F491425
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1188 | 592 | 993 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300046499|Ga0495594_0177404|Ga0495594_0177404_558_1193 |
| Length | 203 |
| Sequence | MSEINTNTVSATGADISSRYYVTEHHPENGTLLGFWIYLMSDCLIFACLFATYAVLGRNYAGGPSGAEIFELPTVALNTAFLLVSSITYGFAMLAAQKKNVKGTQVWLAVTGILGLCFLGLELTEFHALIAEGNGPWRSGFLTAFFSLVGTHGLHVTFGIVWLVTLMFAANYRRLACLSMFWHFLDVVWIGVFTFVYLMGVLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 13 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 14 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 15 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 16 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 17 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 18 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 19 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 20 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 21 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 22 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 23 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 24 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 25 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 26 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 27 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 28 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 29 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 30 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 31 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 32 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 33 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 34 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 35 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 36 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 37 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 38 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 39 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 40 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 41 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 42 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 43 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 44 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 45 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 46 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 47 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 48 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 49 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 50 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 51 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 52 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 53 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 54 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 55 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 56 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 57 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 58 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 59 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 60 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 61 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 62 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 63 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 64 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 65 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 66 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 67 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 68 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 69 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 70 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 71 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 72 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 73 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 74 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 75 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 76 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 77 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 78 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 79 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 80 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 81 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 82 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 83 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 84 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 85 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 86 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 87 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 88 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 89 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 90 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 91 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 92 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 93 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 94 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 95 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 96 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 97 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 98 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 99 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 100 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 101 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 102 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 103 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 104 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 105 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 106 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 107 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 108 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 109 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 110 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 111 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 112 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 113 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 114 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 115 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 116 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 117 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 118 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 119 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 120 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 121 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 122 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 123 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 124 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 125 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 126 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 127 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 128 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 129 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 130 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 131 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 132 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 133 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 134 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 135 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 136 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 137 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 138 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 139 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 140 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 141 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 142 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 143 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 144 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 145 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 146 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 147 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 148 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 149 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 150 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 151 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 152 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 153 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 154 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 155 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 156 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 157 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 158 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 159 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 160 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 161 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 162 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 163 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 164 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 165 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 166 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 167 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 168 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 169 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 170 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 171 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 172 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 173 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 174 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 175 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 176 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 177 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 178 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 179 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 180 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 181 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 182 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 183 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 184 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 185 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 186 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 187 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 188 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 189 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 190 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 191 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 192 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 193 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 194 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 195 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 196 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 197 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 198 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 200 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 201 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 202 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 203 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 204 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 205 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 206 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 207 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 208 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 209 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 210 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 212 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 231 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 232 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 234 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 236 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 238 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 242 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 244 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 245 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 246 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 247 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 248 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 249 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 250 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 251 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 252 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 253 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 254 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 255 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 257 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 258 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 260 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 261 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 263 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 273 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 274 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 277 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 286 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 288 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 289 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 290 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 292 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 293 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 294 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 295 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 296 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 298 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 299 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 300 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 304 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 306 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 307 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 309 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 311 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 313 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 316 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 319 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 369 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 373 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 374 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 375 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 376 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 377 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 378 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 379 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 380 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 381 