0553084_28_414 125
120 3300048929 Ga0496126_0640667 Ga0496126_0640667_100_486 125
121 3300049588 Ga0501072_0037872 Ga0501072_0037872_2963_3340 125
122 3300053098 Ga0500650_0456857 Ga0500650_0456857_153_536 125
123 3300054114 Ga0501084_0039406 Ga0501084_0039406_1213_1590 125
124 iso_pu_bacteria 2643221547 2643756491 125
125 3300005329 Ga0070683_101972020 Ga0070683_1019720201 126
126 3300005336 Ga0070680_100639722 Ga0070680_1006397222 126
127 3300005435 Ga0070714_100070353 Ga0070714_1000703533 126
128 3300005439 Ga0070711_101731074 Ga0070711_1017310741 126
129 3300005614 Ga0068856_100698661 Ga0068856_1006986612 126
130 3300014497 Ga0182008_10053772 Ga0182008_100537723 126
131 3300025916 Ga0207663_10999972 Ga0207663_109999722 126
132 3300025917 Ga0207660_10477817 Ga0207660_104778172 126
133 3300025929 Ga0207664_10035588 Ga0207664_100355882 126
134 3300028800 Ga0265338_10480238 Ga0265338_104802382 126
135 3300031241 Ga0265325_10087695 Ga0265325_100876953 126
136 3300035171 Ga0373946_0178767 Ga0373946_0178767_510_893 126
137 3300037312 Ga0395899_0051228 Ga0395899_0051228_1667_2053 126
138 3300037418 Ga0395900_0010327 Ga0395900_0010327_1490_1876 126
139 3300037418 Ga0395900_0043459 Ga0395900_0043459_3830_4216 126
140 3300037418 Ga0395900_0387634 Ga0395900_0387634_260_646 126
141 3300037418 Ga0395900_0526432 Ga0395900_0526432_631_1017 126
142 3300037466 Ga0395898_0002494 Ga0395898_0002494_13305_13691 126
143 3300037466 Ga0395898_0003815 Ga0395898_0003815_9335_9721 126
144 3300037466 Ga0395898_0304507 Ga0395898_0304507_671_1057 126
145 3300037466 Ga0395898_0377021 Ga0395898_0377021_468_854 126
146 3300038443 Ga0395901_0018402 Ga0395901_0018402_3524_3910 126
147 3300038443 Ga0395901_0025517 Ga0395901_0025517_5199_5585 126
148 3300038443 Ga0395901_0202740 Ga0395901_0202740_1645_2031 126
149 3300038443 Ga0395901_0971502 Ga0395901_0971502_181_567 126
150 3300038443 Ga0395901_1025629 Ga0395901_1025629_260_646 126
151 3300039437 Ga0436365_1220299 Ga0436365_1220299_840_1223 126
152 3300044684 Ga0466966_0066734 Ga0466966_0066734_823_1209 126
153 3300044694 Ga0466963_0045141 Ga0466963_0045141_1293_1679 126
154 3300044694 Ga0466963_0815059 Ga0466963_0815059_248_628 126
155 3300044694 Ga0466963_0877065 Ga0466963_0877065_114_500 126
156 3300044719 Ga0466971_0348406 Ga0466971_0348406_160_546 126
157 3300044842 Ga0466957_0055366 Ga0466957_0055366_1847_2233 126
158 3300044842 Ga0466957_0163849 Ga0466957_0163849_23_409 126
159 3300044842 Ga0466957_0620959 Ga0466957_0620959_91_477 126
160 3300045049 Ga0466959_1181814 Ga0466959_1181814_112_498 126
161 3300045836 Ga0466958_0030567 Ga0466958_0030567_160_546 126
162 3300045836 Ga0466958_0131965 Ga0466958_0131965_199_585 126
163 3300045976 Ga0466967_0003577 Ga0466967_0003577_4608_4994 126
164 3300045976 Ga0466967_1229181 Ga0466967_1229181_303_689 126
165 3300053084 Ga0495595_0035941 Ga0495595_0035941_1672_2058 126
166 3300053085 Ga0495619_0053709 Ga0495619_0053709_1919_2305 126
167 3300061719 Ga0466962_0238867 Ga0466962_0238867_310_696 126
168 3300005366 Ga0070659_100684418 Ga0070659_1006844182 127
169 3300005457 Ga0070662_101167975 Ga0070662_1011679751 127
170 3300006175 Ga0070712_100532489 Ga0070712_1005324892 127
171 3300009148 Ga0105243_10075091 Ga0105243_100750913 127
172 3300009553 Ga0105249_11062943 Ga0105249_110629432 127
173 3300009553 Ga0105249_13163810 Ga0105249_131638101 127
174 3300011119 Ga0105246_11089332 Ga0105246_110893322 127
175 3300014326 Ga0157380_10086328 Ga0157380_100863282 127
176 3300025935 Ga0207709_10357161 Ga0207709_103571611 127
177 3300025961 Ga0207712_10756154 Ga0207712_107561542 127
178 3300028577 Ga0265318_10184582 Ga0265318_101845822 127
179 3300031238 Ga0265332_10166816 Ga0265332_101668162 127
180 3300031239 Ga0265328_10046186 Ga0265328_100461862 127
181 3300031240 Ga0265320_10064698 Ga0265320_100646982 127
182 3300031241 Ga0265325_10009247 Ga0265325_100092473 127
183 3300031242 Ga0265329_10009220 Ga0265329_100092203 127
184 3300031247 Ga0265340_10036372 Ga0265340_100363723 127
185 3300031249 Ga0265339_10274411 Ga0265339_102744112 127
186 3300031250 Ga0265331_10024615 Ga0265331_100246153 127
187 3300031344 Ga0265316_10021951 Ga0265316_100219515 127
188 3300031548 Ga0307408_100086205 Ga0307408_1000862052 127
189 3300031595 Ga0265313_10007379 Ga0265313_100073796 127
190 3300031711 Ga0265314_10002433 Ga0265314_1000243312 127
191 3300031711 Ga0265314_10003272 Ga0265314_100032725 127
192 3300031711 Ga0265314_10152456 Ga0265314_101524562 127
193 3300031712 Ga0265342_10053265 Ga0265342_100532653 127
194 3300031731 Ga0307405_10219875 Ga0307405_102198751 127
195 3300031824 Ga0307413_10533738 Ga0307413_105337382 127
196 3300031824 Ga0307413_12017283 Ga0307413_120172832 127
197 3300031901 Ga0307406_11760322 Ga0307406_117603221 127
198 3300031995 Ga0307409_100170433 Ga0307409_1001704333 127
199 3300032005 Ga0307411_10106315 Ga0307411_101063153 127
200 3300032126 Ga0307415_102076388 Ga0307415_1020763882 127
201 3300035114 Ga0373939_0376558 Ga0373939_0376558_85_471 127
202 3300037853 Ga0436364_0165904 Ga0436364_0165904_5890_6276 127
203 3300038443 Ga0395901_0237239 Ga0395901_0237239_49_432 127
204 3300039437 Ga0436365_0286964 Ga0436365_0286964_19879_20265 127
205 3300041413 Ga0439465_0163510 Ga0439465_0163510_115_501 127
206 3300044683 Ga0466965_0101696 Ga0466965_0101696_188_574 127
207 3300044694 Ga0466963_0580176 Ga0466963_0580176_378_767 127
208 3300044842 Ga0466957_0691794 Ga0466957_0691794_213_596 127
209 3300044901 Ga0466960_0123051 Ga0466960_0123051_282_668 127
210 3300049568 Ga0501031_0213486 Ga0501031_0213486_716_1099 127
211 3300049569 Ga0501032_0239703 Ga0501032_0239703_205_588 127
212 3300049570 Ga0501033_0481433 Ga0501033_0481433_414_797 127
213 3300049571 Ga0501034_0029113 Ga0501034_0029113_1737_2120 127
214 3300049571 Ga0501034_0473555 Ga0501034_0473555_590_973 127
215 3300049573 Ga0501037_0619680 Ga0501037_0619680_198_581 127
216 3300049574 Ga0501038_0017167 Ga0501038_0017167_329_712 127
217 3300049579 Ga0501043_0916399 Ga0501043_0916399_149_532 127
218 3300049581 Ga0501047_0035044 Ga0501047_0035044_1877_2260 127
219 3300049585 Ga0501069_0248163 Ga0501069_0248163_366_749 127
220 3300049586 Ga0501070_0086824 Ga0501070_0086824_1609_1992 127
221 3300049588 Ga0501072_0548700 Ga0501072_0548700_210_593 127
222 3300049589 Ga0501073_0013366 Ga0501073_0013366_1838_2221 127
223 3300049590 Ga0501074_0179347 Ga0501074_0179347_552_935 127
224 3300049705 Ga0501225_0220064 Ga0501225_0220064_131_517 127
225 3300049744 Ga0501083_0113453 Ga0501083_0113453_862_1245 127
226 3300049744 Ga0501083_0760287 Ga0501083_0760287_62_448 127
227 3300049767 Ga0501270_088430 Ga0501270_088430_48_434 127
228 3300049823 Ga0501044_0367280 Ga0501044_0367280_719_1102 127
229 3300049851 Ga0501212_098559 Ga0501212_098559_92_478 127
230 3300053139 Ga0500568_0014119 Ga0500568_0014119_769_1155 127
231 3300054114 Ga0501084_0357365 Ga0501084_0357365_280_663 127
232 3300060353 Ga0501082_0038197 Ga0501082_0038197_2321_2704 127
233 3300060353 Ga0501082_0377372 Ga0501082_0377372_683_1069 127
234 3300031665 Ga0316575_10121640 Ga0316575_101216401 128
235 3300031691 Ga0316579_10097583 Ga0316579_100975832 128
236 3300034818 Ga0373950_0005561 Ga0373950_0005561_398_784 128
237 3300035172 Ga0373955_0135867 Ga0373955_0135867_479_865 128
238 3300035172 Ga0373955_0750873 Ga0373955_0750873_76_462 128
239 3300035242 Ga0373962_0383716 Ga0373962_0383716_52_438 128
240 3300035692 Ga0373935_0268586 Ga0373935_0268586_142_528 128
241 3300036401 Ga0373937_0095541 Ga0373937_0095541_834_1220 128
242 3300046459 Ga0495629_0561460 Ga0495629_0561460_354_740 128
243 3300046463 Ga0495653_0172473 Ga0495653_0172473_16_402 128
244 3300046473 Ga0495582_0702959 Ga0495582_0702959_57_443 128
245 3300046516 Ga0495628_0316951 Ga0495628_0316951_755_1141 128
246 3300046529 Ga0495652_0256266 Ga0495652_0256266_824_1210 128
247 3300046533 Ga0495640_0188521 Ga0495640_0188521_911_1297 128
248 3300046642 Ga0495634_0218569 Ga0495634_0218569_28_414 128
249 3300046663 Ga0495635_0123809 Ga0495635_0123809_1225_1611 128
250 3300046678 Ga0495599_0095990 Ga0495599_0095990_521_907 128
251 3300046683 Ga0495658_0052367 Ga0495658_0052367_98_484 128
252 3300046809 Ga0495600_0037916 Ga0495600_0037916_1006_1392 128
253 3300047317 Ga0495604_0046839 Ga0495604_0046839_500_886 128
254 3300047319 Ga0495674_0074183 Ga0495674_0074183_1269_1655 128
255 3300047471 Ga0495684_0107074 Ga0495684_0107074_1059_1445 128
256 3300049575 Ga0501039_1369715 Ga0501039_1369715_87_479 128
257 3300049744 Ga0501083_0154700 Ga0501083_0154700_1029_1415 128
258 3300050491 nmdc:mga00v17_75166_c1 nmdc:mga00v17_75166_c1_1676_2065 128
