F491450

General Info

Members Datasets Scaffolds Average Seq Length
1190 456 2380 113

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0854457|Ga0495674_0854457_28_447
Length 139
Sequence MIAVRRQIWRLPATAAKLAATTEETRMALKRMVLEIGMGTDIRGAEPTKAAVRALRDALWHNSLSIAKALGQDTDAMRVEVTIGVPHPEKVDRQAVLDVLPHGTGTVTVVDGGLEIPNEDGTNSTLIASAAAVVWLDVA

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
284 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
285 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
286 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
287 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
288 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
289 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
290 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
291 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
294 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
295 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
296 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
297 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
300 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
301 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
302 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
303 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
331 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
336 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
337 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
338 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
339 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
340 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
341 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
351 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
354 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
379 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
412 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
413 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
414 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
418 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
419 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
420 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
421 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
422 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
423 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
424 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
425 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
426 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
427 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
428 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
434 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
435 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
436 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
437 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
438 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
439 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
440 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
441 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
442 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
443 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
444 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
445 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
446 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
449 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
450 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
451 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0
Rhizoplane 6.39
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0854457 3300047319 Bacteria 705
2 JGI24742J22300_10014305 3300002244 Bacteria 1333
3 JGI25407J50210_10133011 3300003373 Unclassified 612
4 JGI25405J52794_10004546 3300003911 Bacteria 2477
5 Ga0058863_11093206 3300004799 Unclassified 665
6 Ga0058860_11548922 3300004801 Bacteria 1314
7 Ga0065712_10023621 3300005290 Bacteria 1354
8 Ga0070683_100158931 3300005329 Bacteria 2144
9 Ga0070683_100939234 3300005329 Bacteria 830
10 Ga0070683_101699656 3300005329 Bacteria 607
11 Ga0070690_100061985 3300005330 Bacteria 2411
12 Ga0070690_100152708 3300005330 Bacteria 1577
13 Ga0070690_100495446 3300005330 Bacteria 913
14 Ga0070690_100518083 3300005330 Bacteria 895
15 Ga0070670_100363148 3300005331 Bacteria 1273
16 Ga0070670_100397336 3300005331 Bacteria 1217
17 Ga0070670_101739863 3300005331 Bacteria 574
18 Ga0070677_10018331 3300005333 Bacteria 2519
19 Ga0070677_10314602 3300005333 Bacteria 800
20 Ga0068869_101484217 3300005334 Unclassified 602
21 Ga0070666_10575430 3300005335 Bacteria 821
22 Ga0070680_100139963 3300005336 Bacteria 2029
23 Ga0070680_100340656 3300005336 Bacteria 1274
24 Ga0070682_100315300 3300005337 Bacteria 1153
25 Ga0070682_100963335 3300005337 Bacteria 705
26 Ga0070682_102086687 3300005337 Bacteria 500
27 Ga0068868_100071958 3300005338 Bacteria 2758
28 Ga0068868_101388657 3300005338 Bacteria 655
29 Ga0070660_100163158 3300005339 Bacteria 1796
30 Ga0070689_100008245 3300005340 Bacteria 7329
31 Ga0070689_100064441 3300005340 Bacteria 2852
32 Ga0070689_100135248 3300005340 Bacteria 1979
33 Ga0070689_100480643 3300005340 Bacteria 1061
34 Ga0070689_100796865 3300005340 Bacteria 831
35 Ga0070689_101356060 3300005340 Bacteria 642
36 Ga0070691_10006074 3300005341 Bacteria 5511
37 Ga0070691_10662237 3300005341 Bacteria 623
38 Ga0070687_100208121 3300005343 Bacteria 1190
39 Ga0070687_101269276 3300005343 Unclassified 546
40 Ga0070661_100091876 3300005344 Bacteria 2248
41 Ga0070668_100331153 3300005347 Bacteria 1284
42 Ga0070668_100970452 3300005347 Bacteria 762
43 Ga0070668_101572990 3300005347 Bacteria 602
44 Ga0070668_101908989 3300005347 Bacteria 547
45 Ga0070669_100196560 3300005353 Bacteria 1585
46 Ga0070669_100232123 3300005353 Bacteria 1463
47 Ga0070675_100082318 3300005354 Bacteria 2685
48 Ga0070675_100437783 3300005354 Bacteria 1171
49 Ga0070675_101350474 3300005354 Bacteria 657
50 Ga0070671_100021982 3300005355 Bacteria 5211
51 Ga0070671_100701205 3300005355 Bacteria 878
52 Ga0070671_100802416 3300005355 Bacteria 820
53 Ga0070674_100010635 3300005356 Bacteria 5573
54 Ga0070674_100112052 3300005356 Unclassified 2005
55 Ga0070674_100117366 3300005356 Bacteria 1965
56 Ga0070674_100289908 3300005356 Bacteria 1301
57 Ga0070674_100986250 3300005356 Bacteria 738
58 Ga0070673_100137809 3300005364 Bacteria 2056
59 Ga0070673_100376553 3300005364 Bacteria 1265
60 Ga0070688_100012110 3300005365 Bacteria 4820
61 Ga0070688_100151760 3300005365 Bacteria 1584
62 Ga0070688_100166754 3300005365 Bacteria 1517
63 Ga0070667_100192368 3300005367 Bacteria 1808
64 Ga0070667_100488528 3300005367 Bacteria 1128
65 Ga0070667_100492452 3300005367 Bacteria 1123
66 Ga0070667_101755320 3300005367 Bacteria 584
67 Ga0070667_101952114 3300005367 Bacteria 553
68 Ga0070709_10007571 3300005434 Bacteria 5959
69 Ga0070709_10124121 3300005434 Bacteria 1754
70 Ga0070714_100018088 3300005435 Bacteria 5717
71 Ga0070714_100168116 3300005435 Unclassified 1988
72 Ga0070714_100411091 3300005435 Bacteria 1281
73 Ga0070714_100653455 3300005435 Bacteria 1012
74 Ga0070714_101024995 3300005435 Bacteria 803
75 Ga0070714_101579019 3300005435 Bacteria 641
76 Ga0070713_100006041 3300005436 Bacteria 8342
77 Ga0070713_100078171 3300005436 Bacteria 2816
78 Ga0070713_100154139 3300005436 Bacteria 2046
79 Ga0070713_100364983 3300005436 Bacteria 1342
80 Ga0070713_100964321 3300005436 Bacteria 822
81 Ga0070713_100969616 3300005436 Unclassified 819
82 Ga0070710_10012582 3300005437 Bacteria 4207
83 Ga0070710_10254974 3300005437 Bacteria 1129
84 Ga0070710_10972555 3300005437 Unclassified 617
85 Ga0070701_10415234 3300005438 Bacteria 856
86 Ga0070701_10853306 3300005438 Bacteria 625
87 Ga0070711_100073767 3300005439 Bacteria 2412
88 Ga0070711_100206778 3300005439 Bacteria 1518
89 Ga0070711_100224018 3300005439 Bacteria 1463
90 Ga0070711_101634774 3300005439 Bacteria 564
91 Ga0070711_102049001 3300005439 Bacteria 504
92 Ga0070705_101744876 3300005440 Bacteria 527
93 Ga0070700_100748916 3300005441 Bacteria 782
94 Ga0070700_101753626 3300005441 Bacteria 534
95 Ga0070694_100619898 3300005444 Bacteria 873
96 Ga0070663_100452942 3300005455 Bacteria 1058
97 Ga0070678_100013179 3300005456 Bacteria 5173
98 Ga0070678_100221473 3300005456 Bacteria 1573
99 Ga0070678_101695546 3300005456 Bacteria 595
100 Ga0070662_100398856 3300005457 Bacteria 1135
101 Ga0070662_100406832 3300005457 Bacteria 1124
102 Ga0070662_100448392 3300005457 Archaea 1071
103 Ga0070662_101908064 3300005457 Unclassified 513
104 Ga0070681_10001152 3300005458 Bacteria 22827
105 Ga0070681_10050252 3300005458 Bacteria 4161
106 Ga0070681_10053270 3300005458 Bacteria 4032
107 Ga0070681_10175294 3300005458 Bacteria 2066
108 Ga0070681_10747078 3300005458 Bacteria 895
109 Ga0070681_11669001 3300005458 Bacteria 563
110 Ga0068867_100065628 3300005459 Bacteria 2701
111 Ga0068867_100094632 3300005459 Unclassified 2272
112 Ga0070685_10114736 3300005466 Bacteria 1665
113 Ga0070706_100023584 3300005467 Bacteria 5665
114 Ga0070706_100056966 3300005467 Unclassified 3606
115 Ga0070706_100466967 3300005467 Bacteria 1174
116 Ga0070706_101260131 3300005467 Bacteria 679
117 Ga0070707_100007453 3300005468 Bacteria 10158
118 Ga0070707_100140150 3300005468 Bacteria 2353
119 Ga0070707_100146332 3300005468 Unclassified 2300
120 Ga0070707_100902267 3300005468 Bacteria 848
121 Ga0070698_100006683 3300005471 Bacteria 12506
122 Ga0070698_100017475 3300005471 Bacteria 7559
123 Ga0070698_100452986 3300005471 Bacteria 1219
124 Ga0070698_100943854 3300005471 Unclassified 809
125 Ga0070699_100054647 3300005518 Bacteria 3456
126 Ga0070699_100276354 3300005518 Bacteria 1504
127 Ga0070699_100364658 3300005518 Bacteria 1303
128 Ga0070679_100159111 3300005530 Bacteria 2233
129 Ga0070679_100180933 3300005530 Bacteria 2080
130 Ga0070679_100207872 3300005530 Bacteria 1922
131 Ga0070679_100456462 3300005530 Bacteria 1222
132 Ga0070679_101700880 3300005530 Unclassified 579
133 Ga0070684_100011059 3300005535 Bacteria 7178
134 Ga0070697_100246407 3300005536 Bacteria 1527
135 Ga0070697_100996691 3300005536 Bacteria 745
136 Ga0068853_101109756 3300005539 Bacteria 763
137 Ga0068853_102009444 3300005539 Bacteria 561
138 Ga0070672_100033169 3300005543 Bacteria 3907
139 Ga0070686_100037537 3300005544 Bacteria 3006
140 Ga0070686_100313888 3300005544 Bacteria 1167
141 Ga0070686_100518435 3300005544 Unclassified 928
142 Ga0070686_100566207 3300005544 Bacteria 891
143 Ga0070686_100881849 3300005544 Bacteria 727
144 Ga0070696_100067310 3300005546 Bacteria 2513
145 Ga0070696_100851041 3300005546 Bacteria 754
146 Ga0070665_100160208 3300005548 Bacteria 2252
147 Ga0070665_101391392 3300005548 Bacteria 711
148 Ga0070704_102202895 3300005549 Unclassified 512
149 Ga0068855_100017426 3300005563 Bacteria 8640
150 Ga0068855_100588956 3300005563 Bacteria 1201
151 Ga0068855_100605833 3300005563 Bacteria 1181
152 Ga0068855_100724604 3300005563 Bacteria 1062
153 Ga0068855_100797900 3300005563 Bacteria 1004
154 Ga0070664_100038843 3300005564 Bacteria 4008
155 Ga0068857_100037617 3300005577 Bacteria 4288
156 Ga0068857_100338446 3300005577 Bacteria 1392
157 Ga0068856_100041817 3300005614 Bacteria 4506
158 Ga0068856_100065822 3300005614 Bacteria 3581
159 Ga0068856_100300969 3300005614 Bacteria 1621
160 Ga0068856_100442780 3300005614 Bacteria 1320