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 382 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 383 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 384 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 385 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 386 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 387 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 388 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 389 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 390 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 391 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 392 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 393 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 394 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 395 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 396 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 397 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 398 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 399 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 400 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 401 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 402 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 403 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 404 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 405 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 406 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 407 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 408 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 409 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 410 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 411 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 412 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 413 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 414 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 415 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 416 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 417 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 418 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 419 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 420 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 421 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 422 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 423 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 424 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 425 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 426 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 427 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 428 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 429 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 430 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 431 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 432 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 433 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 434 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 507 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 508 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 509 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 510 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 511 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 512 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 513 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 514 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 515 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 517 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 518 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 519 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 520 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 521 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 522 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 523 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 524 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 525 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 526 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 527 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 528 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 529 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 530 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 531 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 532 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 533 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 536 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 537 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 548 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 549 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 550 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 551 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 552 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 555 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 556 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 557 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 558 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 560 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 561 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 562 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 563 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 564 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 565 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 566 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 567 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 568 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 570 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 571 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 572 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 573 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 574 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 575 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 576 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 577 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 578 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 579 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 580 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 581 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 582 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 583 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 584 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 585 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 586 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 587 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 588 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 589 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 590 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 591 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 592 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.41 |
| Metatranscriptomes | 1.18 |
| Isolates | 16.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.08 |
| Bulb | 0 |
| Endosphere | 12.29 |
| Nodule | 8.42 |
| Rhizoplane | 3.96 |
| Rhizosphere | 59.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1446302 | 2162886007 | Bacteria | 1499 |
| 2 | SwRhRL2b_contig_3055844 | 2162886007 | Bacteria | 22848 |
| 3 | SwRhRL2b_contig_3207873 | 2162886007 | Bacteria | 73231 |
| 4 | JGI24736J21556_1004445 | 3300001904 | Bacteria | 2394 |
| 5 | JGI24741J21665_1005915 | 3300001915 | Bacteria | 2503 |
| 6 | JGI24741J21665_1007918 | 3300001915 | Bacteria | 2033 |
| 7 | JGI24741J21665_1011473 | 3300001915 | Bacteria | 1548 |
| 8 | JGI24741J21665_1032964 | 3300001915 | Bacteria | 772 |
| 9 | JGI24740J21852_10001457 | 3300001979 | Bacteria | 10853 |
| 10 | JGI24740J21852_10008770 | 3300001979 | Bacteria | 4011 |
| 11 | JGI24740J21852_10009141 | 3300001979 | Bacteria | 3895 |
| 12 | JGI24740J21852_10019556 | 3300001979 | Bacteria | 2383 |
| 13 | JGI24739J22299_10010835 | 3300001989 | Bacteria | 3375 |
| 14 | JGI24738J21930_10000448 | 3300002075 | Bacteria | 11680 |
| 15 | JGI25152J39213_1000231 | 3300002773 | Bacteria | 37495 |
| 16 | JGI25152J39213_1001252 | 3300002773 | Bacteria | 11547 |
| 17 | JGI25150J39212_1000095 | 3300002774 | Bacteria | 50881 |
| 18 | JGI25150J39212_1000142 | 3300002774 | Bacteria | 40535 |
| 19 | JGI25150J39212_1000230 | 3300002774 | Bacteria | 30285 |
| 20 | JGI25151J46595_10000031 | 3300003187 | Bacteria | 197865 |
| 21 | JGI25151J46595_10000477 | 3300003187 | Bacteria | 37879 |
| 22 | JGI25151J46595_10048568 | 3300003187 | Bacteria | 1465 |
| 23 | JGI25153J46596_10000291 | 3300003215 | Bacteria | 37879 |
| 24 | JGI25153J46596_10000927 | 3300003215 | Bacteria | 17813 |
| 25 | rootH2_10082605 | 3300003320 | Bacteria | 2783 |
| 26 | Ga0006556J51387_1032851 | 3300003479 | Bacteria | 1496 |
| 27 | Ga0006560J51390_1037325 | 3300003565 | Bacteria | 803 |
| 28 | Ga0006554J51385_1031149 | 3300003567 | Bacteria | 1366 |
| 29 | Ga0007409J51694_1008758 | 3300003575 | Bacteria | 3822 |
| 30 | Ga0006562J51391_1005855 | 3300003578 | Bacteria | 3889 |
| 31 | Ga0006562J51391_1044196 | 3300003578 | Bacteria | 3593 |
| 32 | Ga0055529_1000076 | 3300003763 | Bacteria | 156104 |
| 33 | Ga0055529_1004557 | 3300003763 | Bacteria | 2093 |
| 34 | Ga0055526_1000874 | 3300003771 | Bacteria | 22514 |
| 35 | Ga0055526_1003976 | 3300003771 | Bacteria | 9107 |
| 36 | Ga0055537_1000268 | 3300003773 | Bacteria | 37958 |
| 37 | Ga0055524_1000010 | 3300003775 | Bacteria | 282893 |
| 38 | Ga0055524_1002624 | 3300003775 | Bacteria | 9149 |
| 39 | Ga0055524_1012477 | 3300003775 | Bacteria | 3260 |
| 40 | Ga0055524_1024025 | 3300003775 | Bacteria | 1946 |
| 41 | Ga0055524_1070331 | 3300003775 | Bacteria | 677 |
| 42 | Ga0055524_1070420 | 3300003775 | Bacteria | 677 |
| 43 | Ga0055536_1000385 | 3300003781 | Bacteria | 32350 |
| 44 | Ga0055536_1022660 | 3300003781 | Bacteria | 1867 |
| 45 | Ga0055536_1041988 | 3300003781 | Bacteria | 1074 |
| 46 | Ga0055534_1000362 | 3300003784 | Bacteria | 28718 |
| 47 | Ga0055528_1000367 | 3300003790 | Bacteria | 36676 |
| 48 | Ga0055528_1000370 | 3300003790 | Bacteria | 36558 |
| 49 | Ga0055530_10000573 | 3300003791 | Bacteria | 31894 |
| 50 | Ga0055530_10003264 | 3300003791 | Bacteria | 9434 |
| 51 | Ga0055530_10005644 | 3300003791 | Bacteria | 5862 |
| 52 | Ga0055540_1019751 | 3300003792 | Bacteria | 1807 |
| 53 | Ga0055531_10001002 | 3300003794 | Bacteria | 22441 |
| 54 | Ga0055531_10025287 | 3300003794 | Bacteria | 2162 |
| 55 | Ga0055531_10081551 | 3300003794 | Bacteria | 711 |
| 56 | Ga0055531_10087643 | 3300003794 | Bacteria | 668 |
| 57 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 58 | Ga0055543_1001100 | 3300004625 | Bacteria | 11684 |
| 59 | Ga0065165_1000040 | 3300005262 | Bacteria | 205767 |
| 60 | Ga0065165_1000101 | 3300005262 | Bacteria | 141486 |
| 61 | Ga0065165_1000386 | 3300005262 | Bacteria | 71435 |
| 62 | Ga0065165_1015600 | 3300005262 | Bacteria | 2890 |
| 63 | Ga0065704_10023675 | 3300005289 | Bacteria | 1486 |
| 64 | Ga0065704_10393488 | 3300005289 | Bacteria | 760 |
| 65 | Ga0065707_10044585 | 3300005295 | Bacteria | 1079 |
| 66 | Ga0070658_10000464 | 3300005327 | Bacteria | 35087 |
| 67 | Ga0070658_10166907 | 3300005327 | Bacteria | 1848 |
| 68 | Ga0070683_100075438 | 3300005329 | Bacteria | 3150 |
| 69 | Ga0070683_100333408 | 3300005329 | Bacteria | 1444 |
| 70 | Ga0070683_100753444 | 3300005329 | Bacteria | 933 |
| 71 | Ga0070670_100051261 | 3300005331 | Bacteria | 3545 |
| 72 | Ga0070677_10075881 | 3300005333 | Bacteria | 1426 |
| 73 | Ga0070666_10000012 | 3300005335 | Bacteria | 244720 |
| 74 | Ga0070680_100005939 | 3300005336 | Bacteria | 9265 |
| 75 | Ga0070680_100025630 | 3300005336 | Bacteria | 4714 |
| 76 | Ga0070680_100046627 | 3300005336 | Bacteria | 3526 |
| 77 | Ga0070682_100081768 | 3300005337 | Bacteria | 2092 |
| 78 | Ga0070682_100812522 | 3300005337 | Bacteria | 761 |
| 79 | Ga0070660_100121185 | 3300005339 | Bacteria | 2087 |
| 80 | Ga0070660_100282896 | 3300005339 | Bacteria | 1357 |
| 81 | Ga0070660_100406981 | 3300005339 | Bacteria | 1125 |
| 82 | Ga0070660_100593765 | 3300005339 | Bacteria | 925 |
| 83 | Ga0070691_10000414 | 3300005341 | Bacteria | 15615 |
| 84 | Ga0070691_10051018 | 3300005341 | Bacteria | 1974 |
| 85 | Ga0070691_10179152 | 3300005341 | Bacteria | 1102 |
| 86 | Ga0070691_10202859 | 3300005341 | Bacteria | 1042 |
| 87 | Ga0070661_100008252 | 3300005344 | Bacteria | 7188 |
| 88 | Ga0070661_100054589 | 3300005344 | Bacteria | 2926 |
| 89 | Ga0070661_100181726 | 3300005344 | Bacteria | 1600 |
| 90 | Ga0070692_10009461 | 3300005345 | Bacteria | 4396 |
| 91 | Ga0070692_10021858 | 3300005345 | Bacteria | 3117 |
| 92 | Ga0070668_100029042 | 3300005347 | Bacteria | 4198 |
| 93 | Ga0070669_100065888 | 3300005353 | Bacteria | 2669 |
| 94 | Ga0070671_100118023 | 3300005355 | Bacteria | 2231 |
| 95 | Ga0070671_100270334 | 3300005355 | Bacteria | 1445 |
| 96 | Ga0070659_100607313 | 3300005366 | Bacteria | 940 |
| 97 | Ga0070667_100029599 | 3300005367 | Bacteria | 4565 |
| 98 | Ga0070667_100805793 | 3300005367 | Bacteria | 872 |
| 99 | Ga0070713_100379402 | 3300005436 | Bacteria | 1317 |
| 100 | Ga0070663_100325147 | 3300005455 | Bacteria | 1238 |
| 101 | Ga0070663_100438417 | 3300005455 | Bacteria | 1074 |
| 102 | Ga0070678_100036678 | 3300005456 | Bacteria | 3434 |
| 103 | Ga0070662_100002976 | 3300005457 | Bacteria | 10530 |
| 104 | Ga0070681_10001054 | 3300005458 | Bacteria | 23444 |
| 105 | Ga0070681_10046305 | 3300005458 | Bacteria | 4348 |
| 106 | Ga0070681_10106849 | 3300005458 | Bacteria | 2740 |
| 107 | Ga0068867_100496952 | 3300005459 | Bacteria | 1048 |
| 108 | Ga0070699_100536014 | 3300005518 | Bacteria | 1065 |
| 109 | Ga0070699_100610319 | 3300005518 | Bacteria | 995 |
| 110 | Ga0070679_100000116 | 3300005530 | Bacteria | 63019 |
| 111 | Ga0070679_100039125 | 3300005530 | Bacteria | 4714 |
| 112 | Ga0070679_100068995 | 3300005530 | Bacteria | 3526 |
| 113 | Ga0070684_100060950 | 3300005535 | Bacteria | 3301 |
| 114 | Ga0070684_100089262 | 3300005535 | Bacteria | 2739 |
| 115 | Ga0068853_100067525 | 3300005539 | Bacteria | 3106 |
| 116 | Ga0068853_100070406 | 3300005539 | Bacteria | 3044 |
| 117 | Ga0068853_100307243 | 3300005539 | Bacteria | 1467 |
| 118 | Ga0068853_100342344 | 3300005539 | Bacteria | 1390 |
| 119 | Ga0068853_100545339 | 3300005539 | Bacteria | 1098 |
| 120 | Ga0068853_100663109 | 3300005539 | Bacteria | 993 |
| 121 | Ga0068853_100761879 | 3300005539 | Bacteria | 925 |
| 122 | Ga0070672_100064190 | 3300005543 | Bacteria | 2901 |
| 123 | Ga0070686_100321305 | 3300005544 | Bacteria | 1154 |
| 124 | Ga0070696_100046009 | 3300005546 | Bacteria | 3025 |
| 125 | Ga0070696_100174920 | 3300005546 | Bacteria | 1589 |
| 126 | Ga0070693_100001124 | 3300005547 | Bacteria | 11992 |
| 127 | Ga0070665_100217358 | 3300005548 | Bacteria | 1912 |
| 128 | Ga0068855_100100356 | 3300005563 | Bacteria | 3333 |