259 3300053077 Ga0495601_0000421 Ga0495601_0000421_7557_7943 128
260 3300053077 Ga0495601_0559152 Ga0495601_0559152_13_399 128
261 3300053078 Ga0495612_0204412 Ga0495612_0204412_299_685 128
262 3300053084 Ga0495595_0033305 Ga0495595_0033305_626_1012 128
263 3300053085 Ga0495619_0000290 Ga0495619_0000290_707_1093 128
264 3300053096 Ga0500641_0015143 Ga0500641_0015143_1166_1552 128
265 2209111006 2214800771 2213830235 129
266 3300000042 ARSoilYngRDRAFT_c00311 ARSoilYngRDRAFT_003117 129
267 3300000043 ARcpr5yngRDRAFT_c000325 ARcpr5yngRDRAFT_0003253 129
268 3300000044 ARSoilOldRDRAFT_c000035 ARSoilOldRDRAFT_00003529 129
269 3300000652 ARCol0yngRDRAFT_1000039 ARCol0yngRDRAFT_10000393 129
270 3300001904 JGI24736J21556_1011646 JGI24736J21556_10116462 129
271 3300001977 JGI24746J21847_1001683 JGI24746J21847_10016833 129
272 3300001978 JGI24747J21853_1000078 JGI24747J21853_10000783 129
273 3300001989 JGI24739J22299_10003335 JGI24739J22299_100033356 129
274 3300001990 JGI24737J22298_10000091 JGI24737J22298_100000913 129
275 3300001990 JGI24737J22298_10002689 JGI24737J22298_100026892 129
276 3300001991 JGI24743J22301_10000116 JGI24743J22301_100001164 129
277 3300002067 JGI24735J21928_10070098 JGI24735J21928_100700982 129
278 3300002070 JGI24750J21931_1000403 JGI24750J21931_100040310 129
279 3300002073 JGI24745J21846_1000016 JGI24745J21846_10000167 129
280 3300002074 JGI24748J21848_1003441 JGI24748J21848_10034412 129
281 3300002075 JGI24738J21930_10000701 JGI24738J21930_1000070110 129
282 3300002076 JGI24749J21850_1000112 JGI24749J21850_100011218 129
283 3300002077 JGI24744J21845_10004766 JGI24744J21845_100047663 129
284 3300002126 JGI24035J26624_1000063 JGI24035J26624_10000634 129
285 3300002239 JGI24034J26672_10000333 JGI24034J26672_100003333 129
286 3300002244 JGI24742J22300_10000372 JGI24742J22300_100003723 129
287 3300003911 JGI25405J52794_10006686 JGI25405J52794_100066862 129
288 3300003911 JGI25405J52794_10009062 JGI25405J52794_100090622 129
289 3300005277 Ga0065716_1002818 Ga0065716_10028182 129
290 3300005290 Ga0065712_10078281 Ga0065712_100782814 129
291 3300005293 Ga0065715_10000516 Ga0065715_1000051612 129
292 3300005293 Ga0065715_10089753 Ga0065715_100897536 129
293 3300005295 Ga0065707_10097659 Ga0065707_100976593 129
294 3300005295 Ga0065707_10145456 Ga0065707_101454563 129
295 3300005295 Ga0065707_10684514 Ga0065707_106845141 129
296 3300005327 Ga0070658_10237134 Ga0070658_102371342 129
297 3300005328 Ga0070676_10000364 Ga0070676_1000036415 129
298 3300005328 Ga0070676_10195938 Ga0070676_101959382 129
299 3300005329 Ga0070683_100000748 Ga0070683_10000074824 129
300 3300005329 Ga0070683_100249305 Ga0070683_1002493052 129
301 3300005330 Ga0070690_100002562 Ga0070690_1000025623 129
302 3300005330 Ga0070690_100017617 Ga0070690_1000176173 129
303 3300005330 Ga0070690_100166028 Ga0070690_1001660282 129
304 3300005331 Ga0070670_100011248 Ga0070670_10001124810 129
305 3300005331 Ga0070670_100142125 Ga0070670_1001421252 129
306 3300005333 Ga0070677_10000228 Ga0070677_100002289 129
307 3300005334 Ga0068869_100016306 Ga0068869_1000163065 129
308 3300005335 Ga0070666_10032523 Ga0070666_100325232 129
309 3300005335 Ga0070666_10129985 Ga0070666_101299852 129
310 3300005336 Ga0070680_100006466 Ga0070680_1000064662 129
311 3300005336 Ga0070680_100010322 Ga0070680_1000103226 129
312 3300005336 Ga0070680_100026684 Ga0070680_1000266845 129
313 3300005336 Ga0070680_100186584 Ga0070680_1001865843 129
314 3300005337 Ga0070682_100001379 Ga0070682_10000137912 129
315 3300005337 Ga0070682_100121886 Ga0070682_1001218862 129
316 3300005337 Ga0070682_100155975 Ga0070682_1001559753 129
317 3300005338 Ga0068868_100001339 Ga0068868_10000133910 129
318 3300005339 Ga0070660_100001616 Ga0070660_10000161614 129
319 3300005339 Ga0070660_100065012 Ga0070660_1000650123 129
320 3300005339 Ga0070660_101008387 Ga0070660_1010083871 129
321 3300005340 Ga0070689_100000146 Ga0070689_10000014613 129
322 3300005341 Ga0070691_10000065 Ga0070691_100000659 129
323 3300005341 Ga0070691_10037556 Ga0070691_100375562 129
324 3300005343 Ga0070687_100000023 Ga0070687_10000002341 129
325 3300005343 Ga0070687_100498358 Ga0070687_1004983582 129
326 3300005344 Ga0070661_100000407 Ga0070661_10000040716 129
327 3300005344 Ga0070661_100409923 Ga0070661_1004099232 129
328 3300005345 Ga0070692_10000270 Ga0070692_100002706 129
329 3300005347 Ga0070668_100011009 Ga0070668_1000110096 129
330 3300005347 Ga0070668_100228949 Ga0070668_1002289493 129
331 3300005347 Ga0070668_100727666 Ga0070668_1007276662 129
332 3300005347 Ga0070668_100832818 Ga0070668_1008328182 129
333 3300005353 Ga0070669_100004155 Ga0070669_1000041558 129
334 3300005353 Ga0070669_100041857 Ga0070669_1000418572 129
335 3300005354 Ga0070675_100000306 Ga0070675_10000030625 129
336 3300005354 Ga0070675_100317093 Ga0070675_1003170932 129
337 3300005354 Ga0070675_101391628 Ga0070675_1013916281 129
338 3300005355 Ga0070671_100009840 Ga0070671_1000098402 129
339 3300005355 Ga0070671_100306428 Ga0070671_1003064282 129
340 3300005355 Ga0070671_100661942 Ga0070671_1006619421 129
341 3300005356 Ga0070674_100000671 Ga0070674_1000006713 129
342 3300005356 Ga0070674_100096495 Ga0070674_1000964952 129
343 3300005364 Ga0070673_100000297 Ga0070673_1000002976 129
344 3300005364 Ga0070673_100598356 Ga0070673_1005983562 129
345 3300005364 Ga0070673_100657598 Ga0070673_1006575982 129
346 3300005365 Ga0070688_100004712 Ga0070688_1000047126 129
347 3300005366 Ga0070659_100001563 Ga0070659_1000015639 129
348 3300005366 Ga0070659_100156952 Ga0070659_1001569522 129
349 3300005367 Ga0070667_100000745 Ga0070667_10000074514 129
350 3300005367 Ga0070667_100091711 Ga0070667_1000917111 129
351 3300005367 Ga0070667_100487063 Ga0070667_1004870632 129
352 3300005434 Ga0070709_10104162 Ga0070709_101041623 129
353 3300005435 Ga0070714_100328883 Ga0070714_1003288832 129
354 3300005435 Ga0070714_100883425 Ga0070714_1008834252 129
355 3300005436 Ga0070713_100038130 Ga0070713_1000381305 129
356 3300005436 Ga0070713_100059946 Ga0070713_1000599462 129
357 3300005436 Ga0070713_100173767 Ga0070713_1001737672 129
358 3300005436 Ga0070713_100908353 Ga0070713_1009083532 129
359 3300005437 Ga0070710_10039547 Ga0070710_100395472 129
360 3300005437 Ga0070710_10135227 Ga0070710_101352272 129
361 3300005437 Ga0070710_10895248 Ga0070710_108952481 129
362 3300005437 Ga0070710_11259451 Ga0070710_112594511 129
363 3300005438 Ga0070701_10118045 Ga0070701_101180451 129
364 3300005439 Ga0070711_100210435 Ga0070711_1002104352 129
365 3300005439 Ga0070711_100234967 Ga0070711_1002349672 129
366 3300005439 Ga0070711_100488296 Ga0070711_1004882962 129
367 3300005439 Ga0070711_100783137 Ga0070711_1007831372 129
368 3300005440 Ga0070705_100196065 Ga0070705_1001960652 129
369 3300005440 Ga0070705_100838066 Ga0070705_1008380661 129
370 3300005440 Ga0070705_100872608 Ga0070705_1008726082 129
371 3300005441 Ga0070700_100004819 Ga0070700_1000048196 129
372 3300005441 Ga0070700_100603734 Ga0070700_1006037342 129
373 3300005441 Ga0070700_100926914 Ga0070700_1009269142 129
374 3300005444 Ga0070694_100014232 Ga0070694_1000142323 129
375 3300005444 Ga0070694_100095358 Ga0070694_1000953583 129
376 3300005445 Ga0070708_100112513 Ga0070708_1001125132 129
377 3300005445 Ga0070708_100296696 Ga0070708_1002966962 129
378 3300005455 Ga0070663_100000121 Ga0070663_10000012133 129
379 3300005455 Ga0070663_100025382 Ga0070663_1000253823 129
380 3300005455 Ga0070663_100030390 Ga0070663_1000303903 129
381 3300005455 Ga0070663_100224449 Ga0070663_1002244492 129
382 3300005455 Ga0070663_100746130 Ga0070663_1007461302 129
383 3300005456 Ga0070678_100089894 Ga0070678_1000898942 129
384 3300005456 Ga0070678_100400349 Ga0070678_1004003492 129
385 3300005457 Ga0070662_100007921 Ga0070662_1000079215 129
386 3300005457 Ga0070662_100011135 Ga0070662_1000111352 129
387 3300005457 Ga0070662_100410465 Ga0070662_1004104652 129
388 3300005458 Ga0070681_10004011 Ga0070681_100040115 129
389 3300005458 Ga0070681_10067881 Ga0070681_100678812 129
390 3300005458 Ga0070681_10222980 Ga0070681_102229802 129
391 3300005458 Ga0070681_10228885 Ga0070681_102288852 129
392 3300005459 Ga0068867_100000553 Ga0068867_10000055323 129
393 3300005459 Ga0068867_100470041 Ga0068867_1004700412 129
394 3300005466 Ga0070685_10000632 Ga0070685_100006323 129
395 3300005466 Ga0070685_10005595 Ga0070685_100055956 129
396 3300005507 Ga0074259_10260207 Ga0074259_102602072 129
397 3300005518 Ga0070699_100134004 Ga0070699_1001340042 129
398 3300005530 Ga0070679_100005467 Ga0070679_10000546714 129
399 3300005530 Ga0070679_100064214 Ga0070679_1000642142 129
400 3300005530 Ga0070679_100117077 Ga0070679_1001170772 129
