F491450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1190 | 456 | 2380 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300047319|Ga0495674_0854457|Ga0495674_0854457_28_447 |
| Length | 139 |
| Sequence | MIAVRRQIWRLPATAAKLAATTEETRMALKRMVLEIGMGTDIRGAEPTKAAVRALRDALWHNSLSIAKALGQDTDAMRVEVTIGVPHPEKVDRQAVLDVLPHGTGTVTVVDGGLEIPNEDGTNSTLIASAAAVVWLDVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 147 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 281 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 284 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 285 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 288 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 289 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 290 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 291 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 294 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 295 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 296 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 297 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 298 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 299 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 300 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 301 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 302 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 303 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 377 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 378 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 379 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 383 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 384 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 414 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 415 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 416 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 418 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 434 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 435 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 436 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 438 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 439 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 440 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 441 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 442 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 443 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 445 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 446 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 447 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 449 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 452 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.76 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.29 |
| Nodule | 0 |
| Rhizoplane | 6.39 |
| Rhizosphere | 85.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495674_0854457 | 3300047319 | Bacteria | 705 |
| 2 | JGI24742J22300_10014305 | 3300002244 | Bacteria | 1333 |
| 3 | JGI25407J50210_10133011 | 3300003373 | Unclassified | 612 |
| 4 | JGI25405J52794_10004546 | 3300003911 | Bacteria | 2477 |
| 5 | Ga0058863_11093206 | 3300004799 | Unclassified | 665 |
| 6 | Ga0058860_11548922 | 3300004801 | Bacteria | 1314 |
| 7 | Ga0065712_10023621 | 3300005290 | Bacteria | 1354 |
| 8 | Ga0070683_100158931 | 3300005329 | Bacteria | 2144 |
| 9 | Ga0070683_100939234 | 3300005329 | Bacteria | 830 |
| 10 | Ga0070683_101699656 | 3300005329 | Bacteria | 607 |
| 11 | Ga0070690_100061985 | 3300005330 | Bacteria | 2411 |
| 12 | Ga0070690_100152708 | 3300005330 | Bacteria | 1577 |
| 13 | Ga0070690_100495446 | 3300005330 | Bacteria | 913 |
| 14 | Ga0070690_100518083 | 3300005330 | Bacteria | 895 |
| 15 | Ga0070670_100363148 | 3300005331 | Bacteria | 1273 |
| 16 | Ga0070670_100397336 | 3300005331 | Bacteria | 1217 |
| 17 | Ga0070670_101739863 | 3300005331 | Bacteria | 574 |
| 18 | Ga0070677_10018331 | 3300005333 | Bacteria | 2519 |
| 19 | Ga0070677_10314602 | 3300005333 | Bacteria | 800 |
| 20 | Ga0068869_101484217 | 3300005334 | Unclassified | 602 |
| 21 | Ga0070666_10575430 | 3300005335 | Bacteria | 821 |
| 22 | Ga0070680_100139963 | 3300005336 | Bacteria | 2029 |
| 23 | Ga0070680_100340656 | 3300005336 | Bacteria | 1274 |
| 24 | Ga0070682_100315300 | 3300005337 | Bacteria | 1153 |
| 25 | Ga0070682_100963335 | 3300005337 | Bacteria | 705 |
| 26 | Ga0070682_102086687 | 3300005337 | Bacteria | 500 |
| 27 | Ga0068868_100071958 | 3300005338 | Bacteria | 2758 |
| 28 | Ga0068868_101388657 | 3300005338 | Bacteria | 655 |
| 29 | Ga0070660_100163158 | 3300005339 | Bacteria | 1796 |
| 30 | Ga0070689_100008245 | 3300005340 | Bacteria | 7329 |
| 31 | Ga0070689_100064441 | 3300005340 | Bacteria | 2852 |
| 32 | Ga0070689_100135248 | 3300005340 | Bacteria | 1979 |
| 33 | Ga0070689_100480643 | 3300005340 | Bacteria | 1061 |
| 34 | Ga0070689_100796865 | 3300005340 | Bacteria | 831 |
| 35 | Ga0070689_101356060 | 3300005340 | Bacteria | 642 |
| 36 | Ga0070691_10006074 | 3300005341 | Bacteria | 5511 |
| 37 | Ga0070691_10662237 | 3300005341 | Bacteria | 623 |
| 38 | Ga0070687_100208121 | 3300005343 | Bacteria | 1190 |
| 39 | Ga0070687_101269276 | 3300005343 | Unclassified | 546 |
| 40 | Ga0070661_100091876 | 3300005344 | Bacteria | 2248 |
| 41 | Ga0070668_100331153 | 3300005347 | Bacteria | 1284 |
| 42 | Ga0070668_100970452 | 3300005347 | Bacteria | 762 |
| 43 | Ga0070668_101572990 | 3300005347 | Bacteria | 602 |
| 44 | Ga0070668_101908989 | 3300005347 | Bacteria | 547 |
| 45 | Ga0070669_100196560 | 3300005353 | Bacteria | 1585 |
| 46 | Ga0070669_100232123 | 3300005353 | Bacteria | 1463 |
| 47 | Ga0070675_100082318 | 3300005354 | Bacteria | 2685 |
| 48 | Ga0070675_100437783 | 3300005354 | Bacteria | 1171 |
| 49 | Ga0070675_101350474 | 3300005354 | Bacteria | 657 |
| 50 | Ga0070671_100021982 | 3300005355 | Bacteria | 5211 |
| 51 | Ga0070671_100701205 | 3300005355 | Bacteria | 878 |
| 52 | Ga0070671_100802416 | 3300005355 | Bacteria | 820 |
| 53 | Ga0070674_100010635 | 3300005356 | Bacteria | 5573 |
| 54 | Ga0070674_100112052 | 3300005356 | Unclassified | 2005 |
| 55 | Ga0070674_100117366 | 3300005356 | Bacteria | 1965 |
| 56 | Ga0070674_100289908 | 3300005356 | Bacteria | 1301 |
| 57 | Ga0070674_100986250 | 3300005356 | Bacteria | 738 |
| 58 | Ga0070673_100137809 | 3300005364 | Bacteria | 2056 |
| 59 | Ga0070673_100376553 | 3300005364 | Bacteria | 1265 |
| 60 | Ga0070688_100012110 | 3300005365 | Bacteria | 4820 |
| 61 | Ga0070688_100151760 | 3300005365 | Bacteria | 1584 |
| 62 | Ga0070688_100166754 | 3300005365 | Bacteria | 1517 |
| 63 | Ga0070667_100192368 | 3300005367 | Bacteria | 1808 |
| 64 | Ga0070667_100488528 | 3300005367 | Bacteria | 1128 |
| 65 | Ga0070667_100492452 | 3300005367 | Bacteria | 1123 |
| 66 | Ga0070667_101755320 | 3300005367 | Bacteria | 584 |
| 67 | Ga0070667_101952114 | 3300005367 | Bacteria | 553 |
| 68 | Ga0070709_10007571 | 3300005434 | Bacteria | 5959 |
| 69 | Ga0070709_10124121 | 3300005434 | Bacteria | 1754 |
| 70 | Ga0070714_100018088 | 3300005435 | Bacteria | 5717 |
| 71 | Ga0070714_100168116 | 3300005435 | Unclassified | 1988 |
| 72 | Ga0070714_100411091 | 3300005435 | Bacteria | 1281 |
| 73 | Ga0070714_100653455 | 3300005435 | Bacteria | 1012 |
| 74 | Ga0070714_101024995 | 3300005435 | Bacteria | 803 |
| 75 | Ga0070714_101579019 | 3300005435 | Bacteria | 641 |
| 76 | Ga0070713_100006041 | 3300005436 | Bacteria | 8342 |
| 77 | Ga0070713_100078171 | 3300005436 | Bacteria | 2816 |
| 78 | Ga0070713_100154139 | 3300005436 | Bacteria | 2046 |
| 79 | Ga0070713_100364983 | 3300005436 | Bacteria | 1342 |
| 80 | Ga0070713_100964321 | 3300005436 | Bacteria | 822 |
| 81 | Ga0070713_100969616 | 3300005436 | Unclassified | 819 |
| 82 | Ga0070710_10012582 | 3300005437 | Bacteria | 4207 |
| 83 | Ga0070710_10254974 | 3300005437 | Bacteria | 1129 |
| 84 | Ga0070710_10972555 | 3300005437 | Unclassified | 617 |
| 85 | Ga0070701_10415234 | 3300005438 | Bacteria | 856 |
| 86 | Ga0070701_10853306 | 3300005438 | Bacteria | 625 |
| 87 | Ga0070711_100073767 | 3300005439 | Bacteria | 2412 |
| 88 | Ga0070711_100206778 | 3300005439 | Bacteria | 1518 |
| 89 | Ga0070711_100224018 | 3300005439 | Bacteria | 1463 |
| 90 | Ga0070711_101634774 | 3300005439 | Bacteria | 564 |
| 91 | Ga0070711_102049001 | 3300005439 | Bacteria | 504 |
| 92 | Ga0070705_101744876 | 3300005440 | Bacteria | 527 |
| 93 | Ga0070700_100748916 | 3300005441 | Bacteria | 782 |
| 94 | Ga0070700_101753626 | 3300005441 | Bacteria | 534 |
| 95 | Ga0070694_100619898 | 3300005444 | Bacteria | 873 |
| 96 | Ga0070663_100452942 | 3300005455 | Bacteria | 1058 |
| 97 | Ga0070678_100013179 | 3300005456 | Bacteria | 5173 |
| 98 | Ga0070678_100221473 | 3300005456 | Bacteria | 1573 |
| 99 | Ga0070678_101695546 | 3300005456 | Bacteria | 595 |
| 100 | Ga0070662_100398856 | 3300005457 | Bacteria | 1135 |
| 101 | Ga0070662_100406832 | 3300005457 | Bacteria | 1124 |
| 102 | Ga0070662_100448392 | 3300005457 | Archaea | 1071 |
| 103 | Ga0070662_101908064 | 3300005457 | Unclassified | 513 |
| 104 | Ga0070681_10001152 | 3300005458 | Bacteria | 22827 |
| 105 | Ga0070681_10050252 | 3300005458 | Bacteria | 4161 |
| 106 | Ga0070681_10053270 | 3300005458 | Bacteria | 4032 |
| 107 | Ga0070681_10175294 | 3300005458 | Bacteria | 2066 |
| 108 | Ga0070681_10747078 | 3300005458 | Bacteria | 895 |
| 109 | Ga0070681_11669001 | 3300005458 | Bacteria | 563 |
| 110 | Ga0068867_100065628 | 3300005459 | Bacteria | 2701 |
| 111 | Ga0068867_100094632 | 3300005459 | Unclassified | 2272 |
| 112 | Ga0070685_10114736 | 3300005466 | Bacteria | 1665 |
| 113 | Ga0070706_100023584 | 3300005467 | Bacteria | 5665 |
| 114 | Ga0070706_100056966 | 3300005467 | Unclassified | 3606 |
| 115 | Ga0070706_100466967 | 3300005467 | Bacteria | 1174 |
| 116 | Ga0070706_101260131 | 3300005467 | Bacteria | 679 |
| 117 | Ga0070707_100007453 | 3300005468 | Bacteria | 10158 |
| 118 | Ga0070707_100140150 | 3300005468 | Bacteria | 2353 |
| 119 | Ga0070707_100146332 | 3300005468 | Unclassified | 2300 |
| 120 | Ga0070707_100902267 | 3300005468 | Bacteria | 848 |
| 121 | Ga0070698_100006683 | 3300005471 | Bacteria | 12506 |
| 122 | Ga0070698_100017475 | 3300005471 | Bacteria | 7559 |
| 123 | Ga0070698_100452986 | 3300005471 | Bacteria | 1219 |
| 124 | Ga0070698_100943854 | 3300005471 | Unclassified | 809 |
| 125 | Ga0070699_100054647 | 3300005518 | Bacteria | 3456 |
| 126 | Ga0070699_100276354 | 3300005518 | Bacteria | 1504 |
| 127 | Ga0070699_100364658 | 3300005518 | Bacteria | 1303 |
| 128 | Ga0070679_100159111 | 3300005530 | Bacteria | 2233 |
| 129 | Ga0070679_100180933 | 3300005530 | Bacteria | 2080 |
| 130 | Ga0070679_100207872 | 3300005530 | Bacteria | 1922 |
| 131 | Ga0070679_100456462 | 3300005530 | Bacteria | 1222 |
| 132 | Ga0070679_101700880 | 3300005530 | Unclassified | 579 |
| 133 | Ga0070684_100011059 | 3300005535 | Bacteria | 7178 |
| 134 | Ga0070697_100246407 | 3300005536 | Bacteria | 1527 |
| 135 | Ga0070697_100996691 | 3300005536 | Bacteria | 745 |
| 136 | Ga0068853_101109756 | 3300005539 | Bacteria | 763 |
| 137 | Ga0068853_102009444 | 3300005539 | Bacteria | 561 |
| 138 | Ga0070672_100033169 | 3300005543 | Bacteria | 3907 |
| 139 | Ga0070686_100037537 | 3300005544 | Bacteria | 3006 |
| 140 | Ga0070686_100313888 | 3300005544 | Bacteria | 1167 |
| 141 | Ga0070686_100518435 | 3300005544 | Unclassified | 928 |
| 142 | Ga0070686_100566207 | 3300005544 | Bacteria | 891 |
| 143 | Ga0070686_100881849 | 3300005544 | Bacteria | 727 |
| 144 | Ga0070696_100067310 | 3300005546 | Bacteria | 2513 |
| 145 | Ga0070696_100851041 | 3300005546 | Bacteria | 754 |
| 146 | Ga0070665_100160208 | 3300005548 | Bacteria | 2252 |
| 147 | Ga0070665_101391392 | 3300005548 | Bacteria | 711 |
| 148 | Ga0070704_102202895 | 3300005549 | Unclassified | 512 |
| 149 | Ga0068855_100017426 | 3300005563 | Bacteria | 8640 |
| 150 | Ga0068855_100588956 | 3300005563 | Bacteria | 1201 |
| 151 | Ga0068855_100605833 | 3300005563 | Bacteria | 1181 |
| 152 | Ga0068855_100724604 | 3300005563 | Bacteria | 1062 |
| 153 | Ga0068855_100797900 | 3300005563 | Bacteria | 1004 |
| 154 | Ga0070664_100038843 | 3300005564 | Bacteria | 4008 |
| 155 | Ga0068857_100037617 | 3300005577 | Bacteria | 4288 |
| 156 | Ga0068857_100338446 | 3300005577 | Bacteria | 1392 |
| 157 | Ga0068856_100041817 | 3300005614 | Bacteria | 4506 |
| 158 | Ga0068856_100065822 | 3300005614 | Bacteria | 3581 |
| 159 | Ga0068856_100300969 | 3300005614 | Bacteria | 1621 |
| 160 | Ga0068856_100442780 | 3300005614 | Bacteria | 1320 |
| 161 | Ga0068856_100512557 | 3300005614 | Bacteria | 1220 |
| 162 | Ga0070702_100194932 | 3300005615 | Bacteria | 1336 |
| 163 | Ga0070702_100442140 | 3300005615 | Bacteria | 941 |
| 164 | Ga0070702_100809645 | 3300005615 | Bacteria | 725 |
| 165 | Ga0070702_101354084 | 3300005615 | Bacteria | 580 |
| 166 | Ga0068852_100088311 | 3300005616 | Bacteria | 2768 |
| 167 | Ga0068859_100096097 | 3300005617 | Bacteria | 3016 |
| 168 | Ga0068859_100242826 | 3300005617 | Bacteria | 1890 |
| 169 | Ga0068859_100788006 | 3300005617 | Bacteria | 1039 |
| 170 | Ga0068859_100799588 | 3300005617 | Bacteria | 1031 |
| 171 | Ga0068859_100948072 | 3300005617 | Bacteria | 944 |
| 172 | Ga0068864_100007330 | 3300005618 | Bacteria | 9078 |
| 173 | Ga0068864_100034477 | 3300005618 | Bacteria | 4306 |
| 174 | Ga0068864_100348548 | 3300005618 | Bacteria | 1396 |
| 175 | Ga0068864_100722957 | 3300005618 | Bacteria | 974 |
| 176 | Ga0068866_10645951 | 3300005718 | Bacteria | 720 |
| 177 | Ga0068861_100048984 | 3300005719 | Bacteria | 3197 |
| 178 | Ga0068861_100570778 | 3300005719 | Bacteria | 1034 |
| 179 | Ga0068861_100918525 | 3300005719 | Bacteria | 830 |
| 180 | Ga0068861_101144080 | 3300005719 | Unclassified | 750 |
| 181 | Ga0068861_101737301 | 3300005719 | Bacteria | 618 |
| 182 | Ga0068870_10547109 | 3300005840 | Bacteria | 779 |
| 183 | Ga0068870_11257347 | 3300005840 | Bacteria | 538 |
| 184 | Ga0068863_100794686 | 3300005841 | Bacteria | 944 |
| 185 | Ga0068863_101679409 | 3300005841 | Bacteria | 645 |
| 186 | Ga0068863_101730723 | 3300005841 | Bacteria | 635 |
| 187 | Ga0068858_100169996 | 3300005842 | Bacteria | 2055 |
| 188 | Ga0068858_100866311 | 3300005842 | Bacteria | 882 |
| 189 | Ga0068858_102343213 | 3300005842 | Bacteria | 528 |
| 190 | Ga0068858_102411374 | 3300005842 | Bacteria | 520 |
| 191 | Ga0068860_100113245 | 3300005843 | Unclassified | 2594 |
| 192 | Ga0068860_100127998 | 3300005843 | Bacteria | 2435 |
| 193 | Ga0068860_100656527 | 3300005843 | Bacteria | 1057 |