| 129 | Ga0068855_100171819 | 3300005563 | Bacteria | 2454 |
| 130 | Ga0068855_100393934 | 3300005563 | Bacteria | 1519 |
| 131 | Ga0068855_100949028 | 3300005563 | Bacteria | 906 |
| 132 | Ga0070664_100050389 | 3300005564 | Bacteria | 3523 |
| 133 | Ga0070664_100096297 | 3300005564 | Bacteria | 2568 |
| 134 | Ga0068857_100066946 | 3300005577 | Bacteria | 3196 |
| 135 | Ga0068857_100074737 | 3300005577 | Bacteria | 3020 |
| 136 | Ga0068857_100078994 | 3300005577 | Bacteria | 2937 |
| 137 | Ga0068857_100797943 | 3300005577 | Bacteria | 901 |
| 138 | Ga0068854_100103909 | 3300005578 | Bacteria | 2133 |
| 139 | Ga0068854_100238794 | 3300005578 | Bacteria | 1446 |
| 140 | Ga0068854_100247328 | 3300005578 | Bacteria | 1422 |
| 141 | Ga0068854_100378785 | 3300005578 | Bacteria | 1165 |
| 142 | Ga0068854_100417520 | 3300005578 | Bacteria | 1114 |
| 143 | Ga0068856_100179946 | 3300005614 | Bacteria | 2127 |
| 144 | Ga0068856_100452758 | 3300005614 | Bacteria | 1304 |
| 145 | Ga0068856_100562660 | 3300005614 | Bacteria | 1161 |
| 146 | Ga0068852_100036629 | 3300005616 | Bacteria | 4108 |
| 147 | Ga0068852_100250925 | 3300005616 | Bacteria | 1695 |
| 148 | Ga0068852_100385620 | 3300005616 | Bacteria | 1375 |
| 149 | Ga0068852_100893102 | 3300005616 | Bacteria | 905 |
| 150 | Ga0068864_100244820 | 3300005618 | Bacteria | 1662 |
| 151 | Ga0068866_10197397 | 3300005718 | Bacteria | 1200 |
| 152 | Ga0068851_10010821 | 3300005834 | Bacteria | 4263 |
| 153 | Ga0068858_100449226 | 3300005842 | Bacteria | 1242 |
| 154 | Ga0068860_100230707 | 3300005843 | Bacteria | 1799 |
| 155 | Ga0068862_100760762 | 3300005844 | Bacteria | 943 |
| 156 | Ga0081455_10000120 | 3300005937 | Bacteria | 89920 |
| 157 | Ga0075364_10092343 | 3300006051 | Bacteria | 2009 |
| 158 | Ga0075364_10208274 | 3300006051 | Bacteria | 1326 |
| 159 | Ga0070715_10076191 | 3300006163 | Bacteria | 1511 |
| 160 | Ga0070712_100057928 | 3300006175 | Bacteria | 2723 |
| 161 | Ga0075369_10081602 | 3300006186 | Bacteria | 1435 |
| 162 | Ga0075369_10202324 | 3300006186 | Bacteria | 916 |
| 163 | Ga0097621_100043182 | 3300006237 | Bacteria | 3634 |
| 164 | Ga0075370_10226356 | 3300006353 | Bacteria | 1106 |
| 165 | Ga0068871_100053473 | 3300006358 | Bacteria | 3273 |
| 166 | Ga0097620_101224099 | 3300006931 | Bacteria | 827 |
| 167 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 168 | Ga0105251_10001750 | 3300009011 | Bacteria | 18123 |
| 169 | Ga0105244_10009858 | 3300009036 | Bacteria | 5831 |
| 170 | Ga0105244_10025146 | 3300009036 | Bacteria | 3241 |
| 171 | Ga0105244_10128061 | 3300009036 | Bacteria | 1226 |
| 172 | Ga0105250_10000005 | 3300009092 | Bacteria | 422580 |
| 173 | Ga0105250_10069397 | 3300009092 | Bacteria | 1423 |
| 174 | Ga0105240_10008512 | 3300009093 | Bacteria | 14670 |
| 175 | Ga0105240_10008765 | 3300009093 | Bacteria | 14414 |
| 176 | Ga0105240_10123556 | 3300009093 | Bacteria | 3114 |
| 177 | Ga0105240_10193184 | 3300009093 | Bacteria | 2392 |
| 178 | Ga0105240_10255133 | 3300009093 | Bacteria | 2026 |
| 179 | Ga0105240_10460024 | 3300009093 | Bacteria | 1422 |
| 180 | Ga0105240_10463790 | 3300009093 | Bacteria | 1415 |
| 181 | Ga0105240_11223492 | 3300009093 | Bacteria | 795 |
| 182 | Ga0105247_10000719 | 3300009101 | Bacteria | 25791 |
| 183 | Ga0105242_10198237 | 3300009176 | Bacteria | 1782 |
| 184 | Ga0105248_10394626 | 3300009177 | Bacteria | 1558 |
| 185 | Ga0105248_10711288 | 3300009177 | Bacteria | 1133 |
| 186 | Ga0105248_11055962 | 3300009177 | Bacteria | 918 |
| 187 | Ga0105248_11363830 | 3300009177 | Bacteria | 802 |
| 188 | Ga0105237_10000202 | 3300009545 | Bacteria | 84889 |
| 189 | Ga0105237_10050473 | 3300009545 | Bacteria | 4180 |
| 190 | Ga0105238_10000109 | 3300009551 | Bacteria | 90227 |
| 191 | Ga0105238_10002754 | 3300009551 | Bacteria | 17526 |
| 192 | Ga0105238_10285677 | 3300009551 | Bacteria | 1632 |
| 193 | Ga0105238_10707001 | 3300009551 | Bacteria | 1020 |
| 194 | Ga0105238_10745431 | 3300009551 | Bacteria | 993 |
| 195 | Ga0105148_100086 | 3300009978 | Bacteria | 14695 |
| 196 | Ga0105147_111069 | 3300009982 | Bacteria | 765 |
| 197 | Ga0105239_10000022 | 3300010375 | Bacteria | 257744 |
| 198 | Ga0105239_10011676 | 3300010375 | Bacteria | 9805 |
| 199 | Ga0105239_10214394 | 3300010375 | Bacteria | 2158 |
| 200 | Ga0105239_10501147 | 3300010375 | Bacteria | 1380 |
| 201 | Ga0105239_11424530 | 3300010375 | Bacteria | 800 |
| 202 | Ga0105246_10191418 | 3300011119 | Bacteria | 1584 |
| 203 | Ga0157327_1013548 | 3300012512 | Bacteria | 821 |
| 204 | Ga0157373_10020888 | 3300013100 | Bacteria | 4753 |
| 205 | Ga0157373_10347880 | 3300013100 | Bacteria | 1057 |
| 206 | Ga0157371_10012688 | 3300013102 | Bacteria | 6428 |
| 207 | Ga0157371_10035605 | 3300013102 | Bacteria | 3567 |
| 208 | Ga0157371_10210343 | 3300013102 | Bacteria | 1396 |
| 209 | Ga0157371_10351170 | 3300013102 | Bacteria | 1073 |
| 210 | Ga0157370_10004006 | 3300013104 | Bacteria | 17114 |
| 211 | Ga0157370_10006361 | 3300013104 | Bacteria | 13038 |
| 212 | Ga0157370_10028770 | 3300013104 | Bacteria | 5463 |
| 213 | Ga0157370_10064244 | 3300013104 | Bacteria | 3475 |
| 214 | Ga0157370_10096501 | 3300013104 | Bacteria | 2773 |
| 215 | Ga0157370_10109162 | 3300013104 | Bacteria | 2587 |
| 216 | Ga0157370_10176959 | 3300013104 | Bacteria | 1983 |
| 217 | Ga0157370_10588822 | 3300013104 | Bacteria | 1019 |
| 218 | Ga0157369_10155544 | 3300013105 | Bacteria | 2415 |
| 219 | Ga0157369_10414277 | 3300013105 | Bacteria | 1397 |
| 220 | Ga0157369_10687233 | 3300013105 | Bacteria | 1054 |
| 221 | Ga0163162_10000324 | 3300013306 | Bacteria | 43904 |
| 222 | Ga0163162_10469613 | 3300013306 | Bacteria | 1390 |
| 223 | Ga0157372_10119219 | 3300013307 | Bacteria | 3029 |
| 224 | Ga0157372_10190386 | 3300013307 | Bacteria | 2376 |
| 225 | Ga0157372_12005137 | 3300013307 | Bacteria | 665 |
| 226 | Ga0157375_10005255 | 3300013308 | Bacteria | 11243 |
| 227 | Ga0157375_10216357 | 3300013308 | Bacteria | 2074 |
| 228 | Ga0157380_10436269 | 3300014326 | Bacteria | 1254 |
| 229 | Ga0157380_10481611 | 3300014326 | Bacteria | 1200 |
| 230 | Ga0182008_10003366 | 3300014497 | Bacteria | 9700 |
| 231 | Ga0182008_10045595 | 3300014497 | Bacteria | 2180 |
| 232 | Ga0157379_10000199 | 3300014968 | Bacteria | 46395 |
| 233 | Ga0182006_1000041 | 3300015261 | Bacteria | 203413 |
| 234 | Ga0182006_1000133 | 3300015261 | Bacteria | 80418 |
| 235 | Ga0182006_1036383 | 3300015261 | Bacteria | 1958 |
| 236 | Ga0182007_10001735 | 3300015262 | Bacteria | 11472 |
| 237 | Ga0182007_10004669 | 3300015262 | Bacteria | 6177 |
| 238 | Ga0182005_1000027 | 3300015265 | Bacteria | 223652 |
| 239 | Ga0182005_1001033 | 3300015265 | Bacteria | 11788 |
| 240 | Ga0182005_1004597 | 3300015265 | Bacteria | 4430 |
| 241 | Ga0182005_1009656 | 3300015265 | Bacteria | 2800 |
| 242 | Ga0163161_10005751 | 3300017792 | Bacteria | 8592 |
| 243 | Ga0163161_10007960 | 3300017792 | Bacteria | 7333 |
| 244 | Ga0163161_10198269 | 3300017792 | Bacteria | 1546 |
| 245 | Ga0206356_11511824 | 3300020070 | Bacteria | 1655 |
| 246 | Ga0206356_11757027 | 3300020070 | Bacteria | 1259 |
| 247 | Ga0206351_10803103 | 3300020077 | Bacteria | 3229 |
| 248 | Ga0206352_10117821 | 3300020078 | Bacteria | 2825 |
| 249 | Ga0206354_10084669 | 3300020081 | Bacteria | 1518 |
| 250 | Ga0206354_10440027 | 3300020081 | Bacteria | 944 |
| 251 | Ga0206353_10964244 | 3300020082 | Bacteria | 3445 |
| 252 | Ga0154015_1188516 | 3300020610 | Bacteria | 4382 |
| 253 | Ga0213872_10003040 | 3300021361 | Bacteria | 9463 |
| 254 | Ga0213872_10052683 | 3300021361 | Bacteria | 1846 |
| 255 | Ga0213874_10204541 | 3300021377 | Bacteria | 712 |
| 256 | Ga0213876_10113987 | 3300021384 | Bacteria | 1435 |
| 257 | Ga0209674_101868 | 3300025226 | Bacteria | 4983 |
| 258 | Ga0209437_102902 | 3300025233 | Bacteria | 3202 |
| 259 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 260 | Ga0207425_1000070 | 3300025245 | Bacteria | 116438 |
| 261 | Ga0207425_1000950 | 3300025245 | Bacteria | 13726 |
| 262 | Ga0209026_1001092 | 3300025250 | Bacteria | 13010 |
| 263 | Ga0209148_1001455 | 3300025254 | Bacteria | 11982 |
| 264 | Ga0209759_1004246 | 3300025256 | Bacteria | 5409 |
| 265 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 266 | Ga0209129_1000172 | 3300025258 | Bacteria | 95144 |
| 267 | Ga0209129_1000232 | 3300025258 | Bacteria | 61645 |
| 268 | Ga0209129_1000647 | 3300025258 | Bacteria | 23358 |
| 269 | Ga0209233_1021961 | 3300025261 | Bacteria | 1642 |
| 270 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 271 | Ga0209565_1006338 | 3300025263 | Bacteria | 3327 |
| 272 | Ga0209455_1000766 | 3300025272 | Bacteria | 18068 |
| 273 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 274 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 275 | Ga0209673_1004973 | 3300025273 | Bacteria | 6892 |
| 276 | Ga0209130_1004306 | 3300025284 | Bacteria | 5492 |
| 277 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 278 | Ga0209675_1005833 | 3300025291 | Bacteria | 5061 |
| 279 | Ga0209675_1022564 | 3300025291 | Bacteria | 1650 |
| 280 | Ga0209676_1000128 | 3300025292 | Bacteria | 188099 |
| 281 | Ga0209676_1000196 | 3300025292 | Bacteria | 135726 |
| 282 | Ga0209676_1000225 | 3300025292 | Bacteria | 124018 |
| 283 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 284 | Ga0209676_1001452 | 3300025292 | Bacteria | 22273 |
| 285 | Ga0209676_1001467 | 3300025292 | Bacteria | 21936 |
| 286 | Ga0209676_1002185 | 3300025292 | Bacteria | 14659 |
| 287 | Ga0209676_1002212 | 3300025292 | Bacteria | 14505 |
| 288 | Ga0209676_1003114 | 3300025292 | Bacteria | 10656 |
| 289 | Ga0209676_1008591 | 3300025292 | Bacteria | 4529 |
| 290 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 291 | Ga0209025_1000083 | 3300025294 | Bacteria | 265556 |
| 292 | Ga0209025_1001945 | 3300025294 | Bacteria | 23845 |
| 293 | Ga0209025_1006637 | 3300025294 | Bacteria | 8900 |
| 294 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 295 | Ga0209564_1000036 | 3300025295 | Bacteria | 423455 |
| 296 | Ga0209564_1022642 | 3300025295 | Bacteria | 2211 |
| 297 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 298 | Ga0209758_1000090 | 3300025297 | Bacteria | 246564 |
| 299 | Ga0209758_1001782 | 3300025297 | Bacteria | 23823 |
| 300 | Ga0209758_1019590 | 3300025297 | Bacteria | 3255 |
| 301 | Ga0209758_1054420 | 3300025297 | Bacteria | 1367 |
| 302 | Ga0209758_1066704 | 3300025297 | Bacteria | 1154 |
| 303 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 304 | Ga0209050_1001118 | 3300025298 | Bacteria | 32421 |
| 305 | Ga0209050_1001542 | 3300025298 | Bacteria | 24144 |
| 306 | Ga0209050_1008975 | 3300025298 | Bacteria | 5213 |
| 307 | Ga0209050_1010537 | 3300025298 | Bacteria | 4540 |
| 308 | Ga0209050_1026358 | 3300025298 | Bacteria | 1947 |
| 309 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 310 | Ga0209256_1000091 | 3300025299 | Bacteria | 210945 |
| 311 | Ga0209256_1000477 | 3300025299 | Bacteria | 59886 |
| 312 | Ga0209256_1002799 | 3300025299 | Bacteria | 13356 |
| 313 | Ga0209256_1004756 | 3300025299 | Bacteria | 8287 |
| 314 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 315 | Ga0207426_1018654 | 3300025302 | Bacteria | 2441 |
| 316 | Ga0207426_1041846 | 3300025302 | Bacteria | 1417 |
| 317 | Ga0209051_1005647 | 3300025303 | Bacteria | 7244 |
| 318 | Ga0209051_1017203 | 3300025303 | Bacteria | 3237 |
| 319 | Ga0209051_1032710 | 3300025303 | Bacteria | 1979 |
| 320 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 321 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 322 | Ga0209257_1000155 | 3300025304 | Bacteria | 182928 |
| 323 | Ga0209257_1000208 | 3300025304 | Bacteria | 141393 |
| 324 | Ga0209257_1000737 | 3300025304 | Bacteria | 49659 |
| 325 | Ga0209257_1000846 | 3300025304 | Bacteria | 43824 |
| 326 | Ga0209257_1020284 | 3300025304 | Bacteria | 2463 |
| 327 | Ga0209257_1040888 | 3300025304 | Bacteria | 1379 |
| 328 | Ga0209257_1045513 | 3300025304 | Bacteria | 1274 |
| 329 | Ga0209257_1056445 | 3300025304 | Bacteria | 1084 |
| 330 | Ga0207656_10022892 | 3300025321 | Bacteria | 2510 |
| 331 | Ga0207656_10086488 | 3300025321 | Bacteria | 1417 |
| 332 | Ga0207696_1000181 | 3300025711 | Bacteria | 98281 |
| 333 | Ga0207655_1003240 | 3300025728 | Bacteria | 12217 |
| 334 | Ga0207655_1034076 | 3300025728 | Bacteria | 2294 |
| 335 | Ga0207713_1000393 | 3300025735 | Bacteria | 47322 |
| 336 | Ga0207710_10003656 | 3300025900 | Bacteria | 6820 |
| 337 | Ga0207710_10144941 | 3300025900 | Bacteria | 1149 |
| 338 | Ga0207688_10345180 | 3300025901 | Bacteria | 916 |
| 339 | Ga0207680_10000013 | 3300025903 | Bacteria | 244716 |
| 340 | Ga0207647_10005263 | 3300025904 | Bacteria | 9520 |
| 341 | Ga0207647_10030288 | 3300025904 | Bacteria | 3492 |
| 342 | Ga0207647_10181630 | 3300025904 | Bacteria | 1222 |
| 343 | Ga0207685_10076528 | 3300025905 | Bacteria | 1372 |
| 344 | Ga0207699_10365875 | 3300025906 | Bacteria | 1021 |
| 345 | Ga0207705_10004077 | 3300025909 | Bacteria | 11089 |
| 346 | Ga0207705_10023168 | 3300025909 | Bacteria | 4429 |
| 347 | Ga0207705_10026499 | 3300025909 | Bacteria | 4133 |
| 348 | Ga0207705_10181359 | 3300025909 | Bacteria | 1589 |
| 349 | Ga0207705_10342909 | 3300025909 | Bacteria | 1150 |
| 350 | Ga0207654_10501962 | 3300025911 | Bacteria | 857 |
| 351 | Ga0207707_10000181 | 3300025912 | Bacteria | 66031 |
| 352 | Ga0207707_10000203 | 3300025912 | Bacteria | 63383 |
| 353 | Ga0207707_10000846 | 3300025912 | Bacteria | 29949 |
| 354 | Ga0207707_10006900 | 3300025912 | Bacteria | 9907 |
| 355 | Ga0207707_10008967 | 3300025912 | Bacteria | 8690 |
| 356 | Ga0207707_10013258 | 3300025912 | Bacteria | 7182 |
| 357 | Ga0207695_10000654 | 3300025913 | Bacteria | 68735 |
| 358 | Ga0207695_10002351 | 3300025913 | Bacteria | 28102 |
| 359 | Ga0207695_10006761 | 3300025913 | Bacteria | 14788 |
| 360 | Ga0207695_10014947 | 3300025913 | Bacteria | 9161 |
| 361 | Ga0207695_10023535 | 3300025913 | Bacteria | 6956 |
| 362 | Ga0207671_10000726 | 3300025914 | Bacteria | 41902 |
| 363 | Ga0207671_10004748 | 3300025914 | Bacteria | 12824 |
| 364 | Ga0207671_10148244 | 3300025914 | Bacteria | 1811 |
| 365 | Ga0207693_10020467 | 3300025915 | Bacteria | 5262 |
| 366 | Ga0207660_10000324 | 3300025917 | Bacteria | 30906 |
| 367 | Ga0207660_10005067 | 3300025917 | Bacteria | 8579 |
| 368 | Ga0207660_10016000 | 3300025917 | Bacteria | 4958 |
| 369 | Ga0207660_10036732 | 3300025917 | Bacteria | 3407 |
| 370 | Ga0207660_10062321 | 3300025917 | Bacteria | 2686 |
| 371 | Ga0207657_10008206 | 3300025919 | Bacteria | 10637 |
| 372 | Ga0207657_10084586 | 3300025919 | Bacteria | 2658 |
| 373 | Ga0207649_10000835 | 3300025920 | Bacteria | 19841 |
| 374 | Ga0207649_10004317 | 3300025920 | Bacteria | 7725 |
| 375 | Ga0207649_10048759 | 3300025920 | Bacteria | 2613 |
| 376 | Ga0207649_10198589 | 3300025920 | Bacteria | 1415 |
| 377 | Ga0207652_10000017 | 3300025921 | Bacteria | 188391 |
| 378 | Ga0207652_10000726 | 3300025921 | Bacteria | 32004 |
| 379 | Ga0207652_10000759 | 3300025921 | Bacteria | 31000 |