401 3300005530 Ga0070679_100125165 Ga0070679_1001251651 129
402 3300005530 Ga0070679_100252778 Ga0070679_1002527782 129
403 3300005530 Ga0070679_101217576 Ga0070679_1012175762 129
404 3300005535 Ga0070684_100000454 Ga0070684_10000045423 129
405 3300005536 Ga0070697_100348928 Ga0070697_1003489282 129
406 3300005536 Ga0070697_100382202 Ga0070697_1003822022 129
407 3300005536 Ga0070697_101809432 Ga0070697_1018094321 129
408 3300005539 Ga0068853_100116823 Ga0068853_1001168232 129
409 3300005539 Ga0068853_101095680 Ga0068853_1010956801 129
410 3300005543 Ga0070672_100000045 Ga0070672_10000004528 129
411 3300005544 Ga0070686_100000480 Ga0070686_1000004805 129
412 3300005544 Ga0070686_100035382 Ga0070686_1000353823 129
413 3300005544 Ga0070686_100211338 Ga0070686_1002113382 129
414 3300005544 Ga0070686_100375582 Ga0070686_1003755822 129
415 3300005544 Ga0070686_100858666 Ga0070686_1008586662 129
416 3300005545 Ga0070695_100004089 Ga0070695_1000040894 129
417 3300005545 Ga0070695_100004677 Ga0070695_1000046777 129
418 3300005545 Ga0070695_100055080 Ga0070695_1000550803 129
419 3300005545 Ga0070695_100829084 Ga0070695_1008290842 129
420 3300005546 Ga0070696_100004193 Ga0070696_1000041937 129
421 3300005546 Ga0070696_100385187 Ga0070696_1003851872 129
422 3300005546 Ga0070696_100818601 Ga0070696_1008186011 129
423 3300005546 Ga0070696_101276047 Ga0070696_1012760471 129
424 3300005547 Ga0070693_100004943 Ga0070693_1000049437 129
425 3300005547 Ga0070693_100177847 Ga0070693_1001778472 129
426 3300005547 Ga0070693_100644696 Ga0070693_1006446961 129
427 3300005548 Ga0070665_100054904 Ga0070665_1000549043 129
428 3300005548 Ga0070665_100574211 Ga0070665_1005742112 129
429 3300005549 Ga0070704_100000031 Ga0070704_1000000315 129
430 3300005549 Ga0070704_100067875 Ga0070704_1000678753 129
431 3300005563 Ga0068855_100006104 Ga0068855_1000061044 129
432 3300005564 Ga0070664_100000899 Ga0070664_1000008996 129
433 3300005564 Ga0070664_100165056 Ga0070664_1001650563 129
434 3300005564 Ga0070664_100222742 Ga0070664_1002227422 129
435 3300005564 Ga0070664_100359277 Ga0070664_1003592771 129
436 3300005564 Ga0070664_100638975 Ga0070664_1006389752 129
437 3300005577 Ga0068857_100000623 Ga0068857_10000062322 129
438 3300005578 Ga0068854_100686888 Ga0068854_1006868882 129
439 3300005614 Ga0068856_100004332 Ga0068856_10000433217 129
440 3300005615 Ga0070702_100000128 Ga0070702_1000001284 129
441 3300005616 Ga0068852_100051090 Ga0068852_1000510902 129
442 3300005616 Ga0068852_100203811 Ga0068852_1002038112 129
443 3300005617 Ga0068859_100001291 Ga0068859_10000129126 129
444 3300005617 Ga0068859_100019144 Ga0068859_1000191446 129
445 3300005617 Ga0068859_101156887 Ga0068859_1011568872 129
446 3300005618 Ga0068864_100010716 Ga0068864_1000107166 129
447 3300005618 Ga0068864_100327381 Ga0068864_1003273812 129
448 3300005618 Ga0068864_100469223 Ga0068864_1004692232 129
449 3300005618 Ga0068864_100617004 Ga0068864_1006170042 129
450 3300005718 Ga0068866_10000346 Ga0068866_1000034616 129
451 3300005719 Ga0068861_100000045 Ga0068861_10000004536 129
452 3300005719 Ga0068861_102579018 Ga0068861_1025790181 129
453 3300005834 Ga0068851_10167711 Ga0068851_101677112 129
454 3300005840 Ga0068870_10000213 Ga0068870_1000021320 129
455 3300005841 Ga0068863_100001919 Ga0068863_10000191919 129
456 3300005841 Ga0068863_101861975 Ga0068863_1018619752 129
457 3300005842 Ga0068858_100000307 Ga0068858_10000030749 129
458 3300005842 Ga0068858_100083063 Ga0068858_1000830634 129
459 3300005842 Ga0068858_100437323 Ga0068858_1004373232 129
460 3300005842 Ga0068858_101129463 Ga0068858_1011294632 129
461 3300005843 Ga0068860_100001587 Ga0068860_10000158720 129
462 3300005843 Ga0068860_100035732 Ga0068860_1000357325 129
463 3300005843 Ga0068860_100115847 Ga0068860_1001158473 129
464 3300005843 Ga0068860_100167288 Ga0068860_1001672883 129
465 3300005843 Ga0068860_100418637 Ga0068860_1004186372 129
466 3300005843 Ga0068860_100459616 Ga0068860_1004596162 129
467 3300005844 Ga0068862_100001373 Ga0068862_1000013732 129
468 3300005937 Ga0081455_10000036 Ga0081455_1000003628 129
469 3300005937 Ga0081455_10030438 Ga0081455_100304383 129
470 3300005937 Ga0081455_10369011 Ga0081455_103690112 129
471 3300005937 Ga0081455_10739402 Ga0081455_107394022 129
472 3300005983 Ga0081540_1013693 Ga0081540_10136932 129
473 3300006028 Ga0070717_10433692 Ga0070717_104336922 129
474 3300006058 Ga0075432_10001113 Ga0075432_1000111310 129
475 3300006058 Ga0075432_10036353 Ga0075432_100363532 129
476 3300006058 Ga0075432_10229341 Ga0075432_102293412 129
477 3300006173 Ga0070716_100018437 Ga0070716_1000184373 129
478 3300006175 Ga0070712_100131019 Ga0070712_1001310192 129
479 3300006175 Ga0070712_100829224 Ga0070712_1008292242 129
480 3300006178 Ga0075367_10019195 Ga0075367_100191952 129
481 3300006194 Ga0075427_10001574 Ga0075427_100015742 129
482 3300006237 Ga0097621_100002565 Ga0097621_1000025655 129
483 3300006237 Ga0097621_100071435 Ga0097621_1000714353 129
484 3300006237 Ga0097621_100811208 Ga0097621_1008112081 129
485 3300006237 Ga0097621_101263713 Ga0097621_1012637132 129
486 3300006353 Ga0075370_10346860 Ga0075370_103468602 129
487 3300006358 Ga0068871_100000654 Ga0068871_1000006543 129
488 3300006358 Ga0068871_100141291 Ga0068871_1001412912 129
489 3300006844 Ga0075428_100075267 Ga0075428_1000752672 129
490 3300006846 Ga0075430_100001350 Ga0075430_10000135019 129
491 3300006847 Ga0075431_100001300 Ga0075431_10000130020 129
492 3300006852 Ga0075433_10000773 Ga0075433_1000077312 129
493 3300006852 Ga0075433_10071240 Ga0075433_100712403 129
494 3300006852 Ga0075433_10239016 Ga0075433_102390162 129
495 3300006871 Ga0075434_100001539 Ga0075434_10000153915 129
496 3300006871 Ga0075434_100010228 Ga0075434_1000102287 129
497 3300006871 Ga0075434_100079695 Ga0075434_1000796953 129
498 3300006871 Ga0075434_100114246 Ga0075434_1001142463 129
499 3300006871 Ga0075434_100370080 Ga0075434_1003700802 129
500 3300006871 Ga0075434_100880397 Ga0075434_1008803972 129
501 3300006880 Ga0075429_100002588 Ga0075429_1000025884 129
502 3300006880 Ga0075429_100828443 Ga0075429_1008284432 129
503 3300006881 Ga0068865_100001596 Ga0068865_10000159613 129
504 3300006881 Ga0068865_100068331 Ga0068865_1000683313 129
505 3300006881 Ga0068865_100113507 Ga0068865_1001135072 129
506 3300006914 Ga0075436_100016509 Ga0075436_1000165092 129
507 3300006914 Ga0075436_100209846 Ga0075436_1002098462 129
508 3300006914 Ga0075436_100246702 Ga0075436_1002467022 129
509 3300006914 Ga0075436_100296034 Ga0075436_1002960342 129
510 3300006914 Ga0075436_100377500 Ga0075436_1003775002 129
511 3300006931 Ga0097620_100001291 Ga0097620_10000129126 129
512 3300006931 Ga0097620_100019143 Ga0097620_1000191436 129
513 3300006931 Ga0097620_101157029 Ga0097620_1011570292 129
514 3300007076 Ga0075435_100080026 Ga0075435_1000800263 129
515 3300007076 Ga0075435_100109691 Ga0075435_1001096913 129
516 3300007076 Ga0075435_100158348 Ga0075435_1001583483 129
517 3300007076 Ga0075435_100305516 Ga0075435_1003055161 129
518 3300009011 Ga0105251_10017546 Ga0105251_100175464 129
519 3300009036 Ga0105244_10028774 Ga0105244_100287743 129
520 3300009092 Ga0105250_10077138 Ga0105250_100771382 129
521 3300009093 Ga0105240_10214588 Ga0105240_102145883 129
522 3300009093 Ga0105240_11182161 Ga0105240_111821611 129
523 3300009094 Ga0111539_10000591 Ga0111539_1000059135 129
524 3300009094 Ga0111539_10001213 Ga0111539_1000121314 129
525 3300009094 Ga0111539_10002431 Ga0111539_100024314 129
526 3300009094 Ga0111539_10550666 Ga0111539_105506662 129
527 3300009098 Ga0105245_10001033 Ga0105245_1000103319 129
528 3300009098 Ga0105245_10088321 Ga0105245_100883212 129
529 3300009098 Ga0105245_10952132 Ga0105245_109521322 129
530 3300009101 Ga0105247_10028489 Ga0105247_100284893 129
531 3300009101 Ga0105247_10058878 Ga0105247_100588782 129
532 3300009101 Ga0105247_10158304 Ga0105247_101583043 129
533 3300009101 Ga0105247_10273385 Ga0105247_102733852 129
534 3300009101 Ga0105247_10453105 Ga0105247_104531052 129
535 3300009147 Ga0114129_10002229 Ga0114129_100022295 129
536 3300009147 Ga0114129_10012044 Ga0114129_100120444 129
537 3300009147 Ga0114129_11098779 Ga0114129_110987792 129
538 3300009148 Ga0105243_10000678 Ga0105243_1000067823 129
539 3300009148 Ga0105243_10027310 Ga0105243_100273105 129
540 3300009148 Ga0105243_10462052 Ga0105243_104620522 129
541 3300009174 Ga0105241_10025430 Ga0105241_100254303 129
542 3300009174 Ga0105241_10028187 Ga0105241_100281875 129
543 3300009174 Ga0105241_11545427 Ga0105241_115454272 129
544 3300009176 Ga0105242_10002866 Ga0105242_1000286614 129
545 3300009176 Ga0105242_10015968 Ga0105242_100159682 129