| 194 | Ga0068860_100765755 | 3300005843 | Bacteria | 978 |
| 195 | Ga0068860_101328784 | 3300005843 | Bacteria | 740 |
| 196 | Ga0068860_101681736 | 3300005843 | Bacteria | 657 |
| 197 | Ga0068862_100263019 | 3300005844 | Bacteria | 1575 |
| 198 | Ga0068862_100365558 | 3300005844 | Bacteria | 1342 |
| 199 | Ga0068862_101025373 | 3300005844 | Unclassified | 817 |
| 200 | Ga0068862_101166789 | 3300005844 | Bacteria | 767 |
| 201 | Ga0081455_10001285 | 3300005937 | Bacteria | 31211 |
| 202 | Ga0081455_10004152 | 3300005937 | Bacteria | 16350 |
| 203 | Ga0081455_10008714 | 3300005937 | Bacteria | 10505 |
| 204 | Ga0081455_10019848 | 3300005937 | Bacteria | 6347 |
| 205 | Ga0081455_10119563 | 3300005937 | Bacteria | 2077 |
| 206 | Ga0081455_10218615 | 3300005937 | Bacteria | 1414 |
| 207 | Ga0081455_10278708 | 3300005937 | Bacteria | 1209 |
| 208 | Ga0081538_10002503 | 3300005981 | Bacteria | 17887 |
| 209 | Ga0081538_10046120 | 3300005981 | Unclassified | 2693 |
| 210 | Ga0081538_10183794 | 3300005981 | Unclassified | 890 |
| 211 | Ga0081538_10212529 | 3300005981 | Bacteria | 778 |
| 212 | Ga0081540_1014265 | 3300005983 | Bacteria | 5102 |
| 213 | Ga0081540_1016449 | 3300005983 | Bacteria | 4627 |
| 214 | Ga0081540_1038882 | 3300005983 | Unclassified | 2501 |
| 215 | Ga0081540_1148069 | 3300005983 | Bacteria | 931 |
| 216 | Ga0081539_10014566 | 3300005985 | Bacteria | 5803 |
| 217 | Ga0081539_10058101 | 3300005985 | Bacteria | 2137 |
| 218 | Ga0081539_10074035 | 3300005985 | Bacteria | 1815 |
| 219 | Ga0070717_10009576 | 3300006028 | Bacteria | 7287 |
| 220 | Ga0070717_10087937 | 3300006028 | Bacteria | 2618 |
| 221 | Ga0070717_10125013 | 3300006028 | Unclassified | 2207 |
| 222 | Ga0070717_10296143 | 3300006028 | Bacteria | 1437 |
| 223 | Ga0070717_10412267 | 3300006028 | Bacteria | 1214 |
| 224 | Ga0070717_11476863 | 3300006028 | Unclassified | 617 |
| 225 | Ga0070717_11712133 | 3300006028 | Bacteria | 569 |
| 226 | Ga0075365_10332686 | 3300006038 | Bacteria | 1070 |
| 227 | Ga0075363_100019332 | 3300006048 | Bacteria | 3405 |
| 228 | Ga0075363_100022989 | 3300006048 | Bacteria | 3155 |
| 229 | Ga0075363_100166982 | 3300006048 | Bacteria | 1248 |
| 230 | Ga0075363_100527483 | 3300006048 | Bacteria | 703 |
| 231 | Ga0075364_10131778 | 3300006051 | Bacteria | 1678 |
| 232 | Ga0075432_10039613 | 3300006058 | Bacteria | 1644 |
| 233 | Ga0075432_10388938 | 3300006058 | Unclassified | 600 |
| 234 | Ga0075432_10575100 | 3300006058 | Unclassified | 512 |
| 235 | Ga0070715_10538716 | 3300006163 | Unclassified | 675 |
| 236 | Ga0070716_100503650 | 3300006173 | Bacteria | 894 |
| 237 | Ga0070712_100010216 | 3300006175 | Bacteria | 5919 |
| 238 | Ga0070712_100021390 | 3300006175 | Bacteria | 4249 |
| 239 | Ga0070712_100067347 | 3300006175 | Bacteria | 2547 |
| 240 | Ga0070712_100119875 | 3300006175 | Bacteria | 1978 |
| 241 | Ga0070712_100470190 | 3300006175 | Unclassified | 1050 |
| 242 | Ga0070712_100495111 | 3300006175 | Unclassified | 1024 |
| 243 | Ga0070712_100676336 | 3300006175 | Bacteria | 878 |
| 244 | Ga0070712_100996561 | 3300006175 | Bacteria | 725 |
| 245 | Ga0075362_10072161 | 3300006177 | Bacteria | 1579 |
| 246 | Ga0075362_10074633 | 3300006177 | Bacteria | 1554 |
| 247 | Ga0075362_10743328 | 3300006177 | Bacteria | 513 |
| 248 | Ga0075367_10023684 | 3300006178 | Bacteria | 3457 |
| 249 | Ga0075367_10173410 | 3300006178 | Bacteria | 1344 |
| 250 | Ga0075367_10250046 | 3300006178 | Bacteria | 1112 |
| 251 | Ga0075367_10294798 | 3300006178 | Bacteria | 1021 |
| 252 | Ga0075367_10350921 | 3300006178 | Unclassified | 931 |
| 253 | Ga0075369_10123622 | 3300006186 | Bacteria | 1172 |
| 254 | Ga0075369_10275118 | 3300006186 | Bacteria | 784 |
| 255 | Ga0075427_10008235 | 3300006194 | Unclassified | 1543 |
| 256 | Ga0075366_10353431 | 3300006195 | Unclassified | 902 |
| 257 | Ga0097621_100939877 | 3300006237 | Bacteria | 807 |
| 258 | Ga0075370_10249521 | 3300006353 | Bacteria | 1052 |
| 259 | Ga0068871_100205742 | 3300006358 | Bacteria | 1701 |
| 260 | Ga0068871_100514203 | 3300006358 | Unclassified | 1081 |
| 261 | Ga0068871_102303062 | 3300006358 | Bacteria | 514 |
| 262 | Ga0075428_100004619 | 3300006844 | Bacteria | 15233 |
| 263 | Ga0075428_100009365 | 3300006844 | Bacteria | 10864 |
| 264 | Ga0075428_100030936 | 3300006844 | Bacteria | 5919 |
| 265 | Ga0075428_100115423 | 3300006844 | Bacteria | 2925 |
| 266 | Ga0075428_100311398 | 3300006844 | Unclassified | 1692 |
| 267 | Ga0075428_100693178 | 3300006844 | Unclassified | 1085 |
| 268 | Ga0075428_100697433 | 3300006844 | Bacteria | 1082 |
| 269 | Ga0075430_100007440 | 3300006846 | Bacteria | 9244 |
| 270 | Ga0075430_100046813 | 3300006846 | Bacteria | 3652 |
| 271 | Ga0075430_100071358 | 3300006846 | Unclassified | 2913 |
| 272 | Ga0075430_100116692 | 3300006846 | Bacteria | 2225 |
| 273 | Ga0075430_100679175 | 3300006846 | Unclassified | 849 |
| 274 | Ga0075430_101251585 | 3300006846 | Unclassified | 611 |
| 275 | Ga0075430_101602258 | 3300006846 | Bacteria | 535 |
| 276 | Ga0075431_100004380 | 3300006847 | Bacteria | 13852 |
| 277 | Ga0075431_100086642 | 3300006847 | Unclassified | 3232 |
| 278 | Ga0075431_100105157 | 3300006847 | Bacteria | 2913 |
| 279 | Ga0075431_100267726 | 3300006847 | Unclassified | 1733 |
| 280 | Ga0075431_100838345 | 3300006847 | Unclassified | 891 |
| 281 | Ga0075431_101453645 | 3300006847 | Unclassified | 644 |
| 282 | Ga0075433_10079299 | 3300006852 | Bacteria | 2893 |
| 283 | Ga0075433_10244853 | 3300006852 | Bacteria | 1592 |
| 284 | Ga0075433_10851719 | 3300006852 | Bacteria | 796 |
| 285 | Ga0075434_100043527 | 3300006871 | Bacteria | 4453 |
| 286 | Ga0075434_100843931 | 3300006871 | Unclassified | 932 |
| 287 | Ga0075429_100016046 | 3300006880 | Bacteria | 6488 |
| 288 | Ga0075429_100061691 | 3300006880 | Bacteria | 3267 |
| 289 | Ga0075429_100110914 | 3300006880 | Unclassified | 2398 |
| 290 | Ga0075429_100349170 | 3300006880 | Bacteria | 1295 |
| 291 | Ga0075429_101155172 | 3300006880 | Unclassified | 676 |
| 292 | Ga0075429_102001837 | 3300006880 | Bacteria | 501 |
| 293 | Ga0068865_100577511 | 3300006881 | Bacteria | 947 |
| 294 | Ga0068865_100599593 | 3300006881 | Bacteria | 931 |
| 295 | Ga0097620_100096099 | 3300006931 | Bacteria | 3016 |
| 296 | Ga0097620_100242823 | 3300006931 | Bacteria | 1890 |
| 297 | Ga0097620_100787964 | 3300006931 | Bacteria | 1039 |
| 298 | Ga0097620_100799612 | 3300006931 | Bacteria | 1031 |
| 299 | Ga0097620_100811535 | 3300006931 | Bacteria | 1023 |
| 300 | Ga0097620_100947842 | 3300006931 | Bacteria | 944 |
| 301 | Ga0075435_100502802 | 3300007076 | Bacteria | 1048 |
| 302 | Ga0075435_100627976 | 3300007076 | Bacteria | 932 |
| 303 | Ga0075435_100858525 | 3300007076 | Bacteria | 791 |
| 304 | Ga0075435_101432830 | 3300007076 | Bacteria | 605 |
| 305 | Ga0075435_101506190 | 3300007076 | Bacteria | 590 |
| 306 | Ga0099794_10276412 | 3300007265 | Bacteria | 868 |
| 307 | Ga0099795_10000237 | 3300007788 | Bacteria | 9757 |
| 308 | Ga0099795_10222530 | 3300007788 | Bacteria | 804 |
| 309 | Ga0099795_10423471 | 3300007788 | Unclassified | 609 |
| 310 | Ga0105244_10512402 | 3300009036 | Unclassified | 552 |
| 311 | Ga0105250_10578213 | 3300009092 | Bacteria | 518 |
| 312 | Ga0105240_10003467 | 3300009093 | Bacteria | 24468 |
| 313 | Ga0105240_11469625 | 3300009093 | Bacteria | 715 |
| 314 | Ga0111539_10025624 | 3300009094 | Bacteria | 7227 |
| 315 | Ga0111539_10046741 | 3300009094 | Bacteria | 5176 |
| 316 | Ga0111539_10508411 | 3300009094 | Bacteria | 1403 |
| 317 | Ga0111539_10946076 | 3300009094 | Bacteria | 1002 |
| 318 | Ga0111539_12191432 | 3300009094 | Bacteria | 641 |
| 319 | Ga0105245_10404063 | 3300009098 | Bacteria | 1366 |
| 320 | Ga0105245_10480631 | 3300009098 | Bacteria | 1255 |
| 321 | Ga0105245_10575379 | 3300009098 | Bacteria | 1150 |
| 322 | Ga0105245_10644779 | 3300009098 | Bacteria | 1089 |
| 323 | Ga0105245_12035332 | 3300009098 | Bacteria | 628 |
| 324 | Ga0105245_12140468 | 3300009098 | Bacteria | 613 |
| 325 | Ga0105247_10141812 | 3300009101 | Bacteria | 1575 |
| 326 | Ga0105247_10206481 | 3300009101 | Bacteria | 1323 |
| 327 | Ga0105247_10216862 | 3300009101 | Bacteria | 1293 |
| 328 | Ga0105247_10291189 | 3300009101 | Bacteria | 1129 |
| 329 | Ga0105247_10779696 | 3300009101 | Bacteria | 727 |
| 330 | Ga0114129_10052483 | 3300009147 | Bacteria | 5722 |
| 331 | Ga0114129_10519023 | 3300009147 | Bacteria | 1553 |
| 332 | Ga0114129_10722934 | 3300009147 | Bacteria | 1277 |
| 333 | Ga0114129_10789325 | 3300009147 | Bacteria | 1212 |
| 334 | Ga0114129_10794148 | 3300009147 | Bacteria | 1208 |
| 335 | Ga0105243_10532913 | 3300009148 | Bacteria | 1119 |
| 336 | Ga0105243_11042280 | 3300009148 | Bacteria | 823 |
| 337 | Ga0105243_11510507 | 3300009148 | Bacteria | 696 |
| 338 | Ga0105243_11593944 | 3300009148 | Unclassified | 679 |
| 339 | Ga0105241_11708505 | 3300009174 | Bacteria | 612 |
| 340 | Ga0105242_10532453 | 3300009176 | Bacteria | 1123 |
| 341 | Ga0105242_10720827 | 3300009176 | Bacteria | 978 |
| 342 | Ga0105242_10768729 | 3300009176 | Bacteria | 950 |
| 343 | Ga0105248_10126790 | 3300009177 | Bacteria | 2879 |
| 344 | Ga0105248_10273984 | 3300009177 | Bacteria | 1900 |
| 345 | Ga0105248_10319558 | 3300009177 | Bacteria | 1748 |
| 346 | Ga0105248_10567922 | 3300009177 | Bacteria | 1280 |
| 347 | Ga0105248_10644158 | 3300009177 | Bacteria | 1196 |
| 348 | Ga0105248_11008614 | 3300009177 | Bacteria | 940 |
| 349 | Ga0105248_12238285 | 3300009177 | Bacteria | 622 |
| 350 | Ga0105248_12466221 | 3300009177 | Bacteria | 593 |
| 351 | Ga0105237_10314451 | 3300009545 | Bacteria | 1569 |
| 352 | Ga0105237_10964138 | 3300009545 | Bacteria | 860 |
| 353 | Ga0105238_10122740 | 3300009551 | Bacteria | 2577 |
| 354 | Ga0105238_10763625 | 3300009551 | Bacteria | 981 |
| 355 | Ga0105238_11180702 | 3300009551 | Bacteria | 789 |
| 356 | Ga0105249_10240746 | 3300009553 | Bacteria | 1789 |
| 357 | Ga0105249_10890360 | 3300009553 | Bacteria | 957 |
| 358 | Ga0105249_11718657 | 3300009553 | Bacteria | 700 |
| 359 | Ga0105249_11808700 | 3300009553 | Bacteria | 683 |
| 360 | Ga0105035_102989 | 3300009988 | Bacteria | 1278 |
| 361 | Ga0099796_10004441 | 3300010159 | Bacteria | 3394 |
| 362 | Ga0099796_10085129 | 3300010159 | Bacteria | 1166 |
| 363 | Ga0099796_10168623 | 3300010159 | Unclassified | 872 |
| 364 | Ga0105239_10182724 | 3300010375 | Bacteria | 2346 |
| 365 | Ga0105239_11414181 | 3300010375 | Bacteria | 803 |
| 366 | Ga0105239_12813857 | 3300010375 | Bacteria | 568 |
| 367 | Ga0105246_10007415 | 3300011119 | Bacteria | 6723 |
| 368 | Ga0105246_11094296 | 3300011119 | Bacteria | 727 |
| 369 | Ga0157373_10203756 | 3300013100 | Bacteria | 1395 |
| 370 | Ga0157371_10128371 | 3300013102 | Bacteria | 1803 |
| 371 | Ga0157371_10529333 | 3300013102 | Bacteria | 872 |
| 372 | Ga0157369_10121041 | 3300013105 | Bacteria | 2777 |
| 373 | Ga0157369_11558158 | 3300013105 | Bacteria | 672 |
| 374 | Ga0157374_10240273 | 3300013296 | Bacteria | 1781 |
| 375 | Ga0157374_11823319 | 3300013296 | Bacteria | 634 |
| 376 | Ga0157374_11996801 | 3300013296 | Bacteria | 606 |
| 377 | Ga0157374_12096208 | 3300013296 | Bacteria | 592 |
| 378 | Ga0157374_12543035 | 3300013296 | Bacteria | 539 |
| 379 | Ga0157378_10429898 | 3300013297 | Bacteria | 1307 |
| 380 | Ga0157378_10533562 | 3300013297 | Bacteria | 1177 |
| 381 | Ga0157378_12206831 | 3300013297 | Bacteria | 602 |
| 382 | Ga0157378_12264081 | 3300013297 | Bacteria | 595 |
| 383 | Ga0157378_12413445 | 3300013297 | Bacteria | 578 |
| 384 | Ga0163162_10755250 | 3300013306 | Bacteria | 1092 |
| 385 | Ga0163162_11508254 | 3300013306 | Bacteria | 766 |
| 386 | Ga0163162_11936868 | 3300013306 | Bacteria | 675 |
| 387 | Ga0163162_12948786 | 3300013306 | Unclassified | 547 |
| 388 | Ga0157372_10128361 | 3300013307 | Bacteria | 2916 |
| 389 | Ga0157375_10141049 | 3300013308 | Unclassified | 2537 |
| 390 | Ga0157375_10143093 | 3300013308 | Bacteria | 2520 |
| 391 | Ga0157375_10321265 | 3300013308 | Unclassified | 1713 |
| 392 | Ga0157375_10605121 | 3300013308 | Bacteria | 1255 |
| 393 | Ga0163163_10039996 | 3300014325 | Bacteria | 4578 |
| 394 | Ga0163163_10040918 | 3300014325 | Bacteria | 4529 |
| 395 | Ga0163163_10141456 | 3300014325 | Bacteria | 2449 |
| 396 | Ga0163163_10494785 | 3300014325 | Bacteria | 1284 |
| 397 | Ga0163163_10677964 | 3300014325 | Bacteria | 1094 |
| 398 | Ga0163163_11186309 | 3300014325 | Bacteria | 826 |
| 399 | Ga0163163_11748428 | 3300014325 | Bacteria | 682 |
| 400 | Ga0157380_10174558 | 3300014326 | Unclassified | 1881 |
| 401 | Ga0157380_10210907 | 3300014326 | Bacteria | 1731 |
| 402 | Ga0157380_10892163 | 3300014326 | Bacteria | 914 |
| 403 | Ga0157380_11275194 | 3300014326 | Unclassified | 781 |
| 404 | Ga0157380_13230620 | 3300014326 | Unclassified | 521 |
| 405 | Ga0182008_10037470 | 3300014497 | Bacteria | 2426 |
| 406 | Ga0157377_10971819 | 3300014745 | Bacteria | 641 |
| 407 | Ga0157377_10986003 | 3300014745 | Unclassified | 637 |
| 408 | Ga0157379_10043895 | 3300014968 | Bacteria | 3992 |
| 409 | Ga0157379_10080970 | 3300014968 | Bacteria | 2909 |
| 410 | Ga0157379_10182222 | 3300014968 | Bacteria | 1897 |
| 411 | Ga0157379_10511215 | 3300014968 | Bacteria | 1114 |
| 412 | Ga0157379_11519288 | 3300014968 | Bacteria | 652 |
| 413 | Ga0157379_12175113 | 3300014968 | Bacteria | 551 |
| 414 | Ga0157376_10285904 | 3300014969 | Bacteria | 1555 |
| 415 | Ga0157376_10362786 | 3300014969 | Bacteria | 1390 |
| 416 | Ga0157376_10656299 | 3300014969 | Bacteria | 1050 |
| 417 | Ga0157376_10894626 | 3300014969 | Bacteria | 906 |
| 418 | Ga0182007_10069741 | 3300015262 | Bacteria | 1152 |
| 419 | Ga0163161_10162370 | 3300017792 | Bacteria | 1704 |
| 420 | Ga0163161_10451607 | 3300017792 | Bacteria | 1039 |
| 421 | Ga0163161_10776870 | 3300017792 | Bacteria | 803 |
| 422 | Ga0163161_10804494 | 3300017792 | Unclassified | 790 |
| 423 | Ga0206354_10341732 | 3300020081 | Bacteria | 938 |
| 424 | Ga0206353_11599512 | 3300020082 | Bacteria | 886 |
| 425 | Ga0213872_10440986 | 3300021361 | Bacteria | 524 |
| 426 | Ga0213874_10238262 | 3300021377 | Bacteria | 667 |
| 427 | Ga0213876_10041220 | 3300021384 | Bacteria | 2440 |
| 428 | Ga0213875_10007211 | 3300021388 | Bacteria | 5765 |
| 429 | Ga0213875_10129936 | 3300021388 | Bacteria | 1178 |
| 430 | Ga0213871_10023826 | 3300021441 | Bacteria | 1544 |
| 431 | Ga0224712_10282220 | 3300022467 | Bacteria | 773 |
| 432 | Ga0228598_1039612 | 3300024227 | Bacteria | 930 |
| 433 | Ga0207426_1071031 | 3300025302 | Bacteria | 971 |
| 434 | Ga0207682_10002121 | 3300025893 | Bacteria | 8985 |
| 435 | Ga0207682_10362151 | 3300025893 | Bacteria | 684 |