| 380 | Ga0207652_10021521 | 3300025921 | Bacteria | 5322 |
| 381 | Ga0207652_10025885 | 3300025921 | Bacteria | 4881 |
| 382 | Ga0207694_10000122 | 3300025924 | Bacteria | 82443 |
| 383 | Ga0207694_10335999 | 3300025924 | Bacteria | 1249 |
| 384 | Ga0207650_10060634 | 3300025925 | Bacteria | 2823 |
| 385 | Ga0207687_10698688 | 3300025927 | Bacteria | 861 |
| 386 | Ga0207644_10067091 | 3300025931 | Bacteria | 2614 |
| 387 | Ga0207690_10001833 | 3300025932 | Bacteria | 13050 |
| 388 | Ga0207690_10026773 | 3300025932 | Bacteria | 3635 |
| 389 | Ga0207690_10084247 | 3300025932 | Bacteria | 2228 |
| 390 | Ga0207690_10104732 | 3300025932 | Bacteria | 2027 |
| 391 | Ga0207706_10017778 | 3300025933 | Bacteria | 6403 |
| 392 | Ga0207686_10149641 | 3300025934 | Bacteria | 1624 |
| 393 | Ga0207665_10018144 | 3300025939 | Bacteria | 4624 |
| 394 | Ga0207691_10049529 | 3300025940 | Bacteria | 3849 |
| 395 | Ga0207691_10202201 | 3300025940 | Bacteria | 1728 |
| 396 | Ga0207711_10025799 | 3300025941 | Bacteria | 4928 |
| 397 | Ga0207661_10018367 | 3300025944 | Bacteria | 5194 |
| 398 | Ga0207661_10027627 | 3300025944 | Bacteria | 4336 |
| 399 | Ga0207661_10168236 | 3300025944 | Bacteria | 1906 |
| 400 | Ga0207679_10014117 | 3300025945 | Bacteria | 5243 |
| 401 | Ga0207679_10208455 | 3300025945 | Bacteria | 1637 |
| 402 | Ga0207667_10000447 | 3300025949 | Bacteria | 55327 |
| 403 | Ga0207667_10000489 | 3300025949 | Bacteria | 52384 |
| 404 | Ga0207667_10055913 | 3300025949 | Bacteria | 4147 |
| 405 | Ga0207667_10144688 | 3300025949 | Bacteria | 2447 |
| 406 | Ga0207667_10174887 | 3300025949 | Bacteria | 2206 |
| 407 | Ga0207667_10203544 | 3300025949 | Bacteria | 2030 |
| 408 | Ga0207667_10497627 | 3300025949 | Bacteria | 1237 |
| 409 | Ga0207667_10805369 | 3300025949 | Bacteria | 936 |
| 410 | Ga0207668_10162988 | 3300025972 | Bacteria | 1739 |
| 411 | Ga0207640_10006018 | 3300025981 | Bacteria | 6629 |
| 412 | Ga0207640_10117635 | 3300025981 | Bacteria | 1897 |
| 413 | Ga0207640_10241125 | 3300025981 | Bacteria | 1397 |
| 414 | Ga0207640_10494080 | 3300025981 | Bacteria | 1018 |
| 415 | Ga0207658_10191811 | 3300025986 | Bacteria | 1699 |
| 416 | Ga0207703_10463520 | 3300026035 | Bacteria | 1185 |
| 417 | Ga0207703_11035931 | 3300026035 | Bacteria | 788 |
| 418 | Ga0207639_10012653 | 3300026041 | Bacteria | 5882 |
| 419 | Ga0207639_10029105 | 3300026041 | Bacteria | 4041 |
| 420 | Ga0207639_10080835 | 3300026041 | Bacteria | 2572 |
| 421 | Ga0207639_10444592 | 3300026041 | Bacteria | 1176 |
| 422 | Ga0207678_10012569 | 3300026067 | Bacteria | 7439 |
| 423 | Ga0207678_10122410 | 3300026067 | Bacteria | 2220 |
| 424 | Ga0207678_10310626 | 3300026067 | Bacteria | 1355 |
| 425 | Ga0207678_10388867 | 3300026067 | Bacteria | 1206 |
| 426 | Ga0207678_10393108 | 3300026067 | Bacteria | 1200 |
| 427 | Ga0207702_10000456 | 3300026078 | Bacteria | 46149 |
| 428 | Ga0207702_10008032 | 3300026078 | Bacteria | 8929 |
| 429 | Ga0207702_10025487 | 3300026078 | Bacteria | 4908 |
| 430 | Ga0207702_10068668 | 3300026078 | Bacteria | 3045 |
| 431 | Ga0207702_10146846 | 3300026078 | Bacteria | 2141 |
| 432 | Ga0207702_10199378 | 3300026078 | Bacteria | 1854 |
| 433 | Ga0207648_10651237 | 3300026089 | Bacteria | 974 |
| 434 | Ga0207674_10000341 | 3300026116 | Bacteria | 60004 |
| 435 | Ga0207674_10039137 | 3300026116 | Bacteria | 4917 |
| 436 | Ga0207674_10063158 | 3300026116 | Bacteria | 3738 |
| 437 | Ga0207674_10087758 | 3300026116 | Bacteria | 3104 |
| 438 | Ga0207674_10548626 | 3300026116 | Bacteria | 1117 |
| 439 | Ga0207675_100478257 | 3300026118 | Bacteria | 1238 |
| 440 | Ga0207683_10112193 | 3300026121 | Bacteria | 2442 |
| 441 | Ga0207698_10001385 | 3300026142 | Bacteria | 14093 |
| 442 | Ga0207698_10002975 | 3300026142 | Bacteria | 10154 |
| 443 | Ga0207698_10118065 | 3300026142 | Bacteria | 2239 |
| 444 | Ga0207698_10322420 | 3300026142 | Bacteria | 1447 |
| 445 | Ga0207698_11077752 | 3300026142 | Bacteria | 816 |
| 446 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 447 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 448 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 449 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 450 | Ga0268266_10177480 | 3300028379 | Bacteria | 1937 |
| 451 | Ga0268265_10216500 | 3300028380 | Bacteria | 1673 |
| 452 | Ga0268264_10249649 | 3300028381 | Bacteria | 1648 |
| 453 | Ga0265337_1003670 | 3300028556 | Bacteria | 6575 |
| 454 | Ga0265326_10003092 | 3300028558 | Bacteria | 5516 |
| 455 | Ga0265319_1000598 | 3300028563 | Bacteria | 24079 |
| 456 | Ga0265334_10000692 | 3300028573 | Bacteria | 16893 |
| 457 | Ga0265318_10005512 | 3300028577 | Bacteria | 5939 |
| 458 | Ga0265323_10000487 | 3300028653 | Bacteria | 22352 |
| 459 | Ga0265336_10001123 | 3300028666 | Bacteria | 12840 |
| 460 | Ga0307515_10327313 | 3300028794 | Bacteria | 1193 |
| 461 | Ga0265338_10000094 | 3300028800 | Bacteria | 168366 |
| 462 | Ga0265324_10001770 | 3300029957 | Bacteria | 11823 |
| 463 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 464 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 465 | Ga0316176_1040965 | 3300030732 | Bacteria | 3598 |
| 466 | Ga0316183_1037672 | 3300030742 | Bacteria | 3234 |
| 467 | Ga0316182_1113340 | 3300030745 | Bacteria | 1590 |
| 468 | Ga0265339_10010885 | 3300031249 | Bacteria | 5624 |
| 469 | Ga0265331_10124406 | 3300031250 | Bacteria | 1178 |
| 470 | Ga0265316_10006562 | 3300031344 | Bacteria | 11097 |
| 471 | Ga0307513_10304043 | 3300031456 | Bacteria | 1360 |
| 472 | Ga0307509_10261629 | 3300031507 | Bacteria | 1505 |
| 473 | Ga0307509_10262360 | 3300031507 | Bacteria | 1502 |
| 474 | Ga0307408_100006936 | 3300031548 | Bacteria | 7498 |
| 475 | Ga0265313_10000181 | 3300031595 | Bacteria | 67263 |
| 476 | Ga0265342_10073510 | 3300031712 | Bacteria | 1988 |
| 477 | Ga0307405_10008120 | 3300031731 | Bacteria | 5302 |
| 478 | Ga0307405_10218475 | 3300031731 | Bacteria | 1397 |
| 479 | Ga0307413_10224612 | 3300031824 | Bacteria | 1374 |
| 480 | Ga0307412_10000575 | 3300031911 | Bacteria | 21817 |
| 481 | Ga0307412_10001031 | 3300031911 | Bacteria | 15911 |
| 482 | Ga0307414_10116095 | 3300032004 | Bacteria | 2048 |
| 483 | Ga0307414_10325666 | 3300032004 | Bacteria | 1309 |
| 484 | Ga0307411_10534239 | 3300032005 | Bacteria | 998 |
| 485 | Ga0307415_100031417 | 3300032126 | Bacteria | 3421 |
| 486 | Ga0307510_10003060 | 3300033180 | Bacteria | 19310 |
| 487 | Ga0307510_10155503 | 3300033180 | Bacteria | 1894 |
| 488 | Ga0373939_0135111 | 3300035114 | Bacteria | 884 |
| 489 | Ga0395899_0000086 | 3300037312 | Bacteria | 157725 |
| 490 | Ga0395900_0046132 | 3300037418 | Bacteria | 4487 |
| 491 | Ga0395900_0097263 | 3300037418 | Bacteria | 3024 |
| 492 | Ga0395900_0749780 | 3300037418 | Bacteria | 907 |
| 493 | Ga0395898_0115774 | 3300037466 | Bacteria | 2568 |
| 494 | Ga0395898_0266007 | 3300037466 | Bacteria | 1635 |
| 495 | Ga0395905_0146690 | 3300037471 | Bacteria | 2220 |
| 496 | Ga0395905_0199330 | 3300037471 | Bacteria | 1877 |
| 497 | Ga0395901_0000263 | 3300038443 | Bacteria | 65735 |
| 498 | Ga0395901_0030291 | 3300038443 | Bacteria | 5574 |
| 499 | Ga0395901_1296731 | 3300038443 | Bacteria | 690 |
| 500 | Ga0237819_00145 | 3300038705 | Bacteria | 26084 |
| 501 | Ga0237819_12915 | 3300038705 | Bacteria | 1020 |
| 502 | Ga0237816_03427 | 3300039145 | Bacteria | 1161 |
| 503 | Ga0436361_0022175 | 3300039447 | Bacteria | 2302 |
| 504 | Ga0436361_0170645 | 3300039447 | Bacteria | 9136 |
| 505 | Ga0436361_0673292 | 3300039447 | Bacteria | 2911 |
| 506 | Ga0436361_0795199 | 3300039447 | Bacteria | 71391 |
| 507 | Ga0436361_0835169 | 3300039447 | Bacteria | 5290 |
| 508 | Ga0436361_1083332 | 3300039447 | Bacteria | 905 |
| 509 | Ga0439436_0000004 | 3300041404 | Bacteria | 175137 |
| 510 | Ga0439439_0027845 | 3300041406 | Bacteria | 1429 |
| 511 | Ga0439461_0000338 | 3300041410 | Bacteria | 6676 |
| 512 | Ga0439465_0001362 | 3300041413 | Bacteria | 7874 |
| 513 | Ga0439465_0012861 | 3300041413 | Bacteria | 2616 |
| 514 | Ga0451793_0151939 | 3300041452 | Bacteria | 1983 |
| 515 | Ga0451798_0004380 | 3300041458 | Bacteria | 1709 |
| 516 | Ga0451800_0510821 | 3300041459 | Bacteria | 768 |
| 517 | Ga0451800_1204646 | 3300041459 | Bacteria | 7949 |
| 518 | Ga0451806_700263 | 3300041462 | Bacteria | 8682 |
| 519 | Ga0451804_0156193 | 3300041463 | Bacteria | 5411 |
| 520 | Ga0451807_0057674 | 3300041486 | Bacteria | 4378 |
| 521 | Ga0451845_0500926 | 3300041501 | Bacteria | 1503 |
| 522 | Ga0439431_0006417 | 3300041997 | Bacteria | 2600 |
| 523 | Ga0439442_002014 | 3300042002 | Bacteria | 3995 |
| 524 | Ga0439445_0000584 | 3300042004 | Bacteria | 7463 |
| 525 | Ga0439432_001838 | 3300042006 | Bacteria | 7972 |
| 526 | Ga0439462_0001500 | 3300042015 | Bacteria | 5213 |
| 527 | Ga0439434_0000210 | 3300042435 | Bacteria | 16132 |
| 528 | Ga0451577_0004095 | 3300042876 | Bacteria | 15657 |
| 529 | Ga0466969_0299580 | 3300044656 | Bacteria | 728 |
| 530 | Ga0466972_0087501 | 3300044658 | Bacteria | 1480 |
| 531 | Ga0466965_0312279 | 3300044683 | Bacteria | 855 |
| 532 | Ga0453684_0320696 | 3300044712 | Bacteria | 1755 |
| 533 | Ga0466968_0018240 | 3300044735 | Bacteria | 2813 |
| 534 | Ga0466968_0032371 | 3300044735 | Bacteria | 2174 |
| 535 | Ga0466957_0065217 | 3300044842 | Bacteria | 2242 |
| 536 | Ga0495617_000018 | 3300046452 | Bacteria | 248300 |
| 537 | Ga0495617_000071 | 3300046452 | Bacteria | 83031 |
| 538 | Ga0495617_000222 | 3300046452 | Bacteria | 34541 |
| 539 | Ga0495627_007672 | 3300046453 | Bacteria | 4118 |
| 540 | Ga0495627_052017 | 3300046453 | Bacteria | 1229 |
| 541 | Ga0495603_0214038 | 3300046455 | Bacteria | 1112 |
| 542 | Ga0495590_0001652 | 3300046457 | Bacteria | 9510 |
| 543 | Ga0495590_0031634 | 3300046457 | Bacteria | 1852 |
| 544 | Ga0495590_0046903 | 3300046457 | Bacteria | 1507 |
| 545 | Ga0495638_0000041 | 3300046460 | Bacteria | 235584 |
| 546 | Ga0495638_0001219 | 3300046460 | Bacteria | 24403 |
| 547 | Ga0495638_0003487 | 3300046460 | Bacteria | 12359 |
| 548 | Ga0495638_0025571 | 3300046460 | Bacteria | 3835 |
| 549 | Ga0495653_0123525 | 3300046463 | Bacteria | 1841 |
| 550 | Ga0495650_0000067 | 3300046471 | Bacteria | 269882 |
| 551 | Ga0495650_0000170 | 3300046471 | Bacteria | 143177 |
| 552 | Ga0495650_0000920 | 3300046471 | Bacteria | 34562 |
| 553 | Ga0495650_0000932 | 3300046471 | Bacteria | 33965 |
| 554 | Ga0495650_0001241 | 3300046471 | Bacteria | 26496 |
| 555 | Ga0495650_0051957 | 3300046471 | Bacteria | 1685 |
| 556 | Ga0495650_0116780 | 3300046471 | Bacteria | 985 |
| 557 | Ga0495582_0040520 | 3300046473 | Bacteria | 2565 |
| 558 | Ga0495605_0000107 | 3300046474 | Bacteria | 105085 |
| 559 | Ga0495605_0074648 | 3300046474 | Bacteria | 1596 |
| 560 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 561 | Ga0495584_0002229 | 3300046491 | Bacteria | 11057 |
| 562 | Ga0495585_0000003 | 3300046492 | Bacteria | 406344 |
| 563 | Ga0495585_0000008 | 3300046492 | Bacteria | 278949 |
| 564 | Ga0495585_0000303 | 3300046492 | Bacteria | 49270 |
| 565 | Ga0495585_0002320 | 3300046492 | Bacteria | 13712 |
| 566 | Ga0495585_0096768 | 3300046492 | Bacteria | 1583 |
| 567 | Ga0495594_0078129 | 3300046499 | Bacteria | 1846 |
| 568 | Ga0495594_0089973 | 3300046499 | Bacteria | 1719 |
| 569 | Ga0495594_0177404 | 3300046499 | Bacteria | 1212 |
| 570 | Ga0495607_0000141 | 3300046501 | Bacteria | 75379 |
| 571 | Ga0495607_0018714 | 3300046501 | Bacteria | 4407 |
| 572 | Ga0495607_0066061 | 3300046501 | Bacteria | 2037 |
| 573 | Ga0495607_0280906 | 3300046501 | Bacteria | 790 |
| 574 | Ga0495583_0006252 | 3300046506 | Bacteria | 7833 |
| 575 | Ga0495583_0022480 | 3300046506 | Bacteria | 3216 |
| 576 | Ga0495583_0050191 | 3300046506 | Bacteria | 1907 |
| 577 | Ga0495606_0000117 | 3300046507 | Bacteria | 134593 |
| 578 | Ga0495606_0000118 | 3300046507 | Bacteria | 134504 |
| 579 | Ga0495606_0001825 | 3300046507 | Bacteria | 26986 |
| 580 | Ga0495606_0009523 | 3300046507 | Bacteria | 8205 |
| 581 | Ga0495606_0040331 | 3300046507 | Bacteria | 3138 |
| 582 | Ga0495606_0088286 | 3300046507 | Bacteria | 1912 |
| 583 | Ga0495606_0303889 | 3300046507 | Bacteria | 863 |
| 584 | Ga0495606_0334266 | 3300046507 | Bacteria | 809 |
| 585 | Ga0495610_0000012 | 3300046512 | Bacteria | 517442 |
| 586 | Ga0495610_0000250 | 3300046512 | Bacteria | 56512 |
| 587 | Ga0495610_0000261 | 3300046512 | Bacteria | 55310 |
| 588 | Ga0495610_0000303 | 3300046512 | Bacteria | 51903 |
| 589 | Ga0495610_0002368 | 3300046512 | Bacteria | 15929 |
| 590 | Ga0495610_0049710 | 3300046512 | Bacteria | 2052 |
| 591 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 592 | Ga0495616_0000002 | 3300046513 | Bacteria | 297337 |
| 593 | Ga0495616_0000228 | 3300046513 | Bacteria | 46105 |
| 594 | Ga0495616_0001259 | 3300046513 | Bacteria | 17823 |
| 595 | Ga0495616_0007214 | 3300046513 | Bacteria | 6662 |
| 596 | Ga0495620_0000008 | 3300046515 | Bacteria | 186489 |
| 597 | Ga0495620_0022151 | 3300046515 | Bacteria | 3068 |
| 598 | Ga0495620_0027255 | 3300046515 | Bacteria | 2676 |
| 599 | Ga0495630_0095365 | 3300046517 | Bacteria | 2250 |
| 600 | Ga0495630_0371981 | 3300046517 | Bacteria | 1094 |
| 601 | Ga0495631_0000001 | 3300046518 | Bacteria | 216492 |
| 602 | Ga0495631_0000093 | 3300046518 | Bacteria | 59068 |
| 603 | Ga0495632_0000196 | 3300046519 | Bacteria | 61287 |
| 604 | Ga0495632_0001811 | 3300046519 | Bacteria | 17226 |
| 605 | Ga0495632_0007983 | 3300046519 | Bacteria | 6569 |
| 606 | Ga0495632_0085766 | 3300046519 | Bacteria | 1498 |
| 607 | Ga0495637_0000342 | 3300046520 | Bacteria | 35805 |
| 608 | Ga0495637_0019179 | 3300046520 | Bacteria | 3163 |
| 609 | Ga0495637_0085954 | 3300046520 | Bacteria | 1247 |
| 610 | Ga0495643_0000341 | 3300046522 | Bacteria | 63337 |
| 611 | Ga0495643_0167060 | 3300046522 | Bacteria | 1078 |
| 612 | Ga0495648_0000063 | 3300046524 | Bacteria | 147540 |
| 613 | Ga0495648_0000171 | 3300046524 | Bacteria | 74494 |
| 614 | Ga0495648_0012310 | 3300046524 | Bacteria | 6389 |
| 615 | Ga0495648_0053226 | 3300046524 | Bacteria | 2453 |
| 616 | Ga0495648_0122160 | 3300046524 | Bacteria | 1398 |
| 617 | Ga0495648_0127445 | 3300046524 | Bacteria | 1358 |
| 618 | Ga0495648_0176545 | 3300046524 | Bacteria | 1090 |
| 619 | Ga0495648_0192516 | 3300046524 | Bacteria | 1028 |
| 620 | Ga0495663_0042232 | 3300046525 | Bacteria | 1389 |
| 621 | Ga0495666_0007754 | 3300046526 | Bacteria | 5372 |
| 622 | Ga0495666_0012710 | 3300046526 | Bacteria | 4195 |
| 623 | Ga0495666_0271178 | 3300046526 | Bacteria | 770 |
| 624 | Ga0495642_0008640 | 3300046528 | Bacteria | 3893 |
| 625 | Ga0495642_0134275 | 3300046528 | Bacteria | 1066 |
| 626 | Ga0495652_0139886 | 3300046529 | Bacteria | 1904 |
| 627 | Ga0495652_0141168 | 3300046529 | Bacteria | 1894 |
| 628 | Ga0495654_0000011 | 3300046530 | Bacteria | 363172 |
| 629 | Ga0495654_0238031 | 3300046530 | Bacteria | 763 |
| 630 | Ga0495665_0000780 | 3300046531 | Bacteria | 16583 |
| 631 | Ga0495665_0005867 | 3300046531 | Bacteria | 6621 |
| 632 | Ga0495665_0105312 | 3300046531 | Bacteria | 1480 |