161 Ga0068856_100512557 3300005614 Bacteria 1220
162 Ga0070702_100194932 3300005615 Bacteria 1336
163 Ga0070702_100442140 3300005615 Bacteria 941
164 Ga0070702_100809645 3300005615 Bacteria 725
165 Ga0070702_101354084 3300005615 Bacteria 580
166 Ga0068852_100088311 3300005616 Bacteria 2768
167 Ga0068859_100096097 3300005617 Bacteria 3016
168 Ga0068859_100242826 3300005617 Bacteria 1890
169 Ga0068859_100788006 3300005617 Bacteria 1039
170 Ga0068859_100799588 3300005617 Bacteria 1031
171 Ga0068859_100948072 3300005617 Bacteria 944
172 Ga0068864_100007330 3300005618 Bacteria 9078
173 Ga0068864_100034477 3300005618 Bacteria 4306
174 Ga0068864_100348548 3300005618 Bacteria 1396
175 Ga0068864_100722957 3300005618 Bacteria 974
176 Ga0068866_10645951 3300005718 Bacteria 720
177 Ga0068861_100048984 3300005719 Bacteria 3197
178 Ga0068861_100570778 3300005719 Bacteria 1034
179 Ga0068861_100918525 3300005719 Bacteria 830
180 Ga0068861_101144080 3300005719 Unclassified 750
181 Ga0068861_101737301 3300005719 Bacteria 618
182 Ga0068870_10547109 3300005840 Bacteria 779
183 Ga0068870_11257347 3300005840 Bacteria 538
184 Ga0068863_100794686 3300005841 Bacteria 944
185 Ga0068863_101679409 3300005841 Bacteria 645
186 Ga0068863_101730723 3300005841 Bacteria 635
187 Ga0068858_100169996 3300005842 Bacteria 2055
188 Ga0068858_100866311 3300005842 Bacteria 882
189 Ga0068858_102343213 3300005842 Bacteria 528
190 Ga0068858_102411374 3300005842 Bacteria 520
191 Ga0068860_100113245 3300005843 Unclassified 2594
192 Ga0068860_100127998 3300005843 Bacteria 2435
193 Ga0068860_100656527 3300005843 Bacteria 1057
194 Ga0068860_100765755 3300005843 Bacteria 978
195 Ga0068860_101328784 3300005843 Bacteria 740
196 Ga0068860_101681736 3300005843 Bacteria 657
197 Ga0068862_100263019 3300005844 Bacteria 1575
198 Ga0068862_100365558 3300005844 Bacteria 1342
199 Ga0068862_101025373 3300005844 Unclassified 817
200 Ga0068862_101166789 3300005844 Bacteria 767
201 Ga0081455_10001285 3300005937 Bacteria 31211
202 Ga0081455_10004152 3300005937 Bacteria 16350
203 Ga0081455_10008714 3300005937 Bacteria 10505
204 Ga0081455_10019848 3300005937 Bacteria 6347
205 Ga0081455_10119563 3300005937 Bacteria 2077
206 Ga0081455_10218615 3300005937 Bacteria 1414
207 Ga0081455_10278708 3300005937 Bacteria 1209
208 Ga0081538_10002503 3300005981 Bacteria 17887
209 Ga0081538_10046120 3300005981 Unclassified 2693
210 Ga0081538_10183794 3300005981 Unclassified 890
211 Ga0081538_10212529 3300005981 Bacteria 778
212 Ga0081540_1014265 3300005983 Bacteria 5102
213 Ga0081540_1016449 3300005983 Bacteria 4627
214 Ga0081540_1038882 3300005983 Unclassified 2501
215 Ga0081540_1148069 3300005983 Bacteria 931
216 Ga0081539_10014566 3300005985 Bacteria 5803
217 Ga0081539_10058101 3300005985 Bacteria 2137
218 Ga0081539_10074035 3300005985 Bacteria 1815
219 Ga0070717_10009576 3300006028 Bacteria 7287
220 Ga0070717_10087937 3300006028 Bacteria 2618
221 Ga0070717_10125013 3300006028 Unclassified 2207
222 Ga0070717_10296143 3300006028 Bacteria 1437
223 Ga0070717_10412267 3300006028 Bacteria 1214
224 Ga0070717_11476863 3300006028 Unclassified 617
225 Ga0070717_11712133 3300006028 Bacteria 569
226 Ga0075365_10332686 3300006038 Bacteria 1070
227 Ga0075363_100019332 3300006048 Bacteria 3405
228 Ga0075363_100022989 3300006048 Bacteria 3155
229 Ga0075363_100166982 3300006048 Bacteria 1248
230 Ga0075363_100527483 3300006048 Bacteria 703
231 Ga0075364_10131778 3300006051 Bacteria 1678
232 Ga0075432_10039613 3300006058 Bacteria 1644
233 Ga0075432_10388938 3300006058 Unclassified 600
234 Ga0075432_10575100 3300006058 Unclassified 512
235 Ga0070715_10538716 3300006163 Unclassified 675
236 Ga0070716_100503650 3300006173 Bacteria 894
237 Ga0070712_100010216 3300006175 Bacteria 5919
238 Ga0070712_100021390 3300006175 Bacteria 4249
239 Ga0070712_100067347 3300006175 Bacteria 2547
240 Ga0070712_100119875 3300006175 Bacteria 1978
241 Ga0070712_100470190 3300006175 Unclassified 1050
242 Ga0070712_100495111 3300006175 Unclassified 1024
243 Ga0070712_100676336 3300006175 Bacteria 878
244 Ga0070712_100996561 3300006175 Bacteria 725
245 Ga0075362_10072161 3300006177 Bacteria 1579
246 Ga0075362_10074633 3300006177 Bacteria 1554
247 Ga0075362_10743328 3300006177 Bacteria 513
248 Ga0075367_10023684 3300006178 Bacteria 3457
249 Ga0075367_10173410 3300006178 Bacteria 1344
250 Ga0075367_10250046 3300006178 Bacteria 1112
251 Ga0075367_10294798 3300006178 Bacteria 1021
252 Ga0075367_10350921 3300006178 Unclassified 931
253 Ga0075369_10123622 3300006186 Bacteria 1172
254 Ga0075369_10275118 3300006186 Bacteria 784
255 Ga0075427_10008235 3300006194 Unclassified 1543
256 Ga0075366_10353431 3300006195 Unclassified 902
257 Ga0097621_100939877 3300006237 Bacteria 807
258 Ga0075370_10249521 3300006353 Bacteria 1052
259 Ga0068871_100205742 3300006358 Bacteria 1701
260 Ga0068871_100514203 3300006358 Unclassified 1081
261 Ga0068871_102303062 3300006358 Bacteria 514
262 Ga0075428_100004619 3300006844 Bacteria 15233
263 Ga0075428_100009365 3300006844 Bacteria 10864
264 Ga0075428_100030936 3300006844 Bacteria 5919
265 Ga0075428_100115423 3300006844 Bacteria 2925
266 Ga0075428_100311398 3300006844 Unclassified 1692
267 Ga0075428_100693178 3300006844 Unclassified 1085
268 Ga0075428_100697433 3300006844 Bacteria 1082
269 Ga0075430_100007440 3300006846 Bacteria 9244
270 Ga0075430_100046813 3300006846 Bacteria 3652
271 Ga0075430_100071358 3300006846 Unclassified 2913
272 Ga0075430_100116692 3300006846 Bacteria 2225
273 Ga0075430_100679175 3300006846 Unclassified 849
274 Ga0075430_101251585 3300006846 Unclassified 611
275 Ga0075430_101602258 3300006846 Bacteria 535
276 Ga0075431_100004380 3300006847 Bacteria 13852
277 Ga0075431_100086642 3300006847 Unclassified 3232
278 Ga0075431_100105157 3300006847 Bacteria 2913
279 Ga0075431_100267726 3300006847 Unclassified 1733
280 Ga0075431_100838345 3300006847 Unclassified 891
281 Ga0075431_101453645 3300006847 Unclassified 644
282 Ga0075433_10079299 3300006852 Bacteria 2893
283 Ga0075433_10244853 3300006852 Bacteria 1592
284 Ga0075433_10851719 3300006852 Bacteria 796
285 Ga0075434_100043527 3300006871 Bacteria 4453
286 Ga0075434_100843931 3300006871 Unclassified 932
287 Ga0075429_100016046 3300006880 Bacteria 6488
288 Ga0075429_100061691 3300006880 Bacteria 3267
289 Ga0075429_100110914 3300006880 Unclassified 2398
290 Ga0075429_100349170 3300006880 Bacteria 1295
291 Ga0075429_101155172 3300006880 Unclassified 676
292 Ga0075429_102001837 3300006880 Bacteria 501
293 Ga0068865_100577511 3300006881 Bacteria 947
294 Ga0068865_100599593 3300006881 Bacteria 931
295 Ga0097620_100096099 3300006931 Bacteria 3016
296 Ga0097620_100242823 3300006931 Bacteria 1890
297 Ga0097620_100787964 3300006931 Bacteria 1039
298 Ga0097620_100799612 3300006931 Bacteria 1031
299 Ga0097620_100811535 3300006931 Bacteria 1023
300 Ga0097620_100947842 3300006931 Bacteria 944
301 Ga0075435_100502802 3300007076 Bacteria 1048
302 Ga0075435_100627976 3300007076 Bacteria 932
303 Ga0075435_100858525 3300007076 Bacteria 791
304 Ga0075435_101432830 3300007076 Bacteria 605
305 Ga0075435_101506190 3300007076 Bacteria 590
306 Ga0099794_10276412 3300007265 Bacteria 868
307 Ga0099795_10000237 3300007788 Bacteria 9757
308 Ga0099795_10222530 3300007788 Bacteria 804
309 Ga0099795_10423471 3300007788 Unclassified 609
310 Ga0105244_10512402 3300009036 Unclassified 552
311 Ga0105250_10578213 3300009092 Bacteria 518
312 Ga0105240_10003467 3300009093 Bacteria 24468
313 Ga0105240_11469625 3300009093 Bacteria 715
314 Ga0111539_10025624 3300009094 Bacteria 7227
315 Ga0111539_10046741 3300009094 Bacteria 5176
316 Ga0111539_10508411 3300009094 Bacteria 1403
317 Ga0111539_10946076 3300009094 Bacteria 1002
318 Ga0111539_12191432 3300009094 Bacteria 641
319 Ga0105245_10404063 3300009098 Bacteria 1366
320 Ga0105245_10480631 3300009098 Bacteria 1255
321 Ga0105245_10575379 3300009098 Bacteria 1150
322 Ga0105245_10644779 3300009098 Bacteria 1089
323 Ga0105245_12035332 3300009098 Bacteria 628
324 Ga0105245_12140468 3300009098 Bacteria 613
325 Ga0105247_10141812 3300009101 Bacteria 1575
326 Ga0105247_10206481 3300009101 Bacteria 1323
327 Ga0105247_10216862 3300009101 Bacteria 1293
328 Ga0105247_10291189 3300009101 Bacteria 1129
329 Ga0105247_10779696 3300009101 Bacteria 727
330 Ga0114129_10052483 3300009147 Bacteria 5722
331 Ga0114129_10519023 3300009147 Bacteria 1553
332 Ga0114129_10722934 3300009147 Bacteria 1277
333 Ga0114129_10789325 3300009147 Bacteria 1212
334 Ga0114129_10794148 3300009147 Bacteria 1208
335 Ga0105243_10532913 3300009148 Bacteria 1119
336 Ga0105243_11042280 3300009148 Bacteria 823
337 Ga0105243_11510507 3300009148 Bacteria 696
338 Ga0105243_11593944 3300009148 Unclassified 679
339 Ga0105241_11708505 3300009174 Bacteria 612
340 Ga0105242_10532453 3300009176 Bacteria 1123
341 Ga0105242_10720827 3300009176 Bacteria 978
342 Ga0105242_10768729 3300009176 Bacteria 950
343 Ga0105248_10126790 3300009177 Bacteria 2879
344 Ga0105248_10273984 3300009177 Bacteria 1900
345 Ga0105248_10319558 3300009177 Bacteria 1748
346 Ga0105248_10567922 3300009177 Bacteria 1280
347 Ga0105248_10644158 3300009177 Bacteria 1196
348 Ga0105248_11008614 3300009177 Bacteria 940
349 Ga0105248_12238285 3300009177 Bacteria 622
350 Ga0105248_12466221 3300009177 Bacteria 593
351 Ga0105237_10314451 3300009545 Bacteria 1569
352 Ga0105237_10964138 3300009545 Bacteria 860
353 Ga0105238_10122740 3300009551 Bacteria 2577
354 Ga0105238_10763625 3300009551 Bacteria 981
355 Ga0105238_11180702 3300009551 Bacteria 789
356 Ga0105249_10240746 3300009553 Bacteria 1789
357 Ga0105249_10890360 3300009553 Bacteria 957
358 Ga0105249_11718657 3300009553 Bacteria 700
359 Ga0105249_11808700 3300009553 Bacteria 683
360 Ga0105035_102989 3300009988 Bacteria 1278
361 Ga0099796_10004441 3300010159 Bacteria 3394
362 Ga0099796_10085129 3300010159 Bacteria 1166
363 Ga0099796_10168623 3300010159 Unclassified 872
364 Ga0105239_10182724 3300010375 Bacteria 2346
365 Ga0105239_11414181 3300010375 Bacteria 803
366 Ga0105239_12813857 3300010375 Bacteria 568
367 Ga0105246_10007415 3300011119 Bacteria 6723
368 Ga0105246_11094296 3300011119 Bacteria 727
369 Ga0157373_10203756 3300013100 Bacteria 1395
370 Ga0157371_10128371 3300013102 Bacteria 1803
371 Ga0157371_10529333 3300013102 Bacteria 872
372 Ga0157369_10121041 3300013105 Bacteria 2777
373 Ga0157369_11558158 3300013105 Bacteria 672
374 Ga0157374_10240273 3300013296 Bacteria 1781
375 Ga0157374_11823319 3300013296 Bacteria 634
376 Ga0157374_11996801 3300013296 Bacteria 606
377 Ga0157374_12096208 3300013296 Bacteria 592
378 Ga0157374_12543035 3300013296 Bacteria 539
379 Ga0157378_10429898 3300013297 Bacteria 1307
380 Ga0157378_10533562 3300013297 Bacteria 1177
381 Ga0157378_12206831 3300013297 Bacteria 602
382 Ga0157378_12264081 3300013297 Bacteria 595
383 Ga0157378_12413445 3300013297 Bacteria 578
384 Ga0163162_10755250 3300013306 Bacteria 1092
385 Ga0163162_11508254 3300013306 Bacteria 766
386 Ga0163162_11936868 3300013306 Bacteria 675
387 Ga0163162_12948786 3300013306 Unclassified 547
388 Ga0157372_10128361 3300013307 Bacteria 2916
389 Ga0157375_10141049 3300013308 Unclassified 2537
390 Ga0157375_10143093 3300013308 Bacteria 2520
391 Ga0157375_10321265 3300013308 Unclassified 1713
392 Ga0157375_10605121 3300013308 Bacteria 1255
393 Ga0163163_10039996 3300014325 Bacteria 4578
394 Ga0163163_10040918 3300014325 Bacteria 4529
395 Ga0163163_10141456 3300014325 Bacteria 2449