| 436 | Ga0207692_10019780 | 3300025898 | Bacteria | 3049 |
| 437 | Ga0207692_10032657 | 3300025898 | Bacteria | 2503 |
| 438 | Ga0207692_10074755 | 3300025898 | Bacteria | 1796 |
| 439 | Ga0207692_10142181 | 3300025898 | Bacteria | 1366 |
| 440 | Ga0207692_10669558 | 3300025898 | Bacteria | 672 |
| 441 | Ga0207692_10787014 | 3300025898 | Unclassified | 621 |
| 442 | Ga0207692_10956745 | 3300025898 | Unclassified | 564 |
| 443 | Ga0207692_11210198 | 3300025898 | Bacteria | 502 |
| 444 | Ga0207642_10062410 | 3300025899 | Bacteria | 1738 |
| 445 | Ga0207642_10400806 | 3300025899 | Bacteria | 821 |
| 446 | Ga0207710_10088984 | 3300025900 | Bacteria | 1442 |
| 447 | Ga0207688_10002666 | 3300025901 | Bacteria | 9666 |
| 448 | Ga0207688_10076000 | 3300025901 | Unclassified | 1912 |
| 449 | Ga0207688_10119204 | 3300025901 | Bacteria | 1538 |
| 450 | Ga0207688_10141901 | 3300025901 | Bacteria | 1414 |
| 451 | Ga0207680_10379792 | 3300025903 | Bacteria | 996 |
| 452 | Ga0207680_10573296 | 3300025903 | Bacteria | 806 |
| 453 | Ga0207680_11069310 | 3300025903 | Bacteria | 577 |
| 454 | Ga0207647_10143742 | 3300025904 | Bacteria | 1397 |
| 455 | Ga0207699_10018475 | 3300025906 | Bacteria | 3695 |
| 456 | Ga0207699_10174489 | 3300025906 | Bacteria | 1441 |
| 457 | Ga0207699_10426556 | 3300025906 | Bacteria | 948 |
| 458 | Ga0207699_10885331 | 3300025906 | Bacteria | 658 |
| 459 | Ga0207645_10105493 | 3300025907 | Bacteria | 1821 |
| 460 | Ga0207643_10001626 | 3300025908 | Bacteria | 12666 |
| 461 | Ga0207643_10080461 | 3300025908 | Bacteria | 1887 |
| 462 | Ga0207643_10294986 | 3300025908 | Bacteria | 1008 |
| 463 | Ga0207705_10094832 | 3300025909 | Bacteria | 2189 |
| 464 | Ga0207684_10069874 | 3300025910 | Unclassified | 2984 |
| 465 | Ga0207684_10074148 | 3300025910 | Bacteria | 2891 |
| 466 | Ga0207684_10232221 | 3300025910 | Bacteria | 1592 |
| 467 | Ga0207684_10478400 | 3300025910 | Bacteria | 1068 |
| 468 | Ga0207654_10227211 | 3300025911 | Bacteria | 1241 |
| 469 | Ga0207654_10466281 | 3300025911 | Bacteria | 888 |
| 470 | Ga0207654_10852797 | 3300025911 | Bacteria | 659 |
| 471 | Ga0207707_10041293 | 3300025912 | Bacteria | 4029 |
| 472 | Ga0207707_10101471 | 3300025912 | Unclassified | 2515 |
| 473 | Ga0207707_10148664 | 3300025912 | Bacteria | 2048 |
| 474 | Ga0207707_10239271 | 3300025912 | Bacteria | 1578 |
| 475 | Ga0207707_11369431 | 3300025912 | Bacteria | 566 |
| 476 | Ga0207695_10054005 | 3300025913 | Bacteria | 4199 |
| 477 | Ga0207695_10546229 | 3300025913 | Bacteria | 1040 |
| 478 | Ga0207671_10080602 | 3300025914 | Bacteria | 2440 |
| 479 | Ga0207693_10002165 | 3300025915 | Bacteria | 17116 |
| 480 | Ga0207693_10017026 | 3300025915 | Bacteria | 5803 |
| 481 | Ga0207693_10019034 | 3300025915 | Bacteria | 5465 |
| 482 | Ga0207693_10020506 | 3300025915 | Bacteria | 5257 |
| 483 | Ga0207693_10059066 | 3300025915 | Bacteria | 3004 |
| 484 | Ga0207693_10118265 | 3300025915 | Bacteria | 2081 |
| 485 | Ga0207693_10181876 | 3300025915 | Bacteria | 1654 |
| 486 | Ga0207693_10213555 | 3300025915 | Bacteria | 1516 |
| 487 | Ga0207693_10667639 | 3300025915 | Bacteria | 807 |
| 488 | Ga0207693_11334537 | 3300025915 | Bacteria | 535 |
| 489 | Ga0207663_10240670 | 3300025916 | Unclassified | 1327 |
| 490 | Ga0207663_10433683 | 3300025916 | Bacteria | 1011 |
| 491 | Ga0207663_11493280 | 3300025916 | Bacteria | 544 |
| 492 | Ga0207660_10010887 | 3300025917 | Bacteria | 5913 |
| 493 | Ga0207660_10572969 | 3300025917 | Bacteria | 919 |
| 494 | Ga0207660_10826523 | 3300025917 | Bacteria | 756 |
| 495 | Ga0207662_10018906 | 3300025918 | Bacteria | 3913 |
| 496 | Ga0207657_10091291 | 3300025919 | Bacteria | 2540 |
| 497 | Ga0207649_10103950 | 3300025920 | Bacteria | 1885 |
| 498 | Ga0207652_10339566 | 3300025921 | Bacteria | 1356 |
| 499 | Ga0207652_11011763 | 3300025921 | Bacteria | 730 |
| 500 | Ga0207646_10092084 | 3300025922 | Bacteria | 2713 |
| 501 | Ga0207646_10125031 | 3300025922 | Unclassified | 2312 |
| 502 | Ga0207646_10176670 | 3300025922 | Bacteria | 1929 |
| 503 | Ga0207646_10546134 | 3300025922 | Bacteria | 1042 |
| 504 | Ga0207646_10784922 | 3300025922 | Bacteria | 849 |
| 505 | Ga0207646_11347838 | 3300025922 | Bacteria | 622 |
| 506 | Ga0207681_10139159 | 3300025923 | Bacteria | 1806 |
| 507 | Ga0207681_10675818 | 3300025923 | Bacteria | 857 |
| 508 | Ga0207681_10811169 | 3300025923 | Bacteria | 782 |
| 509 | Ga0207681_11194820 | 3300025923 | Bacteria | 639 |
| 510 | Ga0207681_11503921 | 3300025923 | Bacteria | 564 |
| 511 | Ga0207694_10213191 | 3300025924 | Bacteria | 1573 |
| 512 | Ga0207650_10700860 | 3300025925 | Unclassified | 855 |
| 513 | Ga0207650_10818887 | 3300025925 | Bacteria | 789 |
| 514 | Ga0207659_10114491 | 3300025926 | Bacteria | 2056 |
| 515 | Ga0207659_10304725 | 3300025926 | Bacteria | 1310 |
| 516 | Ga0207659_10760968 | 3300025926 | Bacteria | 831 |
| 517 | Ga0207687_10251508 | 3300025927 | Bacteria | 1405 |
| 518 | Ga0207700_10062858 | 3300025928 | Bacteria | 2821 |
| 519 | Ga0207700_10067540 | 3300025928 | Bacteria | 2737 |
| 520 | Ga0207700_10200541 | 3300025928 | Bacteria | 1681 |
| 521 | Ga0207700_10406805 | 3300025928 | Unclassified | 1193 |
| 522 | Ga0207700_10658349 | 3300025928 | Bacteria | 934 |
| 523 | Ga0207700_10916603 | 3300025928 | Bacteria | 784 |
| 524 | Ga0207664_10045279 | 3300025929 | Bacteria | 3450 |
| 525 | Ga0207664_10098990 | 3300025929 | Bacteria | 2405 |
| 526 | Ga0207664_10141638 | 3300025929 | Bacteria | 2035 |
| 527 | Ga0207664_10640116 | 3300025929 | Bacteria | 955 |
| 528 | Ga0207664_11418911 | 3300025929 | Bacteria | 615 |
| 529 | Ga0207644_10022359 | 3300025931 | Bacteria | 4320 |
| 530 | Ga0207644_10164837 | 3300025931 | Unclassified | 1726 |
| 531 | Ga0207644_10756443 | 3300025931 | Bacteria | 812 |
| 532 | Ga0207644_11659092 | 3300025931 | Bacteria | 536 |
| 533 | Ga0207690_10049381 | 3300025932 | Bacteria | 2804 |
| 534 | Ga0207690_10335871 | 3300025932 | Bacteria | 1191 |
| 535 | Ga0207690_11832280 | 3300025932 | Bacteria | 506 |
| 536 | Ga0207706_10339881 | 3300025933 | Bacteria | 1306 |
| 537 | Ga0207706_10348142 | 3300025933 | Bacteria | 1288 |
| 538 | Ga0207686_10220929 | 3300025934 | Bacteria | 1368 |
| 539 | Ga0207709_11475976 | 3300025935 | Bacteria | 564 |
| 540 | Ga0207670_10008201 | 3300025936 | Bacteria | 5881 |
| 541 | Ga0207670_10091586 | 3300025936 | Bacteria | 2150 |
| 542 | Ga0207670_10672719 | 3300025936 | Bacteria | 855 |
| 543 | Ga0207670_11499685 | 3300025936 | Bacteria | 573 |
| 544 | Ga0207669_10160054 | 3300025937 | Unclassified | 1589 |
| 545 | Ga0207669_10224009 | 3300025937 | Bacteria | 1382 |
| 546 | Ga0207669_11099660 | 3300025937 | Bacteria | 671 |
| 547 | Ga0207704_10150491 | 3300025938 | Bacteria | 1641 |
| 548 | Ga0207704_10425345 | 3300025938 | Bacteria | 1054 |
| 549 | Ga0207665_10109139 | 3300025939 | Unclassified | 1942 |
| 550 | Ga0207665_10664763 | 3300025939 | Unclassified | 817 |
| 551 | Ga0207691_10004008 | 3300025940 | Bacteria | 14283 |
| 552 | Ga0207691_10036729 | 3300025940 | Bacteria | 4539 |
| 553 | Ga0207691_10217212 | 3300025940 | Bacteria | 1659 |
| 554 | Ga0207691_10236149 | 3300025940 | Bacteria | 1582 |
| 555 | Ga0207711_10003717 | 3300025941 | Bacteria | 13152 |
| 556 | Ga0207711_10155377 | 3300025941 | Bacteria | 2067 |
| 557 | Ga0207711_10440290 | 3300025941 | Bacteria | 1213 |
| 558 | Ga0207711_10860221 | 3300025941 | Bacteria | 844 |
| 559 | Ga0207711_11210955 | 3300025941 | Bacteria | 697 |
| 560 | Ga0207711_11296590 | 3300025941 | Bacteria | 670 |
| 561 | Ga0207711_11583785 | 3300025941 | Bacteria | 598 |
| 562 | Ga0207711_11671325 | 3300025941 | Bacteria | 580 |
| 563 | Ga0207689_10547649 | 3300025942 | Bacteria | 972 |
| 564 | Ga0207689_10551476 | 3300025942 | Bacteria | 968 |
| 565 | Ga0207689_11055628 | 3300025942 | Bacteria | 685 |
| 566 | Ga0207661_10180940 | 3300025944 | Bacteria | 1841 |
| 567 | Ga0207661_10850935 | 3300025944 | Bacteria | 840 |
| 568 | Ga0207661_10941590 | 3300025944 | Bacteria | 796 |
| 569 | Ga0207661_11046541 | 3300025944 | Bacteria | 752 |
| 570 | Ga0207679_10223235 | 3300025945 | Bacteria | 1586 |
| 571 | Ga0207679_10491315 | 3300025945 | Bacteria | 1094 |
| 572 | Ga0207679_11816494 | 3300025945 | Unclassified | 557 |
| 573 | Ga0207667_10044823 | 3300025949 | Bacteria | 4686 |
| 574 | Ga0207667_10112413 | 3300025949 | Bacteria | 2809 |
| 575 | Ga0207667_10800475 | 3300025949 | Bacteria | 939 |
| 576 | Ga0207667_11307340 | 3300025949 | Bacteria | 701 |
| 577 | Ga0207651_10352725 | 3300025960 | Bacteria | 1239 |
| 578 | Ga0207651_10812275 | 3300025960 | Bacteria | 829 |
| 579 | Ga0207712_10747299 | 3300025961 | Bacteria | 857 |
| 580 | Ga0207712_10979989 | 3300025961 | Bacteria | 750 |
| 581 | Ga0207712_11859925 | 3300025961 | Unclassified | 539 |
| 582 | Ga0207668_10139663 | 3300025972 | Bacteria | 1861 |
| 583 | Ga0207668_10188695 | 3300025972 | Bacteria | 1632 |
| 584 | Ga0207668_11325258 | 3300025972 | Bacteria | 648 |
| 585 | Ga0207668_11673845 | 3300025972 | Bacteria | 574 |
| 586 | Ga0207658_10702240 | 3300025986 | Bacteria | 914 |
| 587 | Ga0207658_10921922 | 3300025986 | Bacteria | 796 |
| 588 | Ga0207677_10287169 | 3300026023 | Bacteria | 1353 |
| 589 | Ga0207677_12111355 | 3300026023 | Bacteria | 524 |
| 590 | Ga0207703_10243704 | 3300026035 | Bacteria | 1617 |
| 591 | Ga0207703_11863243 | 3300026035 | Bacteria | 578 |
| 592 | Ga0207639_10367097 | 3300026041 | Bacteria | 1290 |
| 593 | Ga0207639_10420398 | 3300026041 | Bacteria | 1208 |
| 594 | Ga0207678_10176275 | 3300026067 | Bacteria | 1825 |
| 595 | Ga0207678_10241455 | 3300026067 | Unclassified | 1547 |
| 596 | Ga0207678_11160044 | 3300026067 | Bacteria | 684 |
| 597 | Ga0207708_10212232 | 3300026075 | Bacteria | 1548 |
| 598 | Ga0207708_10423909 | 3300026075 | Bacteria | 1104 |
| 599 | Ga0207708_10896120 | 3300026075 | Bacteria | 767 |
| 600 | Ga0207702_10125306 | 3300026078 | Bacteria | 2305 |
| 601 | Ga0207702_10141254 | 3300026078 | Bacteria | 2179 |
| 602 | Ga0207702_10270420 | 3300026078 | Bacteria | 1603 |
| 603 | Ga0207702_10352266 | 3300026078 | Bacteria | 1409 |
| 604 | Ga0207702_11219866 | 3300026078 | Bacteria | 746 |
| 605 | Ga0207702_11655165 | 3300026078 | Bacteria | 633 |
| 606 | Ga0207702_12452370 | 3300026078 | Bacteria | 508 |
| 607 | Ga0207641_10360506 | 3300026088 | Bacteria | 1388 |
| 608 | Ga0207641_10776846 | 3300026088 | Bacteria | 947 |
| 609 | Ga0207641_11263007 | 3300026088 | Bacteria | 739 |
| 610 | Ga0207648_10051810 | 3300026089 | Unclassified | 3587 |
| 611 | Ga0207648_10089803 | 3300026089 | Bacteria | 2685 |
| 612 | Ga0207648_10955748 | 3300026089 | Bacteria | 802 |
| 613 | Ga0207676_10035299 | 3300026095 | Bacteria | 3794 |
| 614 | Ga0207676_10243527 | 3300026095 | Bacteria | 1615 |
| 615 | Ga0207676_10407903 | 3300026095 | Bacteria | 1271 |
| 616 | Ga0207676_12088330 | 3300026095 | Bacteria | 565 |
| 617 | Ga0207674_10046322 | 3300026116 | Bacteria | 4465 |
| 618 | Ga0207674_10068392 | 3300026116 | Bacteria | 3574 |
| 619 | Ga0207675_100004996 | 3300026118 | Bacteria | 12776 |
| 620 | Ga0207675_100053730 | 3300026118 | Bacteria | 3758 |
| 621 | Ga0207675_100065085 | 3300026118 | Bacteria | 3407 |
| 622 | Ga0207675_100191830 | 3300026118 | Bacteria | 1960 |
| 623 | Ga0207675_100357476 | 3300026118 | Bacteria | 1432 |
| 624 | Ga0207675_100624734 | 3300026118 | Bacteria | 1082 |
| 625 | Ga0207675_101508907 | 3300026118 | Bacteria | 693 |
| 626 | Ga0207675_101773736 | 3300026118 | Unclassified | 637 |
| 627 | Ga0207683_10011410 | 3300026121 | Bacteria | 7582 |
| 628 | Ga0207683_10058366 | 3300026121 | Bacteria | 3388 |
| 629 | Ga0207683_10074150 | 3300026121 | Bacteria | 3011 |
| 630 | Ga0207683_10097598 | 3300026121 | Bacteria | 2621 |
| 631 | Ga0207683_11938959 | 3300026121 | Bacteria | 538 |
| 632 | Ga0207698_10233817 | 3300026142 | Bacteria | 1670 |
| 633 | Ga0207698_10903400 | 3300026142 | Bacteria | 890 |
| 634 | Ga0209179_1043654 | 3300027512 | Bacteria | 948 |
| 635 | Ga0209179_1142515 | 3300027512 | Bacteria | 535 |
| 636 | Ga0209813_10088531 | 3300027866 | Bacteria | 1035 |
| 637 | Ga0207428_10034685 | 3300027907 | Unclassified | 4131 |
| 638 | Ga0207428_10147229 | 3300027907 | Bacteria | 1794 |
| 639 | Ga0207428_10226536 | 3300027907 | Bacteria | 1400 |
| 640 | Ga0207428_10721362 | 3300027907 | Unclassified | 712 |
| 641 | Ga0268266_10834296 | 3300028379 | Bacteria | 891 |
| 642 | Ga0268265_10102216 | 3300028380 | Bacteria | 2318 |
| 643 | Ga0268265_10169505 | 3300028380 | Bacteria | 1864 |
| 644 | Ga0268265_10304816 | 3300028380 | Bacteria | 1436 |
| 645 | Ga0268265_10980491 | 3300028380 | Unclassified | 834 |
| 646 | Ga0268265_11096103 | 3300028380 | Unclassified | 790 |
| 647 | Ga0268264_10148943 | 3300028381 | Bacteria | 2096 |
| 648 | Ga0268264_10630079 | 3300028381 | Bacteria | 1059 |
| 649 | Ga0268264_10846845 | 3300028381 | Bacteria | 916 |
| 650 | Ga0265334_10025605 | 3300028573 | Bacteria | 2387 |
| 651 | Ga0265770_1058502 | 3300030878 | Bacteria | 713 |
| 652 | Ga0265760_10064822 | 3300031090 | Bacteria | 1114 |
| 653 | Ga0265330_10274584 | 3300031235 | Bacteria | 710 |
| 654 | Ga0265332_10110015 | 3300031238 | Bacteria | 1161 |
| 655 | Ga0265325_10071089 | 3300031241 | Bacteria | 1747 |
| 656 | Ga0265325_10530048 | 3300031241 | Bacteria | 510 |
| 657 | Ga0265329_10245595 | 3300031242 | Bacteria | 596 |
| 658 | Ga0265340_10157435 | 3300031247 | Bacteria | 1033 |
| 659 | Ga0265339_10512018 | 3300031249 | Bacteria | 554 |
| 660 | Ga0265339_10594919 | 3300031249 | Bacteria | 507 |
| 661 | Ga0265327_10064161 | 3300031251 | Bacteria | 1863 |
| 662 | Ga0265316_10245996 | 3300031344 | Bacteria | 1314 |
| 663 | Ga0265316_10911571 | 3300031344 | Bacteria | 614 |
| 664 | Ga0307513_10129091 | 3300031456 | Bacteria | 2477 |
| 665 | Ga0265342_10304322 | 3300031712 | Bacteria | 839 |
| 666 | Ga0316576_10004877 | 3300031727 | Bacteria | 8108 |
| 667 | Ga0307405_10158387 | 3300031731 | Bacteria | 1601 |
| 668 | Ga0307413_10558187 | 3300031824 | Bacteria | 930 |
| 669 | Ga0307413_10590571 | 3300031824 | Bacteria | 907 |
| 670 | Ga0307413_11439849 | 3300031824 | Bacteria | 607 |
| 671 | Ga0307410_10313703 | 3300031852 | Bacteria | 1242 |
| 672 | Ga0307410_10373883 | 3300031852 | Bacteria | 1145 |
| 673 | Ga0307406_10426985 | 3300031901 | Unclassified | 1057 |
| 674 | Ga0307406_10542464 | 3300031901 | Bacteria | 950 |
| 675 | Ga0307412_11277053 | 3300031911 | Bacteria | 660 |
| 676 | Ga0307409_101881601 | 3300031995 | Unclassified | 628 |
| 677 | Ga0307416_100075944 | 3300032002 | Bacteria | 2814 |
| 678 | Ga0307416_100115956 | 3300032002 | Bacteria | 2373 |