| 633 | Ga0495586_0019616 | 3300046535 | Bacteria | 3600 |
| 634 | Ga0495586_0148621 | 3300046535 | Bacteria | 1317 |
| 635 | Ga0495587_0067776 | 3300046536 | Bacteria | 2079 |
| 636 | Ga0495587_0085335 | 3300046536 | Bacteria | 1828 |
| 637 | Ga0495587_0110097 | 3300046536 | Bacteria | 1582 |
| 638 | Ga0495609_0008465 | 3300046538 | Bacteria | 5038 |
| 639 | Ga0495597_0036025 | 3300046542 | Bacteria | 2229 |
| 640 | Ga0495622_0021124 | 3300046557 | Bacteria | 3033 |
| 641 | Ga0495622_0187334 | 3300046557 | Bacteria | 926 |
| 642 | Ga0495633_0005961 | 3300046558 | Bacteria | 7322 |
| 643 | Ga0495633_0013550 | 3300046558 | Bacteria | 4291 |
| 644 | Ga0495633_0067299 | 3300046558 | Bacteria | 1672 |
| 645 | Ga0495633_0164170 | 3300046558 | Bacteria | 1024 |
| 646 | Ga0495656_0150867 | 3300046615 | Bacteria | 1122 |
| 647 | Ga0495668_0000137 | 3300046616 | Bacteria | 111150 |
| 648 | Ga0495668_0000983 | 3300046616 | Bacteria | 31139 |
| 649 | Ga0495668_0001476 | 3300046616 | Bacteria | 22557 |
| 650 | Ga0495668_0095350 | 3300046616 | Bacteria | 1628 |
| 651 | Ga0495668_0193207 | 3300046616 | Bacteria | 1115 |
| 652 | Ga0495634_0031183 | 3300046642 | Bacteria | 3673 |
| 653 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 654 | Ga0495611_0000097 | 3300046648 | Bacteria | 60484 |
| 655 | Ga0495611_0032636 | 3300046648 | Bacteria | 2295 |
| 656 | Ga0495611_0035087 | 3300046648 | Bacteria | 2220 |
| 657 | Ga0495611_0200438 | 3300046648 | Bacteria | 931 |
| 658 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 659 | Ga0495625_0009860 | 3300046660 | Bacteria | 7944 |
| 660 | Ga0495625_0013228 | 3300046660 | Bacteria | 6642 |
| 661 | Ga0495625_0017582 | 3300046660 | Bacteria | 5595 |
| 662 | Ga0495625_0025312 | 3300046660 | Bacteria | 4502 |
| 663 | Ga0495625_0054020 | 3300046660 | Bacteria | 2870 |
| 664 | Ga0495625_0075451 | 3300046660 | Bacteria | 2359 |
| 665 | Ga0495625_0110131 | 3300046660 | Bacteria | 1883 |
| 666 | Ga0495659_0000286 | 3300046664 | Bacteria | 20508 |
| 667 | Ga0495661_0001175 | 3300046665 | Bacteria | 22763 |
| 668 | Ga0495661_0087338 | 3300046665 | Bacteria | 1783 |
| 669 | Ga0495661_0108212 | 3300046665 | Bacteria | 1553 |
| 670 | Ga0495661_0206495 | 3300046665 | Bacteria | 1025 |
| 671 | Ga0495588_0034196 | 3300046674 | Bacteria | 2571 |
| 672 | Ga0495588_0083805 | 3300046674 | Bacteria | 1665 |
| 673 | Ga0495588_0117530 | 3300046674 | Bacteria | 1401 |
| 674 | Ga0495623_0016435 | 3300046679 | Bacteria | 4779 |
| 675 | Ga0495646_0325177 | 3300046680 | Bacteria | 809 |
| 676 | Ga0495613_0167018 | 3300046689 | Bacteria | 1563 |
| 677 | Ga0495624_0005352 | 3300046690 | Bacteria | 9257 |
| 678 | Ga0495670_0011181 | 3300046691 | Bacteria | 4412 |
| 679 | Ga0495670_0049212 | 3300046691 | Bacteria | 2108 |
| 680 | Ga0495670_0074370 | 3300046691 | Bacteria | 1723 |
| 681 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 682 | Ga0495671_0000163 | 3300046692 | Bacteria | 58489 |
| 683 | Ga0495671_0000598 | 3300046692 | Bacteria | 26613 |
| 684 | Ga0495671_0055817 | 3300046692 | Bacteria | 1956 |
| 685 | Ga0495671_0126603 | 3300046692 | Bacteria | 1245 |
| 686 | Ga0495649_0185523 | 3300046694 | Bacteria | 1084 |
| 687 | Ga0495649_0331677 | 3300046694 | Bacteria | 771 |
| 688 | Ga0495589_0000111 | 3300046794 | Bacteria | 77466 |
| 689 | Ga0495600_0037890 | 3300046809 | Bacteria | 3136 |
| 690 | Ga0495600_0073845 | 3300046809 | Bacteria | 2227 |
| 691 | Ga0495660_0000669 | 3300046810 | Bacteria | 26377 |
| 692 | Ga0495660_0000760 | 3300046810 | Bacteria | 24270 |
| 693 | Ga0495660_0004327 | 3300046810 | Bacteria | 8602 |
| 694 | Ga0495581_0039471 | 3300047315 | Bacteria | 2732 |
| 695 | Ga0495581_0059343 | 3300047315 | Bacteria | 2211 |
| 696 | Ga0495581_0113646 | 3300047315 | Bacteria | 1574 |
| 697 | Ga0495604_0077424 | 3300047317 | Bacteria | 2499 |
| 698 | Ga0495604_0343819 | 3300047317 | Bacteria | 993 |
| 699 | Ga0495674_0008731 | 3300047319 | Bacteria | 9638 |
| 700 | Ga0495672_0000023 | 3300047320 | Bacteria | 419080 |
| 701 | Ga0495672_0054754 | 3300047320 | Bacteria | 2329 |
| 702 | Ga0495672_0171919 | 3300047320 | Bacteria | 1104 |
| 703 | Ga0495676_0162272 | 3300047321 | Bacteria | 1580 |
| 704 | Ga0495680_0225456 | 3300047322 | Bacteria | 1336 |
| 705 | Ga0495683_0000468 | 3300047323 | Bacteria | 31520 |
| 706 | Ga0495683_0290085 | 3300047323 | Bacteria | 705 |
| 707 | Ga0495687_034441 | 3300047443 | Bacteria | 2288 |
| 708 | Ga0495675_0042443 | 3300047444 | Bacteria | 2897 |
| 709 | Ga0495675_0310952 | 3300047444 | Bacteria | 934 |
| 710 | Ga0495677_0039380 | 3300047445 | Bacteria | 1728 |
| 711 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 712 | Ga0495679_004248 | 3300047446 | Bacteria | 6655 |
| 713 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 714 | Ga0495673_0000050 | 3300047469 | Bacteria | 262267 |
| 715 | Ga0495673_0000062 | 3300047469 | Bacteria | 226461 |
| 716 | Ga0495673_0000283 | 3300047469 | Bacteria | 68581 |
| 717 | Ga0495673_0019046 | 3300047469 | Bacteria | 3446 |
| 718 | Ga0495673_0019288 | 3300047469 | Bacteria | 3418 |
| 719 | Ga0495673_0082015 | 3300047469 | Bacteria | 1334 |
| 720 | Ga0495673_0085027 | 3300047469 | Bacteria | 1303 |
| 721 | Ga0495681_0054898 | 3300047470 | Bacteria | 1860 |
| 722 | Ga0495681_0103540 | 3300047470 | Bacteria | 1241 |
| 723 | Ga0495686_0000028 | 3300047472 | Bacteria | 369493 |
| 724 | Ga0495686_0000068 | 3300047472 | Bacteria | 218060 |
| 725 | Ga0495686_0000164 | 3300047472 | Bacteria | 126101 |
| 726 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 727 | Ga0495686_0003752 | 3300047472 | Bacteria | 12924 |
| 728 | Ga0495686_0007171 | 3300047472 | Bacteria | 8392 |
| 729 | Ga0495686_0011381 | 3300047472 | Bacteria | 6271 |
| 730 | Ga0495686_0022911 | 3300047472 | Bacteria | 4126 |
| 731 | Ga0495686_0051119 | 3300047472 | Bacteria | 2594 |
| 732 | Ga0495686_0066613 | 3300047472 | Bacteria | 2225 |
| 733 | Ga0495686_0129929 | 3300047472 | Bacteria | 1494 |
| 734 | Ga0495593_0023745 | 3300047673 | Bacteria | 3404 |
| 735 | Ga0495602_0020013 | 3300048088 | Bacteria | 6624 |
| 736 | Ga0495602_0033930 | 3300048088 | Bacteria | 4781 |
| 737 | Ga0495602_0087077 | 3300048088 | Bacteria | 2605 |
| 738 | Ga0495614_0028898 | 3300048089 | Bacteria | 2387 |
| 739 | Ga0495615_0000440 | 3300048090 | Bacteria | 6099 |
| 740 | Ga0496100_0000969 | 3300048903 | Bacteria | 13774 |
| 741 | Ga0496100_0036158 | 3300048903 | Bacteria | 3112 |
| 742 | Ga0496100_0197319 | 3300048903 | Bacteria | 1465 |
| 743 | Ga0496101_0000134 | 3300048904 | Bacteria | 65710 |
| 744 | Ga0496101_0215785 | 3300048904 | Bacteria | 1488 |
| 745 | Ga0496101_0319910 | 3300048904 | Bacteria | 1217 |
| 746 | Ga0496101_0442365 | 3300048904 | Bacteria | 1025 |
| 747 | Ga0496102_0000181 | 3300048905 | Bacteria | 85605 |
| 748 | Ga0496102_0000315 | 3300048905 | Bacteria | 60883 |
| 749 | Ga0496102_0614110 | 3300048905 | Bacteria | 1010 |
| 750 | Ga0496103_0001484 | 3300048906 | Bacteria | 15672 |
| 751 | Ga0496103_0004132 | 3300048906 | Bacteria | 8813 |
| 752 | Ga0496103_0334834 | 3300048906 | Bacteria | 973 |
| 753 | Ga0496104_0104084 | 3300048907 | Bacteria | 2719 |
| 754 | Ga0496104_0189387 | 3300048907 | Bacteria | 1968 |
| 755 | Ga0496104_0216485 | 3300048907 | Bacteria | 1827 |
| 756 | Ga0496105_0001129 | 3300048908 | Bacteria | 18595 |
| 757 | Ga0496105_0014113 | 3300048908 | Bacteria | 6357 |
| 758 | Ga0496105_0025048 | 3300048908 | Bacteria | 4851 |
| 759 | Ga0496106_0170803 | 3300048909 | Bacteria | 1723 |
| 760 | Ga0496106_0644769 | 3300048909 | Bacteria | 846 |
| 761 | Ga0496107_0122689 | 3300048910 | Bacteria | 1914 |
| 762 | Ga0496107_0172724 | 3300048910 | Bacteria | 1604 |
| 763 | Ga0496108_0056207 | 3300048911 | Bacteria | 3306 |
| 764 | Ga0496108_0727153 | 3300048911 | Bacteria | 860 |
| 765 | Ga0496108_1003661 | 3300048911 | Bacteria | 713 |
| 766 | Ga0496109_0118637 | 3300048912 | Bacteria | 2463 |
| 767 | Ga0496109_0978616 | 3300048912 | Bacteria | 784 |
| 768 | Ga0496110_0112716 | 3300048913 | Bacteria | 2445 |
| 769 | Ga0496110_0789013 | 3300048913 | Bacteria | 854 |
| 770 | Ga0496110_0971428 | 3300048913 | Bacteria | 756 |
| 771 | Ga0496111_0094542 | 3300048914 | Bacteria | 2192 |
| 772 | Ga0496111_0191031 | 3300048914 | Bacteria | 1522 |
| 773 | Ga0496112_0032873 | 3300048915 | Bacteria | 5037 |
| 774 | Ga0496113_0005357 | 3300048916 | Bacteria | 7995 |
| 775 | Ga0496114_0007473 | 3300048917 | Bacteria | 8640 |
| 776 | Ga0496114_0371498 | 3300048917 | Bacteria | 1266 |
| 777 | Ga0496114_0652438 | 3300048917 | Bacteria | 925 |
| 778 | Ga0496115_0007853 | 3300048918 | Bacteria | 7869 |
| 779 | Ga0496115_0445070 | 3300048918 | Bacteria | 1047 |
| 780 | Ga0496116_0005234 | 3300048919 | Bacteria | 12129 |
| 781 | Ga0496116_0008944 | 3300048919 | Bacteria | 8615 |
| 782 | Ga0496116_0027637 | 3300048919 | Bacteria | 4127 |
| 783 | Ga0496116_0074369 | 3300048919 | Bacteria | 2137 |
| 784 | Ga0496116_0130584 | 3300048919 | Bacteria | 1433 |
| 785 | Ga0496116_0170428 | 3300048919 | Bacteria | 1180 |
| 786 | Ga0496116_0194811 | 3300048919 | Bacteria | 1068 |
| 787 | Ga0496116_0198881 | 3300048919 | Bacteria | 1051 |
| 788 | Ga0496116_0222156 | 3300048919 | Bacteria | 967 |
| 789 | Ga0496117_0000484 | 3300048920 | Bacteria | 65863 |
| 790 | Ga0496117_0001420 | 3300048920 | Bacteria | 34726 |
| 791 | Ga0496117_0004049 | 3300048920 | Bacteria | 16474 |
| 792 | Ga0496117_0004800 | 3300048920 | Bacteria | 14649 |
| 793 | Ga0496117_0004899 | 3300048920 | Bacteria | 14419 |
| 794 | Ga0496117_0016813 | 3300048920 | Bacteria | 6147 |
| 795 | Ga0496117_0018675 | 3300048920 | Bacteria | 5731 |
| 796 | Ga0496117_0165643 | 3300048920 | Bacteria | 1289 |
| 797 | Ga0496118_0000135 | 3300048921 | Bacteria | 130330 |
| 798 | Ga0496118_0000486 | 3300048921 | Bacteria | 65791 |
| 799 | Ga0496118_0001019 | 3300048921 | Bacteria | 43569 |
| 800 | Ga0496118_0011231 | 3300048921 | Bacteria | 8768 |
| 801 | Ga0496118_0011915 | 3300048921 | Bacteria | 8416 |
| 802 | Ga0496118_0032231 | 3300048921 | Bacteria | 4323 |
| 803 | Ga0496118_0045381 | 3300048921 | Bacteria | 3432 |
| 804 | Ga0496118_0063391 | 3300048921 | Bacteria | 2720 |
| 805 | Ga0496118_0101584 | 3300048921 | Bacteria | 1941 |
| 806 | Ga0496118_0116457 | 3300048921 | Bacteria | 1756 |
| 807 | Ga0496118_0126003 | 3300048921 | Bacteria | 1657 |
| 808 | Ga0496118_0153253 | 3300048921 | Bacteria | 1439 |
| 809 | Ga0496119_0001058 | 3300048922 | Bacteria | 35115 |
| 810 | Ga0496119_0001587 | 3300048922 | Bacteria | 27028 |
| 811 | Ga0496119_0004632 | 3300048922 | Bacteria | 13573 |
| 812 | Ga0496119_0012434 | 3300048922 | Bacteria | 6912 |
| 813 | Ga0496119_0036466 | 3300048922 | Bacteria | 3209 |
| 814 | Ga0496119_0036896 | 3300048922 | Bacteria | 3183 |
| 815 | Ga0496119_0038389 | 3300048922 | Bacteria | 3095 |
| 816 | Ga0496119_0049366 | 3300048922 | Bacteria | 2602 |
| 817 | Ga0496119_0058521 | 3300048922 | Bacteria | 2322 |
| 818 | Ga0496119_0282164 | 3300048922 | Bacteria | 825 |
| 819 | Ga0496120_0000313 | 3300048923 | Bacteria | 80663 |
| 820 | Ga0496120_0002147 | 3300048923 | Bacteria | 21033 |
| 821 | Ga0496120_0002531 | 3300048923 | Bacteria | 18257 |
| 822 | Ga0496120_0010752 | 3300048923 | Bacteria | 6346 |
| 823 | Ga0496120_0035630 | 3300048923 | Bacteria | 2970 |
| 824 | Ga0496120_0036565 | 3300048923 | Bacteria | 2921 |
| 825 | Ga0496120_0083080 | 3300048923 | Bacteria | 1730 |
| 826 | Ga0496120_0213239 | 3300048923 | Bacteria | 927 |
| 827 | Ga0496121_0000361 | 3300048924 | Bacteria | 93571 |
| 828 | Ga0496121_0000515 | 3300048924 | Bacteria | 73665 |
| 829 | Ga0496121_0000532 | 3300048924 | Bacteria | 72417 |
| 830 | Ga0496121_0000770 | 3300048924 | Bacteria | 58816 |
| 831 | Ga0496121_0001028 | 3300048924 | Bacteria | 49706 |
| 832 | Ga0496121_0008433 | 3300048924 | Bacteria | 12122 |
| 833 | Ga0496121_0023471 | 3300048924 | Bacteria | 5939 |
| 834 | Ga0496121_0033869 | 3300048924 | Bacteria | 4610 |
| 835 | Ga0496121_0050373 | 3300048924 | Bacteria | 3519 |
| 836 | Ga0496121_0059709 | 3300048924 | Bacteria | 3142 |
| 837 | Ga0496121_0063489 | 3300048924 | Bacteria | 3017 |
| 838 | Ga0496121_0077097 | 3300048924 | Bacteria | 2655 |
| 839 | Ga0496121_0134324 | 3300048924 | Bacteria | 1845 |
| 840 | Ga0496121_0140587 | 3300048924 | Bacteria | 1792 |
| 841 | Ga0496121_0145784 | 3300048924 | Bacteria | 1749 |
| 842 | Ga0496121_0557580 | 3300048924 | Bacteria | 715 |
| 843 | Ga0496122_0003345 | 3300048925 | Bacteria | 21155 |
| 844 | Ga0496122_0013233 | 3300048925 | Bacteria | 8093 |
| 845 | Ga0496122_0039578 | 3300048925 | Bacteria | 3758 |
| 846 | Ga0496122_0041456 | 3300048925 | Bacteria | 3639 |
| 847 | Ga0496122_0091290 | 3300048925 | Bacteria | 2074 |
| 848 | Ga0496122_0127937 | 3300048925 | Bacteria | 1621 |
| 849 | Ga0496122_0157445 | 3300048925 | Bacteria | 1391 |
| 850 | Ga0496122_0239470 | 3300048925 | Bacteria | 1024 |
| 851 | Ga0496122_0252598 | 3300048925 | Bacteria | 984 |
| 852 | Ga0496123_0001685 | 3300048926 | Bacteria | 29584 |
| 853 | Ga0496123_0002721 | 3300048926 | Bacteria | 21201 |
| 854 | Ga0496123_0007763 | 3300048926 | Bacteria | 10009 |
| 855 | Ga0496123_0041995 | 3300048926 | Bacteria | 3163 |
| 856 | Ga0496123_0052947 | 3300048926 | Bacteria | 2687 |
| 857 | Ga0496123_0062669 | 3300048926 | Bacteria | 2381 |
| 858 | Ga0496123_0140614 | 3300048926 | Bacteria | 1320 |
| 859 | Ga0496123_0266656 | 3300048926 | Bacteria | 836 |
| 860 | Ga0496123_0313962 | 3300048926 | Bacteria | 743 |
| 861 | Ga0496124_0006165 | 3300048927 | Bacteria | 13145 |
| 862 | Ga0496124_0012352 | 3300048927 | Bacteria | 8434 |
| 863 | Ga0496124_0028088 | 3300048927 | Bacteria | 5035 |
| 864 | Ga0496124_0041671 | 3300048927 | Bacteria | 3959 |
| 865 | Ga0496124_0089365 | 3300048927 | Bacteria | 2515 |
| 866 | Ga0496124_0095201 | 3300048927 | Bacteria | 2420 |
| 867 | Ga0496124_0156147 | 3300048927 | Bacteria | 1784 |
| 868 | Ga0496124_0184948 | 3300048927 | Bacteria | 1600 |
| 869 | Ga0496124_0190942 | 3300048927 | Bacteria | 1567 |
| 870 | Ga0496124_0198029 | 3300048927 | Bacteria | 1530 |
| 871 | Ga0496124_0343835 | 3300048927 | Bacteria | 1058 |
| 872 | Ga0496124_0344211 | 3300048927 | Bacteria | 1057 |
| 873 | Ga0496124_0414141 | 3300048927 | Bacteria | 931 |
| 874 | Ga0496125_0001513 | 3300048928 | Bacteria | 33304 |
| 875 | Ga0496125_0002637 | 3300048928 | Bacteria | 22956 |
| 876 | Ga0496125_0009701 | 3300048928 | Bacteria | 9831 |
| 877 | Ga0496125_0010823 | 3300048928 | Bacteria | 9185 |
| 878 | Ga0496125_0015861 | 3300048928 | Bacteria | 7258 |
| 879 | Ga0496125_0018703 | 3300048928 | Bacteria | 6569 |
| 880 | Ga0496125_0058999 | 3300048928 | Bacteria | 3095 |
| 881 | Ga0496125_0078631 | 3300048928 | Bacteria | 2534 |
| 882 | Ga0496125_0079049 | 3300048928 | Bacteria | 2525 |
| 883 | Ga0496126_0000581 | 3300048929 | Bacteria | 69541 |
| 884 | Ga0496126_0007075 | 3300048929 | Bacteria | 12358 |
| 885 | Ga0496126_0047998 | 3300048929 | Bacteria | 3906 |
| 886 | Ga0496126_0048208 | 3300048929 | Bacteria | 3895 |
| 887 | Ga0496126_0052739 | 3300048929 | Bacteria | 3694 |