396 Ga0163163_10494785 3300014325 Bacteria 1284
397 Ga0163163_10677964 3300014325 Bacteria 1094
398 Ga0163163_11186309 3300014325 Bacteria 826
399 Ga0163163_11748428 3300014325 Bacteria 682
400 Ga0157380_10174558 3300014326 Unclassified 1881
401 Ga0157380_10210907 3300014326 Bacteria 1731
402 Ga0157380_10892163 3300014326 Bacteria 914
403 Ga0157380_11275194 3300014326 Unclassified 781
404 Ga0157380_13230620 3300014326 Unclassified 521
405 Ga0182008_10037470 3300014497 Bacteria 2426
406 Ga0157377_10971819 3300014745 Bacteria 641
407 Ga0157377_10986003 3300014745 Unclassified 637
408 Ga0157379_10043895 3300014968 Bacteria 3992
409 Ga0157379_10080970 3300014968 Bacteria 2909
410 Ga0157379_10182222 3300014968 Bacteria 1897
411 Ga0157379_10511215 3300014968 Bacteria 1114
412 Ga0157379_11519288 3300014968 Bacteria 652
413 Ga0157379_12175113 3300014968 Bacteria 551
414 Ga0157376_10285904 3300014969 Bacteria 1555
415 Ga0157376_10362786 3300014969 Bacteria 1390
416 Ga0157376_10656299 3300014969 Bacteria 1050
417 Ga0157376_10894626 3300014969 Bacteria 906
418 Ga0182007_10069741 3300015262 Bacteria 1152
419 Ga0163161_10162370 3300017792 Bacteria 1704
420 Ga0163161_10451607 3300017792 Bacteria 1039
421 Ga0163161_10776870 3300017792 Bacteria 803
422 Ga0163161_10804494 3300017792 Unclassified 790
423 Ga0206354_10341732 3300020081 Bacteria 938
424 Ga0206353_11599512 3300020082 Bacteria 886
425 Ga0213872_10440986 3300021361 Bacteria 524
426 Ga0213874_10238262 3300021377 Bacteria 667
427 Ga0213876_10041220 3300021384 Bacteria 2440
428 Ga0213875_10007211 3300021388 Bacteria 5765
429 Ga0213875_10129936 3300021388 Bacteria 1178
430 Ga0213871_10023826 3300021441 Bacteria 1544
431 Ga0224712_10282220 3300022467 Bacteria 773
432 Ga0228598_1039612 3300024227 Bacteria 930
433 Ga0207426_1071031 3300025302 Bacteria 971
434 Ga0207682_10002121 3300025893 Bacteria 8985
435 Ga0207682_10362151 3300025893 Bacteria 684
436 Ga0207692_10019780 3300025898 Bacteria 3049
437 Ga0207692_10032657 3300025898 Bacteria 2503
438 Ga0207692_10074755 3300025898 Bacteria 1796
439 Ga0207692_10142181 3300025898 Bacteria 1366
440 Ga0207692_10669558 3300025898 Bacteria 672
441 Ga0207692_10787014 3300025898 Unclassified 621
442 Ga0207692_10956745 3300025898 Unclassified 564
443 Ga0207692_11210198 3300025898 Bacteria 502
444 Ga0207642_10062410 3300025899 Bacteria 1738
445 Ga0207642_10400806 3300025899 Bacteria 821
446 Ga0207710_10088984 3300025900 Bacteria 1442
447 Ga0207688_10002666 3300025901 Bacteria 9666
448 Ga0207688_10076000 3300025901 Unclassified 1912
449 Ga0207688_10119204 3300025901 Bacteria 1538
450 Ga0207688_10141901 3300025901 Bacteria 1414
451 Ga0207680_10379792 3300025903 Bacteria 996
452 Ga0207680_10573296 3300025903 Bacteria 806
453 Ga0207680_11069310 3300025903 Bacteria 577
454 Ga0207647_10143742 3300025904 Bacteria 1397
455 Ga0207699_10018475 3300025906 Bacteria 3695
456 Ga0207699_10174489 3300025906 Bacteria 1441
457 Ga0207699_10426556 3300025906 Bacteria 948
458 Ga0207699_10885331 3300025906 Bacteria 658
459 Ga0207645_10105493 3300025907 Bacteria 1821
460 Ga0207643_10001626 3300025908 Bacteria 12666
461 Ga0207643_10080461 3300025908 Bacteria 1887
462 Ga0207643_10294986 3300025908 Bacteria 1008
463 Ga0207705_10094832 3300025909 Bacteria 2189
464 Ga0207684_10069874 3300025910 Unclassified 2984
465 Ga0207684_10074148 3300025910 Bacteria 2891
466 Ga0207684_10232221 3300025910 Bacteria 1592
467 Ga0207684_10478400 3300025910 Bacteria 1068
468 Ga0207654_10227211 3300025911 Bacteria 1241
469 Ga0207654_10466281 3300025911 Bacteria 888
470 Ga0207654_10852797 3300025911 Bacteria 659
471 Ga0207707_10041293 3300025912 Bacteria 4029
472 Ga0207707_10101471 3300025912 Unclassified 2515
473 Ga0207707_10148664 3300025912 Bacteria 2048
474 Ga0207707_10239271 3300025912 Bacteria 1578
475 Ga0207707_11369431 3300025912 Bacteria 566
476 Ga0207695_10054005 3300025913 Bacteria 4199
477 Ga0207695_10546229 3300025913 Bacteria 1040
478 Ga0207671_10080602 3300025914 Bacteria 2440
479 Ga0207693_10002165 3300025915 Bacteria 17116
480 Ga0207693_10017026 3300025915 Bacteria 5803
481 Ga0207693_10019034 3300025915 Bacteria 5465
482 Ga0207693_10020506 3300025915 Bacteria 5257
483 Ga0207693_10059066 3300025915 Bacteria 3004
484 Ga0207693_10118265 3300025915 Bacteria 2081
485 Ga0207693_10181876 3300025915 Bacteria 1654
486 Ga0207693_10213555 3300025915 Bacteria 1516
487 Ga0207693_10667639 3300025915 Bacteria 807
488 Ga0207693_11334537 3300025915 Bacteria 535
489 Ga0207663_10240670 3300025916 Unclassified 1327
490 Ga0207663_10433683 3300025916 Bacteria 1011
491 Ga0207663_11493280 3300025916 Bacteria 544
492 Ga0207660_10010887 3300025917 Bacteria 5913
493 Ga0207660_10572969 3300025917 Bacteria 919
494 Ga0207660_10826523 3300025917 Bacteria 756
495 Ga0207662_10018906 3300025918 Bacteria 3913
496 Ga0207657_10091291 3300025919 Bacteria 2540
497 Ga0207649_10103950 3300025920 Bacteria 1885
498 Ga0207652_10339566 3300025921 Bacteria 1356
499 Ga0207652_11011763 3300025921 Bacteria 730
500 Ga0207646_10092084 3300025922 Bacteria 2713
501 Ga0207646_10125031 3300025922 Unclassified 2312
502 Ga0207646_10176670 3300025922 Bacteria 1929
503 Ga0207646_10546134 3300025922 Bacteria 1042
504 Ga0207646_10784922 3300025922 Bacteria 849
505 Ga0207646_11347838 3300025922 Bacteria 622
506 Ga0207681_10139159 3300025923 Bacteria 1806
507 Ga0207681_10675818 3300025923 Bacteria 857
508 Ga0207681_10811169 3300025923 Bacteria 782
509 Ga0207681_11194820 3300025923 Bacteria 639
510 Ga0207681_11503921 3300025923 Bacteria 564
511 Ga0207694_10213191 3300025924 Bacteria 1573
512 Ga0207650_10700860 3300025925 Unclassified 855
513 Ga0207650_10818887 3300025925 Bacteria 789
514 Ga0207659_10114491 3300025926 Bacteria 2056
515 Ga0207659_10304725 3300025926 Bacteria 1310
516 Ga0207659_10760968 3300025926 Bacteria 831
517 Ga0207687_10251508 3300025927 Bacteria 1405
518 Ga0207700_10062858 3300025928 Bacteria 2821
519 Ga0207700_10067540 3300025928 Bacteria 2737
520 Ga0207700_10200541 3300025928 Bacteria 1681
521 Ga0207700_10406805 3300025928 Unclassified 1193
522 Ga0207700_10658349 3300025928 Bacteria 934
523 Ga0207700_10916603 3300025928 Bacteria 784
524 Ga0207664_10045279 3300025929 Bacteria 3450
525 Ga0207664_10098990 3300025929 Bacteria 2405
526 Ga0207664_10141638 3300025929 Bacteria 2035
527 Ga0207664_10640116 3300025929 Bacteria 955
528 Ga0207664_11418911 3300025929 Bacteria 615
529 Ga0207644_10022359 3300025931 Bacteria 4320
530 Ga0207644_10164837 3300025931 Unclassified 1726
531 Ga0207644_10756443 3300025931 Bacteria 812
532 Ga0207644_11659092 3300025931 Bacteria 536
533 Ga0207690_10049381 3300025932 Bacteria 2804
534 Ga0207690_10335871 3300025932 Bacteria 1191
535 Ga0207690_11832280 3300025932 Bacteria 506
536 Ga0207706_10339881 3300025933 Bacteria 1306
537 Ga0207706_10348142 3300025933 Bacteria 1288
538 Ga0207686_10220929 3300025934 Bacteria 1368
539 Ga0207709_11475976 3300025935 Bacteria 564
540 Ga0207670_10008201 3300025936 Bacteria 5881
541 Ga0207670_10091586 3300025936 Bacteria 2150
542 Ga0207670_10672719 3300025936 Bacteria 855
543 Ga0207670_11499685 3300025936 Bacteria 573
544 Ga0207669_10160054 3300025937 Unclassified 1589
545 Ga0207669_10224009 3300025937 Bacteria 1382
546 Ga0207669_11099660 3300025937 Bacteria 671
547 Ga0207704_10150491 3300025938 Bacteria 1641
548 Ga0207704_10425345 3300025938 Bacteria 1054
549 Ga0207665_10109139 3300025939 Unclassified 1942
550 Ga0207665_10664763 3300025939 Unclassified 817
551 Ga0207691_10004008 3300025940 Bacteria 14283
552 Ga0207691_10036729 3300025940 Bacteria 4539
553 Ga0207691_10217212 3300025940 Bacteria 1659
554 Ga0207691_10236149 3300025940 Bacteria 1582
555 Ga0207711_10003717 3300025941 Bacteria 13152
556 Ga0207711_10155377 3300025941 Bacteria 2067
557 Ga0207711_10440290 3300025941 Bacteria 1213
558 Ga0207711_10860221 3300025941 Bacteria 844
559 Ga0207711_11210955 3300025941 Bacteria 697
560 Ga0207711_11296590 3300025941 Bacteria 670
561 Ga0207711_11583785 3300025941 Bacteria 598
562 Ga0207711_11671325 3300025941 Bacteria 580
563 Ga0207689_10547649 3300025942 Bacteria 972
564 Ga0207689_10551476 3300025942 Bacteria 968
565 Ga0207689_11055628 3300025942 Bacteria 685
566 Ga0207661_10180940 3300025944 Bacteria 1841
567 Ga0207661_10850935 3300025944 Bacteria 840
568 Ga0207661_10941590 3300025944 Bacteria 796
569 Ga0207661_11046541 3300025944 Bacteria 752
570 Ga0207679_10223235 3300025945 Bacteria 1586
571 Ga0207679_10491315 3300025945 Bacteria 1094
572 Ga0207679_11816494 3300025945 Unclassified 557
573 Ga0207667_10044823 3300025949 Bacteria 4686
574 Ga0207667_10112413 3300025949 Bacteria 2809
575 Ga0207667_10800475 3300025949 Bacteria 939
576 Ga0207667_11307340 3300025949 Bacteria 701
577 Ga0207651_10352725 3300025960 Bacteria 1239
578 Ga0207651_10812275 3300025960 Bacteria 829
579 Ga0207712_10747299 3300025961 Bacteria 857
580 Ga0207712_10979989 3300025961 Bacteria 750
581 Ga0207712_11859925 3300025961 Unclassified 539
582 Ga0207668_10139663 3300025972 Bacteria 1861
583 Ga0207668_10188695 3300025972 Bacteria 1632
584 Ga0207668_11325258 3300025972 Bacteria 648
585 Ga0207668_11673845 3300025972 Bacteria 574
586 Ga0207658_10702240 3300025986 Bacteria 914
587 Ga0207658_10921922 3300025986 Bacteria 796
588 Ga0207677_10287169 3300026023 Bacteria 1353
589 Ga0207677_12111355 3300026023 Bacteria 524
590 Ga0207703_10243704 3300026035 Bacteria 1617
591 Ga0207703_11863243 3300026035 Bacteria 578
592 Ga0207639_10367097 3300026041 Bacteria 1290
593 Ga0207639_10420398 3300026041 Bacteria 1208
594 Ga0207678_10176275 3300026067 Bacteria 1825
595 Ga0207678_10241455 3300026067 Unclassified 1547
596 Ga0207678_11160044 3300026067 Bacteria 684
597 Ga0207708_10212232 3300026075 Bacteria 1548
598 Ga0207708_10423909 3300026075 Bacteria 1104
599 Ga0207708_10896120 3300026075 Bacteria 767
600 Ga0207702_10125306 3300026078 Bacteria 2305
601 Ga0207702_10141254 3300026078 Bacteria 2179
602 Ga0207702_10270420 3300026078 Bacteria 1603
603 Ga0207702_10352266 3300026078 Bacteria 1409
604 Ga0207702_11219866 3300026078 Bacteria 746
605 Ga0207702_11655165 3300026078 Bacteria 633
606 Ga0207702_12452370 3300026078 Bacteria 508
607 Ga0207641_10360506 3300026088 Bacteria 1388
608 Ga0207641_10776846 3300026088 Bacteria 947
609 Ga0207641_11263007 3300026088 Bacteria 739
610 Ga0207648_10051810 3300026089 Unclassified 3587
611 Ga0207648_10089803 3300026089 Bacteria 2685
612 Ga0207648_10955748 3300026089 Bacteria 802
613 Ga0207676_10035299 3300026095 Bacteria 3794
614 Ga0207676_10243527 3300026095 Bacteria 1615
615 Ga0207676_10407903 3300026095 Bacteria 1271
616 Ga0207676_12088330 3300026095 Bacteria 565
617 Ga0207674_10046322 3300026116 Bacteria 4465
618 Ga0207674_10068392 3300026116 Bacteria 3574
619 Ga0207675_100004996 3300026118 Bacteria 12776
620 Ga0207675_100053730 3300026118 Bacteria 3758
621 Ga0207675_100065085 3300026118 Bacteria 3407
622 Ga0207675_100191830 3300026118 Bacteria 1960
623 Ga0207675_100357476 3300026118 Bacteria 1432
624 Ga0207675_100624734 3300026118 Bacteria 1082
625 Ga0207675_101508907 3300026118 Bacteria 693
626 Ga0207675_101773736 3300026118 Unclassified 637
627 Ga0207683_10011410 3300026121 Bacteria 7582
628 Ga0207683_10058366 3300026121 Bacteria 3388
629 Ga0207683_10074150 3300026121 Bacteria 3011
630 Ga0207683_10097598 3300026121 Bacteria 2621
631 Ga0207683_11938959 3300026121 Bacteria 538
632 Ga0207698_10233817 3300026142 Bacteria 1670
633 Ga0207698_10903400 3300026142 Bacteria 890
634 Ga0209179_1043654 3300027512 Bacteria 948