546 3300009176 Ga0105242_10391248 Ga0105242_103912482 129
547 3300009177 Ga0105248_10000399 Ga0105248_1000039951 129
548 3300009177 Ga0105248_10017966 Ga0105248_100179663 129
549 3300009177 Ga0105248_10087692 Ga0105248_100876924 129
550 3300009177 Ga0105248_10313139 Ga0105248_103131392 129
551 3300009177 Ga0105248_10382112 Ga0105248_103821122 129
552 3300009545 Ga0105237_10015879 Ga0105237_100158795 129
553 3300009545 Ga0105237_10196224 Ga0105237_101962243 129
554 3300009545 Ga0105237_10780527 Ga0105237_107805272 129
555 3300009551 Ga0105238_10045890 Ga0105238_100458903 129
556 3300009551 Ga0105238_10154050 Ga0105238_101540502 129
557 3300009553 Ga0105249_10000540 Ga0105249_1000054014 129
558 3300009553 Ga0105249_10003822 Ga0105249_1000382214 129
559 3300009553 Ga0105249_10344665 Ga0105249_103446652 129
560 3300010375 Ga0105239_10018383 Ga0105239_100183833 129
561 3300010375 Ga0105239_10357961 Ga0105239_103579612 129
562 3300010375 Ga0105239_10818301 Ga0105239_108183012 129
563 3300011119 Ga0105246_10000212 Ga0105246_1000021228 129
564 3300011119 Ga0105246_10132920 Ga0105246_101329202 129
565 3300011119 Ga0105246_10287379 Ga0105246_102873792 129
566 3300012508 Ga0157315_1000632 Ga0157315_10006321 129
567 3300012510 Ga0157316_1010643 Ga0157316_10106432 129
568 3300013100 Ga0157373_10005412 Ga0157373_1000541211 129
569 3300013100 Ga0157373_10494482 Ga0157373_104944822 129
570 3300013102 Ga0157371_10037376 Ga0157371_100373762 129
571 3300013102 Ga0157371_10429048 Ga0157371_104290482 129
572 3300013105 Ga0157369_10574372 Ga0157369_105743722 129
573 3300013105 Ga0157369_11270972 Ga0157369_112709722 129
574 3300013296 Ga0157374_10001186 Ga0157374_1000118625 129
575 3300013296 Ga0157374_10016564 Ga0157374_100165645 129
576 3300013296 Ga0157374_10629689 Ga0157374_106296892 129
577 3300013297 Ga0157378_10013662 Ga0157378_100136625 129
578 3300013297 Ga0157378_10086710 Ga0157378_100867103 129
579 3300013297 Ga0157378_10188949 Ga0157378_101889492 129
580 3300013306 Ga0163162_10000762 Ga0163162_100007627 129
581 3300013306 Ga0163162_10242845 Ga0163162_102428452 129
582 3300013306 Ga0163162_10618693 Ga0163162_106186932 129
583 3300013306 Ga0163162_10800021 Ga0163162_108000212 129
584 3300013307 Ga0157372_10006437 Ga0157372_1000643715 129
585 3300013307 Ga0157372_10910997 Ga0157372_109109972 129
586 3300013307 Ga0157372_10990306 Ga0157372_109903062 129
587 3300013308 Ga0157375_10000177 Ga0157375_1000017761 129
588 3300013308 Ga0157375_10391459 Ga0157375_103914592 129
589 3300013308 Ga0157375_10483849 Ga0157375_104838492 129
590 3300014325 Ga0163163_10001917 Ga0163163_100019173 129
591 3300014325 Ga0163163_10004152 Ga0163163_1000415217 129
592 3300014325 Ga0163163_10235321 Ga0163163_102353213 129
593 3300014325 Ga0163163_10313858 Ga0163163_103138582 129
594 3300014325 Ga0163163_10328068 Ga0163163_103280682 129
595 3300014326 Ga0157380_10003066 Ga0157380_1000306610 129
596 3300014745 Ga0157377_10000178 Ga0157377_100001783 129
597 3300014968 Ga0157379_10000135 Ga0157379_1000013548 129
598 3300014968 Ga0157379_10030636 Ga0157379_100306366 129
599 3300014968 Ga0157379_10087467 Ga0157379_100874672 129
600 3300014968 Ga0157379_10104256 Ga0157379_101042563 129
601 3300014968 Ga0157379_10161685 Ga0157379_101616852 129
602 3300014969 Ga0157376_10001353 Ga0157376_100013533 129
603 3300014969 Ga0157376_10173614 Ga0157376_101736143 129
604 3300014969 Ga0157376_10233540 Ga0157376_102335402 129
605 3300017792 Ga0163161_10000867 Ga0163161_100008674 129
606 3300025261 Ga0209233_1011403 Ga0209233_10114033 129
607 3300025271 Ga0207666_1000021 Ga0207666_100002130 129
608 3300025271 Ga0207666_1000444 Ga0207666_10004444 129
609 3300025290 Ga0207673_1000845 Ga0207673_10008453 129
610 3300025315 Ga0207697_10001014 Ga0207697_100010148 129
611 3300025315 Ga0207697_10006655 Ga0207697_100066556 129
612 3300025321 Ga0207656_10645211 Ga0207656_106452112 129
613 3300025885 Ga0207653_10005540 Ga0207653_100055403 129
614 3300025893 Ga0207682_10000426 Ga0207682_1000042618 129
615 3300025898 Ga0207692_10054182 Ga0207692_100541823 129
616 3300025898 Ga0207692_10113421 Ga0207692_101134212 129
617 3300025898 Ga0207692_10124951 Ga0207692_101249511 129
618 3300025898 Ga0207692_10379321 Ga0207692_103793212 129
619 3300025899 Ga0207642_10001961 Ga0207642_100019613 129
620 3300025900 Ga0207710_10015779 Ga0207710_100157793 129
621 3300025901 Ga0207688_10000017 Ga0207688_1000001714 129
622 3300025901 Ga0207688_10555207 Ga0207688_105552072 129
623 3300025901 Ga0207688_10878994 Ga0207688_108789942 129
624 3300025903 Ga0207680_10015394 Ga0207680_100153943 129
625 3300025903 Ga0207680_10030371 Ga0207680_100303712 129
626 3300025904 Ga0207647_10005524 Ga0207647_100055246 129
627 3300025905 Ga0207685_10021875 Ga0207685_100218752 129
628 3300025906 Ga0207699_10115621 Ga0207699_101156212 129
629 3300025906 Ga0207699_10201279 Ga0207699_102012792 129
630 3300025906 Ga0207699_10259235 Ga0207699_102592352 129
631 3300025907 Ga0207645_10000074 Ga0207645_1000007418 129
632 3300025907 Ga0207645_10385640 Ga0207645_103856402 129
633 3300025908 Ga0207643_10000058 Ga0207643_1000005827 129
634 3300025908 Ga0207643_11064081 Ga0207643_110640811 129
635 3300025911 Ga0207654_10020901 Ga0207654_100209011 129
636 3300025911 Ga0207654_10073983 Ga0207654_100739833 129
637 3300025911 Ga0207654_10122366 Ga0207654_101223662 129
638 3300025912 Ga0207707_10007073 Ga0207707_100070735 129
639 3300025912 Ga0207707_10139708 Ga0207707_101397083 129
640 3300025912 Ga0207707_10161129 Ga0207707_101611292 129
641 3300025913 Ga0207695_10057979 Ga0207695_100579792 129
642 3300025914 Ga0207671_10544356 Ga0207671_105443562 129
643 3300025915 Ga0207693_10013942 Ga0207693_100139427 129
644 3300025915 Ga0207693_10079128 Ga0207693_100791282 129
645 3300025915 Ga0207693_10084244 Ga0207693_100842443 129
646 3300025915 Ga0207693_10213470 Ga0207693_102134702 129
647 3300025916 Ga0207663_10091487 Ga0207663_100914872 129
648 3300025916 Ga0207663_10274104 Ga0207663_102741042 129
649 3300025916 Ga0207663_10668812 Ga0207663_106688122 129
650 3300025917 Ga0207660_10000578 Ga0207660_1000057816 129
651 3300025917 Ga0207660_10159000 Ga0207660_101590003 129
652 3300025917 Ga0207660_10258975 Ga0207660_102589753 129
653 3300025917 Ga0207660_10923668 Ga0207660_109236682 129
654 3300025918 Ga0207662_10000069 Ga0207662_1000006912 129
655 3300025918 Ga0207662_10005716 Ga0207662_100057166 129
656 3300025918 Ga0207662_10577514 Ga0207662_105775142 129
657 3300025919 Ga0207657_10000721 Ga0207657_1000072128 129
658 3300025919 Ga0207657_10086818 Ga0207657_100868183 129
659 3300025919 Ga0207657_10145048 Ga0207657_101450482 129
660 3300025920 Ga0207649_10000282 Ga0207649_1000028232 129
661 3300025920 Ga0207649_11374825 Ga0207649_113748251 129
662 3300025921 Ga0207652_10009825 Ga0207652_100098257 129
663 3300025921 Ga0207652_10011123 Ga0207652_100111235 129
664 3300025921 Ga0207652_10101582 Ga0207652_101015823 129
665 3300025921 Ga0207652_10265213 Ga0207652_102652133 129
666 3300025923 Ga0207681_10000806 Ga0207681_100008063 129
667 3300025923 Ga0207681_10120433 Ga0207681_101204332 129
668 3300025924 Ga0207694_10020964 Ga0207694_100209643 129
669 3300025925 Ga0207650_10004953 Ga0207650_100049534 129
670 3300025925 Ga0207650_10050620 Ga0207650_100506203 129
671 3300025926 Ga0207659_10000039 Ga0207659_1000003968 129
672 3300025926 Ga0207659_11260047 Ga0207659_112600472 129
673 3300025927 Ga0207687_10008561 Ga0207687_100085613 129
674 3300025927 Ga0207687_10018052 Ga0207687_100180523 129
675 3300025928 Ga0207700_10002144 Ga0207700_100021443 129
676 3300025928 Ga0207700_10114255 Ga0207700_101142553 129
677 3300025928 Ga0207700_10501396 Ga0207700_105013962 129
678 3300025928 Ga0207700_11163582 Ga0207700_111635821 129
679 3300025929 Ga0207664_10383031 Ga0207664_103830312 129
680 3300025931 Ga0207644_10006357 Ga0207644_100063572 129
681 3300025931 Ga0207644_10034963 Ga0207644_100349634 129
682 3300025931 Ga0207644_10034966 Ga0207644_100349664 129
683 3300025931 Ga0207644_10049974 Ga0207644_100499742 129
684 3300025932 Ga0207690_10000303 Ga0207690_1000030312 129
685 3300025932 Ga0207690_10434516 Ga0207690_104345162 129
686 3300025932 Ga0207690_11362253 Ga0207690_113622531 129
687 3300025933 Ga0207706_10002511 Ga0207706_1000251111 129
688 3300025933 Ga0207706_10036762 Ga0207706_100367624 129
689 3300025933 Ga0207706_10115647 Ga0207706_101156473 129
690 3300025934 Ga0207686_10000540 Ga0207686_1000054023 129
691 3300025935 Ga0207709_10000970 Ga0207709_1000097021 129
692 3300025935 Ga0207709_10098509 Ga0207709_100985093 129
693 3300025935 Ga0207709_10418480 Ga0207709_104184802 129
694 3300025936 Ga0207670_10000200 Ga0207670_1000020016 129