| 679 | Ga0307416_100756627 | 3300032002 | Bacteria | 1065 |
| 680 | Ga0307416_101627524 | 3300032002 | Unclassified | 751 |
| 681 | Ga0307414_10023092 | 3300032004 | Bacteria | 3937 |
| 682 | Ga0307411_11006256 | 3300032005 | Bacteria | 746 |
| 683 | Ga0307415_101586246 | 3300032126 | Bacteria | 628 |
| 684 | Ga0373930_0007127 | 3300034816 | Bacteria | 1914 |
| 685 | Ga0373930_0072164 | 3300034816 | Bacteria | 786 |
| 686 | Ga0373948_0085880 | 3300034817 | Bacteria | 724 |
| 687 | Ga0373958_0023348 | 3300034819 | Bacteria | 1163 |
| 688 | Ga0373938_0012328 | 3300034957 | Unclassified | 1602 |
| 689 | Ga0373926_0457394 | 3300035083 | Bacteria | 507 |
| 690 | Ga0373928_0069546 | 3300035084 | Bacteria | 867 |
| 691 | Ga0373928_0079779 | 3300035084 | Bacteria | 823 |
| 692 | Ga0373929_0144235 | 3300035085 | Bacteria | 634 |
| 693 | Ga0373934_0063951 | 3300035086 | Bacteria | 1468 |
| 694 | Ga0373934_0335811 | 3300035086 | Bacteria | 628 |
| 695 | Ga0373944_0087370 | 3300035089 | Unclassified | 1038 |
| 696 | Ga0373944_0195308 | 3300035089 | Bacteria | 731 |
| 697 | Ga0373949_0256435 | 3300035090 | Unclassified | 542 |
| 698 | Ga0373923_0052094 | 3300035111 | Bacteria | 1719 |
| 699 | Ga0373923_0066352 | 3300035111 | Bacteria | 1542 |
| 700 | Ga0373923_0193084 | 3300035111 | Bacteria | 939 |
| 701 | Ga0373923_0474299 | 3300035111 | Bacteria | 608 |
| 702 | Ga0373923_0474435 | 3300035111 | Unclassified | 608 |
| 703 | Ga0373932_0098324 | 3300035112 | Bacteria | 949 |
| 704 | Ga0373932_0223679 | 3300035112 | Unclassified | 677 |
| 705 | Ga0373941_0032936 | 3300035115 | Bacteria | 1554 |
| 706 | Ga0373941_0195598 | 3300035115 | Bacteria | 766 |
| 707 | Ga0373945_0137638 | 3300035116 | Bacteria | 983 |
| 708 | Ga0373945_0195374 | 3300035116 | Bacteria | 838 |
| 709 | Ga0373945_0352050 | 3300035116 | Bacteria | 639 |
| 710 | Ga0373953_0042164 | 3300035117 | Bacteria | 1818 |
| 711 | Ga0373954_0062818 | 3300035118 | Bacteria | 1755 |
| 712 | Ga0373957_0223669 | 3300035120 | Bacteria | 788 |
| 713 | Ga0373960_0056480 | 3300035121 | Bacteria | 1179 |
| 714 | Ga0373943_0111803 | 3300035170 | Bacteria | 1442 |
| 715 | Ga0373943_0139392 | 3300035170 | Bacteria | 1305 |
| 716 | Ga0373943_0415235 | 3300035170 | Bacteria | 778 |
| 717 | Ga0373943_0473926 | 3300035170 | Unclassified | 729 |
| 718 | Ga0373946_0024327 | 3300035171 | Bacteria | 2373 |
| 719 | Ga0373946_0123555 | 3300035171 | Bacteria | 1184 |
| 720 | Ga0373946_0131635 | 3300035171 | Unclassified | 1151 |
| 721 | Ga0373946_0306223 | 3300035171 | Bacteria | 787 |
| 722 | Ga0373955_0035900 | 3300035172 | Bacteria | 2628 |
| 723 | Ga0373942_0344426 | 3300035207 | Bacteria | 525 |
| 724 | Ga0316574_0000554 | 3300035398 | Bacteria | 15462 |
| 725 | Ga0373924_0056580 | 3300035410 | Bacteria | 1634 |
| 726 | Ga0373924_0171450 | 3300035410 | Bacteria | 954 |
| 727 | Ga0373924_0201763 | 3300035410 | Bacteria | 877 |
| 728 | Ga0373924_0213733 | 3300035410 | Bacteria | 851 |
| 729 | Ga0373924_0370194 | 3300035410 | Bacteria | 639 |
| 730 | Ga0373924_0561581 | 3300035410 | Archaea | 514 |
| 731 | Ga0373931_0005698 | 3300035691 | Bacteria | 5786 |
| 732 | Ga0373931_0212666 | 3300035691 | Bacteria | 1160 |
| 733 | Ga0373931_0263133 | 3300035691 | Bacteria | 1053 |
| 734 | Ga0373935_0132319 | 3300035692 | Bacteria | 1677 |
| 735 | Ga0373935_0154422 | 3300035692 | Bacteria | 1560 |
| 736 | Ga0373935_0361736 | 3300035692 | Bacteria | 1036 |
| 737 | Ga0373935_0445179 | 3300035692 | Bacteria | 935 |
| 738 | Ga0373935_0573908 | 3300035692 | Bacteria | 823 |
| 739 | Ga0373927_0035725 | 3300035695 | Bacteria | 3232 |
| 740 | Ga0373927_0099605 | 3300035695 | Bacteria | 1890 |
| 741 | Ga0373927_0318478 | 3300035695 | Bacteria | 1024 |
| 742 | Ga0373927_0435138 | 3300035695 | Bacteria | 866 |
| 743 | Ga0373933_0019411 | 3300035724 | Bacteria | 3840 |
| 744 | Ga0373933_0204709 | 3300035724 | Bacteria | 1263 |
| 745 | Ga0373933_0466929 | 3300035724 | Bacteria | 826 |
| 746 | Ga0373933_0573722 | 3300035724 | Bacteria | 740 |
| 747 | Ga0373947_0016135 | 3300035725 | Bacteria | 4292 |
| 748 | Ga0373947_0210116 | 3300035725 | Bacteria | 1276 |
| 749 | Ga0373947_0258864 | 3300035725 | Bacteria | 1152 |
| 750 | Ga0373947_0433857 | 3300035725 | Bacteria | 889 |
| 751 | Ga0373947_0434812 | 3300035725 | Bacteria | 888 |
| 752 | Ga0373947_0476578 | 3300035725 | Bacteria | 847 |
| 753 | Ga0373947_0797876 | 3300035725 | Archaea | 645 |
| 754 | Ga0373937_0010322 | 3300036401 | Bacteria | 8153 |
| 755 | Ga0373937_0011572 | 3300036401 | Bacteria | 7744 |
| 756 | Ga0373937_0042211 | 3300036401 | Bacteria | 4161 |
| 757 | Ga0373937_0151436 | 3300036401 | Bacteria | 2173 |
| 758 | Ga0373937_0226175 | 3300036401 | Bacteria | 1761 |
| 759 | Ga0373937_0255204 | 3300036401 | Bacteria | 1653 |
| 760 | Ga0373937_0842979 | 3300036401 | Bacteria | 865 |
| 761 | Ga0373937_1293272 | 3300036401 | Bacteria | 677 |
| 762 | Ga0373937_1454726 | 3300036401 | Bacteria | 633 |
| 763 | Ga0316584_0080860 | 3300036712 | Bacteria | 2434 |
| 764 | Ga0373925_0011071 | 3300037068 | Bacteria | 6551 |
| 765 | Ga0373925_0152202 | 3300037068 | Bacteria | 1817 |
| 766 | Ga0373925_0159821 | 3300037068 | Unclassified | 1774 |
| 767 | Ga0373925_0200637 | 3300037068 | Bacteria | 1586 |
| 768 | Ga0373925_0223869 | 3300037068 | Bacteria | 1502 |
| 769 | Ga0373925_0339535 | 3300037068 | Bacteria | 1218 |
| 770 | Ga0373925_0447899 | 3300037068 | Bacteria | 1057 |
| 771 | Ga0373925_0536599 | 3300037068 | Bacteria | 962 |
| 772 | Ga0373925_0995618 | 3300037068 | Bacteria | 690 |
| 773 | Ga0395899_0085033 | 3300037312 | Bacteria | 2299 |
| 774 | Ga0395899_0089097 | 3300037312 | Bacteria | 2238 |
| 775 | Ga0395900_0102684 | 3300037418 | Bacteria | 2937 |
| 776 | Ga0395900_0119467 | 3300037418 | Bacteria | 2705 |
| 777 | Ga0395900_0192735 | 3300037418 | Bacteria | 2066 |
| 778 | Ga0395900_0456322 | 3300037418 | Bacteria | 1233 |
| 779 | Ga0395898_0324483 | 3300037466 | Bacteria | 1468 |
| 780 | Ga0395898_0771188 | 3300037466 | Bacteria | 902 |
| 781 | Ga0395905_0205943 | 3300037471 | Bacteria | 1844 |
| 782 | Ga0436364_0293754 | 3300037853 | Bacteria | 44649 |
| 783 | Ga0436364_0318274 | 3300037853 | Bacteria | 2136 |
| 784 | Ga0436364_0379074 | 3300037853 | Bacteria | 1585 |
| 785 | Ga0436364_0457515 | 3300037853 | Bacteria | 1335 |
| 786 | Ga0436364_0911241 | 3300037853 | Bacteria | 2561 |
| 787 | Ga0436364_0912700 | 3300037853 | Bacteria | 852 |
| 788 | Ga0436364_0952421 | 3300037853 | Bacteria | 1811 |
| 789 | Ga0436364_1041984 | 3300037853 | Bacteria | 4299 |
| 790 | Ga0395901_0011181 | 3300038443 | Bacteria | 9096 |
| 791 | Ga0395901_0031666 | 3300038443 | Bacteria | 5452 |
| 792 | Ga0395901_0160315 | 3300038443 | Bacteria | 2362 |
| 793 | Ga0395901_0210272 | 3300038443 | Bacteria | 2036 |
| 794 | Ga0436365_0094547 | 3300039437 | Bacteria | 2704 |
| 795 | Ga0436365_0219364 | 3300039437 | Bacteria | 2773 |
| 796 | Ga0436365_0267445 | 3300039437 | Bacteria | 1053 |
| 797 | Ga0436365_0360139 | 3300039437 | Bacteria | 506 |
| 798 | Ga0436365_0501014 | 3300039437 | Bacteria | 1093 |
| 799 | Ga0436365_0596609 | 3300039437 | Bacteria | 1133 |
| 800 | Ga0436365_0720013 | 3300039437 | Bacteria | 810 |
| 801 | Ga0436365_0843728 | 3300039437 | Bacteria | 1963 |
| 802 | Ga0436365_1110167 | 3300039437 | Bacteria | 1229 |
| 803 | Ga0436365_1489642 | 3300039437 | Bacteria | 1398 |
| 804 | Ga0436360_0043757 | 3300039438 | Bacteria | 833 |
| 805 | Ga0436360_0079681 | 3300039438 | Bacteria | 942 |
| 806 | Ga0436360_0180394 | 3300039438 | Bacteria | 2538 |
| 807 | Ga0436360_0255206 | 3300039438 | Unclassified | 1879 |
| 808 | Ga0436360_0404586 | 3300039438 | Bacteria | 1335 |
| 809 | Ga0436360_1029522 | 3300039438 | Bacteria | 717 |
| 810 | Ga0436360_1055705 | 3300039438 | Bacteria | 2070 |
| 811 | Ga0436360_1126448 | 3300039438 | Unclassified | 774 |
| 812 | Ga0436360_1277821 | 3300039438 | Bacteria | 6049 |
| 813 | Ga0436360_1344602 | 3300039438 | Bacteria | 2216 |
| 814 | Ga0436361_0096195 | 3300039447 | Bacteria | 946 |
| 815 | Ga0436361_0145041 | 3300039447 | Bacteria | 2253 |
| 816 | Ga0436361_0506783 | 3300039447 | Bacteria | 709 |
| 817 | Ga0436361_0617642 | 3300039447 | Unclassified | 726 |
| 818 | Ga0436363_0706903 | 3300039450 | Bacteria | 2037 |
| 819 | Ga0436363_0851323 | 3300039450 | Bacteria | 1336 |
| 820 | Ga0436363_1077716 | 3300039450 | Bacteria | 699 |
| 821 | Ga0436363_1635770 | 3300039450 | Bacteria | 694 |
| 822 | Ga0436362_0169667 | 3300039453 | Bacteria | 2261 |
| 823 | Ga0436362_0249591 | 3300039453 | Bacteria | 603 |
| 824 | Ga0436362_0859630 | 3300039453 | Bacteria | 2063 |
| 825 | Ga0436362_1035255 | 3300039453 | Bacteria | 711 |
| 826 | Ga0439453_0000261 | 3300041408 | Bacteria | 5359 |
| 827 | Ga0451787_279969 | 3300041441 | Unclassified | 579 |
| 828 | Ga0451802_1332546 | 3300041460 | Bacteria | 521 |
| 829 | Ga0451833_0725335 | 3300041491 | Unclassified | 761 |
| 830 | Ga0451841_0664810 | 3300041498 | Bacteria | 613 |
| 831 | Ga0439448_0020041 | 3300042005 | Bacteria | 2066 |
| 832 | Ga0439455_0066350 | 3300042012 | Bacteria | 964 |
| 833 | Ga0439456_090928 | 3300042013 | Bacteria | 686 |
| 834 | Ga0439457_160751 | 3300042014 | Bacteria | 543 |
| 835 | Ga0439458_0084594 | 3300042157 | Bacteria | 812 |
| 836 | Ga0439435_0043450 | 3300042436 | Bacteria | 1264 |
| 837 | Ga0439444_0006855 | 3300042437 | Bacteria | 1733 |
| 838 | Ga0439459_0058459 | 3300042438 | Bacteria | 865 |
| 839 | Ga0439460_0027441 | 3300042461 | Bacteria | 1599 |
| 840 | Ga0451577_0404817 | 3300042876 | Bacteria | 1239 |
| 841 | Ga0439440_0192608 | 3300042993 | Unclassified | 602 |
| 842 | Ga0466966_0677853 | 3300044684 | Bacteria | 621 |
| 843 | Ga0466961_0292966 | 3300044693 | Bacteria | 995 |
| 844 | Ga0466963_0009031 | 3300044694 | Bacteria | 5988 |
| 845 | Ga0453684_1192451 | 3300044712 | Bacteria | 800 |
| 846 | Ga0466957_0006661 | 3300044842 | Bacteria | 6532 |
| 847 | Ga0466960_0089059 | 3300044901 | Bacteria | 1570 |
| 848 | Ga0466960_0531418 | 3300044901 | Bacteria | 692 |
| 849 | Ga0451576_2203968 | 3300045051 | Bacteria | 566 |
| 850 | Ga0466958_0304666 | 3300045836 | Bacteria | 1023 |
| 851 | Ga0466958_0456439 | 3300045836 | Bacteria | 828 |
| 852 | Ga0466958_0886133 | 3300045836 | Bacteria | 582 |
| 853 | Ga0466967_0328347 | 3300045976 | Bacteria | 1477 |
| 854 | Ga0495592_0230892 | 3300046454 | Bacteria | 1232 |
| 855 | Ga0495592_0654506 | 3300046454 | Unclassified | 636 |
| 856 | Ga0495590_0110931 | 3300046457 | Bacteria | 979 |
| 857 | Ga0495629_0121489 | 3300046459 | Bacteria | 1820 |
| 858 | Ga0495638_0005322 | 3300046460 | Bacteria | 9598 |
| 859 | Ga0495638_0023899 | 3300046460 | Bacteria | 3992 |
| 860 | Ga0495638_0532239 | 3300046460 | Bacteria | 587 |
| 861 | Ga0495638_0636474 | 3300046460 | Unclassified | 520 |
| 862 | Ga0495641_0159479 | 3300046461 | Bacteria | 1009 |
| 863 | Ga0495651_0019063 | 3300046462 | Bacteria | 5316 |
| 864 | Ga0495580_0175190 | 3300046472 | Bacteria | 1482 |
| 865 | Ga0495580_0821387 | 3300046472 | Bacteria | 601 |
| 866 | Ga0495580_0859930 | 3300046472 | Archaea | 585 |
| 867 | Ga0495582_0019353 | 3300046473 | Bacteria | 3722 |
| 868 | Ga0495582_0886454 | 3300046473 | Unclassified | 516 |
| 869 | Ga0495605_0241149 | 3300046474 | Bacteria | 776 |
| 870 | Ga0495639_0008479 | 3300046475 | Bacteria | 4407 |
| 871 | Ga0495664_0000446 | 3300046477 | Bacteria | 20340 |
| 872 | Ga0495584_0015860 | 3300046491 | Bacteria | 3844 |
| 873 | Ga0495594_0596128 | 3300046499 | Bacteria | 626 |
| 874 | Ga0495594_0788121 | 3300046499 | Unclassified | 536 |
| 875 | Ga0495608_0030865 | 3300046511 | Bacteria | 3625 |
| 876 | Ga0495616_0198159 | 3300046513 | Bacteria | 884 |
| 877 | Ga0495620_0133636 | 3300046515 | Bacteria | 973 |
| 878 | Ga0495628_0044634 | 3300046516 | Bacteria | 3525 |
| 879 | Ga0495628_0089536 | 3300046516 | Bacteria | 2383 |
| 880 | Ga0495630_0819223 | 3300046517 | Archaea | 710 |
| 881 | Ga0495630_1179054 | 3300046517 | Bacteria | 579 |
| 882 | Ga0495630_1428609 | 3300046517 | Bacteria | 520 |
| 883 | Ga0495643_0487005 | 3300046522 | Bacteria | 532 |
| 884 | Ga0495666_0209221 | 3300046526 | Archaea | 895 |
| 885 | Ga0495652_0140559 | 3300046529 | Bacteria | 1899 |
| 886 | Ga0495665_0041929 | 3300046531 | Bacteria | 2437 |
| 887 | Ga0495640_0090123 | 3300046533 | Bacteria | 2025 |
| 888 | Ga0495586_0656070 | 3300046535 | Unclassified | 606 |
| 889 | Ga0495587_0039923 | 3300046536 | Bacteria | 2807 |
| 890 | Ga0495587_0304632 | 3300046536 | Bacteria | 891 |
| 891 | Ga0495645_0008204 | 3300046543 | Bacteria | 7283 |
| 892 | Ga0495645_0898401 | 3300046543 | Bacteria | 526 |
| 893 | Ga0495622_0531721 | 3300046557 | Bacteria | 502 |
| 894 | Ga0495633_0224463 | 3300046558 | Bacteria | 860 |
| 895 | Ga0495667_0005255 | 3300046559 | Bacteria | 8751 |
| 896 | Ga0495667_0023798 | 3300046559 | Bacteria | 4125 |
| 897 | Ga0495667_0229606 | 3300046559 | Bacteria | 1183 |
| 898 | Ga0495656_0222290 | 3300046615 | Bacteria | 945 |
| 899 | Ga0495668_0071749 | 3300046616 | Bacteria | 1903 |
| 900 | Ga0495668_0800404 | 3300046616 | Unclassified | 522 |
| 901 | Ga0495634_0477219 | 3300046642 | Bacteria | 733 |
| 902 | Ga0495634_0597574 | 3300046642 | Bacteria | 641 |
| 903 | Ga0495611_0206718 | 3300046648 | Bacteria | 915 |
| 904 | Ga0495625_0208376 | 3300046660 | Bacteria | 1286 |
| 905 | Ga0495635_0005845 | 3300046663 | Bacteria | 8574 |
| 906 | Ga0495635_0292016 | 3300046663 | Bacteria | 1094 |
| 907 | Ga0495661_0410720 | 3300046665 | Archaea | 657 |
| 908 | Ga0495588_0302946 | 3300046674 | Archaea | 841 |
| 909 | Ga0495588_0464718 | 3300046674 | Unclassified | 664 |
| 910 | Ga0495657_0289480 | 3300046675 | Bacteria | 979 |
| 911 | Ga0495599_0007396 | 3300046678 | Bacteria | 6658 |
| 912 | Ga0495599_0056282 | 3300046678 | Bacteria | 2461 |
| 913 | Ga0495623_0277063 | 3300046679 | Bacteria | 934 |
| 914 | Ga0495623_0455193 | 3300046679 | Bacteria | 681 |
| 915 | Ga0495646_0014797 | 3300046680 | Bacteria | 4959 |
| 916 | Ga0495646_0122527 | 3300046680 | Bacteria | 1470 |
| 917 | Ga0495646_0501789 | 3300046680 | Bacteria | 623 |
| 918 | Ga0495658_0611465 | 3300046683 | Bacteria | 698 |
| 919 | Ga0495669_0178913 | 3300046684 | Bacteria | 1011 |
| 920 | Ga0495613_0118298 | 3300046689 | Bacteria | 1905 |
| 921 | Ga0495613_0327521 | 3300046689 | Unclassified | 1056 |
| 922 | Ga0495671_0484148 | 3300046692 | Bacteria | 591 |
| 923 | Ga0495589_0221069 | 3300046794 | Bacteria | 890 |
| 924 | Ga0495589_0280438 | 3300046794 | Bacteria | 775 |
| 925 | Ga0495600_0178042 | 3300046809 | Bacteria | 1371 |
| 926 | Ga0495581_0487082 | 3300047315 | Unclassified | 717 |