635 Ga0209179_1142515 3300027512 Bacteria 535
636 Ga0209813_10088531 3300027866 Bacteria 1035
637 Ga0207428_10034685 3300027907 Unclassified 4131
638 Ga0207428_10147229 3300027907 Bacteria 1794
639 Ga0207428_10226536 3300027907 Bacteria 1400
640 Ga0207428_10721362 3300027907 Unclassified 712
641 Ga0268266_10834296 3300028379 Bacteria 891
642 Ga0268265_10102216 3300028380 Bacteria 2318
643 Ga0268265_10169505 3300028380 Bacteria 1864
644 Ga0268265_10304816 3300028380 Bacteria 1436
645 Ga0268265_10980491 3300028380 Unclassified 834
646 Ga0268265_11096103 3300028380 Unclassified 790
647 Ga0268264_10148943 3300028381 Bacteria 2096
648 Ga0268264_10630079 3300028381 Bacteria 1059
649 Ga0268264_10846845 3300028381 Bacteria 916
650 Ga0265334_10025605 3300028573 Bacteria 2387
651 Ga0265770_1058502 3300030878 Bacteria 713
652 Ga0265760_10064822 3300031090 Bacteria 1114
653 Ga0265330_10274584 3300031235 Bacteria 710
654 Ga0265332_10110015 3300031238 Bacteria 1161
655 Ga0265325_10071089 3300031241 Bacteria 1747
656 Ga0265325_10530048 3300031241 Bacteria 510
657 Ga0265329_10245595 3300031242 Bacteria 596
658 Ga0265340_10157435 3300031247 Bacteria 1033
659 Ga0265339_10512018 3300031249 Bacteria 554
660 Ga0265339_10594919 3300031249 Bacteria 507
661 Ga0265327_10064161 3300031251 Bacteria 1863
662 Ga0265316_10245996 3300031344 Bacteria 1314
663 Ga0265316_10911571 3300031344 Bacteria 614
664 Ga0307513_10129091 3300031456 Bacteria 2477
665 Ga0265342_10304322 3300031712 Bacteria 839
666 Ga0316576_10004877 3300031727 Bacteria 8108
667 Ga0307405_10158387 3300031731 Bacteria 1601
668 Ga0307413_10558187 3300031824 Bacteria 930
669 Ga0307413_10590571 3300031824 Bacteria 907
670 Ga0307413_11439849 3300031824 Bacteria 607
671 Ga0307410_10313703 3300031852 Bacteria 1242
672 Ga0307410_10373883 3300031852 Bacteria 1145
673 Ga0307406_10426985 3300031901 Unclassified 1057
674 Ga0307406_10542464 3300031901 Bacteria 950
675 Ga0307412_11277053 3300031911 Bacteria 660
676 Ga0307409_101881601 3300031995 Unclassified 628
677 Ga0307416_100075944 3300032002 Bacteria 2814
678 Ga0307416_100115956 3300032002 Bacteria 2373
679 Ga0307416_100756627 3300032002 Bacteria 1065
680 Ga0307416_101627524 3300032002 Unclassified 751
681 Ga0307414_10023092 3300032004 Bacteria 3937
682 Ga0307411_11006256 3300032005 Bacteria 746
683 Ga0307415_101586246 3300032126 Bacteria 628
684 Ga0373930_0007127 3300034816 Bacteria 1914
685 Ga0373930_0072164 3300034816 Bacteria 786
686 Ga0373948_0085880 3300034817 Bacteria 724
687 Ga0373958_0023348 3300034819 Bacteria 1163
688 Ga0373938_0012328 3300034957 Unclassified 1602
689 Ga0373926_0457394 3300035083 Bacteria 507
690 Ga0373928_0069546 3300035084 Bacteria 867
691 Ga0373928_0079779 3300035084 Bacteria 823
692 Ga0373929_0144235 3300035085 Bacteria 634
693 Ga0373934_0063951 3300035086 Bacteria 1468
694 Ga0373934_0335811 3300035086 Bacteria 628
695 Ga0373944_0087370 3300035089 Unclassified 1038
696 Ga0373944_0195308 3300035089 Bacteria 731
697 Ga0373949_0256435 3300035090 Unclassified 542
698 Ga0373923_0052094 3300035111 Bacteria 1719
699 Ga0373923_0066352 3300035111 Bacteria 1542
700 Ga0373923_0193084 3300035111 Bacteria 939
701 Ga0373923_0474299 3300035111 Bacteria 608
702 Ga0373923_0474435 3300035111 Unclassified 608
703 Ga0373932_0098324 3300035112 Bacteria 949
704 Ga0373932_0223679 3300035112 Unclassified 677
705 Ga0373941_0032936 3300035115 Bacteria 1554
706 Ga0373941_0195598 3300035115 Bacteria 766
707 Ga0373945_0137638 3300035116 Bacteria 983
708 Ga0373945_0195374 3300035116 Bacteria 838
709 Ga0373945_0352050 3300035116 Bacteria 639
710 Ga0373953_0042164 3300035117 Bacteria 1818
711 Ga0373954_0062818 3300035118 Bacteria 1755
712 Ga0373957_0223669 3300035120 Bacteria 788
713 Ga0373960_0056480 3300035121 Bacteria 1179
714 Ga0373943_0111803 3300035170 Bacteria 1442
715 Ga0373943_0139392 3300035170 Bacteria 1305
716 Ga0373943_0415235 3300035170 Bacteria 778
717 Ga0373943_0473926 3300035170 Unclassified 729
718 Ga0373946_0024327 3300035171 Bacteria 2373
719 Ga0373946_0123555 3300035171 Bacteria 1184
720 Ga0373946_0131635 3300035171 Unclassified 1151
721 Ga0373946_0306223 3300035171 Bacteria 787
722 Ga0373955_0035900 3300035172 Bacteria 2628
723 Ga0373942_0344426 3300035207 Bacteria 525
724 Ga0316574_0000554 3300035398 Bacteria 15462
725 Ga0373924_0056580 3300035410 Bacteria 1634
726 Ga0373924_0171450 3300035410 Bacteria 954
727 Ga0373924_0201763 3300035410 Bacteria 877
728 Ga0373924_0213733 3300035410 Bacteria 851
729 Ga0373924_0370194 3300035410 Bacteria 639
730 Ga0373924_0561581 3300035410 Archaea 514
731 Ga0373931_0005698 3300035691 Bacteria 5786
732 Ga0373931_0212666 3300035691 Bacteria 1160
733 Ga0373931_0263133 3300035691 Bacteria 1053
734 Ga0373935_0132319 3300035692 Bacteria 1677
735 Ga0373935_0154422 3300035692 Bacteria 1560
736 Ga0373935_0361736 3300035692 Bacteria 1036
737 Ga0373935_0445179 3300035692 Bacteria 935
738 Ga0373935_0573908 3300035692 Bacteria 823
739 Ga0373927_0035725 3300035695 Bacteria 3232
740 Ga0373927_0099605 3300035695 Bacteria 1890
741 Ga0373927_0318478 3300035695 Bacteria 1024
742 Ga0373927_0435138 3300035695 Bacteria 866
743 Ga0373933_0019411 3300035724 Bacteria 3840
744 Ga0373933_0204709 3300035724 Bacteria 1263
745 Ga0373933_0466929 3300035724 Bacteria 826
746 Ga0373933_0573722 3300035724 Bacteria 740
747 Ga0373947_0016135 3300035725 Bacteria 4292
748 Ga0373947_0210116 3300035725 Bacteria 1276
749 Ga0373947_0258864 3300035725 Bacteria 1152
750 Ga0373947_0433857 3300035725 Bacteria 889
751 Ga0373947_0434812 3300035725 Bacteria 888
752 Ga0373947_0476578 3300035725 Bacteria 847
753 Ga0373947_0797876 3300035725 Archaea 645
754 Ga0373937_0010322 3300036401 Bacteria 8153
755 Ga0373937_0011572 3300036401 Bacteria 7744
756 Ga0373937_0042211 3300036401 Bacteria 4161
757 Ga0373937_0151436 3300036401 Bacteria 2173
758 Ga0373937_0226175 3300036401 Bacteria 1761
759 Ga0373937_0255204 3300036401 Bacteria 1653
760 Ga0373937_0842979 3300036401 Bacteria 865
761 Ga0373937_1293272 3300036401 Bacteria 677
762 Ga0373937_1454726 3300036401 Bacteria 633
763 Ga0316584_0080860 3300036712 Bacteria 2434
764 Ga0373925_0011071 3300037068 Bacteria 6551
765 Ga0373925_0152202 3300037068 Bacteria 1817
766 Ga0373925_0159821 3300037068 Unclassified 1774
767 Ga0373925_0200637 3300037068 Bacteria 1586
768 Ga0373925_0223869 3300037068 Bacteria 1502
769 Ga0373925_0339535 3300037068 Bacteria 1218
770 Ga0373925_0447899 3300037068 Bacteria 1057
771 Ga0373925_0536599 3300037068 Bacteria 962
772 Ga0373925_0995618 3300037068 Bacteria 690
773 Ga0395899_0085033 3300037312 Bacteria 2299
774 Ga0395899_0089097 3300037312 Bacteria 2238
775 Ga0395900_0102684 3300037418 Bacteria 2937
776 Ga0395900_0119467 3300037418 Bacteria 2705
777 Ga0395900_0192735 3300037418 Bacteria 2066
778 Ga0395900_0456322 3300037418 Bacteria 1233
779 Ga0395898_0324483 3300037466 Bacteria 1468
780 Ga0395898_0771188 3300037466 Bacteria 902
781 Ga0395905_0205943 3300037471 Bacteria 1844
782 Ga0436364_0293754 3300037853 Bacteria 44649
783 Ga0436364_0318274 3300037853 Bacteria 2136
784 Ga0436364_0379074 3300037853 Bacteria 1585
785 Ga0436364_0457515 3300037853 Bacteria 1335
786 Ga0436364_0911241 3300037853 Bacteria 2561
787 Ga0436364_0912700 3300037853 Bacteria 852
788 Ga0436364_0952421 3300037853 Bacteria 1811
789 Ga0436364_1041984 3300037853 Bacteria 4299
790 Ga0395901_0011181 3300038443 Bacteria 9096
791 Ga0395901_0031666 3300038443 Bacteria 5452
792 Ga0395901_0160315 3300038443 Bacteria 2362
793 Ga0395901_0210272 3300038443 Bacteria 2036
794 Ga0436365_0094547 3300039437 Bacteria 2704
795 Ga0436365_0219364 3300039437 Bacteria 2773
796 Ga0436365_0267445 3300039437 Bacteria 1053
797 Ga0436365_0360139 3300039437 Bacteria 506
798 Ga0436365_0501014 3300039437 Bacteria 1093
799 Ga0436365_0596609 3300039437 Bacteria 1133
800 Ga0436365_0720013 3300039437 Bacteria 810
801 Ga0436365_0843728 3300039437 Bacteria 1963
802 Ga0436365_1110167 3300039437 Bacteria 1229
803 Ga0436365_1489642 3300039437 Bacteria 1398
804 Ga0436360_0043757 3300039438 Bacteria 833
805 Ga0436360_0079681 3300039438 Bacteria 942
806 Ga0436360_0180394 3300039438 Bacteria 2538
807 Ga0436360_0255206 3300039438 Unclassified 1879
808 Ga0436360_0404586 3300039438 Bacteria 1335
809 Ga0436360_1029522 3300039438 Bacteria 717
810 Ga0436360_1055705 3300039438 Bacteria 2070
811 Ga0436360_1126448 3300039438 Unclassified 774
812 Ga0436360_1277821 3300039438 Bacteria 6049
813 Ga0436360_1344602 3300039438 Bacteria 2216
814 Ga0436361_0096195 3300039447 Bacteria 946
815 Ga0436361_0145041 3300039447 Bacteria 2253
816 Ga0436361_0506783 3300039447 Bacteria 709
817 Ga0436361_0617642 3300039447 Unclassified 726
818 Ga0436363_0706903 3300039450 Bacteria 2037
819 Ga0436363_0851323 3300039450 Bacteria 1336
820 Ga0436363_1077716 3300039450 Bacteria 699
821 Ga0436363_1635770 3300039450 Bacteria 694
822 Ga0436362_0169667 3300039453 Bacteria 2261
823 Ga0436362_0249591 3300039453 Bacteria 603
824 Ga0436362_0859630 3300039453 Bacteria 2063
825 Ga0436362_1035255 3300039453 Bacteria 711
826 Ga0439453_0000261 3300041408 Bacteria 5359
827 Ga0451787_279969 3300041441 Unclassified 579
828 Ga0451802_1332546 3300041460 Bacteria 521
829 Ga0451833_0725335 3300041491 Unclassified 761
830 Ga0451841_0664810 3300041498 Bacteria 613
831 Ga0439448_0020041 3300042005 Bacteria 2066
832 Ga0439455_0066350 3300042012 Bacteria 964
833 Ga0439456_090928 3300042013 Bacteria 686
834 Ga0439457_160751 3300042014 Bacteria 543
835 Ga0439458_0084594 3300042157 Bacteria 812
836 Ga0439435_0043450 3300042436 Bacteria 1264
837 Ga0439444_0006855 3300042437 Bacteria 1733
838 Ga0439459_0058459 3300042438 Bacteria 865
839 Ga0439460_0027441 3300042461 Bacteria 1599
840 Ga0451577_0404817 3300042876 Bacteria 1239
841 Ga0439440_0192608 3300042993 Unclassified 602
842 Ga0466966_0677853 3300044684 Bacteria 621
843 Ga0466961_0292966 3300044693 Bacteria 995
844 Ga0466963_0009031 3300044694 Bacteria 5988
845 Ga0453684_1192451 3300044712 Bacteria 800
846 Ga0466957_0006661 3300044842 Bacteria 6532
847 Ga0466960_0089059 3300044901 Bacteria 1570
848 Ga0466960_0531418 3300044901 Bacteria 692
849 Ga0451576_2203968 3300045051 Bacteria 566
850 Ga0466958_0304666 3300045836 Bacteria 1023
851 Ga0466958_0456439 3300045836 Bacteria 828
852 Ga0466958_0886133 3300045836 Bacteria 582
853 Ga0466967_0328347 3300045976 Bacteria 1477
854 Ga0495592_0230892 3300046454 Bacteria 1232
855 Ga0495592_0654506 3300046454 Unclassified 636
856 Ga0495590_0110931 3300046457 Bacteria 979
857 Ga0495629_0121489 3300046459 Bacteria 1820
858 Ga0495638_0005322 3300046460 Bacteria 9598
859 Ga0495638_0023899 3300046460 Bacteria 3992
860 Ga0495638_0532239 3300046460 Bacteria 587
861 Ga0495638_0636474 3300046460 Unclassified 520
862 Ga0495641_0159479 3300046461 Bacteria 1009
863 Ga0495651_0019063 3300046462 Bacteria 5316
864 Ga0495580_0175190 3300046472 Bacteria 1482
865 Ga0495580_0821387 3300046472 Bacteria 601
866 Ga0495580_0859930 3300046472 Archaea 585
867 Ga0495582_0019353 3300046473 Bacteria 3722
868 Ga0495582_0886454 3300046473 Unclassified 516
869 Ga0495605_0241149 3300046474 Bacteria 776
870 Ga0495639_0008479 3300046475 Bacteria 4407
871 Ga0495664_0000446 3300046477 Bacteria 20340
872 Ga0495584_0015860 3300046491 Bacteria 3844
873 Ga0495594_0596128 3300046499 Bacteria 626
874 Ga0495594_0788121 3300046499 Unclassified 536
875 Ga0495608_0030865 3300046511 Bacteria 3625
876 Ga0495616_0198159 3300046513 Bacteria 884