695 3300025937 Ga0207669_10000098 Ga0207669_1000009821 129
696 3300025937 Ga0207669_10017634 Ga0207669_100176342 129
697 3300025937 Ga0207669_10178040 Ga0207669_101780402 129
698 3300025937 Ga0207669_10222883 Ga0207669_102228833 129
699 3300025938 Ga0207704_10004239 Ga0207704_100042393 129
700 3300025938 Ga0207704_10053256 Ga0207704_100532562 129
701 3300025938 Ga0207704_10088865 Ga0207704_100888653 129
702 3300025939 Ga0207665_10000905 Ga0207665_100009051 129
703 3300025939 Ga0207665_10140093 Ga0207665_101400932 129
704 3300025940 Ga0207691_10000169 Ga0207691_1000016912 129
705 3300025941 Ga0207711_10003735 Ga0207711_1000373512 129
706 3300025941 Ga0207711_10050482 Ga0207711_100504823 129
707 3300025941 Ga0207711_10055122 Ga0207711_100551224 129
708 3300025941 Ga0207711_10613047 Ga0207711_106130472 129
709 3300025942 Ga0207689_10000363 Ga0207689_1000036348 129
710 3300025942 Ga0207689_11044547 Ga0207689_110445472 129
711 3300025944 Ga0207661_10000700 Ga0207661_100007007 129
712 3300025944 Ga0207661_10097304 Ga0207661_100973043 129
713 3300025945 Ga0207679_10000030 Ga0207679_1000003042 129
714 3300025945 Ga0207679_10136920 Ga0207679_101369203 129
715 3300025945 Ga0207679_10390036 Ga0207679_103900361 129
716 3300025945 Ga0207679_10530522 Ga0207679_105305222 129
717 3300025945 Ga0207679_11020508 Ga0207679_110205082 129
718 3300025949 Ga0207667_10011075 Ga0207667_100110759 129
719 3300025949 Ga0207667_10043831 Ga0207667_100438312 129
720 3300025949 Ga0207667_10073699 Ga0207667_100736993 129
721 3300025960 Ga0207651_10000593 Ga0207651_1000059316 129
722 3300025960 Ga0207651_10222784 Ga0207651_102227841 129
723 3300025960 Ga0207651_10608887 Ga0207651_106088872 129
724 3300025961 Ga0207712_10000473 Ga0207712_1000047327 129
725 3300025961 Ga0207712_10044542 Ga0207712_100445422 129
726 3300025961 Ga0207712_10117637 Ga0207712_101176373 129
727 3300025972 Ga0207668_10000220 Ga0207668_1000022022 129
728 3300025981 Ga0207640_10000379 Ga0207640_100003798 129
729 3300025986 Ga0207658_10001133 Ga0207658_1000113319 129
730 3300025986 Ga0207658_11807562 Ga0207658_118075621 129
731 3300026023 Ga0207677_10000513 Ga0207677_1000051313 129
732 3300026023 Ga0207677_10320898 Ga0207677_103208982 129
733 3300026035 Ga0207703_10001263 Ga0207703_1000126326 129
734 3300026035 Ga0207703_10020402 Ga0207703_100204025 129
735 3300026035 Ga0207703_10175358 Ga0207703_101753583 129
736 3300026035 Ga0207703_10205576 Ga0207703_102055763 129
737 3300026035 Ga0207703_10265310 Ga0207703_102653102 129
738 3300026035 Ga0207703_10421520 Ga0207703_104215202 129
739 3300026041 Ga0207639_10015014 Ga0207639_100150147 129
740 3300026041 Ga0207639_10369678 Ga0207639_103696781 129
741 3300026041 Ga0207639_10959702 Ga0207639_109597022 129
742 3300026067 Ga0207678_10003592 Ga0207678_100035925 129
743 3300026067 Ga0207678_10075348 Ga0207678_100753483 129
744 3300026067 Ga0207678_10096163 Ga0207678_100961632 129
745 3300026067 Ga0207678_10197474 Ga0207678_101974742 129
746 3300026067 Ga0207678_10280170 Ga0207678_102801702 129
747 3300026067 Ga0207678_11369783 Ga0207678_113697832 129
748 3300026075 Ga0207708_10000428 Ga0207708_1000042814 129
749 3300026075 Ga0207708_10003371 Ga0207708_1000337111 129
750 3300026075 Ga0207708_10035252 Ga0207708_100352523 129
751 3300026075 Ga0207708_10973385 Ga0207708_109733852 129
752 3300026078 Ga0207702_10004376 Ga0207702_100043767 129
753 3300026078 Ga0207702_11670249 Ga0207702_116702492 129
754 3300026088 Ga0207641_10001143 Ga0207641_1000114325 129
755 3300026088 Ga0207641_10087284 Ga0207641_100872842 129
756 3300026089 Ga0207648_10000272 Ga0207648_100002726 129
757 3300026089 Ga0207648_10095794 Ga0207648_100957943 129
758 3300026089 Ga0207648_10386872 Ga0207648_103868722 129
759 3300026095 Ga0207676_10009286 Ga0207676_100092864 129
760 3300026095 Ga0207676_10349154 Ga0207676_103491542 129
761 3300026095 Ga0207676_10369255 Ga0207676_103692552 129
762 3300026116 Ga0207674_10000135 Ga0207674_1000013560 129
763 3300026118 Ga0207675_100000245 Ga0207675_10000024548 129
764 3300026121 Ga0207683_10000136 Ga0207683_1000013657 129
765 3300026121 Ga0207683_10372807 Ga0207683_103728072 129
766 3300026142 Ga0207698_10000828 Ga0207698_1000082817 129
767 3300026142 Ga0207698_10409684 Ga0207698_104096842 129
768 3300027252 Ga0209973_1006195 Ga0209973_10061952 129
769 3300027360 Ga0209969_1061002 Ga0209969_10610021 129
770 3300027395 Ga0209996_1007399 Ga0209996_10073992 129
771 3300027526 Ga0209968_1043865 Ga0209968_10438652 129
772 3300027543 Ga0209999_1015941 Ga0209999_10159412 129
773 3300027614 Ga0209970_1006005 Ga0209970_10060052 129
774 3300027617 Ga0210002_1004082 Ga0210002_10040822 129
775 3300027665 Ga0209983_1013802 Ga0209983_10138023 129
776 3300027682 Ga0209971_1026726 Ga0209971_10267262 129
777 3300027695 Ga0209966_1006735 Ga0209966_10067353 129
778 3300027695 Ga0209966_1017712 Ga0209966_10177122 129
779 3300027717 Ga0209998_10006808 Ga0209998_100068083 129
780 3300027876 Ga0209974_10015919 Ga0209974_100159193 129
781 3300027907 Ga0207428_10000249 Ga0207428_1000024945 129
782 3300027907 Ga0207428_10000471 Ga0207428_1000047124 129
783 3300027907 Ga0207428_10002287 Ga0207428_100022876 129
784 3300027907 Ga0207428_10644545 Ga0207428_106445452 129
785 3300028379 Ga0268266_10738673 Ga0268266_107386732 129
786 3300028380 Ga0268265_10001888 Ga0268265_1000188813 129
787 3300028381 Ga0268264_10000693 Ga0268264_1000069324 129
788 3300028381 Ga0268264_10161724 Ga0268264_101617242 129
789 3300028381 Ga0268264_10681003 Ga0268264_106810032 129
790 3300028381 Ga0268264_11421126 Ga0268264_114211262 129
791 3300028556 Ga0265337_1156957 Ga0265337_11569572 129
792 3300028800 Ga0265338_10500418 Ga0265338_105004181 129
793 3300031235 Ga0265330_10034754 Ga0265330_100347542 129
794 3300031238 Ga0265332_10044370 Ga0265332_100443703 129
795 3300031238 Ga0265332_10283369 Ga0265332_102833692 129
796 3300031241 Ga0265325_10000055 Ga0265325_1000005527 129
797 3300031241 Ga0265325_10044077 Ga0265325_100440772 129
798 3300031249 Ga0265339_10008094 Ga0265339_100080945 129
799 3300031249 Ga0265339_10475157 Ga0265339_104751571 129
800 3300031595 Ga0265313_10008657 Ga0265313_100086576 129
801 3300031595 Ga0265313_10022395 Ga0265313_100223953 129
802 3300031665 Ga0316575_10112747 Ga0316575_101127472 129
803 3300031712 Ga0265342_10000760 Ga0265342_1000076018 129
804 3300031712 Ga0265342_10011993 Ga0265342_100119931 129
805 3300032133 Ga0316583_10001350 Ga0316583_100013505 129
806 3300034816 Ga0373930_0000940 Ga0373930_0000940_1890_2279 129
807 3300034816 Ga0373930_0004040 Ga0373930_0004040_1243_1632 129
808 3300034816 Ga0373930_0060393 Ga0373930_0060393_48_437 129
809 3300034817 Ga0373948_0000536 Ga0373948_0000536_3688_4077 129
810 3300034817 Ga0373948_0134631 Ga0373948_0134631_17_406 129
811 3300034818 Ga0373950_0001447 Ga0373950_0001447_288_677 129
812 3300034819 Ga0373958_0000870 Ga0373958_0000870_2331_2720 129
813 3300034819 Ga0373958_0002779 Ga0373958_0002779_1426_1815 129
814 3300034820 Ga0373959_0001430 Ga0373959_0001430_883_1272 129
815 3300034820 Ga0373959_0016991 Ga0373959_0016991_47_436 129
816 3300034957 Ga0373938_0000293 Ga0373938_0000293_895_1284 129
817 3300034957 Ga0373938_0061213 Ga0373938_0061213_248_637 129
818 3300035083 Ga0373926_0077596 Ga0373926_0077596_309_698 129
819 3300035084 Ga0373928_0037557 Ga0373928_0037557_200_589 129
820 3300035085 Ga0373929_0001712 Ga0373929_0001712_866_1255 129
821 3300035085 Ga0373929_0001899 Ga0373929_0001899_2489_2878 129
822 3300035086 Ga0373934_0025591 Ga0373934_0025591_1599_1988 129
823 3300035088 Ga0373940_0008719 Ga0373940_0008719_1080_1469 129
824 3300035088 Ga0373940_0029033 Ga0373940_0029033_791_1180 129
825 3300035088 Ga0373940_0079432 Ga0373940_0079432_521_910 129
826 3300035089 Ga0373944_0025385 Ga0373944_0025385_1079_1468 129
827 3300035089 Ga0373944_0045119 Ga0373944_0045119_779_1168 129
828 3300035090 Ga0373949_0000797 Ga0373949_0000797_4060_4449 129
829 3300035090 Ga0373949_0002468 Ga0373949_0002468_3450_3839 129
830 3300035090 Ga0373949_0068148 Ga0373949_0068148_231_620 129
831 3300035091 Ga0373951_0012685 Ga0373951_0012685_993_1382 129
832 3300035092 Ga0373952_0007256 Ga0373952_0007256_832_1221 129
833 3300035092 Ga0373952_0026490 Ga0373952_0026490_487_876 129
834 3300035111 Ga0373923_0011716 Ga0373923_0011716_2294_2683 129
835 3300035111 Ga0373923_0015860 Ga0373923_0015860_1188_1577 129
836 3300035112 Ga0373932_0001341 Ga0373932_0001341_895_1284 129
837 3300035112 Ga0373932_0001774 Ga0373932_0001774_5304_5693 129
838 3300035112 Ga0373932_0023817 Ga0373932_0023817_601_990 129
839 3300035113 Ga0373936_0005884 Ga0373936_0005884_1882_2271 129