| 888 | Ga0496126_0070369 | 3300048929 | Bacteria | 3117 |
| 889 | Ga0496126_0215948 | 3300048929 | Bacteria | 1613 |
| 890 | Ga0496126_0248031 | 3300048929 | Bacteria | 1485 |
| 891 | Ga0495678_000019 | 3300049459 | Bacteria | 269723 |
| 892 | Ga0495678_000288 | 3300049459 | Bacteria | 55368 |
| 893 | Ga0495678_106556 | 3300049459 | Bacteria | 963 |
| 894 | Ga0495682_0004816 | 3300049460 | Bacteria | 5698 |
| 895 | Ga0495682_0034109 | 3300049460 | Bacteria | 1877 |
| 896 | Ga0501290_001270 | 3300049513 | Bacteria | 3514 |
| 897 | Ga0501300_004769 | 3300049523 | Bacteria | 2005 |
| 898 | Ga0501032_0048794 | 3300049569 | Bacteria | 2858 |
| 899 | Ga0501033_0000259 | 3300049570 | Bacteria | 50619 |
| 900 | Ga0501033_0051275 | 3300049570 | Bacteria | 3058 |
| 901 | Ga0501033_0123340 | 3300049570 | Bacteria | 1879 |
| 902 | Ga0501034_0005872 | 3300049571 | Bacteria | 13347 |
| 903 | Ga0501034_0013222 | 3300049571 | Bacteria | 8505 |
| 904 | Ga0501034_0195238 | 3300049571 | Bacteria | 1984 |
| 905 | Ga0501034_0269958 | 3300049571 | Bacteria | 1642 |
| 906 | Ga0501036_0044409 | 3300049572 | Bacteria | 3764 |
| 907 | Ga0501036_0268666 | 3300049572 | Bacteria | 1428 |
| 908 | Ga0501037_0015430 | 3300049573 | Bacteria | 5621 |
| 909 | Ga0501038_0011847 | 3300049574 | Bacteria | 7959 |
| 910 | Ga0501038_0123922 | 3300049574 | Bacteria | 2128 |
| 911 | Ga0501038_0214165 | 3300049574 | Bacteria | 1540 |
| 912 | Ga0501043_0001256 | 3300049579 | Bacteria | 22358 |
| 913 | Ga0501043_0024778 | 3300049579 | Bacteria | 4706 |
| 914 | Ga0501043_0146151 | 3300049579 | Bacteria | 1851 |
| 915 | Ga0501046_0086498 | 3300049580 | Bacteria | 2416 |
| 916 | Ga0501046_0276152 | 3300049580 | Bacteria | 1232 |
| 917 | Ga0501046_0328112 | 3300049580 | Bacteria | 1114 |
| 918 | Ga0501046_0560948 | 3300049580 | Bacteria | 813 |
| 919 | Ga0501047_0025460 | 3300049581 | Bacteria | 5688 |
| 920 | Ga0501047_0269925 | 3300049581 | Bacteria | 1547 |
| 921 | Ga0501047_0758572 | 3300049581 | Bacteria | 786 |
| 922 | Ga0501048_0605371 | 3300049582 | Bacteria | 787 |
| 923 | Ga0501069_0160151 | 3300049585 | Bacteria | 1296 |
| 924 | Ga0501069_0167538 | 3300049585 | Bacteria | 1267 |
| 925 | Ga0501069_0256958 | 3300049585 | Bacteria | 1019 |
| 926 | Ga0501070_0000201 | 3300049586 | Bacteria | 56006 |
| 927 | Ga0501070_0038943 | 3300049586 | Bacteria | 3966 |
| 928 | Ga0501070_0041143 | 3300049586 | Bacteria | 3850 |
| 929 | Ga0501070_0045585 | 3300049586 | Bacteria | 3647 |
| 930 | Ga0501070_0059770 | 3300049586 | Bacteria | 3159 |
| 931 | Ga0501070_0092416 | 3300049586 | Bacteria | 2504 |
| 932 | Ga0501070_0112254 | 3300049586 | Bacteria | 2253 |
| 933 | Ga0501070_0150774 | 3300049586 | Bacteria | 1918 |
| 934 | Ga0501070_0170066 | 3300049586 | Bacteria | 1795 |
| 935 | Ga0501073_0336638 | 3300049589 | Bacteria | 1042 |
| 936 | Ga0501074_0035073 | 3300049590 | Bacteria | 3635 |
| 937 | Ga0501074_0067603 | 3300049590 | Bacteria | 2569 |
| 938 | Ga0501074_0076002 | 3300049590 | Bacteria | 2411 |
| 939 | Ga0501206_009653 | 3300049653 | Bacteria | 1286 |
| 940 | Ga0501079_0367054 | 3300049741 | Bacteria | 1128 |
| 941 | Ga0501080_0015803 | 3300049742 | Bacteria | 6963 |
| 942 | Ga0501080_0019509 | 3300049742 | Bacteria | 6280 |
| 943 | Ga0501080_0044729 | 3300049742 | Bacteria | 4121 |
| 944 | Ga0501080_0062572 | 3300049742 | Bacteria | 3463 |
| 945 | Ga0501080_0111958 | 3300049742 | Bacteria | 2530 |
| 946 | Ga0501080_0470294 | 3300049742 | Bacteria | 1125 |
| 947 | Ga0501263_002145 | 3300049760 | Bacteria | 1975 |
| 948 | Ga0501265_000506 | 3300049762 | Bacteria | 4137 |
| 949 | Ga0501275_000287 | 3300049772 | Bacteria | 5733 |
| 950 | Ga0501035_0003843 | 3300049822 | Bacteria | 14317 |
| 951 | Ga0501035_0009828 | 3300049822 | Bacteria | 8886 |
| 952 | Ga0501035_0013408 | 3300049822 | Bacteria | 7565 |
| 953 | Ga0501035_0089749 | 3300049822 | Bacteria | 2706 |
| 954 | Ga0501035_0197647 | 3300049822 | Bacteria | 1726 |
| 955 | Ga0501035_0234169 | 3300049822 | Bacteria | 1564 |
| 956 | Ga0501035_0426974 | 3300049822 | Bacteria | 1100 |
| 957 | Ga0501044_0001901 | 3300049823 | Bacteria | 24163 |
| 958 | Ga0501044_0015720 | 3300049823 | Bacteria | 8150 |
| 959 | Ga0501044_0035800 | 3300049823 | Bacteria | 5196 |
| 960 | Ga0501044_0043685 | 3300049823 | Bacteria | 4655 |
| 961 | Ga0501044_0129050 | 3300049823 | Bacteria | 2523 |
| 962 | Ga0501044_0234726 | 3300049823 | Bacteria | 1780 |
| 963 | Ga0501044_0365919 | 3300049823 | Bacteria | 1359 |
| 964 | nmdc:mga07m45_285943_c1 | 3300050496 | Bacteria | 959 |
| 965 | nmdc:mga0sz30_33831_c2 | 3300050516 | Bacteria | 1407 |
| 966 | Ga0500643_000054 | 3300053087 | Bacteria | 135351 |
| 967 | Ga0500644_0072872 | 3300053088 | Bacteria | 1242 |
| 968 | Ga0500583_0295266 | 3300053092 | Bacteria | 794 |
| 969 | Ga0500641_0074051 | 3300053096 | Bacteria | 1438 |
| 970 | Ga0500641_0111080 | 3300053096 | Bacteria | 1180 |
| 971 | Ga0500641_0177754 | 3300053096 | Bacteria | 914 |
| 972 | Ga0500555_001223 | 3300053103 | Bacteria | 8295 |
| 973 | Ga0500607_027544 | 3300053121 | Bacteria | 3153 |
| 974 | Ga0500608_000056 | 3300053122 | Bacteria | 48877 |
| 975 | Ga0500618_000476 | 3300053125 | Bacteria | 25891 |
| 976 | Ga0500618_076521 | 3300053125 | Bacteria | 750 |
| 977 | Ga0500642_0188971 | 3300053130 | Bacteria | 961 |
| 978 | Ga0500652_087960 | 3300053131 | Bacteria | 1296 |
| 979 | Ga0500652_170828 | 3300053131 | Bacteria | 895 |
| 980 | Ga0500658_0005690 | 3300053134 | Bacteria | 4641 |
| 981 | Ga0500559_0000058 | 3300053136 | Bacteria | 88268 |
| 982 | Ga0500559_0083446 | 3300053136 | Bacteria | 1455 |
| 983 | Ga0500568_0045537 | 3300053139 | Bacteria | 1745 |
| 984 | Ga0500568_0112641 | 3300053139 | Bacteria | 1016 |
| 985 | Ga0500573_0000021 | 3300053140 | Bacteria | 159093 |
| 986 | Ga0500616_0000011 | 3300053153 | Bacteria | 732880 |
| 987 | Ga0500616_0005790 | 3300053153 | Bacteria | 8296 |
| 988 | Ga0500616_0034466 | 3300053153 | Bacteria | 2757 |
| 989 | Ga0500622_0007115 | 3300053156 | Bacteria | 6390 |
| 990 | Ga0500622_0029876 | 3300053156 | Bacteria | 2863 |
| 991 | Ga0500622_0038650 | 3300053156 | Bacteria | 2490 |
| 992 | Ga0500622_0108173 | 3300053156 | Bacteria | 1361 |
| 993 | Ga0500645_038014 | 3300053730 | Bacteria | 1429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001989 | JGI24739J22299_10010835 | JGI24739J22299_100108353 | 190 |
| 2 | 3300005563 | Ga0068855_100393934 | Ga0068855_1003939342 | 191 |
| 3 | 3300030745 | Ga0316182_1113340 | Ga0316182_11133402 | 191 |
| 4 | 3300032004 | Ga0307414_10325666 | Ga0307414_103256662 | 191 |
| 5 | 3300046615 | Ga0495656_0150867 | Ga0495656_0150867_326_946 | 191 |
| 6 | 3300046648 | Ga0495611_0032636 | Ga0495611_0032636_910_1530 | 191 |
| 7 | iso_pu_bacteria | 2501025504 | 2501409081 | 191 |
| 8 | iso_pu_bacteria | 2510917014 | 2511101172 | 191 |
| 9 | 3300021361 | Ga0213872_10003040 | Ga0213872_100030405 | 192 |
| 10 | 3300031249 | Ga0265339_10010885 | Ga0265339_100108854 | 192 |
| 11 | 3300031344 | Ga0265316_10006562 | Ga0265316_1000656211 | 192 |
| 12 | 3300031595 | Ga0265313_10000181 | Ga0265313_1000018166 | 192 |
| 13 | 3300031712 | Ga0265342_10073510 | Ga0265342_100735104 | 192 |
| 14 | 3300037471 | Ga0395905_0146690 | Ga0395905_0146690_100_714 | 192 |
| 15 | 3300039447 | Ga0436361_0170645 | Ga0436361_0170645_4294_4929 | 192 |
| 16 | 3300046453 | Ga0495627_007672 | Ga0495627_007672_388_1014 | 192 |
| 17 | 3300048925 | Ga0496122_0039578 | Ga0496122_0039578_2509_3132 | 192 |
| 18 | 3300048926 | Ga0496123_0041995 | Ga0496123_0041995_2054_2677 | 192 |
| 19 | 3300048927 | Ga0496124_0156147 | Ga0496124_0156147_518_1144 | 192 |
| 20 | 3300053121 | Ga0500607_027544 | Ga0500607_027544_565_1215 | 192 |
| 21 | 3300003320 | rootH2_10082605 | rootH2_100826053 | 193 |
| 22 | 3300003856 | Ga0058692_1000002 | Ga0058692_1000002474 | 193 |
| 23 | 3300005456 | Ga0070678_100036678 | Ga0070678_1000366783 | 193 |
| 24 | 3300005578 | Ga0068854_100238794 | Ga0068854_1002387942 | 193 |
| 25 | 3300006051 | Ga0075364_10092343 | Ga0075364_100923432 | 193 |
| 26 | 3300009036 | Ga0105244_10025146 | Ga0105244_100251462 | 193 |
| 27 | 3300025981 | Ga0207640_10241125 | Ga0207640_102411252 | 193 |
| 28 | 3300026121 | Ga0207683_10112193 | Ga0207683_101121932 | 193 |
| 29 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004680 | 193 |
| 30 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005366 | 193 |
| 31 | 3300030742 | Ga0316183_1037672 | Ga0316183_10376722 | 193 |
| 32 | 3300046455 | Ga0495603_0214038 | Ga0495603_0214038_358_981 | 193 |
| 33 | 3300046457 | Ga0495590_0031634 | Ga0495590_0031634_282_905 | 193 |
| 34 | 3300046474 | Ga0495605_0074648 | Ga0495605_0074648_395_1018 | 193 |
| 35 | 3300046501 | Ga0495607_0280906 | Ga0495607_0280906_86_709 | 193 |
| 36 | 3300046513 | Ga0495616_0007214 | Ga0495616_0007214_1969_2592 | 193 |
| 37 | 3300046524 | Ga0495648_0053226 | Ga0495648_0053226_1604_2227 | 193 |
| 38 | 3300046557 | Ga0495622_0187334 | Ga0495622_0187334_104_727 | 193 |
| 39 | 3300047319 | Ga0495674_0008731 | Ga0495674_0008731_5917_6540 | 193 |
| 40 | 3300047323 | Ga0495683_0290085 | Ga0495683_0290085_35_658 | 193 |
| 41 | 3300047443 | Ga0495687_034441 | Ga0495687_034441_1606_2229 | 193 |
| 42 | 3300047445 | Ga0495677_0039380 | Ga0495677_0039380_479_1102 | 193 |
| 43 | 3300047469 | Ga0495673_0019288 | Ga0495673_0019288_378_1001 | 193 |
| 44 | 3300048903 | Ga0496100_0000969 | Ga0496100_0000969_11265_11888 | 193 |
| 45 | 3300048903 | Ga0496100_0036158 | Ga0496100_0036158_1070_1693 | 193 |
| 46 | 3300048904 | Ga0496101_0000134 | Ga0496101_0000134_1705_2328 | 193 |
| 47 | 3300048904 | Ga0496101_0442365 | Ga0496101_0442365_249_872 | 193 |
| 48 | 3300048905 | Ga0496102_0000181 | Ga0496102_0000181_35130_35753 | 193 |
| 49 | 3300048906 | Ga0496103_0004132 | Ga0496103_0004132_733_1356 | 193 |
| 50 | 3300048907 | Ga0496104_0104084 | Ga0496104_0104084_885_1508 | 193 |
| 51 | 3300048907 | Ga0496104_0189387 | Ga0496104_0189387_219_842 | 193 |
| 52 | 3300048909 | Ga0496106_0170803 | Ga0496106_0170803_1086_1709 | 193 |
| 53 | 3300048909 | Ga0496106_0644769 | Ga0496106_0644769_24_647 | 193 |
| 54 | 3300048910 | Ga0496107_0122689 | Ga0496107_0122689_425_1045 | 193 |
| 55 | 3300048913 | Ga0496110_0789013 | Ga0496110_0789013_13_636 | 193 |
| 56 | 3300048915 | Ga0496112_0032873 | Ga0496112_0032873_3919_4542 | 193 |
| 57 | 3300048916 | Ga0496113_0005357 | Ga0496113_0005357_5052_5675 | 193 |
| 58 | 3300048919 | Ga0496116_0130584 | Ga0496116_0130584_67_690 | 193 |
| 59 | 3300048920 | Ga0496117_0004049 | Ga0496117_0004049_871_1494 | 193 |
| 60 | 3300048920 | Ga0496117_0004800 | Ga0496117_0004800_3706_4323 | 193 |
| 61 | 3300048921 | Ga0496118_0000135 | Ga0496118_0000135_42154_42777 | 193 |
| 62 | 3300048921 | Ga0496118_0011915 | Ga0496118_0011915_7068_7685 | 193 |
| 63 | 3300048922 | Ga0496119_0049366 | Ga0496119_0049366_1830_2453 | 193 |
| 64 | 3300048923 | Ga0496120_0083080 | Ga0496120_0083080_378_1001 | 193 |
| 65 | 3300048924 | Ga0496121_0000361 | Ga0496121_0000361_13604_14227 | 193 |
| 66 | 3300048924 | Ga0496121_0000532 | Ga0496121_0000532_71110_71730 | 193 |
| 67 | 3300048924 | Ga0496121_0008433 | Ga0496121_0008433_732_1349 | 193 |
| 68 | 3300048924 | Ga0496121_0077097 | Ga0496121_0077097_1231_1854 | 193 |
| 69 | 3300048925 | Ga0496122_0157445 | Ga0496122_0157445_415_1038 | 193 |
| 70 | 3300048926 | Ga0496123_0266656 | Ga0496123_0266656_199_822 | 193 |
| 71 | 3300048928 | Ga0496125_0015861 | Ga0496125_0015861_793_1410 | 193 |
| 72 | 3300048929 | Ga0496126_0248031 | Ga0496126_0248031_658_1281 | 193 |
| 73 | 3300049460 | Ga0495682_0034109 | Ga0495682_0034109_552_1175 | 193 |
| 74 | iso_pu_bacteria | 2501025501 | 2501072490 | 193 |
| 75 | iso_pu_bacteria | 2510917015 | 2511107112 | 193 |
| 76 | iso_pu_bacteria | 2513237082 | 2513552407 | 193 |
| 77 | iso_pu_bacteria | 2513237083 | 2513565695 | 193 |
| 78 | iso_pu_bacteria | 8003955200 | 8003959322 | 193 |
| 79 | 3300003781 | Ga0055536_1022660 | Ga0055536_10226602 | 194 |
| 80 | 3300005262 | Ga0065165_1000040 | Ga0065165_1000040108 | 194 |
| 81 | 3300013104 | Ga0157370_10588822 | Ga0157370_105888222 | 194 |
| 82 | 3300025284 | Ga0209130_1004306 | Ga0209130_10043067 | 194 |
| 83 | 3300025292 | Ga0209676_1000225 | Ga0209676_1000225107 | 194 |
| 84 | 3300025298 | Ga0209050_1010537 | Ga0209050_10105374 | 194 |
| 85 | 3300025302 | Ga0207426_1000004 | Ga0207426_1000004786 | 194 |
| 86 | 3300025981 | Ga0207640_10494080 | Ga0207640_104940802 | 194 |
| 87 | 3300026142 | Ga0207698_11077752 | Ga0207698_110777522 | 194 |
| 88 | 3300031824 | Ga0307413_10224612 | Ga0307413_102246123 | 194 |
| 89 | 3300046558 | Ga0495633_0164170 | Ga0495633_0164170_28_618 | 194 |
| 90 | 3300048922 | Ga0496119_0058521 | Ga0496119_0058521_957_1571 | 194 |
| 91 | 3300053096 | Ga0500641_0177754 | Ga0500641_0177754_212_820 | 194 |
| 92 | 3300053153 | Ga0500616_0034466 | Ga0500616_0034466_86_694 | 194 |
| 93 | iso_pu_bacteria | 2515154189 | 2516018856 | 194 |
| 94 | iso_pu_bacteria | 2738543030 | 2739342855 | 194 |
| 95 | iso_pu_bacteria | 2808606384 | 2808969127 | 194 |
| 96 | iso_pu_bacteria | 2808606390 | 2809003958 | 194 |
| 97 | iso_pu_bacteria | 2808606391 | 2809011235 | 194 |
| 98 | iso_pu_bacteria | 8021622325 | 8021624860 | 194 |
| 99 | 3300003775 | Ga0055524_1012477 | Ga0055524_10124773 | 195 |
| 100 | 3300003790 | Ga0055528_1000367 | Ga0055528_100036734 | 195 |
| 101 | 3300013104 | Ga0157370_10109162 | Ga0157370_101091623 | 195 |
| 102 | 3300013306 | Ga0163162_10469613 | Ga0163162_104696132 | 195 |
| 103 | 3300025273 | Ga0209673_1000005 | Ga0209673_1000005573 | 195 |
| 104 | 3300025299 | Ga0209256_1000477 | Ga0209256_100047741 | 195 |
| 105 | 3300026118 | Ga0207675_100478257 | Ga0207675_1004782572 | 195 |
| 106 | 3300030732 | Ga0316176_1040965 | Ga0316176_10409653 | 195 |
| 107 | 3300032004 | Ga0307414_10116095 | Ga0307414_101160952 | 195 |
| 108 | 3300046453 | Ga0495627_052017 | Ga0495627_052017_376_993 | 195 |
| 109 | 3300046460 | Ga0495638_0003487 | Ga0495638_0003487_710_1351 | 195 |
| 110 | 3300046524 | Ga0495648_0127445 | Ga0495648_0127445_435_1037 | 195 |
| 111 | 3300046524 | Ga0495648_0176545 | Ga0495648_0176545_127_768 | 195 |
| 112 | 3300047470 | Ga0495681_0103540 | Ga0495681_0103540_127_768 | 195 |
| 113 | 3300048911 | Ga0496108_1003661 | Ga0496108_1003661_22_645 | 195 |
| 114 | 3300048922 | Ga0496119_0038389 | Ga0496119_0038389_16_639 | 195 |
| 115 | 3300048924 | Ga0496121_0557580 | Ga0496121_0557580_28_636 | 195 |
| 116 | 3300048925 | Ga0496122_0252598 | Ga0496122_0252598_75_716 | 195 |
| 117 | 3300048926 | Ga0496123_0140614 | Ga0496123_0140614_435_1052 | 195 |
| 118 | 3300048927 | Ga0496124_0012352 | Ga0496124_0012352_7719_8360 | 195 |
| 119 | 3300048927 | Ga0496124_0095201 | Ga0496124_0095201_133_750 | 195 |
| 120 | 3300048928 | Ga0496125_0018703 | Ga0496125_0018703_5796_6437 | 195 |
| 121 | 3300049571 | Ga0501034_0005872 | Ga0501034_0005872_7961_8599 | 195 |
| 122 | iso_pu_bacteria | 2501025502 | 2501080443 | 195 |
| 123 | iso_pu_bacteria | 2510917013 | 2511088276 | 195 |
| 124 | iso_pu_bacteria | 2738543009 | 2739226565 | 195 |