877 Ga0495620_0133636 3300046515 Bacteria 973
878 Ga0495628_0044634 3300046516 Bacteria 3525
879 Ga0495628_0089536 3300046516 Bacteria 2383
880 Ga0495630_0819223 3300046517 Archaea 710
881 Ga0495630_1179054 3300046517 Bacteria 579
882 Ga0495630_1428609 3300046517 Bacteria 520
883 Ga0495643_0487005 3300046522 Bacteria 532
884 Ga0495666_0209221 3300046526 Archaea 895
885 Ga0495652_0140559 3300046529 Bacteria 1899
886 Ga0495665_0041929 3300046531 Bacteria 2437
887 Ga0495640_0090123 3300046533 Bacteria 2025
888 Ga0495586_0656070 3300046535 Unclassified 606
889 Ga0495587_0039923 3300046536 Bacteria 2807
890 Ga0495587_0304632 3300046536 Bacteria 891
891 Ga0495645_0008204 3300046543 Bacteria 7283
892 Ga0495645_0898401 3300046543 Bacteria 526
893 Ga0495622_0531721 3300046557 Bacteria 502
894 Ga0495633_0224463 3300046558 Bacteria 860
895 Ga0495667_0005255 3300046559 Bacteria 8751
896 Ga0495667_0023798 3300046559 Bacteria 4125
897 Ga0495667_0229606 3300046559 Bacteria 1183
898 Ga0495656_0222290 3300046615 Bacteria 945
899 Ga0495668_0071749 3300046616 Bacteria 1903
900 Ga0495668_0800404 3300046616 Unclassified 522
901 Ga0495634_0477219 3300046642 Bacteria 733
902 Ga0495634_0597574 3300046642 Bacteria 641
903 Ga0495611_0206718 3300046648 Bacteria 915
904 Ga0495625_0208376 3300046660 Bacteria 1286
905 Ga0495635_0005845 3300046663 Bacteria 8574
906 Ga0495635_0292016 3300046663 Bacteria 1094
907 Ga0495661_0410720 3300046665 Archaea 657
908 Ga0495588_0302946 3300046674 Archaea 841
909 Ga0495588_0464718 3300046674 Unclassified 664
910 Ga0495657_0289480 3300046675 Bacteria 979
911 Ga0495599_0007396 3300046678 Bacteria 6658
912 Ga0495599_0056282 3300046678 Bacteria 2461
913 Ga0495623_0277063 3300046679 Bacteria 934
914 Ga0495623_0455193 3300046679 Bacteria 681
915 Ga0495646_0014797 3300046680 Bacteria 4959
916 Ga0495646_0122527 3300046680 Bacteria 1470
917 Ga0495646_0501789 3300046680 Bacteria 623
918 Ga0495658_0611465 3300046683 Bacteria 698
919 Ga0495669_0178913 3300046684 Bacteria 1011
920 Ga0495613_0118298 3300046689 Bacteria 1905
921 Ga0495613_0327521 3300046689 Unclassified 1056
922 Ga0495671_0484148 3300046692 Bacteria 591
923 Ga0495589_0221069 3300046794 Bacteria 890
924 Ga0495589_0280438 3300046794 Bacteria 775
925 Ga0495600_0178042 3300046809 Bacteria 1371
926 Ga0495581_0487082 3300047315 Unclassified 717
927 Ga0495604_0205734 3300047317 Bacteria 1362
928 Ga0495674_0070100 3300047319 Bacteria 3030
929 Ga0495676_0329898 3300047321 Bacteria 1023
930 Ga0495680_0080958 3300047322 Bacteria 2453
931 Ga0495680_0115796 3300047322 Bacteria 1983
932 Ga0495680_0477349 3300047322 Bacteria 849
933 Ga0495675_0227682 3300047444 Bacteria 1126
934 Ga0495675_0713432 3300047444 Bacteria 561
935 Ga0495684_0126792 3300047471 Bacteria 1920
936 Ga0495593_0184475 3300047673 Bacteria 1051
937 Ga0495593_0447248 3300047673 Bacteria 647
938 Ga0495602_0000599 3300048088 Bacteria 33832
939 Ga0495602_0030436 3300048088 Bacteria 5119
940 Ga0495602_0058529 3300048088 Bacteria 3372
941 Ga0495602_0792718 3300048088 Bacteria 637
942 Ga0495615_0057733 3300048090 Bacteria 1016
943 Ga0496100_0022252 3300048903 Bacteria 3834
944 Ga0496100_0112976 3300048903 Bacteria 1890
945 Ga0496100_0182693 3300048903 Bacteria 1517
946 Ga0496101_0181217 3300048904 Bacteria 1622
947 Ga0496101_0357290 3300048904 Unclassified 1148
948 Ga0496101_0688230 3300048904 Bacteria 807
949 Ga0496102_0089407 3300048905 Bacteria 2849
950 Ga0496102_0106489 3300048905 Bacteria 2610
951 Ga0496102_0290011 3300048905 Bacteria 1542
952 Ga0496102_0349742 3300048905 Bacteria 1392
953 Ga0496102_0943241 3300048905 Bacteria 784
954 Ga0496103_0198823 3300048906 Bacteria 1289
955 Ga0496104_0001104 3300048907 Bacteria 23081
956 Ga0496104_0004659 3300048907 Bacteria 11929
957 Ga0496104_0059771 3300048907 Bacteria 3609
958 Ga0496104_0405603 3300048907 Bacteria 1275
959 Ga0496104_0564667 3300048907 Bacteria 1048
960 Ga0496104_0674123 3300048907 Bacteria 942
961 Ga0496104_0836820 3300048907 Bacteria 826
962 Ga0496105_0015005 3300048908 Bacteria 6164
963 Ga0496105_0017200 3300048908 Bacteria 5792
964 Ga0496105_0024151 3300048908 Bacteria 4937
965 Ga0496105_0145898 3300048908 Bacteria 1946
966 Ga0496105_0312684 3300048908 Bacteria 1261
967 Ga0496106_0034132 3300048909 Bacteria 3799
968 Ga0496106_0092248 3300048909 Unclassified 2339
969 Ga0496106_0233267 3300048909 Bacteria 1470
970 Ga0496107_0042424 3300048910 Unclassified 3267
971 Ga0496107_0077830 3300048910 Bacteria 2416
972 Ga0496107_0242399 3300048910 Bacteria 1341
973 Ga0496107_0929960 3300048910 Bacteria 633
974 Ga0496108_0029045 3300048911 Bacteria 4576
975 Ga0496108_0083883 3300048911 Unclassified 2703
976 Ga0496108_0106853 3300048911 Bacteria 2390
977 Ga0496108_0275392 3300048911 Bacteria 1465
978 Ga0496108_0382737 3300048911 Bacteria 1228
979 Ga0496108_0476726 3300048911 Bacteria 1090
980 Ga0496108_0644844 3300048911 Bacteria 921
981 Ga0496109_0011205 3300048912 Bacteria 7695
982 Ga0496109_0173543 3300048912 Bacteria 2023
983 Ga0496109_0619194 3300048912 Bacteria 1019
984 Ga0496109_0964831 3300048912 Bacteria 790
985 Ga0496109_1718322 3300048912 Unclassified 561
986 Ga0496110_0008353 3300048913 Bacteria 8331
987 Ga0496110_0053884 3300048913 Bacteria 3537
988 Ga0496110_0282720 3300048913 Bacteria 1511
989 Ga0496110_0367130 3300048913 Bacteria 1311
990 Ga0496110_0562992 3300048913 Bacteria 1035
991 Ga0496111_0004033 3300048914 Bacteria 9219
992 Ga0496111_0114041 3300048914 Bacteria 1992
993 Ga0496111_0178722 3300048914 Bacteria 1577
994 Ga0496111_0839917 3300048914 Unclassified 663
995 Ga0496112_0092849 3300048915 Bacteria 2988
996 Ga0496112_0099383 3300048915 Bacteria 2879
997 Ga0496112_0214962 3300048915 Unclassified 1879
998 Ga0496112_0366001 3300048915 Bacteria 1383
999 Ga0496112_0427658 3300048915 Bacteria 1263
1000 Ga0496112_0484024 3300048915 Bacteria 1174
1001 Ga0496112_0715966 3300048915 Bacteria 928
1002 Ga0496112_0984013 3300048915 Bacteria 764
1003 Ga0496112_1004698 3300048915 Bacteria 754
1004 Ga0496113_0025785 3300048916 Bacteria 4195
1005 Ga0496113_0146944 3300048916 Unclassified 1858
1006 Ga0496113_0156960 3300048916 Bacteria 1797
1007 Ga0496113_0242835 3300048916 Unclassified 1437
1008 Ga0496113_0714272 3300048916 Bacteria 799
1009 Ga0496113_0821084 3300048916 Bacteria 738
1010 Ga0496113_0947177 3300048916 Bacteria 680
1011 Ga0496114_0020588 3300048917 Bacteria 5355
1012 Ga0496114_0148548 3300048917 Unclassified 2032
1013 Ga0496114_0163640 3300048917 Bacteria 1936
1014 Ga0496115_0021674 3300048918 Bacteria 4966
1015 Ga0496115_0084936 3300048918 Bacteria 2581
1016 Ga0496115_0533686 3300048918 Bacteria 939
1017 Ga0496119_0075291 3300048922 Bacteria 1962
1018 Ga0496120_0016883 3300048923 Bacteria 4753
1019 Ga0496126_0824531 3300048929 Bacteria 710
1020 Ga0501031_0369623 3300049568 Bacteria 928
1021 Ga0501031_0418723 3300049568 Unclassified 866
1022 Ga0501032_0358693 3300049569 Unclassified 939
1023 Ga0501033_0030233 3300049570 Bacteria 4070
1024 Ga0501033_0731672 3300049570 Unclassified 672
1025 Ga0501034_0004530 3300049571 Bacteria 15448
1026 Ga0501034_0048873 3300049571 Bacteria 4269
1027 Ga0501034_0138934 3300049571 Bacteria 2410
1028 Ga0501034_0191023 3300049571 Bacteria 2010
1029 Ga0501036_0811778 3300049572 Bacteria 770
1030 Ga0501036_0828658 3300049572 Bacteria 761
1031 Ga0501036_1101269 3300049572 Bacteria 649
1032 Ga0501037_0014364 3300049573 Bacteria 5831
1033 Ga0501038_0343918 3300049574 Bacteria 1163
1034 Ga0501038_0506369 3300049574 Bacteria 923
1035 Ga0501038_0528552 3300049574 Bacteria 899
1036 Ga0501039_0555155 3300049575 Unclassified 901
1037 Ga0501039_0842313 3300049575 Bacteria 715
1038 Ga0501040_0546358 3300049576 Bacteria 836
1039 Ga0501040_1238148 3300049576 Unclassified 542
1040 Ga0501041_0137666 3300049577 Unclassified 1522
1041 Ga0501042_0108985 3300049578 Bacteria 1994
1042 Ga0501043_0840957 3300049579 Unclassified 662
1043 Ga0501046_0203550 3300049580 Bacteria 1472
1044 Ga0501047_0129823 3300049581 Bacteria 2401
1045 Ga0501047_0304218 3300049581 Bacteria 1436
1046 Ga0501047_0319601 3300049581 Bacteria 1392
1047 Ga0501048_0097824 3300049582 Unclassified 2071
1048 Ga0501048_0282804 3300049582 Bacteria 1180
1049 Ga0501068_0008897 3300049584 Bacteria 5602
1050 Ga0501068_0314789 3300049584 Bacteria 1003
1051 Ga0501068_0999979 3300049584 Unclassified 552
1052 Ga0501069_0654519 3300049585 Bacteria 632
1053 Ga0501070_0191902 3300049586 Bacteria 1679
1054 Ga0501070_0233215 3300049586 Bacteria 1508
1055 Ga0501070_0526750 3300049586 Bacteria 948
1056 Ga0501070_0986090 3300049586 Bacteria 654
1057 Ga0501071_0336321 3300049587 Unclassified 1148
1058 Ga0501071_0400673 3300049587 Bacteria 1048
1059 Ga0501071_1128237 3300049587 Unclassified 606
1060 Ga0501072_0141251 3300049588 Unclassified 1920
1061 Ga0501072_0450940 3300049588 Bacteria 1019
1062 Ga0501072_0799782 3300049588 Bacteria 739
1063 Ga0501072_1046583 3300049588 Bacteria 636
1064 Ga0501072_1199152 3300049588 Bacteria 590
1065 Ga0501073_0194332 3300049589 Bacteria 1404
1066 Ga0501073_0407253 3300049589 Bacteria 940
1067 Ga0501076_0218418 3300049592 Unclassified 1558
1068 Ga0501076_0781837 3300049592 Bacteria 788
1069 Ga0501077_0289670 3300049593 Unclassified 1043
1070 Ga0501080_0287794 3300049742 Bacteria 1493
1071 Ga0501080_0573942 3300049742 Bacteria 1003
1072 Ga0501080_0753534 3300049742 Bacteria 856
1073 Ga0501080_1105567 3300049742 Bacteria 684
1074 Ga0501080_1628049 3300049742 Bacteria 546
1075 Ga0501081_0297855 3300049743 Bacteria 1183
1076 Ga0501081_0409819 3300049743 Bacteria 1004
1077 Ga0501035_0092116 3300049822 Bacteria 2667
1078 Ga0501035_0510320 3300049822 Bacteria 989
1079 Ga0501035_0926740 3300049822 Bacteria 689
1080 Ga0501044_0071231 3300049823 Bacteria 3535
1081 Ga0501044_0174924 3300049823 Bacteria 2116
1082 Ga0501044_0203380 3300049823 Bacteria 1938
1083 Ga0501044_0397535 3300049823 Bacteria 1291
1084 Ga0501044_0842081 3300049823 Bacteria 794
1085 Ga0501045_0237382 3300049824 Bacteria 1357
1086 Ga0501045_0970874 3300049824 Bacteria 623
1087 nmdc:mga03683_161650_c1 3300050489 Bacteria 1015
1088 nmdc:mga03683_326773_c1 3300050489 Bacteria 723
1089 nmdc:mga03683_82565_c1 3300050489 Bacteria 1390
1090 nmdc:mga03n38_14547_c1 3300050490 Bacteria 3018
1091 nmdc:mga03n38_24423_c1 3300050490 Bacteria 2471
1092 nmdc:mga03n38_49021_c1 3300050490 Bacteria 1248
1093 nmdc:mga00v17_278354_c1 3300050491 Bacteria 1086
1094 nmdc:mga00v17_568681_c1 3300050491 Bacteria 732
1095 nmdc:mga0k408_22378_c1 3300050493 Bacteria 3559
1096 nmdc:mga06z11_26296_c1 3300050494 Bacteria 2768
1097 nmdc:mga06z11_299_c1 3300050494 Bacteria 19034
1098 nmdc:mga06z11_311993_c1 3300050494 Bacteria 937
1099 nmdc:mga06z11_3349_c1 3300050494 Bacteria 6202
1100 nmdc:mga06z11_544167_c1 3300050494 Bacteria 705
1101 nmdc:mga06z11_586301_c1 3300050494 Bacteria 678
1102 nmdc:mga04h51_117127_c1 3300050495 Bacteria 989
1103 nmdc:mga04h51_201419_c1 3300050495 Bacteria 782
1104 nmdc:mga04h51_22862_c1 3300050495 Bacteria 1897
1105 nmdc:mga04h51_79177_c1 3300050495 Bacteria 1163
1106 nmdc:mga07m45_282299_c1 3300050496 Bacteria 966
1107 nmdc:mga05p37_1019249_c1 3300050507 Bacteria 877
1108 nmdc:mga05p37_1692977_c1 3300050507 Bacteria 617
1109 nmdc:mga05p37_170768_c1 3300050507 Bacteria 2652
1110 nmdc:mga05p37_1771279_c1 3300050507 Unclassified 598
1111 nmdc:mga05p37_60902_c1 3300050507 Unclassified 4647
1112 nmdc:mga05p37_72006_c1 3300050507 Bacteria 4253
1113 nmdc:mga09592_11144_c1 3300050508 Bacteria 7315