840 3300035113 Ga0373936_0039644 Ga0373936_0039644_383_772 129
841 3300035114 Ga0373939_0005695 Ga0373939_0005695_818_1207 129
842 3300035114 Ga0373939_0008647 Ga0373939_0008647_976_1365 129
843 3300035115 Ga0373941_0000410 Ga0373941_0000410_1134_1523 129
844 3300035115 Ga0373941_0133631 Ga0373941_0133631_377_766 129
845 3300035116 Ga0373945_0017444 Ga0373945_0017444_679_1068 129
846 3300035117 Ga0373953_0057174 Ga0373953_0057174_244_633 129
847 3300035117 Ga0373953_0332158 Ga0373953_0332158_265_654 129
848 3300035118 Ga0373954_0012230 Ga0373954_0012230_1294_1683 129
849 3300035118 Ga0373954_0046542 Ga0373954_0046542_472_861 129
850 3300035118 Ga0373954_0151141 Ga0373954_0151141_680_1069 129
851 3300035119 Ga0373956_0178031 Ga0373956_0178031_100_489 129
852 3300035119 Ga0373956_0417073 Ga0373956_0417073_64_453 129
853 3300035121 Ga0373960_0001361 Ga0373960_0001361_2431_2820 129
854 3300035170 Ga0373943_0001756 Ga0373943_0001756_4358_4747 129
855 3300035170 Ga0373943_0018728 Ga0373943_0018728_2647_3036 129
856 3300035170 Ga0373943_0179633 Ga0373943_0179633_548_937 129
857 3300035171 Ga0373946_0068622 Ga0373946_0068622_449_838 129
858 3300035171 Ga0373946_0154967 Ga0373946_0154967_278_667 129
859 3300035171 Ga0373946_0270679 Ga0373946_0270679_201_590 129
860 3300035172 Ga0373955_0010447 Ga0373955_0010447_281_670 129
861 3300035172 Ga0373955_0016087 Ga0373955_0016087_1779_2168 129
862 3300035172 Ga0373955_0019549 Ga0373955_0019549_485_874 129
863 3300035172 Ga0373955_0334504 Ga0373955_0334504_76_465 129
864 3300035207 Ga0373942_0006328 Ga0373942_0006328_265_654 129
865 3300035241 Ga0373961_0004108 Ga0373961_0004108_1894_2283 129
866 3300035241 Ga0373961_0005274 Ga0373961_0005274_16_405 129
867 3300035242 Ga0373962_0003406 Ga0373962_0003406_2801_3190 129
868 3300035242 Ga0373962_0005753 Ga0373962_0005753_1139_1528 129
869 3300035242 Ga0373962_0027678 Ga0373962_0027678_934_1323 129
870 3300035242 Ga0373962_0296490 Ga0373962_0296490_17_406 129
871 3300035410 Ga0373924_0020653 Ga0373924_0020653_2107_2496 129
872 3300035410 Ga0373924_0234712 Ga0373924_0234712_146_535 129
873 3300035410 Ga0373924_0479461 Ga0373924_0479461_128_517 129
874 3300035691 Ga0373931_0000853 Ga0373931_0000853_5037_5426 129
875 3300035691 Ga0373931_0010380 Ga0373931_0010380_3220_3609 129
876 3300035691 Ga0373931_0066193 Ga0373931_0066193_1100_1489 129
877 3300035691 Ga0373931_0071581 Ga0373931_0071581_530_919 129
878 3300035691 Ga0373931_0171350 Ga0373931_0171350_11_400 129
879 3300035692 Ga0373935_0011348 Ga0373935_0011348_2234_2623 129
880 3300035692 Ga0373935_0021300 Ga0373935_0021300_2406_2795 129
881 3300035692 Ga0373935_0054419 Ga0373935_0054419_217_606 129
882 3300035692 Ga0373935_0166496 Ga0373935_0166496_624_1013 129
883 3300035692 Ga0373935_0302696 Ga0373935_0302696_471_860 129
884 3300035695 Ga0373927_0042609 Ga0373927_0042609_1363_1752 129
885 3300035695 Ga0373927_0048857 Ga0373927_0048857_267_656 129
886 3300035724 Ga0373933_0007033 Ga0373933_0007033_4868_5257 129
887 3300035724 Ga0373933_0027449 Ga0373933_0027449_1647_2036 129
888 3300035724 Ga0373933_0027713 Ga0373933_0027713_999_1388 129
889 3300035725 Ga0373947_0043464 Ga0373947_0043464_2016_2405 129
890 3300035725 Ga0373947_0241315 Ga0373947_0241315_472_861 129
891 3300035725 Ga0373947_0402488 Ga0373947_0402488_278_667 129
892 3300036401 Ga0373937_0010852 Ga0373937_0010852_478_867 129
893 3300036401 Ga0373937_0135019 Ga0373937_0135019_952_1341 129
894 3300037068 Ga0373925_0012204 Ga0373925_0012204_5375_5764 129
895 3300037068 Ga0373925_0049123 Ga0373925_0049123_2466_2855 129
896 3300037068 Ga0373925_0079963 Ga0373925_0079963_1530_1919 129
897 3300037068 Ga0373925_0498873 Ga0373925_0498873_244_633 129
898 3300038698 Ga0242419_018407 Ga0242419_018407_142_531 129
899 3300038996 Ga0242420_009830 Ga0242420_009830_15_404 129
900 3300042008 Ga0439450_012559 Ga0439450_012559_1195_1584 129
901 3300042439 Ga0439464_0005686 Ga0439464_0005686_901_1290 129
902 3300042461 Ga0439460_0026965 Ga0439460_0026965_870_1259 129
903 3300042876 Ga0451577_1970918 Ga0451577_1970918_100_489 129
904 3300042993 Ga0439440_0027245 Ga0439440_0027245_703_1092 129
905 3300045051 Ga0451576_0035228 Ga0451576_0035228_2245_2634 129
906 3300045836 Ga0466958_0467783 Ga0466958_0467783_160_552 129
907 3300046452 Ga0495617_016986 Ga0495617_016986_585_974 129
908 3300046454 Ga0495592_0007525 Ga0495592_0007525_425_814 129
909 3300046454 Ga0495592_0010371 Ga0495592_0010371_105_494 129
910 3300046454 Ga0495592_0119940 Ga0495592_0119940_830_1219 129
911 3300046455 Ga0495603_0007148 Ga0495603_0007148_3820_4209 129
912 3300046455 Ga0495603_0044070 Ga0495603_0044070_1943_2332 129
913 3300046455 Ga0495603_0077397 Ga0495603_0077397_263_652 129
914 3300046457 Ga0495590_0114198 Ga0495590_0114198_88_477 129
915 3300046459 Ga0495629_0001477 Ga0495629_0001477_2505_2894 129
916 3300046459 Ga0495629_0350234 Ga0495629_0350234_147_536 129
917 3300046459 Ga0495629_0377067 Ga0495629_0377067_509_898 129
918 3300046460 Ga0495638_0050928 Ga0495638_0050928_218_607 129
919 3300046460 Ga0495638_0654827 Ga0495638_0654827_58_447 129
920 3300046461 Ga0495641_0039881 Ga0495641_0039881_1485_1874 129
921 3300046461 Ga0495641_0167335 Ga0495641_0167335_79_468 129
922 3300046462 Ga0495651_0001224 Ga0495651_0001224_15030_15419 129
923 3300046462 Ga0495651_0005238 Ga0495651_0005238_6571_6960 129
924 3300046462 Ga0495651_0021305 Ga0495651_0021305_2826_3215 129
925 3300046463 Ga0495653_0022871 Ga0495653_0022871_3028_3417 129
926 3300046463 Ga0495653_0042382 Ga0495653_0042382_630_1019 129
927 3300046463 Ga0495653_0083798 Ga0495653_0083798_749_1138 129
928 3300046463 Ga0495653_0464076 Ga0495653_0464076_212_601 129
929 3300046472 Ga0495580_0017328 Ga0495580_0017328_978_1367 129
930 3300046472 Ga0495580_0223459 Ga0495580_0223459_27_416 129
931 3300046473 Ga0495582_0006537 Ga0495582_0006537_1636_2025 129
932 3300046473 Ga0495582_0659262 Ga0495582_0659262_160_549 129
933 3300046474 Ga0495605_0255393 Ga0495605_0255393_133_522 129
934 3300046475 Ga0495639_0027411 Ga0495639_0027411_147_536 129
935 3300046475 Ga0495639_0046153 Ga0495639_0046153_1118_1507 129
936 3300046476 Ga0495662_0048387 Ga0495662_0048387_144_533 129
937 3300046476 Ga0495662_0050106 Ga0495662_0050106_174_563 129
938 3300046477 Ga0495664_0004186 Ga0495664_0004186_3285_3674 129
939 3300046477 Ga0495664_0101750 Ga0495664_0101750_1095_1484 129
940 3300046477 Ga0495664_0106162 Ga0495664_0106162_650_1039 129
941 3300046491 Ga0495584_0024671 Ga0495584_0024671_2415_2804 129
942 3300046491 Ga0495584_0349846 Ga0495584_0349846_346_735 129
943 3300046492 Ga0495585_0001120 Ga0495585_0001120_12265_12654 129
944 3300046499 Ga0495594_0026443 Ga0495594_0026443_527_916 129
945 3300046499 Ga0495594_0043621 Ga0495594_0043621_332_721 129
946 3300046501 Ga0495607_0009551 Ga0495607_0009551_5280_5669 129
947 3300046506 Ga0495583_0202343 Ga0495583_0202343_91_480 129
948 3300046511 Ga0495608_0000894 Ga0495608_0000894_10455_10844 129
949 3300046513 Ga0495616_0137912 Ga0495616_0137912_466_855 129
950 3300046514 Ga0495618_0007468 Ga0495618_0007468_5997_6386 129
951 3300046514 Ga0495618_0016463 Ga0495618_0016463_1215_1604 129
952 3300046514 Ga0495618_0216138 Ga0495618_0216138_277_666 129
953 3300046516 Ga0495628_0001643 Ga0495628_0001643_3599_3988 129
954 3300046516 Ga0495628_0005224 Ga0495628_0005224_7557_7946 129
955 3300046516 Ga0495628_0079867 Ga0495628_0079867_1737_2126 129
956 3300046517 Ga0495630_0090226 Ga0495630_0090226_1332_1721 129
957 3300046517 Ga0495630_0265767 Ga0495630_0265767_632_1021 129
958 3300046518 Ga0495631_0461178 Ga0495631_0461178_34_423 129
959 3300046520 Ga0495637_0247086 Ga0495637_0247086_75_464 129
960 3300046523 Ga0495644_0000276 Ga0495644_0000276_17637_18026 129
961 3300046525 Ga0495663_0003625 Ga0495663_0003625_2146_2535 129
962 3300046526 Ga0495666_0030261 Ga0495666_0030261_2074_2463 129
963 3300046526 Ga0495666_0071263 Ga0495666_0071263_1188_1577 129
964 3300046529 Ga0495652_0005225 Ga0495652_0005225_553_942 129
965 3300046529 Ga0495652_0013895 Ga0495652_0013895_2802_3191 129
966 3300046529 Ga0495652_0054951 Ga0495652_0054951_1286_1675 129
967 3300046529 Ga0495652_0182600 Ga0495652_0182600_896_1285 129
968 3300046531 Ga0495665_0005432 Ga0495665_0005432_5527_5916 129
969 3300046531 Ga0495665_0108659 Ga0495665_0108659_194_583 129
970 3300046533 Ga0495640_0009470 Ga0495640_0009470_1541_1930 129
971 3300046533 Ga0495640_0190803 Ga0495640_0190803_458_847 129
972 3300046533 Ga0495640_0301469 Ga0495640_0301469_57_446 129
973 3300046533 Ga0495640_0313416 Ga0495640_0313416_147_536 129
974 3300046535 Ga0495586_0034648 Ga0495586_0034648_25_414 129
975 3300046536 Ga0495587_0002982 Ga0495587_0002982_6937_7326 129