| 927 | Ga0495604_0205734 | 3300047317 | Bacteria | 1362 |
| 928 | Ga0495674_0070100 | 3300047319 | Bacteria | 3030 |
| 929 | Ga0495676_0329898 | 3300047321 | Bacteria | 1023 |
| 930 | Ga0495680_0080958 | 3300047322 | Bacteria | 2453 |
| 931 | Ga0495680_0115796 | 3300047322 | Bacteria | 1983 |
| 932 | Ga0495680_0477349 | 3300047322 | Bacteria | 849 |
| 933 | Ga0495675_0227682 | 3300047444 | Bacteria | 1126 |
| 934 | Ga0495675_0713432 | 3300047444 | Bacteria | 561 |
| 935 | Ga0495684_0126792 | 3300047471 | Bacteria | 1920 |
| 936 | Ga0495593_0184475 | 3300047673 | Bacteria | 1051 |
| 937 | Ga0495593_0447248 | 3300047673 | Bacteria | 647 |
| 938 | Ga0495602_0000599 | 3300048088 | Bacteria | 33832 |
| 939 | Ga0495602_0030436 | 3300048088 | Bacteria | 5119 |
| 940 | Ga0495602_0058529 | 3300048088 | Bacteria | 3372 |
| 941 | Ga0495602_0792718 | 3300048088 | Bacteria | 637 |
| 942 | Ga0495615_0057733 | 3300048090 | Bacteria | 1016 |
| 943 | Ga0496100_0022252 | 3300048903 | Bacteria | 3834 |
| 944 | Ga0496100_0112976 | 3300048903 | Bacteria | 1890 |
| 945 | Ga0496100_0182693 | 3300048903 | Bacteria | 1517 |
| 946 | Ga0496101_0181217 | 3300048904 | Bacteria | 1622 |
| 947 | Ga0496101_0357290 | 3300048904 | Unclassified | 1148 |
| 948 | Ga0496101_0688230 | 3300048904 | Bacteria | 807 |
| 949 | Ga0496102_0089407 | 3300048905 | Bacteria | 2849 |
| 950 | Ga0496102_0106489 | 3300048905 | Bacteria | 2610 |
| 951 | Ga0496102_0290011 | 3300048905 | Bacteria | 1542 |
| 952 | Ga0496102_0349742 | 3300048905 | Bacteria | 1392 |
| 953 | Ga0496102_0943241 | 3300048905 | Bacteria | 784 |
| 954 | Ga0496103_0198823 | 3300048906 | Bacteria | 1289 |
| 955 | Ga0496104_0001104 | 3300048907 | Bacteria | 23081 |
| 956 | Ga0496104_0004659 | 3300048907 | Bacteria | 11929 |
| 957 | Ga0496104_0059771 | 3300048907 | Bacteria | 3609 |
| 958 | Ga0496104_0405603 | 3300048907 | Bacteria | 1275 |
| 959 | Ga0496104_0564667 | 3300048907 | Bacteria | 1048 |
| 960 | Ga0496104_0674123 | 3300048907 | Bacteria | 942 |
| 961 | Ga0496104_0836820 | 3300048907 | Bacteria | 826 |
| 962 | Ga0496105_0015005 | 3300048908 | Bacteria | 6164 |
| 963 | Ga0496105_0017200 | 3300048908 | Bacteria | 5792 |
| 964 | Ga0496105_0024151 | 3300048908 | Bacteria | 4937 |
| 965 | Ga0496105_0145898 | 3300048908 | Bacteria | 1946 |
| 966 | Ga0496105_0312684 | 3300048908 | Bacteria | 1261 |
| 967 | Ga0496106_0034132 | 3300048909 | Bacteria | 3799 |
| 968 | Ga0496106_0092248 | 3300048909 | Unclassified | 2339 |
| 969 | Ga0496106_0233267 | 3300048909 | Bacteria | 1470 |
| 970 | Ga0496107_0042424 | 3300048910 | Unclassified | 3267 |
| 971 | Ga0496107_0077830 | 3300048910 | Bacteria | 2416 |
| 972 | Ga0496107_0242399 | 3300048910 | Bacteria | 1341 |
| 973 | Ga0496107_0929960 | 3300048910 | Bacteria | 633 |
| 974 | Ga0496108_0029045 | 3300048911 | Bacteria | 4576 |
| 975 | Ga0496108_0083883 | 3300048911 | Unclassified | 2703 |
| 976 | Ga0496108_0106853 | 3300048911 | Bacteria | 2390 |
| 977 | Ga0496108_0275392 | 3300048911 | Bacteria | 1465 |
| 978 | Ga0496108_0382737 | 3300048911 | Bacteria | 1228 |
| 979 | Ga0496108_0476726 | 3300048911 | Bacteria | 1090 |
| 980 | Ga0496108_0644844 | 3300048911 | Bacteria | 921 |
| 981 | Ga0496109_0011205 | 3300048912 | Bacteria | 7695 |
| 982 | Ga0496109_0173543 | 3300048912 | Bacteria | 2023 |
| 983 | Ga0496109_0619194 | 3300048912 | Bacteria | 1019 |
| 984 | Ga0496109_0964831 | 3300048912 | Bacteria | 790 |
| 985 | Ga0496109_1718322 | 3300048912 | Unclassified | 561 |
| 986 | Ga0496110_0008353 | 3300048913 | Bacteria | 8331 |
| 987 | Ga0496110_0053884 | 3300048913 | Bacteria | 3537 |
| 988 | Ga0496110_0282720 | 3300048913 | Bacteria | 1511 |
| 989 | Ga0496110_0367130 | 3300048913 | Bacteria | 1311 |
| 990 | Ga0496110_0562992 | 3300048913 | Bacteria | 1035 |
| 991 | Ga0496111_0004033 | 3300048914 | Bacteria | 9219 |
| 992 | Ga0496111_0114041 | 3300048914 | Bacteria | 1992 |
| 993 | Ga0496111_0178722 | 3300048914 | Bacteria | 1577 |
| 994 | Ga0496111_0839917 | 3300048914 | Unclassified | 663 |
| 995 | Ga0496112_0092849 | 3300048915 | Bacteria | 2988 |
| 996 | Ga0496112_0099383 | 3300048915 | Bacteria | 2879 |
| 997 | Ga0496112_0214962 | 3300048915 | Unclassified | 1879 |
| 998 | Ga0496112_0366001 | 3300048915 | Bacteria | 1383 |
| 999 | Ga0496112_0427658 | 3300048915 | Bacteria | 1263 |
| 1000 | Ga0496112_0484024 | 3300048915 | Bacteria | 1174 |
| 1001 | Ga0496112_0715966 | 3300048915 | Bacteria | 928 |
| 1002 | Ga0496112_0984013 | 3300048915 | Bacteria | 764 |
| 1003 | Ga0496112_1004698 | 3300048915 | Bacteria | 754 |
| 1004 | Ga0496113_0025785 | 3300048916 | Bacteria | 4195 |
| 1005 | Ga0496113_0146944 | 3300048916 | Unclassified | 1858 |
| 1006 | Ga0496113_0156960 | 3300048916 | Bacteria | 1797 |
| 1007 | Ga0496113_0242835 | 3300048916 | Unclassified | 1437 |
| 1008 | Ga0496113_0714272 | 3300048916 | Bacteria | 799 |
| 1009 | Ga0496113_0821084 | 3300048916 | Bacteria | 738 |
| 1010 | Ga0496113_0947177 | 3300048916 | Bacteria | 680 |
| 1011 | Ga0496114_0020588 | 3300048917 | Bacteria | 5355 |
| 1012 | Ga0496114_0148548 | 3300048917 | Unclassified | 2032 |
| 1013 | Ga0496114_0163640 | 3300048917 | Bacteria | 1936 |
| 1014 | Ga0496115_0021674 | 3300048918 | Bacteria | 4966 |
| 1015 | Ga0496115_0084936 | 3300048918 | Bacteria | 2581 |
| 1016 | Ga0496115_0533686 | 3300048918 | Bacteria | 939 |
| 1017 | Ga0496119_0075291 | 3300048922 | Bacteria | 1962 |
| 1018 | Ga0496120_0016883 | 3300048923 | Bacteria | 4753 |
| 1019 | Ga0496126_0824531 | 3300048929 | Bacteria | 710 |
| 1020 | Ga0501031_0369623 | 3300049568 | Bacteria | 928 |
| 1021 | Ga0501031_0418723 | 3300049568 | Unclassified | 866 |
| 1022 | Ga0501032_0358693 | 3300049569 | Unclassified | 939 |
| 1023 | Ga0501033_0030233 | 3300049570 | Bacteria | 4070 |
| 1024 | Ga0501033_0731672 | 3300049570 | Unclassified | 672 |
| 1025 | Ga0501034_0004530 | 3300049571 | Bacteria | 15448 |
| 1026 | Ga0501034_0048873 | 3300049571 | Bacteria | 4269 |
| 1027 | Ga0501034_0138934 | 3300049571 | Bacteria | 2410 |
| 1028 | Ga0501034_0191023 | 3300049571 | Bacteria | 2010 |
| 1029 | Ga0501036_0811778 | 3300049572 | Bacteria | 770 |
| 1030 | Ga0501036_0828658 | 3300049572 | Bacteria | 761 |
| 1031 | Ga0501036_1101269 | 3300049572 | Bacteria | 649 |
| 1032 | Ga0501037_0014364 | 3300049573 | Bacteria | 5831 |
| 1033 | Ga0501038_0343918 | 3300049574 | Bacteria | 1163 |
| 1034 | Ga0501038_0506369 | 3300049574 | Bacteria | 923 |
| 1035 | Ga0501038_0528552 | 3300049574 | Bacteria | 899 |
| 1036 | Ga0501039_0555155 | 3300049575 | Unclassified | 901 |
| 1037 | Ga0501039_0842313 | 3300049575 | Bacteria | 715 |
| 1038 | Ga0501040_0546358 | 3300049576 | Bacteria | 836 |
| 1039 | Ga0501040_1238148 | 3300049576 | Unclassified | 542 |
| 1040 | Ga0501041_0137666 | 3300049577 | Unclassified | 1522 |
| 1041 | Ga0501042_0108985 | 3300049578 | Bacteria | 1994 |
| 1042 | Ga0501043_0840957 | 3300049579 | Unclassified | 662 |
| 1043 | Ga0501046_0203550 | 3300049580 | Bacteria | 1472 |
| 1044 | Ga0501047_0129823 | 3300049581 | Bacteria | 2401 |
| 1045 | Ga0501047_0304218 | 3300049581 | Bacteria | 1436 |
| 1046 | Ga0501047_0319601 | 3300049581 | Bacteria | 1392 |
| 1047 | Ga0501048_0097824 | 3300049582 | Unclassified | 2071 |
| 1048 | Ga0501048_0282804 | 3300049582 | Bacteria | 1180 |
| 1049 | Ga0501068_0008897 | 3300049584 | Bacteria | 5602 |
| 1050 | Ga0501068_0314789 | 3300049584 | Bacteria | 1003 |
| 1051 | Ga0501068_0999979 | 3300049584 | Unclassified | 552 |
| 1052 | Ga0501069_0654519 | 3300049585 | Bacteria | 632 |
| 1053 | Ga0501070_0191902 | 3300049586 | Bacteria | 1679 |
| 1054 | Ga0501070_0233215 | 3300049586 | Bacteria | 1508 |
| 1055 | Ga0501070_0526750 | 3300049586 | Bacteria | 948 |
| 1056 | Ga0501070_0986090 | 3300049586 | Bacteria | 654 |
| 1057 | Ga0501071_0336321 | 3300049587 | Unclassified | 1148 |
| 1058 | Ga0501071_0400673 | 3300049587 | Bacteria | 1048 |
| 1059 | Ga0501071_1128237 | 3300049587 | Unclassified | 606 |
| 1060 | Ga0501072_0141251 | 3300049588 | Unclassified | 1920 |
| 1061 | Ga0501072_0450940 | 3300049588 | Bacteria | 1019 |
| 1062 | Ga0501072_0799782 | 3300049588 | Bacteria | 739 |
| 1063 | Ga0501072_1046583 | 3300049588 | Bacteria | 636 |
| 1064 | Ga0501072_1199152 | 3300049588 | Bacteria | 590 |
| 1065 | Ga0501073_0194332 | 3300049589 | Bacteria | 1404 |
| 1066 | Ga0501073_0407253 | 3300049589 | Bacteria | 940 |
| 1067 | Ga0501076_0218418 | 3300049592 | Unclassified | 1558 |
| 1068 | Ga0501076_0781837 | 3300049592 | Bacteria | 788 |
| 1069 | Ga0501077_0289670 | 3300049593 | Unclassified | 1043 |
| 1070 | Ga0501080_0287794 | 3300049742 | Bacteria | 1493 |
| 1071 | Ga0501080_0573942 | 3300049742 | Bacteria | 1003 |
| 1072 | Ga0501080_0753534 | 3300049742 | Bacteria | 856 |
| 1073 | Ga0501080_1105567 | 3300049742 | Bacteria | 684 |
| 1074 | Ga0501080_1628049 | 3300049742 | Bacteria | 546 |
| 1075 | Ga0501081_0297855 | 3300049743 | Bacteria | 1183 |
| 1076 | Ga0501081_0409819 | 3300049743 | Bacteria | 1004 |
| 1077 | Ga0501035_0092116 | 3300049822 | Bacteria | 2667 |
| 1078 | Ga0501035_0510320 | 3300049822 | Bacteria | 989 |
| 1079 | Ga0501035_0926740 | 3300049822 | Bacteria | 689 |
| 1080 | Ga0501044_0071231 | 3300049823 | Bacteria | 3535 |
| 1081 | Ga0501044_0174924 | 3300049823 | Bacteria | 2116 |
| 1082 | Ga0501044_0203380 | 3300049823 | Bacteria | 1938 |
| 1083 | Ga0501044_0397535 | 3300049823 | Bacteria | 1291 |
| 1084 | Ga0501044_0842081 | 3300049823 | Bacteria | 794 |
| 1085 | Ga0501045_0237382 | 3300049824 | Bacteria | 1357 |
| 1086 | Ga0501045_0970874 | 3300049824 | Bacteria | 623 |
| 1087 | nmdc:mga03683_161650_c1 | 3300050489 | Bacteria | 1015 |
| 1088 | nmdc:mga03683_326773_c1 | 3300050489 | Bacteria | 723 |
| 1089 | nmdc:mga03683_82565_c1 | 3300050489 | Bacteria | 1390 |
| 1090 | nmdc:mga03n38_14547_c1 | 3300050490 | Bacteria | 3018 |
| 1091 | nmdc:mga03n38_24423_c1 | 3300050490 | Bacteria | 2471 |
| 1092 | nmdc:mga03n38_49021_c1 | 3300050490 | Bacteria | 1248 |
| 1093 | nmdc:mga00v17_278354_c1 | 3300050491 | Bacteria | 1086 |
| 1094 | nmdc:mga00v17_568681_c1 | 3300050491 | Bacteria | 732 |
| 1095 | nmdc:mga0k408_22378_c1 | 3300050493 | Bacteria | 3559 |
| 1096 | nmdc:mga06z11_26296_c1 | 3300050494 | Bacteria | 2768 |
| 1097 | nmdc:mga06z11_299_c1 | 3300050494 | Bacteria | 19034 |
| 1098 | nmdc:mga06z11_311993_c1 | 3300050494 | Bacteria | 937 |
| 1099 | nmdc:mga06z11_3349_c1 | 3300050494 | Bacteria | 6202 |
| 1100 | nmdc:mga06z11_544167_c1 | 3300050494 | Bacteria | 705 |
| 1101 | nmdc:mga06z11_586301_c1 | 3300050494 | Bacteria | 678 |
| 1102 | nmdc:mga04h51_117127_c1 | 3300050495 | Bacteria | 989 |
| 1103 | nmdc:mga04h51_201419_c1 | 3300050495 | Bacteria | 782 |
| 1104 | nmdc:mga04h51_22862_c1 | 3300050495 | Bacteria | 1897 |
| 1105 | nmdc:mga04h51_79177_c1 | 3300050495 | Bacteria | 1163 |
| 1106 | nmdc:mga07m45_282299_c1 | 3300050496 | Bacteria | 966 |
| 1107 | nmdc:mga05p37_1019249_c1 | 3300050507 | Bacteria | 877 |
| 1108 | nmdc:mga05p37_1692977_c1 | 3300050507 | Bacteria | 617 |
| 1109 | nmdc:mga05p37_170768_c1 | 3300050507 | Bacteria | 2652 |
| 1110 | nmdc:mga05p37_1771279_c1 | 3300050507 | Unclassified | 598 |
| 1111 | nmdc:mga05p37_60902_c1 | 3300050507 | Unclassified | 4647 |
| 1112 | nmdc:mga05p37_72006_c1 | 3300050507 | Bacteria | 4253 |
| 1113 | nmdc:mga09592_11144_c1 | 3300050508 | Bacteria | 7315 |
| 1114 | nmdc:mga09592_152887_c1 | 3300050508 | Unclassified | 1991 |
| 1115 | nmdc:mga09592_436351_c2 | 3300050508 | Unclassified | 574 |
| 1116 | nmdc:mga09592_576604_c1 | 3300050508 | Bacteria | 965 |
| 1117 | nmdc:mga09592_657779_c1 | 3300050508 | Unclassified | 894 |
| 1118 | nmdc:mga09592_750513_c1 | 3300050508 | Bacteria | 828 |
| 1119 | nmdc:mga09592_84591_c1 | 3300050508 | Bacteria | 2705 |
| 1120 | nmdc:mga0qj67_146531_c1 | 3300050509 | Bacteria | 1914 |
| 1121 | nmdc:mga0qj67_168105_c1 | 3300050509 | Unclassified | 1780 |
| 1122 | nmdc:mga0qj67_19_c1 | 3300050509 | Bacteria | 112208 |
| 1123 | nmdc:mga0qj67_314274_c1 | 3300050509 | Bacteria | 1268 |
| 1124 | nmdc:mga0qj67_364041_c1 | 3300050509 | Bacteria | 1168 |
| 1125 | nmdc:mga0qj67_63179_c1 | 3300050509 | Unclassified | 2944 |
| 1126 | nmdc:mga0qj67_84461_c1 | 3300050509 | Unclassified | 2546 |
| 1127 | nmdc:mga06r32_1178847_c1 | 3300050510 | Bacteria | 713 |
| 1128 | nmdc:mga06r32_1915866_c1 | 3300050510 | Unclassified | 527 |
| 1129 | nmdc:mga06r32_569924_c1 | 3300050510 | Bacteria | 1105 |
| 1130 | nmdc:mga06r32_76360_c1 | 3300050510 | Unclassified | 3253 |
| 1131 | nmdc:mga06r32_874440_c1 | 3300050510 | Unclassified | 856 |
| 1132 | nmdc:mga06r32_917785_c1 | 3300050510 | Bacteria | 831 |
| 1133 | nmdc:mga08y16_1095929_c1 | 3300050511 | Bacteria | 772 |
| 1134 | nmdc:mga08y16_480461_c1 | 3300050511 | Bacteria | 1264 |
| 1135 | nmdc:mga08y16_679007_c1 | 3300050511 | Bacteria | 1032 |
| 1136 | nmdc:mga08y16_97469_c1 | 3300050511 | Bacteria | 3062 |
| 1137 | nmdc:mga0n895_1035854_c1 | 3300050512 | Unclassified | 800 |
| 1138 | nmdc:mga0n895_1270236_c1 | 3300050512 | Bacteria | 708 |
| 1139 | nmdc:mga0n895_31442_c1 | 3300050512 | Bacteria | 5083 |
| 1140 | nmdc:mga0n895_847914_c1 | 3300050512 | Bacteria | 902 |
| 1141 | nmdc:mga0rr50_1325040_c1 | 3300050513 | Bacteria | 610 |
| 1142 | nmdc:mga0rr50_207113_c1 | 3300050513 | Unclassified | 1614 |
| 1143 | nmdc:mga0rr50_471688_c1 | 3300050513 | Unclassified | 1065 |
| 1144 | nmdc:mga0rr50_739555_c1 | 3300050513 | Bacteria | 839 |
| 1145 | nmdc:mga08x19_61691_c1 | 3300050514 | Bacteria | 2430 |
| 1146 | nmdc:mga0a205_1149740_c1 | 3300050515 | Bacteria | 624 |
| 1147 | nmdc:mga0a205_460525_c1 | 3300050515 | Bacteria | 1131 |
| 1148 | nmdc:mga0a205_529903_c1 | 3300050515 | Bacteria | 1034 |
| 1149 | nmdc:mga0a205_77713_c1 | 3300050515 | Bacteria | 3207 |
| 1150 | nmdc:mga0sz30_277463_c1 | 3300050516 | Bacteria | 747 |
| 1151 | nmdc:mga0sz30_66935_c1 | 3300050516 | Bacteria | 1542 |
| 1152 | Ga0495601_0000349 | 3300053077 | Bacteria | 24294 |
| 1153 | Ga0495601_0317030 | 3300053077 | Bacteria | 1015 |
| 1154 | Ga0495601_0392072 | 3300053077 | Archaea | 901 |
| 1155 | Ga0495601_0599436 | 3300053077 | Unclassified | 707 |
| 1156 | Ga0495612_0001007 | 3300053078 | Bacteria | 11601 |
| 1157 | Ga0495595_0047423 | 3300053084 | Bacteria | 1982 |
| 1158 | Ga0495619_0111388 | 3300053085 | Bacteria | 1870 |
| 1159 | Ga0495619_0126078 | 3300053085 | Bacteria | 1757 |
| 1160 | Ga0495619_0201948 | 3300053085 | Bacteria | 1376 |
| 1161 | Ga0495619_0339932 | 3300053085 | Bacteria | 1039 |
| 1162 | Ga0500646_0037115 | 3300053090 | Unclassified | 1360 |
| 1163 | Ga0500647_0108819 | 3300053091 | Bacteria | 1319 |