1114 nmdc:mga09592_152887_c1 3300050508 Unclassified 1991
1115 nmdc:mga09592_436351_c2 3300050508 Unclassified 574
1116 nmdc:mga09592_576604_c1 3300050508 Bacteria 965
1117 nmdc:mga09592_657779_c1 3300050508 Unclassified 894
1118 nmdc:mga09592_750513_c1 3300050508 Bacteria 828
1119 nmdc:mga09592_84591_c1 3300050508 Bacteria 2705
1120 nmdc:mga0qj67_146531_c1 3300050509 Bacteria 1914
1121 nmdc:mga0qj67_168105_c1 3300050509 Unclassified 1780
1122 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
1123 nmdc:mga0qj67_314274_c1 3300050509 Bacteria 1268
1124 nmdc:mga0qj67_364041_c1 3300050509 Bacteria 1168
1125 nmdc:mga0qj67_63179_c1 3300050509 Unclassified 2944
1126 nmdc:mga0qj67_84461_c1 3300050509 Unclassified 2546
1127 nmdc:mga06r32_1178847_c1 3300050510 Bacteria 713
1128 nmdc:mga06r32_1915866_c1 3300050510 Unclassified 527
1129 nmdc:mga06r32_569924_c1 3300050510 Bacteria 1105
1130 nmdc:mga06r32_76360_c1 3300050510 Unclassified 3253
1131 nmdc:mga06r32_874440_c1 3300050510 Unclassified 856
1132 nmdc:mga06r32_917785_c1 3300050510 Bacteria 831
1133 nmdc:mga08y16_1095929_c1 3300050511 Bacteria 772
1134 nmdc:mga08y16_480461_c1 3300050511 Bacteria 1264
1135 nmdc:mga08y16_679007_c1 3300050511 Bacteria 1032
1136 nmdc:mga08y16_97469_c1 3300050511 Bacteria 3062
1137 nmdc:mga0n895_1035854_c1 3300050512 Unclassified 800
1138 nmdc:mga0n895_1270236_c1 3300050512 Bacteria 708
1139 nmdc:mga0n895_31442_c1 3300050512 Bacteria 5083
1140 nmdc:mga0n895_847914_c1 3300050512 Bacteria 902
1141 nmdc:mga0rr50_1325040_c1 3300050513 Bacteria 610
1142 nmdc:mga0rr50_207113_c1 3300050513 Unclassified 1614
1143 nmdc:mga0rr50_471688_c1 3300050513 Unclassified 1065
1144 nmdc:mga0rr50_739555_c1 3300050513 Bacteria 839
1145 nmdc:mga08x19_61691_c1 3300050514 Bacteria 2430
1146 nmdc:mga0a205_1149740_c1 3300050515 Bacteria 624
1147 nmdc:mga0a205_460525_c1 3300050515 Bacteria 1131
1148 nmdc:mga0a205_529903_c1 3300050515 Bacteria 1034
1149 nmdc:mga0a205_77713_c1 3300050515 Bacteria 3207
1150 nmdc:mga0sz30_277463_c1 3300050516 Bacteria 747
1151 nmdc:mga0sz30_66935_c1 3300050516 Bacteria 1542
1152 Ga0495601_0000349 3300053077 Bacteria 24294
1153 Ga0495601_0317030 3300053077 Bacteria 1015
1154 Ga0495601_0392072 3300053077 Archaea 901
1155 Ga0495601_0599436 3300053077 Unclassified 707
1156 Ga0495612_0001007 3300053078 Bacteria 11601
1157 Ga0495595_0047423 3300053084 Bacteria 1982
1158 Ga0495619_0111388 3300053085 Bacteria 1870
1159 Ga0495619_0126078 3300053085 Bacteria 1757
1160 Ga0495619_0201948 3300053085 Bacteria 1376
1161 Ga0495619_0339932 3300053085 Bacteria 1039
1162 Ga0500646_0037115 3300053090 Unclassified 1360
1163 Ga0500647_0108819 3300053091 Bacteria 1319
1164 Ga0500651_0336534 3300053093 Bacteria 859
1165 Ga0500566_0347863 3300053094 Bacteria 680
1166 Ga0500641_0170517 3300053096 Bacteria 937
1167 Ga0500650_0084755 3300053098 Bacteria 1483
1168 Ga0500555_086857 3300053103 Bacteria 808
1169 Ga0500595_124263 3300053119 Bacteria 728
1170 Ga0500614_075867 3300053123 Bacteria 932
1171 Ga0500642_0075535 3300053130 Unclassified 1540
1172 Ga0500658_0025615 3300053134 Bacteria 2268
1173 Ga0500568_0009712 3300053139 Bacteria 4554
1174 Ga0500577_0113072 3300053142 Bacteria 1123
1175 Ga0500577_0283066 3300053142 Unclassified 723
1176 Ga0500588_0058560 3300053146 Bacteria 1227
1177 Ga0500616_0002142 3300053153 Bacteria 17085
1178 Ga0500616_0031547 3300053153 Bacteria 2902
1179 Ga0500620_052693 3300053155 Bacteria 1368
1180 Ga0500627_0245925 3300053158 Unclassified 793
1181 Ga0500645_178523 3300053730 Bacteria 578
1182 Ga0500552_000105 3300053733 Bacteria 7017
1183 Ga0501084_1274938 3300054114 Bacteria 616
1184 Ga0587079_139807 3300059647 Bacteria 616
1185 Ga0587111_0190887 3300060346 Bacteria 575
1186 Ga0501082_0154525 3300060353 Unclassified 1994
1187 Ga0501082_0373451 3300060353 Bacteria 1244
1188 Ga0501082_1542956 3300060353 Bacteria 580
1189 Ga0530510_0162784 3300061734 Unclassified 1651
1190 Ga0530510_0335786 3300061734 Bacteria 1134
1191 Ga0495674_0854457
1192 JGI24742J22300_10014305
1193 JGI25407J50210_10133011
1194 JGI25405J52794_10004546
1195 Ga0058863_11093206
1196 Ga0058860_11548922
1197 Ga0065712_10023621
1198 Ga0070683_100158931
1199 Ga0070683_100939234
1200 Ga0070683_101699656
1201 Ga0070690_100061985
1202 Ga0070690_100152708
1203 Ga0070690_100495446
1204 Ga0070690_100518083
1205 Ga0070670_100363148
1206 Ga0070670_100397336
1207 Ga0070670_101739863
1208 Ga0070677_10018331
1209 Ga0070677_10314602
1210 Ga0068869_101484217
1211 Ga0070666_10575430
1212 Ga0070680_100139963
1213 Ga0070680_100340656
1214 Ga0070682_100315300
1215 Ga0070682_100963335
1216 Ga0070682_102086687
1217 Ga0068868_100071958
1218 Ga0068868_101388657
1219 Ga0070660_100163158
1220 Ga0070689_100008245
1221 Ga0070689_100064441
1222 Ga0070689_100135248
1223 Ga0070689_100480643
1224 Ga0070689_100796865
1225 Ga0070689_101356060
1226 Ga0070691_10006074
1227 Ga0070691_10662237
1228 Ga0070687_100208121
1229 Ga0070687_101269276
1230 Ga0070661_100091876
1231 Ga0070668_100331153
1232 Ga0070668_100970452
1233 Ga0070668_101572990
1234 Ga0070668_101908989
1235 Ga0070669_100196560
1236 Ga0070669_100232123
1237 Ga0070675_100082318
1238 Ga0070675_100437783
1239 Ga0070675_101350474
1240 Ga0070671_100021982
1241 Ga0070671_100701205
1242 Ga0070671_100802416
1243 Ga0070674_100010635
1244 Ga0070674_100112052
1245 Ga0070674_100117366
1246 Ga0070674_100289908
1247 Ga0070674_100986250
1248 Ga0070673_100137809
1249 Ga0070673_100376553
1250 Ga0070688_100012110
1251 Ga0070688_100151760
1252 Ga0070688_100166754
1253 Ga0070667_100192368
1254 Ga0070667_100488528
1255 Ga0070667_100492452
1256 Ga0070667_101755320
1257 Ga0070667_101952114
1258 Ga0070709_10007571
1259 Ga0070709_10124121
1260 Ga0070714_100018088
1261 Ga0070714_100168116
1262 Ga0070714_100411091
1263 Ga0070714_100653455
1264 Ga0070714_101024995
1265 Ga0070714_101579019
1266 Ga0070713_100006041
1267 Ga0070713_100078171
1268 Ga0070713_100154139
1269 Ga0070713_100364983
1270 Ga0070713_100964321
1271 Ga0070713_100969616
1272 Ga0070710_10012582
1273 Ga0070710_10254974
1274 Ga0070710_10972555
1275 Ga0070701_10415234
1276 Ga0070701_10853306
1277 Ga0070711_100073767
1278 Ga0070711_100206778
1279 Ga0070711_100224018
1280 Ga0070711_101634774
1281 Ga0070711_102049001
1282 Ga0070705_101744876
1283 Ga0070700_100748916
1284 Ga0070700_101753626
1285 Ga0070694_100619898
1286 Ga0070663_100452942
1287 Ga0070678_100013179
1288 Ga0070678_100221473
1289 Ga0070678_101695546
1290 Ga0070662_100398856
1291 Ga0070662_100406832
1292 Ga0070662_100448392
1293 Ga0070662_101908064
1294 Ga0070681_10001152
1295 Ga0070681_10050252
1296 Ga0070681_10053270
1297 Ga0070681_10175294
1298 Ga0070681_10747078
1299 Ga0070681_11669001
1300 Ga0068867_100065628
1301 Ga0068867_100094632
1302 Ga0070685_10114736
1303 Ga0070706_100023584
1304 Ga0070706_100056966
1305 Ga0070706_100466967
1306 Ga0070706_101260131
1307 Ga0070707_100007453
1308 Ga0070707_100140150
1309 Ga0070707_100146332
1310 Ga0070707_100902267
1311 Ga0070698_100006683
1312 Ga0070698_100017475
1313 Ga0070698_100452986
1314 Ga0070698_100943854
1315 Ga0070699_100054647
1316 Ga0070699_100276354
1317 Ga0070699_100364658
1318 Ga0070679_100159111
1319 Ga0070679_100180933
1320 Ga0070679_100207872
1321 Ga0070679_100456462
1322 Ga0070679_101700880
1323 Ga0070684_100011059
1324 Ga0070697_100246407
1325 Ga0070697_100996691
1326 Ga0068853_101109756
1327 Ga0068853_102009444
1328 Ga0070672_100033169
1329 Ga0070686_100037537
1330 Ga0070686_100313888
1331 Ga0070686_100518435
1332 Ga0070686_100566207
1333 Ga0070686_100881849
1334 Ga0070696_100067310
1335 Ga0070696_100851041
1336 Ga0070665_100160208
1337 Ga0070665_101391392
1338 Ga0070704_102202895
1339 Ga0068855_100017426
1340 Ga0068855_100588956
1341 Ga0068855_100605833
1342 Ga0068855_100724604
1343 Ga0068855_100797900
1344 Ga0070664_100038843
1345 Ga0068857_100037617
1346 Ga0068857_100338446
1347 Ga0068856_100041817
1348 Ga0068856_100065822
1349 Ga0068856_100300969
1350 Ga0068856_100442780
1351 Ga0068856_100512557
1352 Ga0070702_100194932
1353 Ga0070702_100442140
1354 Ga0070702_100809645
1355 Ga0070702_101354084
1356 Ga0068852_100088311
1357 Ga0068859_100096097
1358 Ga0068859_100242826
1359 Ga0068859_100788006
1360 Ga0068859_100799588
1361 Ga0068859_100948072
1362 Ga0068864_100007330
1363 Ga0068864_100034477
1364 Ga0068864_100348548
1365 Ga0068864_100722957
1366 Ga0068866_10645951
1367 Ga0068861_100048984
1368 Ga0068861_100570778
1369 Ga0068861_100918525
1370 Ga0068861_101144080
1371 Ga0068861_101737301
1372 Ga0068870_10547109
1373 Ga0068870_11257347
1374 Ga0068863_100794686
1375 Ga0068863_101679409
1376 Ga0068863_101730723
1377 Ga0068858_100169996
1378 Ga0068858_100866311
1379 Ga0068858_102343213
1380 Ga0068858_102411374
1381 Ga0068860_100113245
1382 Ga0068860_100127998
1383 Ga0068860_100656527
1384 Ga0068860_100765755
1385 Ga0068860_101328784
1386 Ga0068860_101681736
1387 Ga0068862_100263019
1388 Ga0068862_100365558
1389 Ga0068862_101025373
1390 Ga0068862_101166789
1391 Ga0081455_10001285
1392 Ga0081455_10004152
1393 Ga0081455_10008714
1394 Ga0081455_10019848
1395 Ga0081455_10119563
1396 Ga0081455_10218615
1397 Ga0081455_10278708
1398 Ga0081538_10002503
1399 Ga0081538_10046120
1400 Ga0081538_10183794
1401 Ga0081538_10212529
1402 Ga0081540_1014265
1403 Ga0081540_1016449
1404 Ga0081540_1038882
1405 Ga0081540_1148069
1406 Ga0081539_10014566
1407 Ga0081539_10058101
1408 Ga0081539_10074035
1409 Ga0070717_10009576
1410 Ga0070717_10087937
1411 Ga0070717_10125013
1412 Ga0070717_10296143
1413 Ga0070717_10412267
1414 Ga0070717_11476863
1415 Ga0070717_11712133
1416 Ga0075365_10332686
1417 Ga0075363_100019332
1418 Ga0075363_100022989
1419 Ga0075363_100166982
1420 Ga0075363_100527483
1421 Ga0075364_10131778
1422 Ga0075432_10039613
1423 Ga0075432_10388938
1424 Ga0075432_10575100
1425 Ga0070715_10538716
1426 Ga0070716_100503650
1427 Ga0070712_100010216
1428 Ga0070712_100021390
1429 Ga0070712_100067347
1430 Ga0070712_100119875
1431 Ga0070712_100470190
1432 Ga0070712_100495111
1433 Ga0070712_100676336
1434 Ga0070712_100996561
1435 Ga0075362_10072161
1436 Ga0075362_10074633
1437 Ga0075362_10743328
1438 Ga0075367_10023684
1439 Ga0075367_10173410
1440 Ga0075367_10250046
1441 Ga0075367_10294798
1442 Ga0075367_10350921
1443 Ga0075369_10123622
1444 Ga0075369_10275118
1445 Ga0075427_10008235
1446 Ga0075366_10353431
1447 Ga0097621_100939877
1448 Ga0075370_10249521
1449 Ga0068871_100205742
1450 Ga0068871_100514203
1451 Ga0068871_102303062
1452 Ga0075428_100004619
1453 Ga0075428_100009365
1454 Ga0075428_100030936
1455 Ga0075428_100115423
1456 Ga0075428_100311398
1457 Ga0075428_100693178
1458 Ga0075428_100697433
1459 Ga0075430_100007440
1460 Ga0075430_100046813
1461 Ga0075430_100071358
1462 Ga0075430_100116692
1463 Ga0075430_100679175
1464 Ga0075430_101251585
1465 Ga0075430_101602258
1466 Ga0075431_100004380
1467 Ga0075431_100086642
1468 Ga0075431_100105157
1469 Ga0075431_100267726
1470 Ga0075431_100838345
1471 Ga0075431_101453645
1472 Ga0075433_10079299
1473 Ga0075433_10244853
1474 Ga0075433_10851719
1475 Ga0075434_100043527
1476 Ga0075434_100843931
1477 Ga0075429_100016046
1478 Ga0075429_100061691
1479 Ga0075429_100110914
1480 Ga0075429_100349170
1481 Ga0075429_101155172
1482 Ga0075429_102001837
1483 Ga0068865_100577511
1484 Ga0068865_100599593
1485 Ga0097620_100096099
1486 Ga0097620_100242823
1487 Ga0097620_100787964
1488 Ga0097620_100799612
1489 Ga0097620_100811535
1490 Ga0097620_100947842
1491 Ga0075435_100502802