976 3300046536 Ga0495587_0019533 Ga0495587_0019533_2194_2583 129
977 3300046536 Ga0495587_0020752 Ga0495587_0020752_1263_1652 129
978 3300046537 Ga0495598_0010089 Ga0495598_0010089_416_805 129
979 3300046543 Ga0495645_0007183 Ga0495645_0007183_6937_7326 129
980 3300046543 Ga0495645_0051654 Ga0495645_0051654_1991_2380 129
981 3300046557 Ga0495622_0012450 Ga0495622_0012450_1091_1480 129
982 3300046557 Ga0495622_0037807 Ga0495622_0037807_422_811 129
983 3300046558 Ga0495633_0006390 Ga0495633_0006390_3405_3794 129
984 3300046559 Ga0495667_0006825 Ga0495667_0006825_5332_5721 129
985 3300046559 Ga0495667_0020138 Ga0495667_0020138_977_1366 129
986 3300046559 Ga0495667_0050526 Ga0495667_0050526_1706_2095 129
987 3300046615 Ga0495656_0000754 Ga0495656_0000754_7516_7905 129
988 3300046642 Ga0495634_0112115 Ga0495634_0112115_476_865 129
989 3300046642 Ga0495634_0204657 Ga0495634_0204657_309_698 129
990 3300046648 Ga0495611_0003788 Ga0495611_0003788_3201_3590 129
991 3300046663 Ga0495635_0026238 Ga0495635_0026238_1523_1912 129
992 3300046663 Ga0495635_0044778 Ga0495635_0044778_2581_2970 129
993 3300046663 Ga0495635_0100441 Ga0495635_0100441_192_581 129
994 3300046663 Ga0495635_0121067 Ga0495635_0121067_511_900 129
995 3300046664 Ga0495659_0000313 Ga0495659_0000313_14246_14635 129
996 3300046674 Ga0495588_0081088 Ga0495588_0081088_965_1354 129
997 3300046675 Ga0495657_0007186 Ga0495657_0007186_4885_5274 129
998 3300046675 Ga0495657_0504829 Ga0495657_0504829_273_662 129
999 3300046675 Ga0495657_0623366 Ga0495657_0623366_85_474 129
1000 3300046678 Ga0495599_0003276 Ga0495599_0003276_7213_7602 129
1001 3300046679 Ga0495623_0004045 Ga0495623_0004045_2328_2717 129
1002 3300046679 Ga0495623_0010576 Ga0495623_0010576_3470_3859 129
1003 3300046680 Ga0495646_0002740 Ga0495646_0002740_3445_3834 129
1004 3300046680 Ga0495646_0010561 Ga0495646_0010561_5415_5804 129
1005 3300046680 Ga0495646_0113630 Ga0495646_0113630_62_451 129
1006 3300046681 Ga0495647_0032878 Ga0495647_0032878_27_416 129
1007 3300046681 Ga0495647_0043528 Ga0495647_0043528_1121_1510 129
1008 3300046681 Ga0495647_0057038 Ga0495647_0057038_177_566 129
1009 3300046683 Ga0495658_0001518 Ga0495658_0001518_6318_6707 129
1010 3300046683 Ga0495658_0010651 Ga0495658_0010651_3974_4363 129
1011 3300046683 Ga0495658_0211672 Ga0495658_0211672_533_922 129
1012 3300046683 Ga0495658_0472600 Ga0495658_0472600_59_448 129
1013 3300046684 Ga0495669_0174490 Ga0495669_0174490_387_776 129
1014 3300046689 Ga0495613_0192980 Ga0495613_0192980_194_583 129
1015 3300046689 Ga0495613_0634045 Ga0495613_0634045_78_467 129
1016 3300046690 Ga0495624_0196456 Ga0495624_0196456_253_642 129
1017 3300046690 Ga0495624_0422902 Ga0495624_0422902_57_446 129
1018 3300046691 Ga0495670_0000678 Ga0495670_0000678_12026_12415 129
1019 3300046794 Ga0495589_0147333 Ga0495589_0147333_657_1046 129
1020 3300046809 Ga0495600_0015965 Ga0495600_0015965_190_579 129
1021 3300046809 Ga0495600_0021509 Ga0495600_0021509_2625_3014 129
1022 3300047315 Ga0495581_0005389 Ga0495581_0005389_1794_2183 129
1023 3300047315 Ga0495581_0054350 Ga0495581_0054350_28_417 129
1024 3300047315 Ga0495581_0337183 Ga0495581_0337183_123_512 129
1025 3300047317 Ga0495604_0005224 Ga0495604_0005224_2338_2727 129
1026 3300047317 Ga0495604_0020077 Ga0495604_0020077_1778_2167 129
1027 3300047317 Ga0495604_0036373 Ga0495604_0036373_198_587 129
1028 3300047319 Ga0495674_0065440 Ga0495674_0065440_596_985 129
1029 3300047319 Ga0495674_0131245 Ga0495674_0131245_580_969 129
1030 3300047319 Ga0495674_0203312 Ga0495674_0203312_844_1233 129
1031 3300047319 Ga0495674_0266832 Ga0495674_0266832_512_901 129
1032 3300047321 Ga0495676_0084467 Ga0495676_0084467_978_1367 129
1033 3300047321 Ga0495676_0094678 Ga0495676_0094678_26_415 129
1034 3300047321 Ga0495676_0453639 Ga0495676_0453639_394_783 129
1035 3300047322 Ga0495680_0010223 Ga0495680_0010223_803_1192 129
1036 3300047322 Ga0495680_0012624 Ga0495680_0012624_2975_3364 129
1037 3300047322 Ga0495680_0030552 Ga0495680_0030552_3476_3865 129
1038 3300047322 Ga0495680_0098448 Ga0495680_0098448_147_536 129
1039 3300047444 Ga0495675_0001149 Ga0495675_0001149_7340_7729 129
1040 3300047444 Ga0495675_0780306 Ga0495675_0780306_14_403 129
1041 3300047445 Ga0495677_0057187 Ga0495677_0057187_940_1329 129
1042 3300047446 Ga0495679_020206 Ga0495679_020206_1729_2118 129
1043 3300047471 Ga0495684_0003052 Ga0495684_0003052_12505_12894 129
1044 3300047471 Ga0495684_0129052 Ga0495684_0129052_179_568 129
1045 3300047673 Ga0495593_0025793 Ga0495593_0025793_972_1361 129
1046 3300047673 Ga0495593_0259740 Ga0495593_0259740_41_430 129
1047 3300048088 Ga0495602_0009459 Ga0495602_0009459_7187_7576 129
1048 3300048088 Ga0495602_0019879 Ga0495602_0019879_1428_1817 129
1049 3300048088 Ga0495602_0882401 Ga0495602_0882401_89_478 129
1050 3300048089 Ga0495614_0027957 Ga0495614_0027957_355_744 129
1051 3300048089 Ga0495614_0061537 Ga0495614_0061537_599_988 129
1052 3300048089 Ga0495614_0494616 Ga0495614_0494616_82_471 129
1053 3300048903 Ga0496100_0003970 Ga0496100_0003970_3767_4156 129
1054 3300048903 Ga0496100_0164294 Ga0496100_0164294_647_1036 129
1055 3300048903 Ga0496100_0610600 Ga0496100_0610600_116_505 129
1056 3300048904 Ga0496101_0001569 Ga0496101_0001569_10012_10401 129
1057 3300048904 Ga0496101_0020202 Ga0496101_0020202_2555_2944 129
1058 3300048904 Ga0496101_0050260 Ga0496101_0050260_28_417 129
1059 3300048904 Ga0496101_0250973 Ga0496101_0250973_325_714 129
1060 3300048904 Ga0496101_0642548 Ga0496101_0642548_65_454 129
1061 3300048905 Ga0496102_0004673 Ga0496102_0004673_11059_11448 129
1062 3300048905 Ga0496102_0018222 Ga0496102_0018222_561_950 129
1063 3300048905 Ga0496102_0081843 Ga0496102_0081843_2028_2417 129
1064 3300048905 Ga0496102_0113730 Ga0496102_0113730_1532_1921 129
1065 3300048905 Ga0496102_0414458 Ga0496102_0414458_662_1051 129
1066 3300048905 Ga0496102_0938567 Ga0496102_0938567_104_493 129
1067 3300048906 Ga0496103_0000430 Ga0496103_0000430_23308_23697 129
1068 3300048906 Ga0496103_0008308 Ga0496103_0008308_532_921 129
1069 3300048906 Ga0496103_0039270 Ga0496103_0039270_102_491 129
1070 3300048906 Ga0496103_0045716 Ga0496103_0045716_1172_1561 129
1071 3300048906 Ga0496103_0115786 Ga0496103_0115786_119_508 129
1072 3300048906 Ga0496103_0120597 Ga0496103_0120597_725_1114 129
1073 3300048907 Ga0496104_0000090 Ga0496104_0000090_3635_4024 129
1074 3300048907 Ga0496104_0130526 Ga0496104_0130526_1611_2000 129
1075 3300048907 Ga0496104_0167267 Ga0496104_0167267_1187_1576 129
1076 3300048907 Ga0496104_0208475 Ga0496104_0208475_364_753 129
1077 3300048907 Ga0496104_0306891 Ga0496104_0306891_28_417 129
1078 3300048907 Ga0496104_0433438 Ga0496104_0433438_684_1073 129
1079 3300048908 Ga0496105_0036668 Ga0496105_0036668_928_1317 129
1080 3300048908 Ga0496105_0064401 Ga0496105_0064401_112_501 129
1081 3300048908 Ga0496105_0066007 Ga0496105_0066007_1005_1394 129
1082 3300048908 Ga0496105_0171353 Ga0496105_0171353_330_719 129
1083 3300048908 Ga0496105_0278071 Ga0496105_0278071_430_819 129
1084 3300048908 Ga0496105_0392059 Ga0496105_0392059_430_819 129
1085 3300048909 Ga0496106_0003028 Ga0496106_0003028_11290_11679 129
1086 3300048909 Ga0496106_0007444 Ga0496106_0007444_901_1290 129
1087 3300048909 Ga0496106_0018178 Ga0496106_0018178_552_941 129
1088 3300048909 Ga0496106_0065164 Ga0496106_0065164_1500_1889 129
1089 3300048909 Ga0496106_0092461 Ga0496106_0092461_935_1324 129
1090 3300048909 Ga0496106_0248627 Ga0496106_0248627_855_1244 129
1091 3300048910 Ga0496107_0001324 Ga0496107_0001324_8689_9078 129
1092 3300048910 Ga0496107_0011160 Ga0496107_0011160_5792_6181 129
1093 3300048910 Ga0496107_0011716 Ga0496107_0011716_3880_4269 129
1094 3300048910 Ga0496107_0755280 Ga0496107_0755280_255_644 129
1095 3300048911 Ga0496108_0003835 Ga0496108_0003835_4002_4391 129
1096 3300048911 Ga0496108_0103714 Ga0496108_0103714_427_816 129
1097 3300048911 Ga0496108_0146984 Ga0496108_0146984_1518_1907 129
1098 3300048911 Ga0496108_0173049 Ga0496108_0173049_561_950 129
1099 3300048912 Ga0496109_0000338 Ga0496109_0000338_12869_13258 129
1100 3300048912 Ga0496109_0211106 Ga0496109_0211106_519_908 129
1101 3300048912 Ga0496109_0265648 Ga0496109_0265648_175_564 129
1102 3300048912 Ga0496109_0407527 Ga0496109_0407527_474_863 129
1103 3300048912 Ga0496109_0769848 Ga0496109_0769848_411_800 129
1104 3300048913 Ga0496110_0055234 Ga0496110_0055234_3061_3450 129
1105 3300048913 Ga0496110_0063385 Ga0496110_0063385_1205_1594 129
1106 3300048913 Ga0496110_0099831 Ga0496110_0099831_1839_2228 129
1107 3300048913 Ga0496110_0134508 Ga0496110_0134508_1512_1901 129
1108 3300048913 Ga0496110_0330086 Ga0496110_0330086_110_499 129