| 1164 | Ga0500651_0336534 | 3300053093 | Bacteria | 859 |
| 1165 | Ga0500566_0347863 | 3300053094 | Bacteria | 680 |
| 1166 | Ga0500641_0170517 | 3300053096 | Bacteria | 937 |
| 1167 | Ga0500650_0084755 | 3300053098 | Bacteria | 1483 |
| 1168 | Ga0500555_086857 | 3300053103 | Bacteria | 808 |
| 1169 | Ga0500595_124263 | 3300053119 | Bacteria | 728 |
| 1170 | Ga0500614_075867 | 3300053123 | Bacteria | 932 |
| 1171 | Ga0500642_0075535 | 3300053130 | Unclassified | 1540 |
| 1172 | Ga0500658_0025615 | 3300053134 | Bacteria | 2268 |
| 1173 | Ga0500568_0009712 | 3300053139 | Bacteria | 4554 |
| 1174 | Ga0500577_0113072 | 3300053142 | Bacteria | 1123 |
| 1175 | Ga0500577_0283066 | 3300053142 | Unclassified | 723 |
| 1176 | Ga0500588_0058560 | 3300053146 | Bacteria | 1227 |
| 1177 | Ga0500616_0002142 | 3300053153 | Bacteria | 17085 |
| 1178 | Ga0500616_0031547 | 3300053153 | Bacteria | 2902 |
| 1179 | Ga0500620_052693 | 3300053155 | Bacteria | 1368 |
| 1180 | Ga0500627_0245925 | 3300053158 | Unclassified | 793 |
| 1181 | Ga0500645_178523 | 3300053730 | Bacteria | 578 |
| 1182 | Ga0500552_000105 | 3300053733 | Bacteria | 7017 |
| 1183 | Ga0501084_1274938 | 3300054114 | Bacteria | 616 |
| 1184 | Ga0587079_139807 | 3300059647 | Bacteria | 616 |
| 1185 | Ga0587111_0190887 | 3300060346 | Bacteria | 575 |
| 1186 | Ga0501082_0154525 | 3300060353 | Unclassified | 1994 |
| 1187 | Ga0501082_0373451 | 3300060353 | Bacteria | 1244 |
| 1188 | Ga0501082_1542956 | 3300060353 | Bacteria | 580 |
| 1189 | Ga0530510_0162784 | 3300061734 | Unclassified | 1651 |
| 1190 | Ga0530510_0335786 | 3300061734 | Bacteria | 1134 |
| 1191 | Ga0495674_0854457 | |||
| 1192 | JGI24742J22300_10014305 | |||
| 1193 | JGI25407J50210_10133011 | |||
| 1194 | JGI25405J52794_10004546 | |||
| 1195 | Ga0058863_11093206 | |||
| 1196 | Ga0058860_11548922 | |||
| 1197 | Ga0065712_10023621 | |||
| 1198 | Ga0070683_100158931 | |||
| 1199 | Ga0070683_100939234 | |||
| 1200 | Ga0070683_101699656 | |||
| 1201 | Ga0070690_100061985 | |||
| 1202 | Ga0070690_100152708 | |||
| 1203 | Ga0070690_100495446 | |||
| 1204 | Ga0070690_100518083 | |||
| 1205 | Ga0070670_100363148 | |||
| 1206 | Ga0070670_100397336 | |||
| 1207 | Ga0070670_101739863 | |||
| 1208 | Ga0070677_10018331 | |||
| 1209 | Ga0070677_10314602 | |||
| 1210 | Ga0068869_101484217 | |||
| 1211 | Ga0070666_10575430 | |||
| 1212 | Ga0070680_100139963 | |||
| 1213 | Ga0070680_100340656 | |||
| 1214 | Ga0070682_100315300 | |||
| 1215 | Ga0070682_100963335 | |||
| 1216 | Ga0070682_102086687 | |||
| 1217 | Ga0068868_100071958 | |||
| 1218 | Ga0068868_101388657 | |||
| 1219 | Ga0070660_100163158 | |||
| 1220 | Ga0070689_100008245 | |||
| 1221 | Ga0070689_100064441 | |||
| 1222 | Ga0070689_100135248 | |||
| 1223 | Ga0070689_100480643 | |||
| 1224 | Ga0070689_100796865 | |||
| 1225 | Ga0070689_101356060 | |||
| 1226 | Ga0070691_10006074 | |||
| 1227 | Ga0070691_10662237 | |||
| 1228 | Ga0070687_100208121 | |||
| 1229 | Ga0070687_101269276 | |||
| 1230 | Ga0070661_100091876 | |||
| 1231 | Ga0070668_100331153 | |||
| 1232 | Ga0070668_100970452 | |||
| 1233 | Ga0070668_101572990 | |||
| 1234 | Ga0070668_101908989 | |||
| 1235 | Ga0070669_100196560 | |||
| 1236 | Ga0070669_100232123 | |||
| 1237 | Ga0070675_100082318 | |||
| 1238 | Ga0070675_100437783 | |||
| 1239 | Ga0070675_101350474 | |||
| 1240 | Ga0070671_100021982 | |||
| 1241 | Ga0070671_100701205 | |||
| 1242 | Ga0070671_100802416 | |||
| 1243 | Ga0070674_100010635 | |||
| 1244 | Ga0070674_100112052 | |||
| 1245 | Ga0070674_100117366 | |||
| 1246 | Ga0070674_100289908 | |||
| 1247 | Ga0070674_100986250 | |||
| 1248 | Ga0070673_100137809 | |||
| 1249 | Ga0070673_100376553 | |||
| 1250 | Ga0070688_100012110 | |||
| 1251 | Ga0070688_100151760 | |||
| 1252 | Ga0070688_100166754 | |||
| 1253 | Ga0070667_100192368 | |||
| 1254 | Ga0070667_100488528 | |||
| 1255 | Ga0070667_100492452 | |||
| 1256 | Ga0070667_101755320 | |||
| 1257 | Ga0070667_101952114 | |||
| 1258 | Ga0070709_10007571 | |||
| 1259 | Ga0070709_10124121 | |||
| 1260 | Ga0070714_100018088 | |||
| 1261 | Ga0070714_100168116 | |||
| 1262 | Ga0070714_100411091 | |||
| 1263 | Ga0070714_100653455 | |||
| 1264 | Ga0070714_101024995 | |||
| 1265 | Ga0070714_101579019 | |||
| 1266 | Ga0070713_100006041 | |||
| 1267 | Ga0070713_100078171 | |||
| 1268 | Ga0070713_100154139 | |||
| 1269 | Ga0070713_100364983 | |||
| 1270 | Ga0070713_100964321 | |||
| 1271 | Ga0070713_100969616 | |||
| 1272 | Ga0070710_10012582 | |||
| 1273 | Ga0070710_10254974 | |||
| 1274 | Ga0070710_10972555 | |||
| 1275 | Ga0070701_10415234 | |||
| 1276 | Ga0070701_10853306 | |||
| 1277 | Ga0070711_100073767 | |||
| 1278 | Ga0070711_100206778 | |||
| 1279 | Ga0070711_100224018 | |||
| 1280 | Ga0070711_101634774 | |||
| 1281 | Ga0070711_102049001 | |||
| 1282 | Ga0070705_101744876 | |||
| 1283 | Ga0070700_100748916 | |||
| 1284 | Ga0070700_101753626 | |||
| 1285 | Ga0070694_100619898 | |||
| 1286 | Ga0070663_100452942 | |||
| 1287 | Ga0070678_100013179 | |||
| 1288 | Ga0070678_100221473 | |||
| 1289 | Ga0070678_101695546 | |||
| 1290 | Ga0070662_100398856 | |||
| 1291 | Ga0070662_100406832 | |||
| 1292 | Ga0070662_100448392 | |||
| 1293 | Ga0070662_101908064 | |||
| 1294 | Ga0070681_10001152 | |||
| 1295 | Ga0070681_10050252 | |||
| 1296 | Ga0070681_10053270 | |||
| 1297 | Ga0070681_10175294 | |||
| 1298 | Ga0070681_10747078 | |||
| 1299 | Ga0070681_11669001 | |||
| 1300 | Ga0068867_100065628 | |||
| 1301 | Ga0068867_100094632 | |||
| 1302 | Ga0070685_10114736 | |||
| 1303 | Ga0070706_100023584 | |||
| 1304 | Ga0070706_100056966 | |||
| 1305 | Ga0070706_100466967 | |||
| 1306 | Ga0070706_101260131 | |||
| 1307 | Ga0070707_100007453 | |||
| 1308 | Ga0070707_100140150 | |||
| 1309 | Ga0070707_100146332 | |||
| 1310 | Ga0070707_100902267 | |||
| 1311 | Ga0070698_100006683 | |||
| 1312 | Ga0070698_100017475 | |||
| 1313 | Ga0070698_100452986 | |||
| 1314 | Ga0070698_100943854 | |||
| 1315 | Ga0070699_100054647 | |||
| 1316 | Ga0070699_100276354 | |||
| 1317 | Ga0070699_100364658 | |||
| 1318 | Ga0070679_100159111 | |||
| 1319 | Ga0070679_100180933 | |||
| 1320 | Ga0070679_100207872 | |||
| 1321 | Ga0070679_100456462 | |||
| 1322 | Ga0070679_101700880 | |||
| 1323 | Ga0070684_100011059 | |||
| 1324 | Ga0070697_100246407 | |||
| 1325 | Ga0070697_100996691 | |||
| 1326 | Ga0068853_101109756 | |||
| 1327 | Ga0068853_102009444 | |||
| 1328 | Ga0070672_100033169 | |||
| 1329 | Ga0070686_100037537 | |||
| 1330 | Ga0070686_100313888 | |||
| 1331 | Ga0070686_100518435 | |||
| 1332 | Ga0070686_100566207 | |||
| 1333 | Ga0070686_100881849 | |||
| 1334 | Ga0070696_100067310 | |||
| 1335 | Ga0070696_100851041 | |||
| 1336 | Ga0070665_100160208 | |||
| 1337 | Ga0070665_101391392 | |||
| 1338 | Ga0070704_102202895 | |||
| 1339 | Ga0068855_100017426 | |||
| 1340 | Ga0068855_100588956 | |||
| 1341 | Ga0068855_100605833 | |||
| 1342 | Ga0068855_100724604 | |||
| 1343 | Ga0068855_100797900 | |||
| 1344 | Ga0070664_100038843 | |||
| 1345 | Ga0068857_100037617 | |||
| 1346 | Ga0068857_100338446 | |||
| 1347 | Ga0068856_100041817 | |||
| 1348 | Ga0068856_100065822 | |||
| 1349 | Ga0068856_100300969 | |||
| 1350 | Ga0068856_100442780 | |||
| 1351 | Ga0068856_100512557 | |||
| 1352 | Ga0070702_100194932 | |||
| 1353 | Ga0070702_100442140 | |||
| 1354 | Ga0070702_100809645 | |||
| 1355 | Ga0070702_101354084 | |||
| 1356 | Ga0068852_100088311 | |||
| 1357 | Ga0068859_100096097 | |||
| 1358 | Ga0068859_100242826 | |||
| 1359 | Ga0068859_100788006 | |||
| 1360 | Ga0068859_100799588 | |||
| 1361 | Ga0068859_100948072 | |||
| 1362 | Ga0068864_100007330 | |||
| 1363 | Ga0068864_100034477 | |||
| 1364 | Ga0068864_100348548 | |||
| 1365 | Ga0068864_100722957 | |||
| 1366 | Ga0068866_10645951 | |||
| 1367 | Ga0068861_100048984 | |||
| 1368 | Ga0068861_100570778 | |||
| 1369 | Ga0068861_100918525 | |||
| 1370 | Ga0068861_101144080 | |||
| 1371 | Ga0068861_101737301 | |||
| 1372 | Ga0068870_10547109 | |||
| 1373 | Ga0068870_11257347 | |||
| 1374 | Ga0068863_100794686 | |||
| 1375 | Ga0068863_101679409 | |||
| 1376 | Ga0068863_101730723 | |||
| 1377 | Ga0068858_100169996 | |||
| 1378 | Ga0068858_100866311 | |||
| 1379 | Ga0068858_102343213 | |||
| 1380 | Ga0068858_102411374 | |||
| 1381 | Ga0068860_100113245 | |||
| 1382 | Ga0068860_100127998 | |||
| 1383 | Ga0068860_100656527 | |||
| 1384 | Ga0068860_100765755 | |||
| 1385 | Ga0068860_101328784 | |||
| 1386 | Ga0068860_101681736 | |||
| 1387 | Ga0068862_100263019 | |||
| 1388 | Ga0068862_100365558 | |||
| 1389 | Ga0068862_101025373 | |||
| 1390 | Ga0068862_101166789 | |||
| 1391 | Ga0081455_10001285 | |||
| 1392 | Ga0081455_10004152 | |||
| 1393 | Ga0081455_10008714 | |||
| 1394 | Ga0081455_10019848 | |||
| 1395 | Ga0081455_10119563 | |||
| 1396 | Ga0081455_10218615 | |||
| 1397 | Ga0081455_10278708 | |||
| 1398 | Ga0081538_10002503 | |||
| 1399 | Ga0081538_10046120 | |||
| 1400 | Ga0081538_10183794 | |||
| 1401 | Ga0081538_10212529 | |||
| 1402 | Ga0081540_1014265 | |||
| 1403 | Ga0081540_1016449 | |||
| 1404 | Ga0081540_1038882 | |||
| 1405 | Ga0081540_1148069 | |||
| 1406 | Ga0081539_10014566 | |||
| 1407 | Ga0081539_10058101 | |||
| 1408 | Ga0081539_10074035 | |||
| 1409 | Ga0070717_10009576 | |||
| 1410 | Ga0070717_10087937 | |||
| 1411 | Ga0070717_10125013 | |||
| 1412 | Ga0070717_10296143 | |||
| 1413 | Ga0070717_10412267 | |||
| 1414 | Ga0070717_11476863 | |||
| 1415 | Ga0070717_11712133 | |||
| 1416 | Ga0075365_10332686 | |||
| 1417 | Ga0075363_100019332 | |||
| 1418 | Ga0075363_100022989 | |||
| 1419 | Ga0075363_100166982 | |||
| 1420 | Ga0075363_100527483 | |||
| 1421 | Ga0075364_10131778 | |||
| 1422 | Ga0075432_10039613 | |||
| 1423 | Ga0075432_10388938 | |||
| 1424 | Ga0075432_10575100 | |||
| 1425 | Ga0070715_10538716 | |||
| 1426 | Ga0070716_100503650 | |||
| 1427 | Ga0070712_100010216 | |||
| 1428 | Ga0070712_100021390 | |||
| 1429 | Ga0070712_100067347 | |||
| 1430 | Ga0070712_100119875 | |||
| 1431 | Ga0070712_100470190 | |||
| 1432 | Ga0070712_100495111 | |||
| 1433 | Ga0070712_100676336 | |||
| 1434 | Ga0070712_100996561 | |||
| 1435 | Ga0075362_10072161 | |||
| 1436 | Ga0075362_10074633 | |||
| 1437 | Ga0075362_10743328 | |||
| 1438 | Ga0075367_10023684 | |||
| 1439 | Ga0075367_10173410 | |||
| 1440 | Ga0075367_10250046 | |||
| 1441 | Ga0075367_10294798 | |||
| 1442 | Ga0075367_10350921 | |||
| 1443 | Ga0075369_10123622 | |||
| 1444 | Ga0075369_10275118 | |||
| 1445 | Ga0075427_10008235 | |||
| 1446 | Ga0075366_10353431 | |||
| 1447 | Ga0097621_100939877 | |||
| 1448 | Ga0075370_10249521 | |||
| 1449 | Ga0068871_100205742 | |||
| 1450 | Ga0068871_100514203 | |||
| 1451 | Ga0068871_102303062 | |||
| 1452 | Ga0075428_100004619 | |||
| 1453 | Ga0075428_100009365 | |||
| 1454 | Ga0075428_100030936 | |||
| 1455 | Ga0075428_100115423 | |||
| 1456 | Ga0075428_100311398 | |||
| 1457 | Ga0075428_100693178 | |||
| 1458 | Ga0075428_100697433 | |||
| 1459 | Ga0075430_100007440 | |||
| 1460 | Ga0075430_100046813 | |||
| 1461 | Ga0075430_100071358 | |||
| 1462 | Ga0075430_100116692 | |||
| 1463 | Ga0075430_100679175 | |||
| 1464 | Ga0075430_101251585 | |||
| 1465 | Ga0075430_101602258 | |||
| 1466 | Ga0075431_100004380 | |||
| 1467 | Ga0075431_100086642 | |||
| 1468 | Ga0075431_100105157 | |||
| 1469 | Ga0075431_100267726 | |||
| 1470 | Ga0075431_100838345 | |||
| 1471 | Ga0075431_101453645 | |||
| 1472 | Ga0075433_10079299 | |||
| 1473 | Ga0075433_10244853 | |||
| 1474 | Ga0075433_10851719 | |||
| 1475 | Ga0075434_100043527 | |||
| 1476 | Ga0075434_100843931 | |||
| 1477 | Ga0075429_100016046 | |||
| 1478 | Ga0075429_100061691 | |||
| 1479 | Ga0075429_100110914 | |||
| 1480 | Ga0075429_100349170 | |||
| 1481 | Ga0075429_101155172 | |||
| 1482 | Ga0075429_102001837 | |||
| 1483 | Ga0068865_100577511 | |||
| 1484 | Ga0068865_100599593 | |||
| 1485 | Ga0097620_100096099 | |||
| 1486 | Ga0097620_100242823 | |||
| 1487 | Ga0097620_100787964 | |||
| 1488 | Ga0097620_100799612 | |||
| 1489 | Ga0097620_100811535 | |||
| 1490 | Ga0097620_100947842 | |||
| 1491 | Ga0075435_100502802 | |||
| 1492 | Ga0075435_100627976 | |||
| 1493 | Ga0075435_100858525 | |||
| 1494 | Ga0075435_101432830 | |||
| 1495 | Ga0075435_101506190 | |||
| 1496 | Ga0099794_10276412 | |||
| 1497 | Ga0099795_10000237 | |||
| 1498 | Ga0099795_10222530 | |||
| 1499 | Ga0099795_10423471 | |||
| 1500 | Ga0105244_10512402 | |||
| 1501 | Ga0105250_10578213 | |||
| 1502 | Ga0105240_10003467 | |||
| 1503 | Ga0105240_11469625 | |||
| 1504 | Ga0111539_10025624 | |||
| 1505 | Ga0111539_10046741 | |||
| 1506 | Ga0111539_10508411 | |||
| 1507 | Ga0111539_10946076 | |||
| 1508 | Ga0111539_12191432 | |||
| 1509 | Ga0105245_10404063 | |||
| 1510 | Ga0105245_10480631 | |||
| 1511 | Ga0105245_10575379 | |||
| 1512 | Ga0105245_10644779 | |||
| 1513 | Ga0105245_12035332 | |||
| 1514 | Ga0105245_12140468 | |||
| 1515 | Ga0105247_10141812 | |||
| 1516 | Ga0105247_10206481 | |||
| 1517 | Ga0105247_10216862 | |||
| 1518 | Ga0105247_10291189 | |||
| 1519 | Ga0105247_10779696 | |||
| 1520 | Ga0114129_10052483 | |||
| 1521 | Ga0114129_10519023 | |||
| 1522 | Ga0114129_10722934 | |||
| 1523 | Ga0114129_10789325 | |||
| 1524 | Ga0114129_10794148 | |||
| 1525 | Ga0105243_10532913 | |||
| 1526 | Ga0105243_11042280 | |||
| 1527 | Ga0105243_11510507 | |||
| 1528 | Ga0105243_11593944 | |||
| 1529 | Ga0105241_11708505 | |||
| 1530 | Ga0105242_10532453 | |||
| 1531 | Ga0105242_10720827 | |||
| 1532 | Ga0105242_10768729 | |||
| 1533 | Ga0105248_10126790 | |||
| 1534 | Ga0105248_10273984 | |||
| 1535 | Ga0105248_10319558 | |||
| 1536 | Ga0105248_10567922 | |||
| 1537 | Ga0105248_10644158 | |||
| 1538 | Ga0105248_11008614 | |||
| 1539 | Ga0105248_12238285 | |||
| 1540 | Ga0105248_12466221 | |||
| 1541 | Ga0105237_10314451 | |||
| 1542 | Ga0105237_10964138 | |||
| 1543 | Ga0105238_10122740 | |||
| 1544 | Ga0105238_10763625 | |||
| 1545 | Ga0105238_11180702 | |||
| 1546 | Ga0105249_10240746 | |||
| 1547 | Ga0105249_10890360 | |||
| 1548 | Ga0105249_11718657 | |||
| 1549 | Ga0105249_11808700 | |||
| 1550 | Ga0105035_102989 | |||
| 1551 | Ga0099796_10004441 | |||
| 1552 | Ga0099796_10085129 | |||
| 1553 | Ga0099796_10168623 | |||
| 1554 | Ga0105239_10182724 | |||
| 1555 | Ga0105239_11414181 | |||
| 1556 | Ga0105239_12813857 | |||
| 1557 | Ga0105246_10007415 | |||
| 1558 | Ga0105246_11094296 | |||
| 1559 | Ga0157373_10203756 | |||
| 1560 | Ga0157371_10128371 | |||
| 1561 | Ga0157371_10529333 | |||
| 1562 | Ga0157369_10121041 | |||
| 1563 | Ga0157369_11558158 | |||
| 1564 | Ga0157374_10240273 | |||
| 1565 | Ga0157374_11823319 | |||
| 1566 | Ga0157374_11996801 | |||