1492 Ga0075435_100627976
1493 Ga0075435_100858525
1494 Ga0075435_101432830
1495 Ga0075435_101506190
1496 Ga0099794_10276412
1497 Ga0099795_10000237
1498 Ga0099795_10222530
1499 Ga0099795_10423471
1500 Ga0105244_10512402
1501 Ga0105250_10578213
1502 Ga0105240_10003467
1503 Ga0105240_11469625
1504 Ga0111539_10025624
1505 Ga0111539_10046741
1506 Ga0111539_10508411
1507 Ga0111539_10946076
1508 Ga0111539_12191432
1509 Ga0105245_10404063
1510 Ga0105245_10480631
1511 Ga0105245_10575379
1512 Ga0105245_10644779
1513 Ga0105245_12035332
1514 Ga0105245_12140468
1515 Ga0105247_10141812
1516 Ga0105247_10206481
1517 Ga0105247_10216862
1518 Ga0105247_10291189
1519 Ga0105247_10779696
1520 Ga0114129_10052483
1521 Ga0114129_10519023
1522 Ga0114129_10722934
1523 Ga0114129_10789325
1524 Ga0114129_10794148
1525 Ga0105243_10532913
1526 Ga0105243_11042280
1527 Ga0105243_11510507
1528 Ga0105243_11593944
1529 Ga0105241_11708505
1530 Ga0105242_10532453
1531 Ga0105242_10720827
1532 Ga0105242_10768729
1533 Ga0105248_10126790
1534 Ga0105248_10273984
1535 Ga0105248_10319558
1536 Ga0105248_10567922
1537 Ga0105248_10644158
1538 Ga0105248_11008614
1539 Ga0105248_12238285
1540 Ga0105248_12466221
1541 Ga0105237_10314451
1542 Ga0105237_10964138
1543 Ga0105238_10122740
1544 Ga0105238_10763625
1545 Ga0105238_11180702
1546 Ga0105249_10240746
1547 Ga0105249_10890360
1548 Ga0105249_11718657
1549 Ga0105249_11808700
1550 Ga0105035_102989
1551 Ga0099796_10004441
1552 Ga0099796_10085129
1553 Ga0099796_10168623
1554 Ga0105239_10182724
1555 Ga0105239_11414181
1556 Ga0105239_12813857
1557 Ga0105246_10007415
1558 Ga0105246_11094296
1559 Ga0157373_10203756
1560 Ga0157371_10128371
1561 Ga0157371_10529333
1562 Ga0157369_10121041
1563 Ga0157369_11558158
1564 Ga0157374_10240273
1565 Ga0157374_11823319
1566 Ga0157374_11996801
1567 Ga0157374_12096208
1568 Ga0157374_12543035
1569 Ga0157378_10429898
1570 Ga0157378_10533562
1571 Ga0157378_12206831
1572 Ga0157378_12264081
1573 Ga0157378_12413445
1574 Ga0163162_10755250
1575 Ga0163162_11508254
1576 Ga0163162_11936868
1577 Ga0163162_12948786
1578 Ga0157372_10128361
1579 Ga0157375_10141049
1580 Ga0157375_10143093
1581 Ga0157375_10321265
1582 Ga0157375_10605121
1583 Ga0163163_10039996
1584 Ga0163163_10040918
1585 Ga0163163_10141456
1586 Ga0163163_10494785
1587 Ga0163163_10677964
1588 Ga0163163_11186309
1589 Ga0163163_11748428
1590 Ga0157380_10174558
1591 Ga0157380_10210907
1592 Ga0157380_10892163
1593 Ga0157380_11275194
1594 Ga0157380_13230620
1595 Ga0182008_10037470
1596 Ga0157377_10971819
1597 Ga0157377_10986003
1598 Ga0157379_10043895
1599 Ga0157379_10080970
1600 Ga0157379_10182222
1601 Ga0157379_10511215
1602 Ga0157379_11519288
1603 Ga0157379_12175113
1604 Ga0157376_10285904
1605 Ga0157376_10362786
1606 Ga0157376_10656299
1607 Ga0157376_10894626
1608 Ga0182007_10069741
1609 Ga0163161_10162370
1610 Ga0163161_10451607
1611 Ga0163161_10776870
1612 Ga0163161_10804494
1613 Ga0206354_10341732
1614 Ga0206353_11599512
1615 Ga0213872_10440986
1616 Ga0213874_10238262
1617 Ga0213876_10041220
1618 Ga0213875_10007211
1619 Ga0213875_10129936
1620 Ga0213871_10023826
1621 Ga0224712_10282220
1622 Ga0228598_1039612
1623 Ga0207426_1071031
1624 Ga0207682_10002121
1625 Ga0207682_10362151
1626 Ga0207692_10019780
1627 Ga0207692_10032657
1628 Ga0207692_10074755
1629 Ga0207692_10142181
1630 Ga0207692_10669558
1631 Ga0207692_10787014
1632 Ga0207692_10956745
1633 Ga0207692_11210198
1634 Ga0207642_10062410
1635 Ga0207642_10400806
1636 Ga0207710_10088984
1637 Ga0207688_10002666
1638 Ga0207688_10076000
1639 Ga0207688_10119204
1640 Ga0207688_10141901
1641 Ga0207680_10379792
1642 Ga0207680_10573296
1643 Ga0207680_11069310
1644 Ga0207647_10143742
1645 Ga0207699_10018475
1646 Ga0207699_10174489
1647 Ga0207699_10426556
1648 Ga0207699_10885331
1649 Ga0207645_10105493
1650 Ga0207643_10001626
1651 Ga0207643_10080461
1652 Ga0207643_10294986
1653 Ga0207705_10094832
1654 Ga0207684_10069874
1655 Ga0207684_10074148
1656 Ga0207684_10232221
1657 Ga0207684_10478400
1658 Ga0207654_10227211
1659 Ga0207654_10466281
1660 Ga0207654_10852797
1661 Ga0207707_10041293
1662 Ga0207707_10101471
1663 Ga0207707_10148664
1664 Ga0207707_10239271
1665 Ga0207707_11369431
1666 Ga0207695_10054005
1667 Ga0207695_10546229
1668 Ga0207671_10080602
1669 Ga0207693_10002165
1670 Ga0207693_10017026
1671 Ga0207693_10019034
1672 Ga0207693_10020506
1673 Ga0207693_10059066
1674 Ga0207693_10118265
1675 Ga0207693_10181876
1676 Ga0207693_10213555
1677 Ga0207693_10667639
1678 Ga0207693_11334537
1679 Ga0207663_10240670
1680 Ga0207663_10433683
1681 Ga0207663_11493280
1682 Ga0207660_10010887
1683 Ga0207660_10572969
1684 Ga0207660_10826523
1685 Ga0207662_10018906
1686 Ga0207657_10091291
1687 Ga0207649_10103950
1688 Ga0207652_10339566
1689 Ga0207652_11011763
1690 Ga0207646_10092084
1691 Ga0207646_10125031
1692 Ga0207646_10176670
1693 Ga0207646_10546134
1694 Ga0207646_10784922
1695 Ga0207646_11347838
1696 Ga0207681_10139159
1697 Ga0207681_10675818
1698 Ga0207681_10811169
1699 Ga0207681_11194820
1700 Ga0207681_11503921
1701 Ga0207694_10213191
1702 Ga0207650_10700860
1703 Ga0207650_10818887
1704 Ga0207659_10114491
1705 Ga0207659_10304725
1706 Ga0207659_10760968
1707 Ga0207687_10251508
1708 Ga0207700_10062858
1709 Ga0207700_10067540
1710 Ga0207700_10200541
1711 Ga0207700_10406805
1712 Ga0207700_10658349
1713 Ga0207700_10916603
1714 Ga0207664_10045279
1715 Ga0207664_10098990
1716 Ga0207664_10141638
1717 Ga0207664_10640116
1718 Ga0207664_11418911
1719 Ga0207644_10022359
1720 Ga0207644_10164837
1721 Ga0207644_10756443
1722 Ga0207644_11659092
1723 Ga0207690_10049381
1724 Ga0207690_10335871
1725 Ga0207690_11832280
1726 Ga0207706_10339881
1727 Ga0207706_10348142
1728 Ga0207686_10220929
1729 Ga0207709_11475976
1730 Ga0207670_10008201
1731 Ga0207670_10091586
1732 Ga0207670_10672719
1733 Ga0207670_11499685
1734 Ga0207669_10160054
1735 Ga0207669_10224009
1736 Ga0207669_11099660
1737 Ga0207704_10150491
1738 Ga0207704_10425345
1739 Ga0207665_10109139
1740 Ga0207665_10664763
1741 Ga0207691_10004008
1742 Ga0207691_10036729
1743 Ga0207691_10217212
1744 Ga0207691_10236149
1745 Ga0207711_10003717
1746 Ga0207711_10155377
1747 Ga0207711_10440290
1748 Ga0207711_10860221
1749 Ga0207711_11210955
1750 Ga0207711_11296590
1751 Ga0207711_11583785
1752 Ga0207711_11671325
1753 Ga0207689_10547649
1754 Ga0207689_10551476
1755 Ga0207689_11055628
1756 Ga0207661_10180940
1757 Ga0207661_10850935
1758 Ga0207661_10941590
1759 Ga0207661_11046541
1760 Ga0207679_10223235
1761 Ga0207679_10491315
1762 Ga0207679_11816494
1763 Ga0207667_10044823
1764 Ga0207667_10112413
1765 Ga0207667_10800475
1766 Ga0207667_11307340
1767 Ga0207651_10352725
1768 Ga0207651_10812275
1769 Ga0207712_10747299
1770 Ga0207712_10979989
1771 Ga0207712_11859925
1772 Ga0207668_10139663
1773 Ga0207668_10188695
1774 Ga0207668_11325258
1775 Ga0207668_11673845
1776 Ga0207658_10702240
1777 Ga0207658_10921922
1778 Ga0207677_10287169
1779 Ga0207677_12111355
1780 Ga0207703_10243704
1781 Ga0207703_11863243
1782 Ga0207639_10367097
1783 Ga0207639_10420398
1784 Ga0207678_10176275
1785 Ga0207678_10241455
1786 Ga0207678_11160044
1787 Ga0207708_10212232
1788 Ga0207708_10423909
1789 Ga0207708_10896120
1790 Ga0207702_10125306
1791 Ga0207702_10141254
1792 Ga0207702_10270420
1793 Ga0207702_10352266
1794 Ga0207702_11219866
1795 Ga0207702_11655165
1796 Ga0207702_12452370
1797 Ga0207641_10360506
1798 Ga0207641_10776846
1799 Ga0207641_11263007
1800 Ga0207648_10051810
1801 Ga0207648_10089803
1802 Ga0207648_10955748
1803 Ga0207676_10035299
1804 Ga0207676_10243527
1805 Ga0207676_10407903
1806 Ga0207676_12088330
1807 Ga0207674_10046322
1808 Ga0207674_10068392
1809 Ga0207675_100004996
1810 Ga0207675_100053730
1811 Ga0207675_100065085
1812 Ga0207675_100191830
1813 Ga0207675_100357476
1814 Ga0207675_100624734
1815 Ga0207675_101508907
1816 Ga0207675_101773736
1817 Ga0207683_10011410
1818 Ga0207683_10058366
1819 Ga0207683_10074150
1820 Ga0207683_10097598
1821 Ga0207683_11938959
1822 Ga0207698_10233817
1823 Ga0207698_10903400
1824 Ga0209179_1043654
1825 Ga0209179_1142515
1826 Ga0209813_10088531
1827 Ga0207428_10034685
1828 Ga0207428_10147229
1829 Ga0207428_10226536
1830 Ga0207428_10721362
1831 Ga0268266_10834296
1832 Ga0268265_10102216
1833 Ga0268265_10169505
1834 Ga0268265_10304816
1835 Ga0268265_10980491
1836 Ga0268265_11096103
1837 Ga0268264_10148943
1838 Ga0268264_10630079
1839 Ga0268264_10846845
1840 Ga0265334_10025605
1841 Ga0265770_1058502
1842 Ga0265760_10064822
1843 Ga0265330_10274584
1844 Ga0265332_10110015
1845 Ga0265325_10071089
1846 Ga0265325_10530048
1847 Ga0265329_10245595
1848 Ga0265340_10157435
1849 Ga0265339_10512018
1850 Ga0265339_10594919
1851 Ga0265327_10064161
1852 Ga0265316_10245996
1853 Ga0265316_10911571
1854 Ga0307513_10129091
1855 Ga0265342_10304322
1856 Ga0316576_10004877
1857 Ga0307405_10158387
1858 Ga0307413_10558187
1859 Ga0307413_10590571
1860 Ga0307413_11439849
1861 Ga0307410_10313703
1862 Ga0307410_10373883
1863 Ga0307406_10426985
1864 Ga0307406_10542464
1865 Ga0307412_11277053
1866 Ga0307409_101881601
1867 Ga0307416_100075944
1868 Ga0307416_100115956
1869 Ga0307416_100756627
1870 Ga0307416_101627524
1871 Ga0307414_10023092
1872 Ga0307411_11006256
1873 Ga0307415_101586246
1874 Ga0373930_0007127
1875 Ga0373930_0072164
1876 Ga0373948_0085880
1877 Ga0373958_0023348
1878 Ga0373938_0012328
1879 Ga0373926_0457394
1880 Ga0373928_0069546
1881 Ga0373928_0079779
1882 Ga0373929_0144235
1883 Ga0373934_0063951
1884 Ga0373934_0335811
1885 Ga0373944_0087370
1886 Ga0373944_0195308
1887 Ga0373949_0256435
1888 Ga0373923_0052094
1889 Ga0373923_0066352
1890 Ga0373923_0193084
1891 Ga0373923_0474299
1892 Ga0373923_0474435
1893 Ga0373932_0098324
1894 Ga0373932_0223679
1895 Ga0373941_0032936
1896 Ga0373941_0195598
1897 Ga0373945_0137638
1898 Ga0373945_0195374
1899 Ga0373945_0352050
1900 Ga0373953_0042164
1901 Ga0373954_0062818
1902 Ga0373957_0223669
1903 Ga0373960_0056480
1904 Ga0373943_0111803
1905 Ga0373943_0139392
1906 Ga0373943_0415235
1907 Ga0373943_0473926
1908 Ga0373946_0024327
1909 Ga0373946_0123555
1910 Ga0373946_0131635
1911 Ga0373946_0306223
1912 Ga0373955_0035900
1913 Ga0373942_0344426
1914 Ga0316574_0000554
1915 Ga0373924_0056580
1916 Ga0373924_0171450
1917 Ga0373924_0201763
1918 Ga0373924_0213733
1919 Ga0373924_0370194
1920 Ga0373924_0561581
1921 Ga0373931_0005698
1922 Ga0373931_0212666
1923 Ga0373931_0263133
1924 Ga0373935_0132319
1925 Ga0373935_0154422
1926 Ga0373935_0361736
1927 Ga0373935_0445179
1928 Ga0373935_0573908
1929 Ga0373927_0035725
1930 Ga0373927_0099605
1931 Ga0373927_0318478
1932 Ga0373927_0435138
1933 Ga0373933_0019411
1934 Ga0373933_0204709
1935 Ga0373933_0466929
1936 Ga0373933_0573722
1937 Ga0373947_0016135
1938 Ga0373947_0210116
1939 Ga0373947_0258864
1940 Ga0373947_0433857
1941 Ga0373947_0434812
1942 Ga0373947_0476578
1943 Ga0373947_0797876
1944 Ga0373937_0010322
1945 Ga0373937_0011572
1946 Ga0373937_0042211
1947 Ga0373937_0151436
1948 Ga0373937_0226175
1949 Ga0373937_0255204
1950 Ga0373937_0842979
1951 Ga0373937_1293272
1952 Ga0373937_1454726
1953 Ga0316584_0080860
1954 Ga0373925_0011071
1955 Ga0373925_0152202
1956 Ga0373925_0159821
1957 Ga0373925_0200637
1958 Ga0373925_0223869
1959 Ga0373925_0339535
1960 Ga0373925_0447899
1961 Ga0373925_0536599
1962 Ga0373925_0995618
1963 Ga0395899_0085033
1964 Ga0395899_0089097
1965 Ga0395900_0102684
1966 Ga0395900_0119467
1967 Ga0395900_0192735
1968 Ga0395900_0456322
1969 Ga0395898_0324483
1970 Ga0395898_0771188
1971 Ga0395905_0205943