| 125 | iso_pu_bacteria | 2791355137 | 2792838133 | 195 |
| 126 | iso_pu_bacteria | 2818991457 | 2819660328 | 195 |
| 127 | iso_pu_bacteria | 2852684882 | 2852689138 | 195 |
| 128 | iso_pu_bacteria | 2883087390 | 2883092170 | 195 |
| 129 | iso_pu_bacteria | 2904615490 | 2904616826 | 195 |
| 130 | iso_pu_bacteria | 2919130084 | 2919130400 | 195 |
| 131 | iso_pu_bacteria | 2929195423 | 2929198592 | 195 |
| 132 | iso_pu_bacteria | 8021626552 | 8021627842 | 195 |
| 133 | iso_pu_bacteria | 8021648035 | 8021650786 | 195 |
| 134 | 3300003792 | Ga0055540_1019751 | Ga0055540_10197512 | 196 |
| 135 | 3300005563 | Ga0068855_100949028 | Ga0068855_1009490282 | 196 |
| 136 | 3300009093 | Ga0105240_10008512 | Ga0105240_100085122 | 196 |
| 137 | 3300009093 | Ga0105240_10193184 | Ga0105240_101931843 | 196 |
| 138 | 3300010375 | Ga0105239_10000022 | Ga0105239_1000002286 | 196 |
| 139 | 3300021361 | Ga0213872_10052683 | Ga0213872_100526832 | 196 |
| 140 | 3300025292 | Ga0209676_1001452 | Ga0209676_10014522 | 196 |
| 141 | 3300025292 | Ga0209676_1003114 | Ga0209676_100311410 | 196 |
| 142 | 3300025298 | Ga0209050_1026358 | Ga0209050_10263582 | 196 |
| 143 | 3300025303 | Ga0209051_1005647 | Ga0209051_10056476 | 196 |
| 144 | 3300025304 | Ga0209257_1000208 | Ga0209257_1000208131 | 196 |
| 145 | 3300025304 | Ga0209257_1020284 | Ga0209257_10202842 | 196 |
| 146 | 3300025913 | Ga0207695_10000654 | Ga0207695_1000065421 | 196 |
| 147 | 3300025913 | Ga0207695_10006761 | Ga0207695_1000676118 | 196 |
| 148 | 3300025949 | Ga0207667_10805369 | Ga0207667_108053692 | 196 |
| 149 | 3300038705 | Ga0237819_12915 | Ga0237819_12915_79_720 | 196 |
| 150 | 3300039447 | Ga0436361_0022175 | Ga0436361_0022175_1344_1949 | 196 |
| 151 | 3300039447 | Ga0436361_0835169 | Ga0436361_0835169_1562_2167 | 196 |
| 152 | 3300044656 | Ga0466969_0299580 | Ga0466969_0299580_121_711 | 196 |
| 153 | 3300048904 | Ga0496101_0215785 | Ga0496101_0215785_423_1043 | 196 |
| 154 | 3300048906 | Ga0496103_0334834 | Ga0496103_0334834_285_914 | 196 |
| 155 | 3300048924 | Ga0496121_0059709 | Ga0496121_0059709_784_1404 | 196 |
| 156 | 3300048927 | Ga0496124_0184948 | Ga0496124_0184948_109_753 | 196 |
| 157 | 3300048929 | Ga0496126_0000581 | Ga0496126_0000581_49348_49968 | 196 |
| 158 | iso_pu_bacteria | 2738541307 | 2738883224 | 196 |
| 159 | iso_pu_bacteria | 2848694841 | 2848700141 | 196 |
| 160 | iso_pu_bacteria | 2891048133 | 2891048377 | 196 |
| 161 | 3300002773 | JGI25152J39213_1000231 | JGI25152J39213_100023119 | 197 |
| 162 | 3300002774 | JGI25150J39212_1000095 | JGI25150J39212_100009518 | 197 |
| 163 | 3300003187 | JGI25151J46595_10000477 | JGI25151J46595_1000047724 | 197 |
| 164 | 3300003215 | JGI25153J46596_10000291 | JGI25153J46596_1000029124 | 197 |
| 165 | 3300005333 | Ga0070677_10075881 | Ga0070677_100758812 | 197 |
| 166 | 3300006051 | Ga0075364_10208274 | Ga0075364_102082742 | 197 |
| 167 | 3300009036 | Ga0105244_10128061 | Ga0105244_101280612 | 197 |
| 168 | 3300013102 | Ga0157371_10012688 | Ga0157371_100126882 | 197 |
| 169 | 3300015261 | Ga0182006_1036383 | Ga0182006_10363832 | 197 |
| 170 | 3300015262 | Ga0182007_10001735 | Ga0182007_100017358 | 197 |
| 171 | 3300015265 | Ga0182005_1001033 | Ga0182005_10010338 | 197 |
| 172 | 3300021384 | Ga0213876_10113987 | Ga0213876_101139872 | 197 |
| 173 | 3300025245 | Ga0207425_1000028 | Ga0207425_1000028132 | 197 |
| 174 | 3300025258 | Ga0209129_1000065 | Ga0209129_100006580 | 197 |
| 175 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002140 | 197 |
| 176 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003147 | 197 |
| 177 | 3300025728 | Ga0207655_1034076 | Ga0207655_10340763 | 197 |
| 178 | 3300039447 | Ga0436361_0673292 | Ga0436361_0673292_918_1517 | 197 |
| 179 | 3300047317 | Ga0495604_0343819 | Ga0495604_0343819_87_689 | 197 |
| 180 | 3300047472 | Ga0495686_0051119 | Ga0495686_0051119_659_1255 | 197 |
| 181 | 3300047472 | Ga0495686_0129929 | Ga0495686_0129929_538_1182 | 197 |
| 182 | 3300048919 | Ga0496116_0198881 | Ga0496116_0198881_235_876 | 197 |
| 183 | 3300048921 | Ga0496118_0032231 | Ga0496118_0032231_164_805 | 197 |
| 184 | 3300048922 | Ga0496119_0001587 | Ga0496119_0001587_730_1371 | 197 |
| 185 | 3300048923 | Ga0496120_0000313 | Ga0496120_0000313_739_1380 | 197 |
| 186 | 3300048924 | Ga0496121_0145784 | Ga0496121_0145784_627_1268 | 197 |
| 187 | 3300048929 | Ga0496126_0047998 | Ga0496126_0047998_2536_3177 | 197 |
| 188 | iso_pu_bacteria | 2513237166 | 2514047121 | 197 |
| 189 | iso_pu_bacteria | 2739367700 | 2739733274 | 197 |
| 190 | iso_pu_bacteria | 2765235840 | 2765578195 | 197 |
| 191 | iso_pu_bacteria | 2816332141 | 2816516239 | 197 |
| 192 | iso_pu_bacteria | 2842391507 | 2842393576 | 197 |
| 193 | iso_pu_bacteria | 2842757796 | 2842759395 | 197 |
| 194 | iso_pu_bacteria | 2871435913 | 2871439005 | 197 |
| 195 | iso_pu_bacteria | 2919089067 | 2919090861 | 197 |
| 196 | iso_pu_bacteria | 2919134579 | 2919136953 | 197 |
| 197 | iso_pu_bacteria | 2928496128 | 2928496845 | 197 |
| 198 | iso_pu_bacteria | 2931380184 | 2931381545 | 197 |
| 199 | iso_pu_bacteria | 2937610967 | 2937611662 | 197 |
| 200 | iso_pu_bacteria | 2939626828 | 2939627596 | 197 |
| 201 | iso_pu_bacteria | 2961047084 | 2961047596 | 197 |
| 202 | iso_pu_bacteria | 2961064222 | 2961068427 | 197 |
| 203 | iso_pu_bacteria | 2995392953 | 2995394332 | 197 |
| 204 | iso_pu_bacteria | 642555112 | 642597536 | 197 |
| 205 | iso_pu_bacteria | 8057575449 | 8057579245 | 197 |
| 206 | 3300005518 | Ga0070699_100610319 | Ga0070699_1006103191 | 198 |
| 207 | 3300038443 | Ga0395901_1296731 | Ga0395901_1296731_56_658 | 198 |
| 208 | 3300046507 | Ga0495606_0088286 | Ga0495606_0088286_536_1138 | 198 |
| 209 | iso_pu_bacteria | 2576861471 | 2578459146 | 198 |
| 210 | iso_pu_bacteria | 2643221645 | 2644252791 | 198 |
| 211 | iso_pu_bacteria | 2643221664 | 2644355163 | 198 |
| 212 | iso_pu_bacteria | 2711768613 | 2713480284 | 198 |
| 213 | iso_pu_bacteria | 2738541280 | 2738737691 | 198 |
| 214 | iso_pu_bacteria | 2738541300 | 2738841894 | 198 |
| 215 | iso_pu_bacteria | 2738543018 | 2739272753 | 198 |
| 216 | iso_pu_bacteria | 2738543030 | 2739341797 | 198 |
| 217 | iso_pu_bacteria | 2857442823 | 2857443022 | 198 |
| 218 | iso_pu_bacteria | 2921643360 | 2921643945 | 198 |
| 219 | iso_pu_bacteria | 2939589442 | 2939592240 | 198 |
| 220 | iso_pu_bacteria | 2939622612 | 2939626397 | 198 |
| 221 | iso_pu_bacteria | 2941475908 | 2941476935 | 198 |
| 222 | iso_pu_bacteria | 2974307012 | 2974309581 | 198 |
| 223 | iso_pu_bacteria | 2977247770 | 2977250319 | 198 |
| 224 | iso_pu_bacteria | 2984514374 | 2984515206 | 198 |
| 225 | iso_pu_bacteria | 3005409236 | 3005416253 | 198 |
| 226 | 2162886007 | SwRhRL2b_contig_3055844 | SwRhRL2b_0833.00004610 | 199 |
| 227 | 3300005331 | Ga0070670_100051261 | Ga0070670_1000512615 | 199 |
| 228 | 3300009011 | Ga0105251_10001750 | Ga0105251_100017507 | 199 |
| 229 | 3300011119 | Ga0105246_10191418 | Ga0105246_101914182 | 199 |
| 230 | 3300013102 | Ga0157371_10351170 | Ga0157371_103511701 | 199 |
| 231 | 3300015265 | Ga0182005_1004597 | Ga0182005_10045973 | 199 |
| 232 | 3300025735 | Ga0207713_1000393 | Ga0207713_100039330 | 199 |
| 233 | 3300025925 | Ga0207650_10060634 | Ga0207650_100606344 | 199 |
| 234 | 3300026116 | Ga0207674_10548626 | Ga0207674_105486261 | 199 |
| 235 | 3300031548 | Ga0307408_100006936 | Ga0307408_1000069366 | 199 |
| 236 | 3300039447 | Ga0436361_1083332 | Ga0436361_1083332_29_643 | 199 |
| 237 | 3300046463 | Ga0495653_0123525 | Ga0495653_0123525_1187_1801 | 199 |
| 238 | 3300046680 | Ga0495646_0325177 | Ga0495646_0325177_53_667 | 199 |
| 239 | 3300048088 | Ga0495602_0020013 | Ga0495602_0020013_1159_1773 | 199 |
| 240 | 3300048907 | Ga0496104_0216485 | Ga0496104_0216485_284_901 | 199 |
| 241 | 3300048908 | Ga0496105_0025048 | Ga0496105_0025048_1255_1872 | 199 |
| 242 | 3300048919 | Ga0496116_0074369 | Ga0496116_0074369_1479_2087 | 199 |
| 243 | 3300048919 | Ga0496116_0194811 | Ga0496116_0194811_85_702 | 199 |
| 244 | 3300048920 | Ga0496117_0001420 | Ga0496117_0001420_33251_33874 | 199 |
| 245 | 3300048920 | Ga0496117_0004899 | Ga0496117_0004899_8640_9257 | 199 |
| 246 | 3300048921 | Ga0496118_0011231 | Ga0496118_0011231_925_1542 | 199 |
| 247 | 3300048921 | Ga0496118_0116457 | Ga0496118_0116457_893_1501 | 199 |
| 248 | 3300048921 | Ga0496118_0126003 | Ga0496118_0126003_694_1317 | 199 |
| 249 | 3300048922 | Ga0496119_0001058 | Ga0496119_0001058_29336_29953 | 199 |
| 250 | 3300048922 | Ga0496119_0036896 | Ga0496119_0036896_396_1004 | 199 |
| 251 | 3300048922 | Ga0496119_0282164 | Ga0496119_0282164_175_792 | 199 |
| 252 | 3300048923 | Ga0496120_0002147 | Ga0496120_0002147_688_1311 | 199 |
| 253 | 3300048923 | Ga0496120_0002531 | Ga0496120_0002531_16690_17307 | 199 |
| 254 | 3300048923 | Ga0496120_0010752 | Ga0496120_0010752_5167_5784 | 199 |
| 255 | 3300048923 | Ga0496120_0035630 | Ga0496120_0035630_1410_2018 | 199 |
| 256 | 3300048924 | Ga0496121_0063489 | Ga0496121_0063489_1623_2231 | 199 |
| 257 | 3300048925 | Ga0496122_0003345 | Ga0496122_0003345_19946_20569 | 199 |
| 258 | 3300048925 | Ga0496122_0091290 | Ga0496122_0091290_112_720 | 199 |
| 259 | 3300048925 | Ga0496122_0239470 | Ga0496122_0239470_395_1003 | 199 |
| 260 | 3300048926 | Ga0496123_0002721 | Ga0496123_0002721_19904_20527 | 199 |
| 261 | 3300048926 | Ga0496123_0052947 | Ga0496123_0052947_819_1427 | 199 |
| 262 | 3300048927 | Ga0496124_0190942 | Ga0496124_0190942_25_633 | 199 |
| 263 | 3300048928 | Ga0496125_0002637 | Ga0496125_0002637_7240_7848 | 199 |
| 264 | 3300048929 | Ga0496126_0070369 | Ga0496126_0070369_659_1267 | 199 |
| 265 | 3300048929 | Ga0496126_0215948 | Ga0496126_0215948_481_1098 | 199 |
| 266 | 3300049579 | Ga0501043_0001256 | Ga0501043_0001256_7154_7765 | 199 |
| 267 | 3300049653 | Ga0501206_009653 | Ga0501206_009653_173_778 | 199 |
| 268 | 3300049760 | Ga0501263_002145 | Ga0501263_002145_1045_1656 | 199 |
| 269 | 3300049822 | Ga0501035_0234169 | Ga0501035_0234169_12_623 | 199 |
| 270 | iso_pu_bacteria | 2513237098 | 2513678071 | 199 |
| 271 | iso_pu_bacteria | 2513237305 | 2514423417 | 199 |
| 272 | iso_pu_bacteria | 2687453392 | 2688599150 | 199 |
| 273 | iso_pu_bacteria | 2721755686 | 2723578225 | 199 |
| 274 | iso_pu_bacteria | 2818991461 | 2819682929 | 199 |
| 275 | iso_pu_bacteria | 2844009547 | 2844014329 | 199 |
| 276 | iso_pu_bacteria | 2856328259 | 2856329099 | 199 |
| 277 | iso_pu_bacteria | 2856334872 | 2856341988 | 199 |
| 278 | iso_pu_bacteria | 2857367948 | 2857372336 | 199 |
| 279 | iso_pu_bacteria | 2869169390 | 2869174037 | 199 |
| 280 | iso_pu_bacteria | 2869234852 | 2869240697 | 199 |
| 281 | iso_pu_bacteria | 2869242130 | 2869244930 | 199 |
| 282 | iso_pu_bacteria | 2869249662 | 2869252222 | 199 |
| 283 | iso_pu_bacteria | 2869256925 | 2869263518 | 199 |
| 284 | iso_pu_bacteria | 2869264136 | 2869268171 | 199 |
| 285 | iso_pu_bacteria | 2869271264 | 2869278016 | 199 |
| 286 | iso_pu_bacteria | 2871451962 | 2871452008 | 199 |
| 287 | iso_pu_bacteria | 2871459585 | 2871460127 | 199 |
| 288 | iso_pu_bacteria | 2871481445 | 2871483950 | 199 |
| 289 | iso_pu_bacteria | 2874109183 | 2874110944 | 199 |
| 290 | iso_pu_bacteria | 2874116593 | 2874121780 | 199 |
| 291 | iso_pu_bacteria | 2874131515 | 2874135795 | 199 |
| 292 | iso_pu_bacteria | 2874162495 | 2874167871 | 199 |
| 293 | iso_pu_bacteria | 2876386047 | 2876386564 | 199 |
| 294 | iso_pu_bacteria | 2876399893 | 2876403335 | 199 |
| 295 | iso_pu_bacteria | 2876406927 | 2876408956 | 199 |
| 296 | iso_pu_bacteria | 2876420981 | 2876422220 | 199 |
| 297 | iso_pu_bacteria | 2878730984 | 2878738061 | 199 |
| 298 | iso_pu_bacteria | 2878774303 | 2878775639 | 199 |
| 299 | iso_pu_bacteria | 2878781027 | 2878783640 | 199 |
| 300 | iso_pu_bacteria | 2882632389 | 2882637502 | 199 |
| 301 | iso_pu_bacteria | 2903513507 | 2903520512 | 199 |
| 302 | iso_pu_bacteria | 2906363423 | 2906365028 | 199 |
| 303 | iso_pu_bacteria | 2906370794 | 2906376921 | 199 |
| 304 | iso_pu_bacteria | 2906393657 | 2906395347 | 199 |
| 305 | iso_pu_bacteria | 2906401398 | 2906402107 | 199 |
| 306 | iso_pu_bacteria | 2906408224 | 2906414359 | 199 |
| 307 | iso_pu_bacteria | 2906427513 | 2906434314 | 199 |
| 308 | iso_pu_bacteria | 2919138771 | 2919139797 | 199 |
| 309 | iso_pu_bacteria | 2922151315 | 2922153772 | 199 |
| 310 | iso_pu_bacteria | 2922172374 | 2922173102 | 199 |
| 311 | iso_pu_bacteria | 2922178524 | 2922184320 | 199 |
| 312 | iso_pu_bacteria | 2924733363 | 2924734656 | 199 |
| 313 | iso_pu_bacteria | 2924741084 | 2924743182 | 199 |
| 314 | iso_pu_bacteria | 2924748358 | 2924752106 | 199 |
| 315 | iso_pu_bacteria | 2935638405 | 2935647795 | 199 |
| 316 | iso_pu_bacteria | 2935665750 | 2935666830 | 199 |
| 317 | iso_pu_bacteria | 2935827899 | 2935837279 | 199 |
| 318 | iso_pu_bacteria | 2937861824 | 2937864229 | 199 |
| 319 | iso_pu_bacteria | 2937980651 | 2937988297 | 199 |
| 320 | iso_pu_bacteria | 2958108152 | 2958108934 | 199 |
| 321 | iso_pu_bacteria | 2958122699 | 2958123340 | 199 |
| 322 | iso_pu_bacteria | 2958137437 | 2958143996 | 199 |
| 323 | iso_pu_bacteria | 2958158011 | 2958161059 | 199 |
| 324 | iso_pu_bacteria | 2961136820 | 2961138990 | 199 |
| 325 | iso_pu_bacteria | 2961183825 | 2961186784 | 199 |
| 326 | iso_pu_bacteria | 2965025482 | 2965029253 | 199 |
| 327 | iso_pu_bacteria | 2965032056 | 2965036432 | 199 |
| 328 | iso_pu_bacteria | 2965040258 | 2965045848 | 199 |
| 329 | iso_pu_bacteria | 2965047637 | 2965049866 | 199 |
| 330 | iso_pu_bacteria | 2965089291 | 2965091097 | 199 |
| 331 | iso_pu_bacteria | 2970489779 | 2970489800 | 199 |
| 332 | iso_pu_bacteria | 2970510686 | 2970517933 | 199 |
| 333 | iso_pu_bacteria | 2970532167 | 2970538793 | 199 |
| 334 | iso_pu_bacteria | 2970547951 | 2970551921 | 199 |
| 335 | iso_pu_bacteria | 2970627176 | 2970629719 | 199 |
| 336 | iso_pu_bacteria | 2977851361 | 2977853983 | 199 |
| 337 | iso_pu_bacteria | 2977872689 | 2977879637 | 199 |
| 338 | iso_pu_bacteria | 2977907340 | 2977911246 | 199 |
| 339 | iso_pu_bacteria | 2977915119 | 2977918298 | 199 |
| 340 | iso_pu_bacteria | 2977935797 | 2977937536 | 199 |
| 341 | iso_pu_bacteria | 2977950692 | 2977954001 | 199 |
| 342 | iso_pu_bacteria | 2977957713 | 2977963292 | 199 |
| 343 | iso_pu_bacteria | 2979764755 | 2979769019 | 199 |
| 344 | iso_pu_bacteria | 2979772303 | 2979774792 | 199 |
| 345 | iso_pu_bacteria | 2979793036 | 2979798502 | 199 |
| 346 | iso_pu_bacteria | 2987645492 | 2987647285 | 199 |
| 347 | iso_pu_bacteria | 2987673487 | 2987675862 | 199 |
| 348 | iso_pu_bacteria | 2996386984 | 2996388311 | 199 |
| 349 | iso_pu_bacteria | 3004195979 | 3004196985 | 199 |
| 350 | iso_pu_bacteria | 3004232784 | 3004238463 | 199 |
| 351 | iso_pu_bacteria | 3004239961 | 3004242840 | 199 |
| 352 | iso_pu_bacteria | 3004248173 | 3004252801 | 199 |
| 353 | iso_pu_bacteria | 3004268573 | 3004269808 | 199 |
| 354 | iso_pu_bacteria | 649633066 | 649873581 | 199 |
| 355 | iso_pu_bacteria | 8004300914 | 8004306606 | 199 |
| 356 | iso_pu_bacteria | 8004312739 | 8004316980 | 199 |
| 357 | iso_pu_bacteria | 8004361976 | 8004367528 | 199 |
| 358 | iso_pu_bacteria | 8004695233 | 8004699132 | 199 |