| 1567 | Ga0157374_12096208 | |||
| 1568 | Ga0157374_12543035 | |||
| 1569 | Ga0157378_10429898 | |||
| 1570 | Ga0157378_10533562 | |||
| 1571 | Ga0157378_12206831 | |||
| 1572 | Ga0157378_12264081 | |||
| 1573 | Ga0157378_12413445 | |||
| 1574 | Ga0163162_10755250 | |||
| 1575 | Ga0163162_11508254 | |||
| 1576 | Ga0163162_11936868 | |||
| 1577 | Ga0163162_12948786 | |||
| 1578 | Ga0157372_10128361 | |||
| 1579 | Ga0157375_10141049 | |||
| 1580 | Ga0157375_10143093 | |||
| 1581 | Ga0157375_10321265 | |||
| 1582 | Ga0157375_10605121 | |||
| 1583 | Ga0163163_10039996 | |||
| 1584 | Ga0163163_10040918 | |||
| 1585 | Ga0163163_10141456 | |||
| 1586 | Ga0163163_10494785 | |||
| 1587 | Ga0163163_10677964 | |||
| 1588 | Ga0163163_11186309 | |||
| 1589 | Ga0163163_11748428 | |||
| 1590 | Ga0157380_10174558 | |||
| 1591 | Ga0157380_10210907 | |||
| 1592 | Ga0157380_10892163 | |||
| 1593 | Ga0157380_11275194 | |||
| 1594 | Ga0157380_13230620 | |||
| 1595 | Ga0182008_10037470 | |||
| 1596 | Ga0157377_10971819 | |||
| 1597 | Ga0157377_10986003 | |||
| 1598 | Ga0157379_10043895 | |||
| 1599 | Ga0157379_10080970 | |||
| 1600 | Ga0157379_10182222 | |||
| 1601 | Ga0157379_10511215 | |||
| 1602 | Ga0157379_11519288 | |||
| 1603 | Ga0157379_12175113 | |||
| 1604 | Ga0157376_10285904 | |||
| 1605 | Ga0157376_10362786 | |||
| 1606 | Ga0157376_10656299 | |||
| 1607 | Ga0157376_10894626 | |||
| 1608 | Ga0182007_10069741 | |||
| 1609 | Ga0163161_10162370 | |||
| 1610 | Ga0163161_10451607 | |||
| 1611 | Ga0163161_10776870 | |||
| 1612 | Ga0163161_10804494 | |||
| 1613 | Ga0206354_10341732 | |||
| 1614 | Ga0206353_11599512 | |||
| 1615 | Ga0213872_10440986 | |||
| 1616 | Ga0213874_10238262 | |||
| 1617 | Ga0213876_10041220 | |||
| 1618 | Ga0213875_10007211 | |||
| 1619 | Ga0213875_10129936 | |||
| 1620 | Ga0213871_10023826 | |||
| 1621 | Ga0224712_10282220 | |||
| 1622 | Ga0228598_1039612 | |||
| 1623 | Ga0207426_1071031 | |||
| 1624 | Ga0207682_10002121 | |||
| 1625 | Ga0207682_10362151 | |||
| 1626 | Ga0207692_10019780 | |||
| 1627 | Ga0207692_10032657 | |||
| 1628 | Ga0207692_10074755 | |||
| 1629 | Ga0207692_10142181 | |||
| 1630 | Ga0207692_10669558 | |||
| 1631 | Ga0207692_10787014 | |||
| 1632 | Ga0207692_10956745 | |||
| 1633 | Ga0207692_11210198 | |||
| 1634 | Ga0207642_10062410 | |||
| 1635 | Ga0207642_10400806 | |||
| 1636 | Ga0207710_10088984 | |||
| 1637 | Ga0207688_10002666 | |||
| 1638 | Ga0207688_10076000 | |||
| 1639 | Ga0207688_10119204 | |||
| 1640 | Ga0207688_10141901 | |||
| 1641 | Ga0207680_10379792 | |||
| 1642 | Ga0207680_10573296 | |||
| 1643 | Ga0207680_11069310 | |||
| 1644 | Ga0207647_10143742 | |||
| 1645 | Ga0207699_10018475 | |||
| 1646 | Ga0207699_10174489 | |||
| 1647 | Ga0207699_10426556 | |||
| 1648 | Ga0207699_10885331 | |||
| 1649 | Ga0207645_10105493 | |||
| 1650 | Ga0207643_10001626 | |||
| 1651 | Ga0207643_10080461 | |||
| 1652 | Ga0207643_10294986 | |||
| 1653 | Ga0207705_10094832 | |||
| 1654 | Ga0207684_10069874 | |||
| 1655 | Ga0207684_10074148 | |||
| 1656 | Ga0207684_10232221 | |||
| 1657 | Ga0207684_10478400 | |||
| 1658 | Ga0207654_10227211 | |||
| 1659 | Ga0207654_10466281 | |||
| 1660 | Ga0207654_10852797 | |||
| 1661 | Ga0207707_10041293 | |||
| 1662 | Ga0207707_10101471 | |||
| 1663 | Ga0207707_10148664 | |||
| 1664 | Ga0207707_10239271 | |||
| 1665 | Ga0207707_11369431 | |||
| 1666 | Ga0207695_10054005 | |||
| 1667 | Ga0207695_10546229 | |||
| 1668 | Ga0207671_10080602 | |||
| 1669 | Ga0207693_10002165 | |||
| 1670 | Ga0207693_10017026 | |||
| 1671 | Ga0207693_10019034 | |||
| 1672 | Ga0207693_10020506 | |||
| 1673 | Ga0207693_10059066 | |||
| 1674 | Ga0207693_10118265 | |||
| 1675 | Ga0207693_10181876 | |||
| 1676 | Ga0207693_10213555 | |||
| 1677 | Ga0207693_10667639 | |||
| 1678 | Ga0207693_11334537 | |||
| 1679 | Ga0207663_10240670 | |||
| 1680 | Ga0207663_10433683 | |||
| 1681 | Ga0207663_11493280 | |||
| 1682 | Ga0207660_10010887 | |||
| 1683 | Ga0207660_10572969 | |||
| 1684 | Ga0207660_10826523 | |||
| 1685 | Ga0207662_10018906 | |||
| 1686 | Ga0207657_10091291 | |||
| 1687 | Ga0207649_10103950 | |||
| 1688 | Ga0207652_10339566 | |||
| 1689 | Ga0207652_11011763 | |||
| 1690 | Ga0207646_10092084 | |||
| 1691 | Ga0207646_10125031 | |||
| 1692 | Ga0207646_10176670 | |||
| 1693 | Ga0207646_10546134 | |||
| 1694 | Ga0207646_10784922 | |||
| 1695 | Ga0207646_11347838 | |||
| 1696 | Ga0207681_10139159 | |||
| 1697 | Ga0207681_10675818 | |||
| 1698 | Ga0207681_10811169 | |||
| 1699 | Ga0207681_11194820 | |||
| 1700 | Ga0207681_11503921 | |||
| 1701 | Ga0207694_10213191 | |||
| 1702 | Ga0207650_10700860 | |||
| 1703 | Ga0207650_10818887 | |||
| 1704 | Ga0207659_10114491 | |||
| 1705 | Ga0207659_10304725 | |||
| 1706 | Ga0207659_10760968 | |||
| 1707 | Ga0207687_10251508 | |||
| 1708 | Ga0207700_10062858 | |||
| 1709 | Ga0207700_10067540 | |||
| 1710 | Ga0207700_10200541 | |||
| 1711 | Ga0207700_10406805 | |||
| 1712 | Ga0207700_10658349 | |||
| 1713 | Ga0207700_10916603 | |||
| 1714 | Ga0207664_10045279 | |||
| 1715 | Ga0207664_10098990 | |||
| 1716 | Ga0207664_10141638 | |||
| 1717 | Ga0207664_10640116 | |||
| 1718 | Ga0207664_11418911 | |||
| 1719 | Ga0207644_10022359 | |||
| 1720 | Ga0207644_10164837 | |||
| 1721 | Ga0207644_10756443 | |||
| 1722 | Ga0207644_11659092 | |||
| 1723 | Ga0207690_10049381 | |||
| 1724 | Ga0207690_10335871 | |||
| 1725 | Ga0207690_11832280 | |||
| 1726 | Ga0207706_10339881 | |||
| 1727 | Ga0207706_10348142 | |||
| 1728 | Ga0207686_10220929 | |||
| 1729 | Ga0207709_11475976 | |||
| 1730 | Ga0207670_10008201 | |||
| 1731 | Ga0207670_10091586 | |||
| 1732 | Ga0207670_10672719 | |||
| 1733 | Ga0207670_11499685 | |||
| 1734 | Ga0207669_10160054 | |||
| 1735 | Ga0207669_10224009 | |||
| 1736 | Ga0207669_11099660 | |||
| 1737 | Ga0207704_10150491 | |||
| 1738 | Ga0207704_10425345 | |||
| 1739 | Ga0207665_10109139 | |||
| 1740 | Ga0207665_10664763 | |||
| 1741 | Ga0207691_10004008 | |||
| 1742 | Ga0207691_10036729 | |||
| 1743 | Ga0207691_10217212 | |||
| 1744 | Ga0207691_10236149 | |||
| 1745 | Ga0207711_10003717 | |||
| 1746 | Ga0207711_10155377 | |||
| 1747 | Ga0207711_10440290 | |||
| 1748 | Ga0207711_10860221 | |||
| 1749 | Ga0207711_11210955 | |||
| 1750 | Ga0207711_11296590 | |||
| 1751 | Ga0207711_11583785 | |||
| 1752 | Ga0207711_11671325 | |||
| 1753 | Ga0207689_10547649 | |||
| 1754 | Ga0207689_10551476 | |||
| 1755 | Ga0207689_11055628 | |||
| 1756 | Ga0207661_10180940 | |||
| 1757 | Ga0207661_10850935 | |||
| 1758 | Ga0207661_10941590 | |||
| 1759 | Ga0207661_11046541 | |||
| 1760 | Ga0207679_10223235 | |||
| 1761 | Ga0207679_10491315 | |||
| 1762 | Ga0207679_11816494 | |||
| 1763 | Ga0207667_10044823 | |||
| 1764 | Ga0207667_10112413 | |||
| 1765 | Ga0207667_10800475 | |||
| 1766 | Ga0207667_11307340 | |||
| 1767 | Ga0207651_10352725 | |||
| 1768 | Ga0207651_10812275 | |||
| 1769 | Ga0207712_10747299 | |||
| 1770 | Ga0207712_10979989 | |||
| 1771 | Ga0207712_11859925 | |||
| 1772 | Ga0207668_10139663 | |||
| 1773 | Ga0207668_10188695 | |||
| 1774 | Ga0207668_11325258 | |||
| 1775 | Ga0207668_11673845 | |||
| 1776 | Ga0207658_10702240 | |||
| 1777 | Ga0207658_10921922 | |||
| 1778 | Ga0207677_10287169 | |||
| 1779 | Ga0207677_12111355 | |||
| 1780 | Ga0207703_10243704 | |||
| 1781 | Ga0207703_11863243 | |||
| 1782 | Ga0207639_10367097 | |||
| 1783 | Ga0207639_10420398 | |||
| 1784 | Ga0207678_10176275 | |||
| 1785 | Ga0207678_10241455 | |||
| 1786 | Ga0207678_11160044 | |||
| 1787 | Ga0207708_10212232 | |||
| 1788 | Ga0207708_10423909 | |||
| 1789 | Ga0207708_10896120 | |||
| 1790 | Ga0207702_10125306 | |||
| 1791 | Ga0207702_10141254 | |||
| 1792 | Ga0207702_10270420 | |||
| 1793 | Ga0207702_10352266 | |||
| 1794 | Ga0207702_11219866 | |||
| 1795 | Ga0207702_11655165 | |||
| 1796 | Ga0207702_12452370 | |||
| 1797 | Ga0207641_10360506 | |||
| 1798 | Ga0207641_10776846 | |||
| 1799 | Ga0207641_11263007 | |||
| 1800 | Ga0207648_10051810 | |||
| 1801 | Ga0207648_10089803 | |||
| 1802 | Ga0207648_10955748 | |||
| 1803 | Ga0207676_10035299 | |||
| 1804 | Ga0207676_10243527 | |||
| 1805 | Ga0207676_10407903 | |||
| 1806 | Ga0207676_12088330 | |||
| 1807 | Ga0207674_10046322 | |||
| 1808 | Ga0207674_10068392 | |||
| 1809 | Ga0207675_100004996 | |||
| 1810 | Ga0207675_100053730 | |||
| 1811 | Ga0207675_100065085 | |||
| 1812 | Ga0207675_100191830 | |||
| 1813 | Ga0207675_100357476 | |||
| 1814 | Ga0207675_100624734 | |||
| 1815 | Ga0207675_101508907 | |||
| 1816 | Ga0207675_101773736 | |||
| 1817 | Ga0207683_10011410 | |||
| 1818 | Ga0207683_10058366 | |||
| 1819 | Ga0207683_10074150 | |||
| 1820 | Ga0207683_10097598 | |||
| 1821 | Ga0207683_11938959 | |||
| 1822 | Ga0207698_10233817 | |||
| 1823 | Ga0207698_10903400 | |||
| 1824 | Ga0209179_1043654 | |||
| 1825 | Ga0209179_1142515 | |||
| 1826 | Ga0209813_10088531 | |||
| 1827 | Ga0207428_10034685 | |||
| 1828 | Ga0207428_10147229 | |||
| 1829 | Ga0207428_10226536 | |||
| 1830 | Ga0207428_10721362 | |||
| 1831 | Ga0268266_10834296 | |||
| 1832 | Ga0268265_10102216 | |||
| 1833 | Ga0268265_10169505 | |||
| 1834 | Ga0268265_10304816 | |||
| 1835 | Ga0268265_10980491 | |||
| 1836 | Ga0268265_11096103 | |||
| 1837 | Ga0268264_10148943 | |||
| 1838 | Ga0268264_10630079 | |||
| 1839 | Ga0268264_10846845 | |||
| 1840 | Ga0265334_10025605 | |||
| 1841 | Ga0265770_1058502 | |||
| 1842 | Ga0265760_10064822 | |||
| 1843 | Ga0265330_10274584 | |||
| 1844 | Ga0265332_10110015 | |||
| 1845 | Ga0265325_10071089 | |||
| 1846 | Ga0265325_10530048 | |||
| 1847 | Ga0265329_10245595 | |||
| 1848 | Ga0265340_10157435 | |||
| 1849 | Ga0265339_10512018 | |||
| 1850 | Ga0265339_10594919 | |||
| 1851 | Ga0265327_10064161 | |||
| 1852 | Ga0265316_10245996 | |||
| 1853 | Ga0265316_10911571 | |||
| 1854 | Ga0307513_10129091 | |||
| 1855 | Ga0265342_10304322 | |||
| 1856 | Ga0316576_10004877 | |||
| 1857 | Ga0307405_10158387 | |||
| 1858 | Ga0307413_10558187 | |||
| 1859 | Ga0307413_10590571 | |||
| 1860 | Ga0307413_11439849 | |||
| 1861 | Ga0307410_10313703 | |||
| 1862 | Ga0307410_10373883 | |||
| 1863 | Ga0307406_10426985 | |||
| 1864 | Ga0307406_10542464 | |||
| 1865 | Ga0307412_11277053 | |||
| 1866 | Ga0307409_101881601 | |||
| 1867 | Ga0307416_100075944 | |||
| 1868 | Ga0307416_100115956 | |||
| 1869 | Ga0307416_100756627 | |||
| 1870 | Ga0307416_101627524 | |||
| 1871 | Ga0307414_10023092 | |||
| 1872 | Ga0307411_11006256 | |||
| 1873 | Ga0307415_101586246 | |||
| 1874 | Ga0373930_0007127 | |||
| 1875 | Ga0373930_0072164 | |||
| 1876 | Ga0373948_0085880 | |||
| 1877 | Ga0373958_0023348 | |||
| 1878 | Ga0373938_0012328 | |||
| 1879 | Ga0373926_0457394 | |||
| 1880 | Ga0373928_0069546 | |||
| 1881 | Ga0373928_0079779 | |||
| 1882 | Ga0373929_0144235 | |||
| 1883 | Ga0373934_0063951 | |||
| 1884 | Ga0373934_0335811 | |||
| 1885 | Ga0373944_0087370 | |||
| 1886 | Ga0373944_0195308 | |||
| 1887 | Ga0373949_0256435 | |||
| 1888 | Ga0373923_0052094 | |||
| 1889 | Ga0373923_0066352 | |||
| 1890 | Ga0373923_0193084 | |||
| 1891 | Ga0373923_0474299 | |||
| 1892 | Ga0373923_0474435 | |||
| 1893 | Ga0373932_0098324 | |||
| 1894 | Ga0373932_0223679 | |||
| 1895 | Ga0373941_0032936 | |||
| 1896 | Ga0373941_0195598 | |||
| 1897 | Ga0373945_0137638 | |||
| 1898 | Ga0373945_0195374 | |||
| 1899 | Ga0373945_0352050 | |||
| 1900 | Ga0373953_0042164 | |||
| 1901 | Ga0373954_0062818 | |||
| 1902 | Ga0373957_0223669 | |||
| 1903 | Ga0373960_0056480 | |||
| 1904 | Ga0373943_0111803 | |||
| 1905 | Ga0373943_0139392 | |||
| 1906 | Ga0373943_0415235 | |||
| 1907 | Ga0373943_0473926 | |||
| 1908 | Ga0373946_0024327 | |||
| 1909 | Ga0373946_0123555 | |||
| 1910 | Ga0373946_0131635 | |||
| 1911 | Ga0373946_0306223 | |||
| 1912 | Ga0373955_0035900 | |||
| 1913 | Ga0373942_0344426 | |||
| 1914 | Ga0316574_0000554 | |||
| 1915 | Ga0373924_0056580 | |||
| 1916 | Ga0373924_0171450 | |||
| 1917 | Ga0373924_0201763 | |||
| 1918 | Ga0373924_0213733 | |||
| 1919 | Ga0373924_0370194 | |||
| 1920 | Ga0373924_0561581 | |||
| 1921 | Ga0373931_0005698 | |||
| 1922 | Ga0373931_0212666 | |||
| 1923 | Ga0373931_0263133 | |||
| 1924 | Ga0373935_0132319 | |||
| 1925 | Ga0373935_0154422 | |||
| 1926 | Ga0373935_0361736 | |||
| 1927 | Ga0373935_0445179 | |||
| 1928 | Ga0373935_0573908 | |||
| 1929 | Ga0373927_0035725 | |||
| 1930 | Ga0373927_0099605 | |||
| 1931 | Ga0373927_0318478 | |||
| 1932 | Ga0373927_0435138 | |||
| 1933 | Ga0373933_0019411 | |||
| 1934 | Ga0373933_0204709 | |||
| 1935 | Ga0373933_0466929 | |||
| 1936 | Ga0373933_0573722 | |||
| 1937 | Ga0373947_0016135 | |||
| 1938 | Ga0373947_0210116 | |||
| 1939 | Ga0373947_0258864 | |||
| 1940 | Ga0373947_0433857 | |||
| 1941 | Ga0373947_0434812 | |||
| 1942 | Ga0373947_0476578 | |||
| 1943 | Ga0373947_0797876 | |||
| 1944 | Ga0373937_0010322 | |||
| 1945 | Ga0373937_0011572 | |||
| 1946 | Ga0373937_0042211 | |||
| 1947 | Ga0373937_0151436 | |||
| 1948 | Ga0373937_0226175 | |||
| 1949 | Ga0373937_0255204 | |||
| 1950 | Ga0373937_0842979 | |||
| 1951 | Ga0373937_1293272 | |||
| 1952 | Ga0373937_1454726 | |||
| 1953 | Ga0316584_0080860 | |||
| 1954 | Ga0373925_0011071 | |||
| 1955 | Ga0373925_0152202 | |||
| 1956 | Ga0373925_0159821 | |||
| 1957 | Ga0373925_0200637 | |||
| 1958 | Ga0373925_0223869 | |||
| 1959 | Ga0373925_0339535 | |||
| 1960 | Ga0373925_0447899 | |||
| 1961 | Ga0373925_0536599 | |||
| 1962 | Ga0373925_0995618 | |||
| 1963 | Ga0395899_0085033 | |||
| 1964 | Ga0395899_0089097 | |||
| 1965 | Ga0395900_0102684 | |||
| 1966 | Ga0395900_0119467 | |||
| 1967 | Ga0395900_0192735 | |||
| 1968 | Ga0395900_0456322 | |||
| 1969 | Ga0395898_0324483 | |||
| 1970 | Ga0395898_0771188 | |||
| 1971 | Ga0395905_0205943 | |||
| 1972 | Ga0436364_0293754 | |||
| 1973 | Ga0436364_0318274 | |||
| 1974 | Ga0436364_0379074 | |||
| 1975 | Ga0436364_0457515 | |||
| 1976 | Ga0436364_0911241 | |||
| 1977 | Ga0436364_0912700 | |||
| 1978 | Ga0436364_0952421 | |||
| 1979 | Ga0436364_1041984 | |||
| 1980 | Ga0395901_0011181 | |||
| 1981 | Ga0395901_0031666 | |||
| 1982 | Ga0395901_0160315 | |||
| 1983 | Ga0395901_0210272 | |||
| 1984 | Ga0436365_0094547 | |||
| 1985 | Ga0436365_0219364 | |||
| 1986 | Ga0436365_0267445 | |||
| 1987 | Ga0436365_0360139 | |||
| 1988 | Ga0436365_0501014 | |||
| 1989 | Ga0436365_0596609 | |||
| 1990 | Ga0436365_0720013 | |||
| 1991 | Ga0436365_0843728 | |||
| 1992 | Ga0436365_1110167 | |||
| 1993 | Ga0436365_1489642 | |||
| 1994 | Ga0436360_0043757 | |||
| 1995 | Ga0436360_0079681 | |||
| 1996 | Ga0436360_0180394 | |||
| 1997 | Ga0436360_0255206 | |||
| 1998 | Ga0436360_0404586 | |||
| 1999 | Ga0436360_1029522 | |||