1972 Ga0436364_0293754
1973 Ga0436364_0318274
1974 Ga0436364_0379074
1975 Ga0436364_0457515
1976 Ga0436364_0911241
1977 Ga0436364_0912700
1978 Ga0436364_0952421
1979 Ga0436364_1041984
1980 Ga0395901_0011181
1981 Ga0395901_0031666
1982 Ga0395901_0160315
1983 Ga0395901_0210272
1984 Ga0436365_0094547
1985 Ga0436365_0219364
1986 Ga0436365_0267445
1987 Ga0436365_0360139
1988 Ga0436365_0501014
1989 Ga0436365_0596609
1990 Ga0436365_0720013
1991 Ga0436365_0843728
1992 Ga0436365_1110167
1993 Ga0436365_1489642
1994 Ga0436360_0043757
1995 Ga0436360_0079681
1996 Ga0436360_0180394
1997 Ga0436360_0255206
1998 Ga0436360_0404586
1999 Ga0436360_1029522
2000 Ga0436360_1055705
2001 Ga0436360_1126448
2002 Ga0436360_1277821
2003 Ga0436360_1344602
2004 Ga0436361_0096195
2005 Ga0436361_0145041
2006 Ga0436361_0506783
2007 Ga0436361_0617642
2008 Ga0436363_0706903
2009 Ga0436363_0851323
2010 Ga0436363_1077716
2011 Ga0436363_1635770
2012 Ga0436362_0169667
2013 Ga0436362_0249591
2014 Ga0436362_0859630
2015 Ga0436362_1035255
2016 Ga0439453_0000261
2017 Ga0451787_279969
2018 Ga0451802_1332546
2019 Ga0451833_0725335
2020 Ga0451841_0664810
2021 Ga0439448_0020041
2022 Ga0439455_0066350
2023 Ga0439456_090928
2024 Ga0439457_160751
2025 Ga0439458_0084594
2026 Ga0439435_0043450
2027 Ga0439444_0006855
2028 Ga0439459_0058459
2029 Ga0439460_0027441
2030 Ga0451577_0404817
2031 Ga0439440_0192608
2032 Ga0466966_0677853
2033 Ga0466961_0292966
2034 Ga0466963_0009031
2035 Ga0453684_1192451
2036 Ga0466957_0006661
2037 Ga0466960_0089059
2038 Ga0466960_0531418
2039 Ga0451576_2203968
2040 Ga0466958_0304666
2041 Ga0466958_0456439
2042 Ga0466958_0886133
2043 Ga0466967_0328347
2044 Ga0495592_0230892
2045 Ga0495592_0654506
2046 Ga0495590_0110931
2047 Ga0495629_0121489
2048 Ga0495638_0005322
2049 Ga0495638_0023899
2050 Ga0495638_0532239
2051 Ga0495638_0636474
2052 Ga0495641_0159479
2053 Ga0495651_0019063
2054 Ga0495580_0175190
2055 Ga0495580_0821387
2056 Ga0495580_0859930
2057 Ga0495582_0019353
2058 Ga0495582_0886454
2059 Ga0495605_0241149
2060 Ga0495639_0008479
2061 Ga0495664_0000446
2062 Ga0495584_0015860
2063 Ga0495594_0596128
2064 Ga0495594_0788121
2065 Ga0495608_0030865
2066 Ga0495616_0198159
2067 Ga0495620_0133636
2068 Ga0495628_0044634
2069 Ga0495628_0089536
2070 Ga0495630_0819223
2071 Ga0495630_1179054
2072 Ga0495630_1428609
2073 Ga0495643_0487005
2074 Ga0495666_0209221
2075 Ga0495652_0140559
2076 Ga0495665_0041929
2077 Ga0495640_0090123
2078 Ga0495586_0656070
2079 Ga0495587_0039923
2080 Ga0495587_0304632
2081 Ga0495645_0008204
2082 Ga0495645_0898401
2083 Ga0495622_0531721
2084 Ga0495633_0224463
2085 Ga0495667_0005255
2086 Ga0495667_0023798
2087 Ga0495667_0229606
2088 Ga0495656_0222290
2089 Ga0495668_0071749
2090 Ga0495668_0800404
2091 Ga0495634_0477219
2092 Ga0495634_0597574
2093 Ga0495611_0206718
2094 Ga0495625_0208376
2095 Ga0495635_0005845
2096 Ga0495635_0292016
2097 Ga0495661_0410720
2098 Ga0495588_0302946
2099 Ga0495588_0464718
2100 Ga0495657_0289480
2101 Ga0495599_0007396
2102 Ga0495599_0056282
2103 Ga0495623_0277063
2104 Ga0495623_0455193
2105 Ga0495646_0014797
2106 Ga0495646_0122527
2107 Ga0495646_0501789
2108 Ga0495658_0611465
2109 Ga0495669_0178913
2110 Ga0495613_0118298
2111 Ga0495613_0327521
2112 Ga0495671_0484148
2113 Ga0495589_0221069
2114 Ga0495589_0280438
2115 Ga0495600_0178042
2116 Ga0495581_0487082
2117 Ga0495604_0205734
2118 Ga0495674_0070100
2119 Ga0495676_0329898
2120 Ga0495680_0080958
2121 Ga0495680_0115796
2122 Ga0495680_0477349
2123 Ga0495675_0227682
2124 Ga0495675_0713432
2125 Ga0495684_0126792
2126 Ga0495593_0184475
2127 Ga0495593_0447248
2128 Ga0495602_0000599
2129 Ga0495602_0030436
2130 Ga0495602_0058529
2131 Ga0495602_0792718
2132 Ga0495615_0057733
2133 Ga0496100_0022252
2134 Ga0496100_0112976
2135 Ga0496100_0182693
2136 Ga0496101_0181217
2137 Ga0496101_0357290
2138 Ga0496101_0688230
2139 Ga0496102_0089407
2140 Ga0496102_0106489
2141 Ga0496102_0290011
2142 Ga0496102_0349742
2143 Ga0496102_0943241
2144 Ga0496103_0198823
2145 Ga0496104_0001104
2146 Ga0496104_0004659
2147 Ga0496104_0059771
2148 Ga0496104_0405603
2149 Ga0496104_0564667
2150 Ga0496104_0674123
2151 Ga0496104_0836820
2152 Ga0496105_0015005
2153 Ga0496105_0017200
2154 Ga0496105_0024151
2155 Ga0496105_0145898
2156 Ga0496105_0312684
2157 Ga0496106_0034132
2158 Ga0496106_0092248
2159 Ga0496106_0233267
2160 Ga0496107_0042424
2161 Ga0496107_0077830
2162 Ga0496107_0242399
2163 Ga0496107_0929960
2164 Ga0496108_0029045
2165 Ga0496108_0083883
2166 Ga0496108_0106853
2167 Ga0496108_0275392
2168 Ga0496108_0382737
2169 Ga0496108_0476726
2170 Ga0496108_0644844
2171 Ga0496109_0011205
2172 Ga0496109_0173543
2173 Ga0496109_0619194
2174 Ga0496109_0964831
2175 Ga0496109_1718322
2176 Ga0496110_0008353
2177 Ga0496110_0053884
2178 Ga0496110_0282720
2179 Ga0496110_0367130
2180 Ga0496110_0562992
2181 Ga0496111_0004033
2182 Ga0496111_0114041
2183 Ga0496111_0178722
2184 Ga0496111_0839917
2185 Ga0496112_0092849
2186 Ga0496112_0099383
2187 Ga0496112_0214962
2188 Ga0496112_0366001
2189 Ga0496112_0427658
2190 Ga0496112_0484024
2191 Ga0496112_0715966
2192 Ga0496112_0984013
2193 Ga0496112_1004698
2194 Ga0496113_0025785
2195 Ga0496113_0146944
2196 Ga0496113_0156960
2197 Ga0496113_0242835
2198 Ga0496113_0714272
2199 Ga0496113_0821084
2200 Ga0496113_0947177
2201 Ga0496114_0020588
2202 Ga0496114_0148548
2203 Ga0496114_0163640
2204 Ga0496115_0021674
2205 Ga0496115_0084936
2206 Ga0496115_0533686
2207 Ga0496119_0075291
2208 Ga0496120_0016883
2209 Ga0496126_0824531
2210 Ga0501031_0369623
2211 Ga0501031_0418723
2212 Ga0501032_0358693
2213 Ga0501033_0030233
2214 Ga0501033_0731672
2215 Ga0501034_0004530
2216 Ga0501034_0048873
2217 Ga0501034_0138934
2218 Ga0501034_0191023
2219 Ga0501036_0811778
2220 Ga0501036_0828658
2221 Ga0501036_1101269
2222 Ga0501037_0014364
2223 Ga0501038_0343918
2224 Ga0501038_0506369
2225 Ga0501038_0528552
2226 Ga0501039_0555155
2227 Ga0501039_0842313
2228 Ga0501040_0546358
2229 Ga0501040_1238148
2230 Ga0501041_0137666
2231 Ga0501042_0108985
2232 Ga0501043_0840957
2233 Ga0501046_0203550
2234 Ga0501047_0129823
2235 Ga0501047_0304218
2236 Ga0501047_0319601
2237 Ga0501048_0097824
2238 Ga0501048_0282804
2239 Ga0501068_0008897
2240 Ga0501068_0314789
2241 Ga0501068_0999979
2242 Ga0501069_0654519
2243 Ga0501070_0191902
2244 Ga0501070_0233215
2245 Ga0501070_0526750
2246 Ga0501070_0986090
2247 Ga0501071_0336321
2248 Ga0501071_0400673
2249 Ga0501071_1128237
2250 Ga0501072_0141251
2251 Ga0501072_0450940
2252 Ga0501072_0799782
2253 Ga0501072_1046583
2254 Ga0501072_1199152
2255 Ga0501073_0194332
2256 Ga0501073_0407253
2257 Ga0501076_0218418
2258 Ga0501076_0781837
2259 Ga0501077_0289670
2260 Ga0501080_0287794
2261 Ga0501080_0573942
2262 Ga0501080_0753534
2263 Ga0501080_1105567
2264 Ga0501080_1628049
2265 Ga0501081_0297855
2266 Ga0501081_0409819
2267 Ga0501035_0092116
2268 Ga0501035_0510320
2269 Ga0501035_0926740
2270 Ga0501044_0071231
2271 Ga0501044_0174924
2272 Ga0501044_0203380
2273 Ga0501044_0397535
2274 Ga0501044_0842081
2275 Ga0501045_0237382
2276 Ga0501045_0970874
2277 nmdc:mga03683_161650_c1
2278 nmdc:mga03683_326773_c1
2279 nmdc:mga03683_82565_c1
2280 nmdc:mga03n38_14547_c1
2281 nmdc:mga03n38_24423_c1
2282 nmdc:mga03n38_49021_c1
2283 nmdc:mga00v17_278354_c1
2284 nmdc:mga00v17_568681_c1
2285 nmdc:mga0k408_22378_c1
2286 nmdc:mga06z11_26296_c1
2287 nmdc:mga06z11_299_c1
2288 nmdc:mga06z11_311993_c1
2289 nmdc:mga06z11_3349_c1
2290 nmdc:mga06z11_544167_c1
2291 nmdc:mga06z11_586301_c1
2292 nmdc:mga04h51_117127_c1
2293 nmdc:mga04h51_201419_c1
2294 nmdc:mga04h51_22862_c1
2295 nmdc:mga04h51_79177_c1
2296 nmdc:mga07m45_282299_c1
2297 nmdc:mga05p37_1019249_c1
2298 nmdc:mga05p37_1692977_c1
2299 nmdc:mga05p37_170768_c1
2300 nmdc:mga05p37_1771279_c1
2301 nmdc:mga05p37_60902_c1
2302 nmdc:mga05p37_72006_c1
2303 nmdc:mga09592_11144_c1
2304 nmdc:mga09592_152887_c1
2305 nmdc:mga09592_436351_c2
2306 nmdc:mga09592_576604_c1
2307 nmdc:mga09592_657779_c1
2308 nmdc:mga09592_750513_c1
2309 nmdc:mga09592_84591_c1
2310 nmdc:mga0qj67_146531_c1
2311 nmdc:mga0qj67_168105_c1
2312 nmdc:mga0qj67_19_c1
2313 nmdc:mga0qj67_314274_c1
2314 nmdc:mga0qj67_364041_c1
2315 nmdc:mga0qj67_63179_c1
2316 nmdc:mga0qj67_84461_c1
2317 nmdc:mga06r32_1178847_c1
2318 nmdc:mga06r32_1915866_c1
2319 nmdc:mga06r32_569924_c1
2320 nmdc:mga06r32_76360_c1
2321 nmdc:mga06r32_874440_c1
2322 nmdc:mga06r32_917785_c1
2323 nmdc:mga08y16_1095929_c1
2324 nmdc:mga08y16_480461_c1
2325 nmdc:mga08y16_679007_c1
2326 nmdc:mga08y16_97469_c1
2327 nmdc:mga0n895_1035854_c1
2328 nmdc:mga0n895_1270236_c1
2329 nmdc:mga0n895_31442_c1
2330 nmdc:mga0n895_847914_c1
2331 nmdc:mga0rr50_1325040_c1
2332 nmdc:mga0rr50_207113_c1
2333 nmdc:mga0rr50_471688_c1
2334 nmdc:mga0rr50_739555_c1
2335 nmdc:mga08x19_61691_c1
2336 nmdc:mga0a205_1149740_c1
2337 nmdc:mga0a205_460525_c1
2338 nmdc:mga0a205_529903_c1
2339 nmdc:mga0a205_77713_c1
2340 nmdc:mga0sz30_277463_c1
2341 nmdc:mga0sz30_66935_c1
2342 Ga0495601_0000349
2343 Ga0495601_0317030
2344 Ga0495601_0392072
2345 Ga0495601_0599436
2346 Ga0495612_0001007
2347 Ga0495595_0047423
2348 Ga0495619_0111388
2349 Ga0495619_0126078
2350 Ga0495619_0201948
2351 Ga0495619_0339932
2352 Ga0500646_0037115
2353 Ga0500647_0108819
2354 Ga0500651_0336534
2355 Ga0500566_0347863
2356 Ga0500641_0170517
2357 Ga0500650_0084755
2358 Ga0500555_086857
2359 Ga0500595_124263
2360 Ga0500614_075867
2361 Ga0500642_0075535
2362 Ga0500658_0025615
2363 Ga0500568_0009712
2364 Ga0500577_0113072
2365 Ga0500577_0283066
2366 Ga0500588_0058560
2367 Ga0500616_0002142
2368 Ga0500616_0031547
2369 Ga0500620_052693
2370 Ga0500627_0245925
2371 Ga0500645_178523
2372 Ga0500552_000105
2373 Ga0501084_1274938
2374 Ga0587079_139807
2375 Ga0587111_0190887
2376 Ga0501082_0154525
2377 Ga0501082_0373451
2378 Ga0501082_1542956
2379 Ga0530510_0162784
2380 Ga0530510_0335786

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09585

Lin0512_fam

Conserved hypothetical protein (Lin0512_fam)

31

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8l-assembly1.cif.gz_A crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution 0.778 1 112
3c8l-assembly1.cif.gz_A crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution 0.7658 1 112
6y1v-assembly1.cif.gz_B mycobacterium tuberculosis ftsz-gtp-gamma-s in complex with 4-hydroxycoumarin 0.5815 10 113
3wgj-assembly2.cif.gz_B staphylococcus aureus ftsz t7 chimera mutant, t7bs 0.5743 10 109
2q1x-assembly1.cif.gz_A crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with citrate. 0.5517 10 109
ID Description Score Start End Superfamily
3c8lB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain 0.7506 1 110 3.30.1330.20
af_A0A0R0KCY4_1_112_3.30.1330.20 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain 0.6649 1 108 3.30.1330.20
af_A0A0R0KCY4_1_112_3.30.1330.20 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain 0.6395 1 108 3.30.1330.20
af_P0A9A6_224_341_3.30.1330.20 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain 0.5759 9 112 3.30.1330.20
af_K7V2R4_9_169_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.5715 87 112 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7C7K667-F1-model_v4 Uncharacterized protein 0.9334 48 112 GO:0005525
AF-A0A7G2M091-F1-model_v4 Uncharacterized protein 0.9218 41 113 GO:0005525
AF-A0A4Q5PHS3-F1-model_v4 Uncharacterized protein 0.9181 45 111 GO:0005525
AF-A0A2D4UM75-F1-model_v4 Uncharacterized protein 0.9167 53 106 GO:0005525
AF-A0A2D9YBU4-F1-model_v4 Uncharacterized protein 0.9165 31 112 GO:0005525

Map