1109 3300048913 Ga0496110_0334522 Ga0496110_0334522_430_819 129
1110 3300048913 Ga0496110_0334533 Ga0496110_0334533_561_950 129
1111 3300048914 Ga0496111_0012615 Ga0496111_0012615_555_944 129
1112 3300048914 Ga0496111_0066000 Ga0496111_0066000_1617_2006 129
1113 3300048914 Ga0496111_0397003 Ga0496111_0397003_142_531 129
1114 3300048914 Ga0496111_0524722 Ga0496111_0524722_67_456 129
1115 3300048914 Ga0496111_0709182 Ga0496111_0709182_209_598 129
1116 3300048915 Ga0496112_0005440 Ga0496112_0005440_430_819 129
1117 3300048915 Ga0496112_0069073 Ga0496112_0069073_250_639 129
1118 3300048915 Ga0496112_0069190 Ga0496112_0069190_1488_1877 129
1119 3300048915 Ga0496112_0096794 Ga0496112_0096794_726_1115 129
1120 3300048915 Ga0496112_0111044 Ga0496112_0111044_277_666 129
1121 3300048915 Ga0496112_0117700 Ga0496112_0117700_860_1249 129
1122 3300048915 Ga0496112_0426531 Ga0496112_0426531_430_819 129
1123 3300048915 Ga0496112_0999933 Ga0496112_0999933_88_480 129
1124 3300048916 Ga0496113_0010323 Ga0496113_0010323_1920_2309 129
1125 3300048916 Ga0496113_0131711 Ga0496113_0131711_415_804 129
1126 3300048916 Ga0496113_0262535 Ga0496113_0262535_561_950 129
1127 3300048916 Ga0496113_0383164 Ga0496113_0383164_430_819 129
1128 3300048917 Ga0496114_0005514 Ga0496114_0005514_4084_4473 129
1129 3300048917 Ga0496114_0009307 Ga0496114_0009307_559_948 129
1130 3300048918 Ga0496115_0004496 Ga0496115_0004496_6390_6779 129
1131 3300048918 Ga0496115_0036924 Ga0496115_0036924_1611_2000 129
1132 3300048918 Ga0496115_0045977 Ga0496115_0045977_150_539 129
1133 3300048918 Ga0496115_0087837 Ga0496115_0087837_1140_1529 129
1134 3300048918 Ga0496115_0100371 Ga0496115_0100371_1536_1925 129
1135 3300048918 Ga0496115_0129008 Ga0496115_0129008_53_442 129
1136 3300048918 Ga0496115_0423279 Ga0496115_0423279_114_503 129
1137 3300048918 Ga0496115_0465645 Ga0496115_0465645_389_778 129
1138 3300048928 Ga0496125_0656793 Ga0496125_0656793_133_522 129
1139 3300049575 Ga0501039_0481395 Ga0501039_0481395_419_808 129
1140 3300049580 Ga0501046_0661581 Ga0501046_0661581_183_572 129
1141 3300049581 Ga0501047_0085402 Ga0501047_0085402_1953_2342 129
1142 3300049581 Ga0501047_0309500 Ga0501047_0309500_549_938 129
1143 3300049585 Ga0501069_0419835 Ga0501069_0419835_204_596 129
1144 3300049586 Ga0501070_0015452 Ga0501070_0015452_4352_4741 129
1145 3300049587 Ga0501071_1261250 Ga0501071_1261250_104_493 129
1146 3300049590 Ga0501074_0294528 Ga0501074_0294528_58_447 129
1147 3300049590 Ga0501074_0674977 Ga0501074_0674977_273_662 129
1148 3300049593 Ga0501077_0061042 Ga0501077_0061042_1936_2325 129
1149 3300049741 Ga0501079_1623864 Ga0501079_1623864_52_441 129
1150 3300049743 Ga0501081_0418876 Ga0501081_0418876_305_694 129
1151 3300049823 Ga0501044_0158608 Ga0501044_0158608_1193_1582 129
1152 3300049823 Ga0501044_0623399 Ga0501044_0623399_213_602 129
1153 3300049823 Ga0501044_0761432 Ga0501044_0761432_157_546 129
1154 3300049824 Ga0501045_0564976 Ga0501045_0564976_96_485 129
1155 3300050490 nmdc:mga03n38_679272_c1 nmdc:mga03n38_679272_c1_68_460 129
1156 3300050494 nmdc:mga06z11_15118_c1 nmdc:mga06z11_15118_c1_2145_2534 129
1157 3300050496 nmdc:mga07m45_195205_c1 nmdc:mga07m45_195205_c1_544_933 129
1158 3300050496 nmdc:mga07m45_601319_c1 nmdc:mga07m45_601319_c1_141_533 129
1159 3300050507 nmdc:mga05p37_1602_c1 nmdc:mga05p37_1602_c1_6956_7345 129
1160 3300050508 nmdc:mga09592_7132_c1 nmdc:mga09592_7132_c1_275_664 129
1161 3300050509 nmdc:mga0qj67_556_c1 nmdc:mga0qj67_556_c1_18514_18903 129
1162 3300050510 nmdc:mga06r32_8190_c1 nmdc:mga06r32_8190_c1_2190_2579 129
1163 3300050511 nmdc:mga08y16_2018_c1 nmdc:mga08y16_2018_c1_14535_14924 129
1164 3300050511 nmdc:mga08y16_4650_c1 nmdc:mga08y16_4650_c1_13499_13888 129
1165 3300050511 nmdc:mga08y16_659742_c1 nmdc:mga08y16_659742_c1_246_635 129
1166 3300050511 nmdc:mga08y16_66505_c1 nmdc:mga08y16_66505_c1_234_623 129
1167 3300050512 nmdc:mga0n895_1478_c1 nmdc:mga0n895_1478_c1_3525_3914 129
1168 3300050512 nmdc:mga0n895_389772_c1 nmdc:mga0n895_389772_c1_827_1216 129
1169 3300050512 nmdc:mga0n895_45434_c1 nmdc:mga0n895_45434_c1_2459_2848 129
1170 3300050512 nmdc:mga0n895_51021_c1 nmdc:mga0n895_51021_c1_2623_3012 129
1171 3300050512 nmdc:mga0n895_543_c1 nmdc:mga0n895_543_c1_21690_22079 129
1172 3300050512 nmdc:mga0n895_673468_c1 nmdc:mga0n895_673468_c1_624_1013 129
1173 3300050513 nmdc:mga0rr50_21800_c1 nmdc:mga0rr50_21800_c1_2638_3027 129
1174 3300050513 nmdc:mga0rr50_30768_c1 nmdc:mga0rr50_30768_c1_509_898 129
1175 3300050513 nmdc:mga0rr50_812_c1 nmdc:mga0rr50_812_c1_12396_12785 129
1176 3300050514 nmdc:mga08x19_10925_c1 nmdc:mga08x19_10925_c1_4054_4443 129
1177 3300050514 nmdc:mga08x19_281324_c1 nmdc:mga08x19_281324_c1_506_895 129
1178 3300050515 nmdc:mga0a205_22992_c1 nmdc:mga0a205_22992_c1_4011_4400 129
1179 3300050515 nmdc:mga0a205_416_c1 nmdc:mga0a205_416_c1_1924_2313 129
1180 3300050515 nmdc:mga0a205_80693_c1 nmdc:mga0a205_80693_c1_2463_2852 129
1181 3300053077 Ga0495601_0000432 Ga0495601_0000432_13313_13702 129
1182 3300053077 Ga0495601_0002128 Ga0495601_0002128_553_942 129
1183 3300053077 Ga0495601_0003953 Ga0495601_0003953_3722_4111 129
1184 3300053077 Ga0495601_0319739 Ga0495601_0319739_290_679 129
1185 3300053078 Ga0495612_0000870 Ga0495612_0000870_553_942 129
1186 3300053078 Ga0495612_0003173 Ga0495612_0003173_148_537 129
1187 3300053078 Ga0495612_0005259 Ga0495612_0005259_3993_4382 129
1188 3300053078 Ga0495612_0026808 Ga0495612_0026808_816_1205 129
1189 3300053084 Ga0495595_0001669 Ga0495595_0001669_7549_7938 129
1190 3300053084 Ga0495595_0069696 Ga0495595_0069696_1114_1503 129
1191 3300053084 Ga0495595_0252704 Ga0495595_0252704_450_839 129
1192 3300053085 Ga0495619_0000646 Ga0495619_0000646_3548_3937 129
1193 3300053085 Ga0495619_0001716 Ga0495619_0001716_730_1119 129
1194 3300053085 Ga0495619_0009254 Ga0495619_0009254_5446_5835 129
1195 3300053085 Ga0495619_0026265 Ga0495619_0026265_1913_2302 129
1196 3300053085 Ga0495619_0035384 Ga0495619_0035384_966_1355 129
1197 3300053087 Ga0500643_005975 Ga0500643_005975_3636_4025 129
1198 3300053088 Ga0500644_0001048 Ga0500644_0001048_4110_4499 129
1199 3300053093 Ga0500651_0001317 Ga0500651_0001317_4499_4888 129
1200 3300053094 Ga0500566_0225643 Ga0500566_0225643_16_405 129
1201 3300053119 Ga0500595_000207 Ga0500595_000207_36786_37175 129
1202 3300053130 Ga0500642_0086259 Ga0500642_0086259_17_406 129
1203 3300053131 Ga0500652_101713 Ga0500652_101713_85_474 129
1204 3300053153 Ga0500616_0000006 Ga0500616_0000006_918519_918908 129
1205 3300053728 Ga0500657_073848 Ga0500657_073848_145_534 129
1206 3300053730 Ga0500645_000809 Ga0500645_000809_4248_4637 129
1207 3300060353 Ga0501082_0005955 Ga0501082_0005955_1254_1643 129
1208 iso_pu_bacteria 2523231067 2523467226 129
1209 iso_pu_bacteria 2738543031 2739347735 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04430

DUF498

Protein of unknown function (DUF498/DUF598)

32

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fi9-assembly1.cif.gz_A the crystal structure of an outer membrane protein from the bartonella henselae 0.9626 11 129
2fi9-assembly1.cif.gz_A the crystal structure of an outer membrane protein from the bartonella henselae 0.9548 11 129
3cpk-assembly1.cif.gz_A crystal structure of the q7w7n7_borpa protein from bordetella parapertussis. northeast structural genomics consortium target ber31 0.8955 14 127
2fvt-assembly1.cif.gz_A nmr structure of the rpa2829 protein from rhodopseudomonas palustris: northeast structural genomics target rpr43 0.8833 10 129
2k2e-assembly1.cif.gz_A solution nmr structure of bordetella pertussis protein bp2786, a mth938-like domain. northeast structural genomics consortium target ber31 0.8655 16 127
ID Description Score Start End Superfamily
af_A0A0P0VZT1_1_69_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.9658 69 129 3.40.50.10190
2fi9A00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9626 11 129 3.40.1230.10
2fi9A00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9548 11 129 3.40.1230.10
af_Q9BU61_55_171_3.40.1230.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9264 14 129 3.40.1230.10
af_A0A1D6P6M4_78_189_3.40.1230.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9165 20 127 3.40.1230.10
ID Description Score Start End GO Terms
AF-A0A812UYF5-F1-model_v4 deleted 0.9869 30 127
AF-A0A436CPS0-F1-model_v4 Uncharacterized protein 0.9856 64 129
AF-A0A4D7QNA1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9842 31 129
AF-A0A4R3G007-F1-model_v4 Uncharacterized protein DUF498/DUF598 0.9839 55 128
AF-A0A7U3E1F9-F1-model_v4 deleted 0.9797 12 128

Feature Viewer

pLDDT pTM Quality
93.28 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map