| 2000 | Ga0436360_1055705 | |||
| 2001 | Ga0436360_1126448 | |||
| 2002 | Ga0436360_1277821 | |||
| 2003 | Ga0436360_1344602 | |||
| 2004 | Ga0436361_0096195 | |||
| 2005 | Ga0436361_0145041 | |||
| 2006 | Ga0436361_0506783 | |||
| 2007 | Ga0436361_0617642 | |||
| 2008 | Ga0436363_0706903 | |||
| 2009 | Ga0436363_0851323 | |||
| 2010 | Ga0436363_1077716 | |||
| 2011 | Ga0436363_1635770 | |||
| 2012 | Ga0436362_0169667 | |||
| 2013 | Ga0436362_0249591 | |||
| 2014 | Ga0436362_0859630 | |||
| 2015 | Ga0436362_1035255 | |||
| 2016 | Ga0439453_0000261 | |||
| 2017 | Ga0451787_279969 | |||
| 2018 | Ga0451802_1332546 | |||
| 2019 | Ga0451833_0725335 | |||
| 2020 | Ga0451841_0664810 | |||
| 2021 | Ga0439448_0020041 | |||
| 2022 | Ga0439455_0066350 | |||
| 2023 | Ga0439456_090928 | |||
| 2024 | Ga0439457_160751 | |||
| 2025 | Ga0439458_0084594 | |||
| 2026 | Ga0439435_0043450 | |||
| 2027 | Ga0439444_0006855 | |||
| 2028 | Ga0439459_0058459 | |||
| 2029 | Ga0439460_0027441 | |||
| 2030 | Ga0451577_0404817 | |||
| 2031 | Ga0439440_0192608 | |||
| 2032 | Ga0466966_0677853 | |||
| 2033 | Ga0466961_0292966 | |||
| 2034 | Ga0466963_0009031 | |||
| 2035 | Ga0453684_1192451 | |||
| 2036 | Ga0466957_0006661 | |||
| 2037 | Ga0466960_0089059 | |||
| 2038 | Ga0466960_0531418 | |||
| 2039 | Ga0451576_2203968 | |||
| 2040 | Ga0466958_0304666 | |||
| 2041 | Ga0466958_0456439 | |||
| 2042 | Ga0466958_0886133 | |||
| 2043 | Ga0466967_0328347 | |||
| 2044 | Ga0495592_0230892 | |||
| 2045 | Ga0495592_0654506 | |||
| 2046 | Ga0495590_0110931 | |||
| 2047 | Ga0495629_0121489 | |||
| 2048 | Ga0495638_0005322 | |||
| 2049 | Ga0495638_0023899 | |||
| 2050 | Ga0495638_0532239 | |||
| 2051 | Ga0495638_0636474 | |||
| 2052 | Ga0495641_0159479 | |||
| 2053 | Ga0495651_0019063 | |||
| 2054 | Ga0495580_0175190 | |||
| 2055 | Ga0495580_0821387 | |||
| 2056 | Ga0495580_0859930 | |||
| 2057 | Ga0495582_0019353 | |||
| 2058 | Ga0495582_0886454 | |||
| 2059 | Ga0495605_0241149 | |||
| 2060 | Ga0495639_0008479 | |||
| 2061 | Ga0495664_0000446 | |||
| 2062 | Ga0495584_0015860 | |||
| 2063 | Ga0495594_0596128 | |||
| 2064 | Ga0495594_0788121 | |||
| 2065 | Ga0495608_0030865 | |||
| 2066 | Ga0495616_0198159 | |||
| 2067 | Ga0495620_0133636 | |||
| 2068 | Ga0495628_0044634 | |||
| 2069 | Ga0495628_0089536 | |||
| 2070 | Ga0495630_0819223 | |||
| 2071 | Ga0495630_1179054 | |||
| 2072 | Ga0495630_1428609 | |||
| 2073 | Ga0495643_0487005 | |||
| 2074 | Ga0495666_0209221 | |||
| 2075 | Ga0495652_0140559 | |||
| 2076 | Ga0495665_0041929 | |||
| 2077 | Ga0495640_0090123 | |||
| 2078 | Ga0495586_0656070 | |||
| 2079 | Ga0495587_0039923 | |||
| 2080 | Ga0495587_0304632 | |||
| 2081 | Ga0495645_0008204 | |||
| 2082 | Ga0495645_0898401 | |||
| 2083 | Ga0495622_0531721 | |||
| 2084 | Ga0495633_0224463 | |||
| 2085 | Ga0495667_0005255 | |||
| 2086 | Ga0495667_0023798 | |||
| 2087 | Ga0495667_0229606 | |||
| 2088 | Ga0495656_0222290 | |||
| 2089 | Ga0495668_0071749 | |||
| 2090 | Ga0495668_0800404 | |||
| 2091 | Ga0495634_0477219 | |||
| 2092 | Ga0495634_0597574 | |||
| 2093 | Ga0495611_0206718 | |||
| 2094 | Ga0495625_0208376 | |||
| 2095 | Ga0495635_0005845 | |||
| 2096 | Ga0495635_0292016 | |||
| 2097 | Ga0495661_0410720 | |||
| 2098 | Ga0495588_0302946 | |||
| 2099 | Ga0495588_0464718 | |||
| 2100 | Ga0495657_0289480 | |||
| 2101 | Ga0495599_0007396 | |||
| 2102 | Ga0495599_0056282 | |||
| 2103 | Ga0495623_0277063 | |||
| 2104 | Ga0495623_0455193 | |||
| 2105 | Ga0495646_0014797 | |||
| 2106 | Ga0495646_0122527 | |||
| 2107 | Ga0495646_0501789 | |||
| 2108 | Ga0495658_0611465 | |||
| 2109 | Ga0495669_0178913 | |||
| 2110 | Ga0495613_0118298 | |||
| 2111 | Ga0495613_0327521 | |||
| 2112 | Ga0495671_0484148 | |||
| 2113 | Ga0495589_0221069 | |||
| 2114 | Ga0495589_0280438 | |||
| 2115 | Ga0495600_0178042 | |||
| 2116 | Ga0495581_0487082 | |||
| 2117 | Ga0495604_0205734 | |||
| 2118 | Ga0495674_0070100 | |||
| 2119 | Ga0495676_0329898 | |||
| 2120 | Ga0495680_0080958 | |||
| 2121 | Ga0495680_0115796 | |||
| 2122 | Ga0495680_0477349 | |||
| 2123 | Ga0495675_0227682 | |||
| 2124 | Ga0495675_0713432 | |||
| 2125 | Ga0495684_0126792 | |||
| 2126 | Ga0495593_0184475 | |||
| 2127 | Ga0495593_0447248 | |||
| 2128 | Ga0495602_0000599 | |||
| 2129 | Ga0495602_0030436 | |||
| 2130 | Ga0495602_0058529 | |||
| 2131 | Ga0495602_0792718 | |||
| 2132 | Ga0495615_0057733 | |||
| 2133 | Ga0496100_0022252 | |||
| 2134 | Ga0496100_0112976 | |||
| 2135 | Ga0496100_0182693 | |||
| 2136 | Ga0496101_0181217 | |||
| 2137 | Ga0496101_0357290 | |||
| 2138 | Ga0496101_0688230 | |||
| 2139 | Ga0496102_0089407 | |||
| 2140 | Ga0496102_0106489 | |||
| 2141 | Ga0496102_0290011 | |||
| 2142 | Ga0496102_0349742 | |||
| 2143 | Ga0496102_0943241 | |||
| 2144 | Ga0496103_0198823 | |||
| 2145 | Ga0496104_0001104 | |||
| 2146 | Ga0496104_0004659 | |||
| 2147 | Ga0496104_0059771 | |||
| 2148 | Ga0496104_0405603 | |||
| 2149 | Ga0496104_0564667 | |||
| 2150 | Ga0496104_0674123 | |||
| 2151 | Ga0496104_0836820 | |||
| 2152 | Ga0496105_0015005 | |||
| 2153 | Ga0496105_0017200 | |||
| 2154 | Ga0496105_0024151 | |||
| 2155 | Ga0496105_0145898 | |||
| 2156 | Ga0496105_0312684 | |||
| 2157 | Ga0496106_0034132 | |||
| 2158 | Ga0496106_0092248 | |||
| 2159 | Ga0496106_0233267 | |||
| 2160 | Ga0496107_0042424 | |||
| 2161 | Ga0496107_0077830 | |||
| 2162 | Ga0496107_0242399 | |||
| 2163 | Ga0496107_0929960 | |||
| 2164 | Ga0496108_0029045 | |||
| 2165 | Ga0496108_0083883 | |||
| 2166 | Ga0496108_0106853 | |||
| 2167 | Ga0496108_0275392 | |||
| 2168 | Ga0496108_0382737 | |||
| 2169 | Ga0496108_0476726 | |||
| 2170 | Ga0496108_0644844 | |||
| 2171 | Ga0496109_0011205 | |||
| 2172 | Ga0496109_0173543 | |||
| 2173 | Ga0496109_0619194 | |||
| 2174 | Ga0496109_0964831 | |||
| 2175 | Ga0496109_1718322 | |||
| 2176 | Ga0496110_0008353 | |||
| 2177 | Ga0496110_0053884 | |||
| 2178 | Ga0496110_0282720 | |||
| 2179 | Ga0496110_0367130 | |||
| 2180 | Ga0496110_0562992 | |||
| 2181 | Ga0496111_0004033 | |||
| 2182 | Ga0496111_0114041 | |||
| 2183 | Ga0496111_0178722 | |||
| 2184 | Ga0496111_0839917 | |||
| 2185 | Ga0496112_0092849 | |||
| 2186 | Ga0496112_0099383 | |||
| 2187 | Ga0496112_0214962 | |||
| 2188 | Ga0496112_0366001 | |||
| 2189 | Ga0496112_0427658 | |||
| 2190 | Ga0496112_0484024 | |||
| 2191 | Ga0496112_0715966 | |||
| 2192 | Ga0496112_0984013 | |||
| 2193 | Ga0496112_1004698 | |||
| 2194 | Ga0496113_0025785 | |||
| 2195 | Ga0496113_0146944 | |||
| 2196 | Ga0496113_0156960 | |||
| 2197 | Ga0496113_0242835 | |||
| 2198 | Ga0496113_0714272 | |||
| 2199 | Ga0496113_0821084 | |||
| 2200 | Ga0496113_0947177 | |||
| 2201 | Ga0496114_0020588 | |||
| 2202 | Ga0496114_0148548 | |||
| 2203 | Ga0496114_0163640 | |||
| 2204 | Ga0496115_0021674 | |||
| 2205 | Ga0496115_0084936 | |||
| 2206 | Ga0496115_0533686 | |||
| 2207 | Ga0496119_0075291 | |||
| 2208 | Ga0496120_0016883 | |||
| 2209 | Ga0496126_0824531 | |||
| 2210 | Ga0501031_0369623 | |||
| 2211 | Ga0501031_0418723 | |||
| 2212 | Ga0501032_0358693 | |||
| 2213 | Ga0501033_0030233 | |||
| 2214 | Ga0501033_0731672 | |||
| 2215 | Ga0501034_0004530 | |||
| 2216 | Ga0501034_0048873 | |||
| 2217 | Ga0501034_0138934 | |||
| 2218 | Ga0501034_0191023 | |||
| 2219 | Ga0501036_0811778 | |||
| 2220 | Ga0501036_0828658 | |||
| 2221 | Ga0501036_1101269 | |||
| 2222 | Ga0501037_0014364 | |||
| 2223 | Ga0501038_0343918 | |||
| 2224 | Ga0501038_0506369 | |||
| 2225 | Ga0501038_0528552 | |||
| 2226 | Ga0501039_0555155 | |||
| 2227 | Ga0501039_0842313 | |||
| 2228 | Ga0501040_0546358 | |||
| 2229 | Ga0501040_1238148 | |||
| 2230 | Ga0501041_0137666 | |||
| 2231 | Ga0501042_0108985 | |||
| 2232 | Ga0501043_0840957 | |||
| 2233 | Ga0501046_0203550 | |||
| 2234 | Ga0501047_0129823 | |||
| 2235 | Ga0501047_0304218 | |||
| 2236 | Ga0501047_0319601 | |||
| 2237 | Ga0501048_0097824 | |||
| 2238 | Ga0501048_0282804 | |||
| 2239 | Ga0501068_0008897 | |||
| 2240 | Ga0501068_0314789 | |||
| 2241 | Ga0501068_0999979 | |||
| 2242 | Ga0501069_0654519 | |||
| 2243 | Ga0501070_0191902 | |||
| 2244 | Ga0501070_0233215 | |||
| 2245 | Ga0501070_0526750 | |||
| 2246 | Ga0501070_0986090 | |||
| 2247 | Ga0501071_0336321 | |||
| 2248 | Ga0501071_0400673 | |||
| 2249 | Ga0501071_1128237 | |||
| 2250 | Ga0501072_0141251 | |||
| 2251 | Ga0501072_0450940 | |||
| 2252 | Ga0501072_0799782 | |||
| 2253 | Ga0501072_1046583 | |||
| 2254 | Ga0501072_1199152 | |||
| 2255 | Ga0501073_0194332 | |||
| 2256 | Ga0501073_0407253 | |||
| 2257 | Ga0501076_0218418 | |||
| 2258 | Ga0501076_0781837 | |||
| 2259 | Ga0501077_0289670 | |||
| 2260 | Ga0501080_0287794 | |||
| 2261 | Ga0501080_0573942 | |||
| 2262 | Ga0501080_0753534 | |||
| 2263 | Ga0501080_1105567 | |||
| 2264 | Ga0501080_1628049 | |||
| 2265 | Ga0501081_0297855 | |||
| 2266 | Ga0501081_0409819 | |||
| 2267 | Ga0501035_0092116 | |||
| 2268 | Ga0501035_0510320 | |||
| 2269 | Ga0501035_0926740 | |||
| 2270 | Ga0501044_0071231 | |||
| 2271 | Ga0501044_0174924 | |||
| 2272 | Ga0501044_0203380 | |||
| 2273 | Ga0501044_0397535 | |||
| 2274 | Ga0501044_0842081 | |||
| 2275 | Ga0501045_0237382 | |||
| 2276 | Ga0501045_0970874 | |||
| 2277 | nmdc:mga03683_161650_c1 | |||
| 2278 | nmdc:mga03683_326773_c1 | |||
| 2279 | nmdc:mga03683_82565_c1 | |||
| 2280 | nmdc:mga03n38_14547_c1 | |||
| 2281 | nmdc:mga03n38_24423_c1 | |||
| 2282 | nmdc:mga03n38_49021_c1 | |||
| 2283 | nmdc:mga00v17_278354_c1 | |||
| 2284 | nmdc:mga00v17_568681_c1 | |||
| 2285 | nmdc:mga0k408_22378_c1 | |||
| 2286 | nmdc:mga06z11_26296_c1 | |||
| 2287 | nmdc:mga06z11_299_c1 | |||
| 2288 | nmdc:mga06z11_311993_c1 | |||
| 2289 | nmdc:mga06z11_3349_c1 | |||
| 2290 | nmdc:mga06z11_544167_c1 | |||
| 2291 | nmdc:mga06z11_586301_c1 | |||
| 2292 | nmdc:mga04h51_117127_c1 | |||
| 2293 | nmdc:mga04h51_201419_c1 | |||
| 2294 | nmdc:mga04h51_22862_c1 | |||
| 2295 | nmdc:mga04h51_79177_c1 | |||
| 2296 | nmdc:mga07m45_282299_c1 | |||
| 2297 | nmdc:mga05p37_1019249_c1 | |||
| 2298 | nmdc:mga05p37_1692977_c1 | |||
| 2299 | nmdc:mga05p37_170768_c1 | |||
| 2300 | nmdc:mga05p37_1771279_c1 | |||
| 2301 | nmdc:mga05p37_60902_c1 | |||
| 2302 | nmdc:mga05p37_72006_c1 | |||
| 2303 | nmdc:mga09592_11144_c1 | |||
| 2304 | nmdc:mga09592_152887_c1 | |||
| 2305 | nmdc:mga09592_436351_c2 | |||
| 2306 | nmdc:mga09592_576604_c1 | |||
| 2307 | nmdc:mga09592_657779_c1 | |||
| 2308 | nmdc:mga09592_750513_c1 | |||
| 2309 | nmdc:mga09592_84591_c1 | |||
| 2310 | nmdc:mga0qj67_146531_c1 | |||
| 2311 | nmdc:mga0qj67_168105_c1 | |||
| 2312 | nmdc:mga0qj67_19_c1 | |||
| 2313 | nmdc:mga0qj67_314274_c1 | |||
| 2314 | nmdc:mga0qj67_364041_c1 | |||
| 2315 | nmdc:mga0qj67_63179_c1 | |||
| 2316 | nmdc:mga0qj67_84461_c1 | |||
| 2317 | nmdc:mga06r32_1178847_c1 | |||
| 2318 | nmdc:mga06r32_1915866_c1 | |||
| 2319 | nmdc:mga06r32_569924_c1 | |||
| 2320 | nmdc:mga06r32_76360_c1 | |||
| 2321 | nmdc:mga06r32_874440_c1 | |||
| 2322 | nmdc:mga06r32_917785_c1 | |||
| 2323 | nmdc:mga08y16_1095929_c1 | |||
| 2324 | nmdc:mga08y16_480461_c1 | |||
| 2325 | nmdc:mga08y16_679007_c1 | |||
| 2326 | nmdc:mga08y16_97469_c1 | |||
| 2327 | nmdc:mga0n895_1035854_c1 | |||
| 2328 | nmdc:mga0n895_1270236_c1 | |||
| 2329 | nmdc:mga0n895_31442_c1 | |||
| 2330 | nmdc:mga0n895_847914_c1 | |||
| 2331 | nmdc:mga0rr50_1325040_c1 | |||
| 2332 | nmdc:mga0rr50_207113_c1 | |||
| 2333 | nmdc:mga0rr50_471688_c1 | |||
| 2334 | nmdc:mga0rr50_739555_c1 | |||
| 2335 | nmdc:mga08x19_61691_c1 | |||
| 2336 | nmdc:mga0a205_1149740_c1 | |||
| 2337 | nmdc:mga0a205_460525_c1 | |||
| 2338 | nmdc:mga0a205_529903_c1 | |||
| 2339 | nmdc:mga0a205_77713_c1 | |||
| 2340 | nmdc:mga0sz30_277463_c1 | |||
| 2341 | nmdc:mga0sz30_66935_c1 | |||
| 2342 | Ga0495601_0000349 | |||
| 2343 | Ga0495601_0317030 | |||
| 2344 | Ga0495601_0392072 | |||
| 2345 | Ga0495601_0599436 | |||
| 2346 | Ga0495612_0001007 | |||
| 2347 | Ga0495595_0047423 | |||
| 2348 | Ga0495619_0111388 | |||
| 2349 | Ga0495619_0126078 | |||
| 2350 | Ga0495619_0201948 | |||
| 2351 | Ga0495619_0339932 | |||
| 2352 | Ga0500646_0037115 | |||
| 2353 | Ga0500647_0108819 | |||
| 2354 | Ga0500651_0336534 | |||
| 2355 | Ga0500566_0347863 | |||
| 2356 | Ga0500641_0170517 | |||
| 2357 | Ga0500650_0084755 | |||
| 2358 | Ga0500555_086857 | |||
| 2359 | Ga0500595_124263 | |||
| 2360 | Ga0500614_075867 | |||
| 2361 | Ga0500642_0075535 | |||
| 2362 | Ga0500658_0025615 | |||
| 2363 | Ga0500568_0009712 | |||
| 2364 | Ga0500577_0113072 | |||
| 2365 | Ga0500577_0283066 | |||
| 2366 | Ga0500588_0058560 | |||
| 2367 | Ga0500616_0002142 | |||
| 2368 | Ga0500616_0031547 | |||
| 2369 | Ga0500620_052693 | |||
| 2370 | Ga0500627_0245925 | |||
| 2371 | Ga0500645_178523 | |||
| 2372 | Ga0500552_000105 | |||
| 2373 | Ga0501084_1274938 | |||
| 2374 | Ga0587079_139807 | |||
| 2375 | Ga0587111_0190887 | |||
| 2376 | Ga0501082_0154525 | |||
| 2377 | Ga0501082_0373451 | |||
| 2378 | Ga0501082_1542956 | |||
| 2379 | Ga0530510_0162784 | |||
| 2380 | Ga0530510_0335786 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c8l-assembly1.cif.gz_A | crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution | 0.778 | 1 | 112 |
| 3c8l-assembly1.cif.gz_A | crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution | 0.7658 | 1 | 112 |
| 6y1v-assembly1.cif.gz_B | mycobacterium tuberculosis ftsz-gtp-gamma-s in complex with 4-hydroxycoumarin | 0.5815 | 10 | 113 |
| 3wgj-assembly2.cif.gz_B | staphylococcus aureus ftsz t7 chimera mutant, t7bs | 0.5743 | 10 | 109 |
| 2q1x-assembly1.cif.gz_A | crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with citrate. | 0.5517 | 10 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c8lB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.7506 | 1 | 110 | 3.30.1330.20 |
| af_A0A0R0KCY4_1_112_3.30.1330.20 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.6649 | 1 | 108 | 3.30.1330.20 |
| af_A0A0R0KCY4_1_112_3.30.1330.20 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.6395 | 1 | 108 | 3.30.1330.20 |
| af_P0A9A6_224_341_3.30.1330.20 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.5759 | 9 | 112 | 3.30.1330.20 |
| af_K7V2R4_9_169_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.5715 | 87 | 112 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7K667-F1-model_v4 | Uncharacterized protein | 0.9334 | 48 | 112 |
GO:0005525
|
| AF-A0A7G2M091-F1-model_v4 | Uncharacterized protein | 0.9218 | 41 | 113 |
GO:0005525
|
| AF-A0A4Q5PHS3-F1-model_v4 | Uncharacterized protein | 0.9181 | 45 | 111 |
GO:0005525
|
| AF-A0A2D4UM75-F1-model_v4 | Uncharacterized protein | 0.9167 | 53 | 106 |
GO:0005525
|
| AF-A0A2D9YBU4-F1-model_v4 | Uncharacterized protein | 0.9165 | 31 | 112 |
GO:0005525
|