| 359 | iso_pu_bacteria | 8004727605 | 8004728590 | 199 |
| 360 | 3300003763 | Ga0055529_1004557 | Ga0055529_10045572 | 200 |
| 361 | 3300009545 | Ga0105237_10000202 | Ga0105237_1000020284 | 200 |
| 362 | 3300025250 | Ga0209026_1001092 | Ga0209026_10010928 | 200 |
| 363 | 3300025256 | Ga0209759_1004246 | Ga0209759_10042462 | 200 |
| 364 | 3300025272 | Ga0209455_1000766 | Ga0209455_10007663 | 200 |
| 365 | 3300025914 | Ga0207671_10000726 | Ga0207671_1000072635 | 200 |
| 366 | 3300026067 | Ga0207678_10012569 | Ga0207678_100125695 | 200 |
| 367 | 3300026078 | Ga0207702_10000456 | Ga0207702_1000045619 | 200 |
| 368 | 3300027312 | Ga0209371_1000044 | Ga0209371_1000044228 | 200 |
| 369 | 3300030500 | Ga0268256_1000046 | Ga0268256_1000046228 | 200 |
| 370 | 3300031507 | Ga0307509_10262360 | Ga0307509_102623601 | 200 |
| 371 | 3300039447 | Ga0436361_0795199 | Ga0436361_0795199_17359_17982 | 200 |
| 372 | 3300041452 | Ga0451793_0151939 | Ga0451793_0151939_682_1308 | 200 |
| 373 | 3300041458 | Ga0451798_0004380 | Ga0451798_0004380_53_679 | 200 |
| 374 | 3300041459 | Ga0451800_1204646 | Ga0451800_1204646_676_1302 | 200 |
| 375 | 3300041462 | Ga0451806_700263 | Ga0451806_700263_696_1322 | 200 |
| 376 | 3300041463 | Ga0451804_0156193 | Ga0451804_0156193_676_1302 | 200 |
| 377 | 3300041486 | Ga0451807_0057674 | Ga0451807_0057674_710_1336 | 200 |
| 378 | 3300046499 | Ga0495594_0177404 | Ga0495594_0177404_558_1193 | 200 |
| 379 | 3300046507 | Ga0495606_0334266 | Ga0495606_0334266_135_746 | 200 |
| 380 | 3300046520 | Ga0495637_0019179 | Ga0495637_0019179_588_1244 | 200 |
| 381 | 3300046524 | Ga0495648_0122160 | Ga0495648_0122160_522_1133 | 200 |
| 382 | 3300046530 | Ga0495654_0238031 | Ga0495654_0238031_134_745 | 200 |
| 383 | 3300046542 | Ga0495597_0036025 | Ga0495597_0036025_759_1370 | 200 |
| 384 | 3300046660 | Ga0495625_0054020 | Ga0495625_0054020_1017_1628 | 200 |
| 385 | 3300046664 | Ga0495659_0000286 | Ga0495659_0000286_1544_2155 | 200 |
| 386 | 3300046692 | Ga0495671_0000163 | Ga0495671_0000163_56967_57578 | 200 |
| 387 | 3300046694 | Ga0495649_0185523 | Ga0495649_0185523_56_664 | 200 |
| 388 | 3300047320 | Ga0495672_0000023 | Ga0495672_0000023_184781_185392 | 200 |
| 389 | 3300047469 | Ga0495673_0019046 | Ga0495673_0019046_1216_1830 | 200 |
| 390 | 3300047472 | Ga0495686_0000164 | Ga0495686_0000164_58708_59322 | 200 |
| 391 | 3300048926 | Ga0496123_0313962 | Ga0496123_0313962_119_733 | 200 |
| 392 | iso_pu_bacteria | 2585427594 | 2585845312 | 200 |
| 393 | iso_pu_bacteria | 2643221569 | 2643858564 | 200 |
| 394 | iso_pu_bacteria | 2738541293 | 2738800482 | 200 |
| 395 | 3300003771 | Ga0055526_1000874 | Ga0055526_10008744 | 201 |
| 396 | 3300003773 | Ga0055537_1000268 | Ga0055537_100026818 | 201 |
| 397 | 3300003775 | Ga0055524_1002624 | Ga0055524_100262412 | 201 |
| 398 | 3300003784 | Ga0055534_1000362 | Ga0055534_10003628 | 201 |
| 399 | 3300003790 | Ga0055528_1000370 | Ga0055528_100037017 | 201 |
| 400 | 3300005347 | Ga0070668_100029042 | Ga0070668_1000290423 | 201 |
| 401 | 3300009092 | Ga0105250_10069397 | Ga0105250_100693972 | 201 |
| 402 | 3300025263 | Ga0209565_1000017 | Ga0209565_1000017404 | 201 |
| 403 | 3300025273 | Ga0209673_1000007 | Ga0209673_100000725 | 201 |
| 404 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009493 | 201 |
| 405 | 3300025295 | Ga0209564_1000036 | Ga0209564_100003625 | 201 |
| 406 | 3300025299 | Ga0209256_1000091 | Ga0209256_100009125 | 201 |
| 407 | 3300025972 | Ga0207668_10162988 | Ga0207668_101629882 | 201 |
| 408 | 3300044683 | Ga0466965_0312279 | Ga0466965_0312279_138_752 | 201 |
| 409 | 3300046506 | Ga0495583_0050191 | Ga0495583_0050191_563_1186 | 201 |
| 410 | 3300046512 | Ga0495610_0049710 | Ga0495610_0049710_1386_2012 | 201 |
| 411 | 3300046531 | Ga0495665_0105312 | Ga0495665_0105312_775_1398 | 201 |
| 412 | 3300046648 | Ga0495611_0200438 | Ga0495611_0200438_198_821 | 201 |
| 413 | 3300047320 | Ga0495672_0171919 | Ga0495672_0171919_435_1058 | 201 |
| 414 | 3300048908 | Ga0496105_0014113 | Ga0496105_0014113_3675_4298 | 201 |
| 415 | 3300048927 | Ga0496124_0414141 | Ga0496124_0414141_178_792 | 201 |
| 416 | 3300053125 | Ga0500618_076521 | Ga0500618_076521_26_652 | 201 |
| 417 | iso_pu_bacteria | 2643221591 | 2643965005 | 201 |
| 418 | iso_pu_bacteria | 2643221663 | 2644352183 | 201 |
| 419 | iso_pu_bacteria | 2643221699 | 2644548439 | 201 |
| 420 | iso_pu_bacteria | 2830075706 | 2830078969 | 201 |
| 421 | iso_pu_bacteria | 2857504554 | 2857506516 | 201 |
| 422 | iso_pu_bacteria | 8003014200 | 8003014248 | 201 |
| 423 | 3300002773 | JGI25152J39213_1001252 | JGI25152J39213_10012529 | 202 |
| 424 | 3300002774 | JGI25150J39212_1000142 | JGI25150J39212_100014232 | 202 |
| 425 | 3300002774 | JGI25150J39212_1000230 | JGI25150J39212_10002304 | 202 |
| 426 | 3300003187 | JGI25151J46595_10000031 | JGI25151J46595_10000031140 | 202 |
| 427 | 3300003215 | JGI25153J46596_10000927 | JGI25153J46596_100009274 | 202 |
| 428 | 3300003578 | Ga0006562J51391_1005855 | Ga0006562J51391_10058553 | 202 |
| 429 | 3300003775 | Ga0055524_1000010 | Ga0055524_1000010193 | 202 |
| 430 | 3300005262 | Ga0065165_1015600 | Ga0065165_10156004 | 202 |
| 431 | 3300006186 | Ga0075369_10081602 | Ga0075369_100816022 | 202 |
| 432 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002228 | 202 |
| 433 | 3300025245 | Ga0207425_1000070 | Ga0207425_100007079 | 202 |
| 434 | 3300025258 | Ga0209129_1000172 | Ga0209129_100017279 | 202 |
| 435 | 3300025258 | Ga0209129_1000232 | Ga0209129_100023238 | 202 |
| 436 | 3300025263 | Ga0209565_1006338 | Ga0209565_10063383 | 202 |
| 437 | 3300025294 | Ga0209025_1000083 | Ga0209025_1000083184 | 202 |
| 438 | 3300025297 | Ga0209758_1000090 | Ga0209758_100009079 | 202 |
| 439 | 3300025299 | Ga0209256_1000007 | Ga0209256_1000007571 | 202 |
| 440 | 3300026035 | Ga0207703_11035931 | Ga0207703_110359312 | 202 |
| 441 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001919 | 202 |
| 442 | 3300031731 | Ga0307405_10008120 | Ga0307405_100081204 | 202 |
| 443 | 3300031911 | Ga0307412_10001031 | Ga0307412_1000103112 | 202 |
| 444 | 3300032005 | Ga0307411_10534239 | Ga0307411_105342391 | 202 |
| 445 | 3300046471 | Ga0495650_0116780 | Ga0495650_0116780_166_795 | 202 |
| 446 | 3300046512 | Ga0495610_0000250 | Ga0495610_0000250_39342_39971 | 202 |
| 447 | 3300046525 | Ga0495663_0042232 | Ga0495663_0042232_40_681 | 202 |
| 448 | 3300047469 | Ga0495673_0085027 | Ga0495673_0085027_248_877 | 202 |
| 449 | 3300047472 | Ga0495686_0011381 | Ga0495686_0011381_1278_1907 | 202 |
| 450 | 3300048903 | Ga0496100_0197319 | Ga0496100_0197319_247_876 | 202 |
| 451 | 3300048908 | Ga0496105_0001129 | Ga0496105_0001129_8841_9464 | 202 |
| 452 | 3300048912 | Ga0496109_0978616 | Ga0496109_0978616_85_714 | 202 |
| 453 | 3300048919 | Ga0496116_0005234 | Ga0496116_0005234_3709_4338 | 202 |
| 454 | 3300048920 | Ga0496117_0018675 | Ga0496117_0018675_2761_3390 | 202 |
| 455 | 3300048920 | Ga0496117_0165643 | Ga0496117_0165643_92_721 | 202 |
| 456 | 3300048921 | Ga0496118_0045381 | Ga0496118_0045381_1905_2534 | 202 |
| 457 | 3300048922 | Ga0496119_0004632 | Ga0496119_0004632_8942_9565 | 202 |
| 458 | 3300048923 | Ga0496120_0036565 | Ga0496120_0036565_1771_2394 | 202 |
| 459 | 3300048924 | Ga0496121_0033869 | Ga0496121_0033869_922_1551 | 202 |
| 460 | 3300048924 | Ga0496121_0134324 | Ga0496121_0134324_923_1552 | 202 |
| 461 | 3300048925 | Ga0496122_0041456 | Ga0496122_0041456_922_1551 | 202 |
| 462 | 3300048925 | Ga0496122_0127937 | Ga0496122_0127937_923_1552 | 202 |
| 463 | 3300048926 | Ga0496123_0007763 | Ga0496123_0007763_6765_7394 | 202 |
| 464 | 3300048926 | Ga0496123_0062669 | Ga0496123_0062669_923_1552 | 202 |
| 465 | 3300048927 | Ga0496124_0006165 | Ga0496124_0006165_10594_11217 | 202 |
| 466 | 3300048927 | Ga0496124_0041671 | Ga0496124_0041671_120_749 | 202 |
| 467 | 3300048927 | Ga0496124_0089365 | Ga0496124_0089365_1767_2396 | 202 |
| 468 | 3300048927 | Ga0496124_0198029 | Ga0496124_0198029_888_1517 | 202 |
| 469 | 3300048928 | Ga0496125_0009701 | Ga0496125_0009701_8460_9083 | 202 |
| 470 | 3300048928 | Ga0496125_0010823 | Ga0496125_0010823_5011_5640 | 202 |
| 471 | 3300049459 | Ga0495678_106556 | Ga0495678_106556_265_894 | 202 |
| 472 | iso_pu_bacteria | 2842698319 | 2842702357 | 202 |
| 473 | 3300001904 | JGI24736J21556_1004445 | JGI24736J21556_10044453 | 203 |
| 474 | 3300001915 | JGI24741J21665_1005915 | JGI24741J21665_10059152 | 203 |
| 475 | 3300001915 | JGI24741J21665_1007918 | JGI24741J21665_10079182 | 203 |
| 476 | 3300001915 | JGI24741J21665_1032964 | JGI24741J21665_10329641 | 203 |
| 477 | 3300001979 | JGI24740J21852_10001457 | JGI24740J21852_100014577 | 203 |
| 478 | 3300001979 | JGI24740J21852_10009141 | JGI24740J21852_100091412 | 203 |
| 479 | 3300001979 | JGI24740J21852_10019556 | JGI24740J21852_100195562 | 203 |
| 480 | 3300003781 | Ga0055536_1000385 | Ga0055536_10003852 | 203 |
| 481 | 3300003791 | Ga0055530_10000573 | Ga0055530_1000057322 | 203 |
| 482 | 3300005327 | Ga0070658_10166907 | Ga0070658_101669072 | 203 |
| 483 | 3300005329 | Ga0070683_100075438 | Ga0070683_1000754384 | 203 |
| 484 | 3300005329 | Ga0070683_100333408 | Ga0070683_1003334082 | 203 |
| 485 | 3300005336 | Ga0070680_100005939 | Ga0070680_10000593911 | 203 |
| 486 | 3300005336 | Ga0070680_100025630 | Ga0070680_1000256302 | 203 |
| 487 | 3300005336 | Ga0070680_100046627 | Ga0070680_1000466272 | 203 |
| 488 | 3300005337 | Ga0070682_100081768 | Ga0070682_1000817682 | 203 |
| 489 | 3300005339 | Ga0070660_100121185 | Ga0070660_1001211852 | 203 |
| 490 | 3300005339 | Ga0070660_100282896 | Ga0070660_1002828962 | 203 |
| 491 | 3300005339 | Ga0070660_100406981 | Ga0070660_1004069811 | 203 |
| 492 | 3300005339 | Ga0070660_100593765 | Ga0070660_1005937652 | 203 |
| 493 | 3300005341 | Ga0070691_10000414 | Ga0070691_1000041416 | 203 |
| 494 | 3300005341 | Ga0070691_10051018 | Ga0070691_100510183 | 203 |
| 495 | 3300005341 | Ga0070691_10179152 | Ga0070691_101791521 | 203 |
| 496 | 3300005341 | Ga0070691_10202859 | Ga0070691_102028592 | 203 |
| 497 | 3300005344 | Ga0070661_100008252 | Ga0070661_1000082529 | 203 |
| 498 | 3300005344 | Ga0070661_100054589 | Ga0070661_1000545894 | 203 |
| 499 | 3300005344 | Ga0070661_100181726 | Ga0070661_1001817262 | 203 |
| 500 | 3300005345 | Ga0070692_10009461 | Ga0070692_100094615 | 203 |
| 501 | 3300005345 | Ga0070692_10021858 | Ga0070692_100218584 | 203 |
| 502 | 3300005366 | Ga0070659_100607313 | Ga0070659_1006073132 | 203 |
| 503 | 3300005436 | Ga0070713_100379402 | Ga0070713_1003794022 | 203 |
| 504 | 3300005455 | Ga0070663_100438417 | Ga0070663_1004384172 | 203 |
| 505 | 3300005457 | Ga0070662_100002976 | Ga0070662_1000029765 | 203 |
| 506 | 3300005458 | Ga0070681_10001054 | Ga0070681_100010542 | 203 |
| 507 | 3300005458 | Ga0070681_10046305 | Ga0070681_100463052 | 203 |
| 508 | 3300005458 | Ga0070681_10106849 | Ga0070681_101068492 | 203 |
| 509 | 3300005518 | Ga0070699_100536014 | Ga0070699_1005360141 | 203 |
| 510 | 3300005530 | Ga0070679_100000116 | Ga0070679_10000011645 | 203 |
| 511 | 3300005530 | Ga0070679_100039125 | Ga0070679_1000391255 | 203 |
| 512 | 3300005530 | Ga0070679_100068995 | Ga0070679_1000689952 | 203 |
| 513 | 3300005535 | Ga0070684_100060950 | Ga0070684_1000609504 | 203 |
| 514 | 3300005535 | Ga0070684_100089262 | Ga0070684_1000892622 | 203 |
| 515 | 3300005539 | Ga0068853_100067525 | Ga0068853_1000675255 | 203 |
| 516 | 3300005539 | Ga0068853_100307243 | Ga0068853_1003072432 | 203 |
| 517 | 3300005539 | Ga0068853_100663109 | Ga0068853_1006631092 | 203 |
| 518 | 3300005539 | Ga0068853_100761879 | Ga0068853_1007618791 | 203 |
| 519 | 3300005546 | Ga0070696_100046009 | Ga0070696_1000460092 | 203 |
| 520 | 3300005546 | Ga0070696_100174920 | Ga0070696_1001749202 | 203 |
| 521 | 3300005547 | Ga0070693_100001124 | Ga0070693_1000011246 | 203 |
| 522 | 3300005563 | Ga0068855_100100356 | Ga0068855_1001003562 | 203 |
| 523 | 3300005563 | Ga0068855_100171819 | Ga0068855_1001718192 | 203 |
| 524 | 3300005564 | Ga0070664_100050389 | Ga0070664_1000503894 | 203 |
| 525 | 3300005564 | Ga0070664_100096297 | Ga0070664_1000962972 | 203 |
| 526 | 3300005577 | Ga0068857_100066946 | Ga0068857_1000669464 | 203 |
| 527 | 3300005577 | Ga0068857_100074737 | Ga0068857_1000747375 | 203 |
| 528 | 3300005577 | Ga0068857_100797943 | Ga0068857_1007979432 | 203 |
| 529 | 3300005578 | Ga0068854_100103909 | Ga0068854_1001039092 | 203 |
| 530 | 3300005578 | Ga0068854_100247328 | Ga0068854_1002473282 | 203 |
| 531 | 3300005578 | Ga0068854_100378785 | Ga0068854_1003787852 | 203 |
| 532 | 3300005614 | Ga0068856_100179946 | Ga0068856_1001799461 | 203 |
| 533 | 3300005614 | Ga0068856_100452758 | Ga0068856_1004527582 | 203 |
| 534 | 3300005614 | Ga0068856_100562660 | Ga0068856_1005626602 | 203 |
| 535 | 3300005616 | Ga0068852_100250925 | Ga0068852_1002509251 | 203 |
| 536 | 3300005616 | Ga0068852_100385620 | Ga0068852_1003856202 | 203 |
| 537 | 3300005616 | Ga0068852_100893102 | Ga0068852_1008931022 | 203 |
| 538 | 3300005834 | Ga0068851_10010821 | Ga0068851_100108214 | 203 |
| 539 | 3300006163 | Ga0070715_10076191 | Ga0070715_100761912 | 203 |
| 540 | 3300006175 | Ga0070712_100057928 | Ga0070712_1000579282 | 203 |
| 541 | 3300009093 | Ga0105240_10123556 | Ga0105240_101235562 | 203 |
| 542 | 3300009093 | Ga0105240_10255133 | Ga0105240_102551333 | 203 |
| 543 | 3300009093 | Ga0105240_10460024 | Ga0105240_104600242 | 203 |
| 544 | 3300009093 | Ga0105240_11223492 | Ga0105240_112234921 | 203 |
| 545 | 3300009551 | Ga0105238_10002754 | Ga0105238_100027542 | 203 |
| 546 | 3300013100 | Ga0157373_10020888 | Ga0157373_100208884 | 203 |
| 547 | 3300013102 | Ga0157371_10035605 | Ga0157371_100356052 | 203 |
| 548 | 3300013102 | Ga0157371_10210343 | Ga0157371_102103432 | 203 |
| 549 | 3300013104 | Ga0157370_10006361 | Ga0157370_1000636112 | 203 |
| 550 | 3300013104 | Ga0157370_10028770 | Ga0157370_100287702 | 203 |
| 551 | 3300013104 | Ga0157370_10096501 | Ga0157370_100965012 | 203 |
| 552 | 3300013105 | Ga0157369_10155544 | Ga0157369_101555442 | 203 |
| 553 | 3300013105 | Ga0157369_10414277 | Ga0157369_104142771 | 203 |
| 554 | 3300013105 | Ga0157369_10687233 | Ga0157369_106872332 | 203 |
| 555 | 3300013307 | Ga0157372_10119219 | Ga0157372_101192192 | 203 |
| 556 | 3300013307 | Ga0157372_10190386 | Ga0157372_101903863 | 203 |
| 557 | 3300013307 | Ga0157372_12005137 | Ga0157372_120051371 | 203 |
| 558 | 3300020070 | Ga0206356_11511824 | Ga0206356_115118242 | 203 |
| 559 | 3300020070 | Ga0206356_11757027 | Ga0206356_117570271 | 203 |
| 560 | 3300020077 | Ga0206351_10803103 | Ga0206351_108031032 | 203 |
| 561 | 3300020078 | Ga0206352_10117821 | Ga0206352_101178212 | 203 |
| 562 | 3300020081 | Ga0206354_10084669 | Ga0206354_100846692 | 203 |
| 563 | 3300020081 | Ga0206354_10440027 | Ga0206354_104400272 | 203 |
| 564 | 3300020082 | Ga0206353_10964244 | Ga0206353_109642443 | 203 |
| 565 | 3300020610 | Ga0154015_1188516 | Ga0154015_11885162 | 203 |
| 566 | 3300025261 | Ga0209233_1021961 | Ga0209233_10219612 | 203 |
| 567 | 3300025292 | Ga0209676_1000128 | Ga0209676_1000128142 | 203 |
| 568 | 3300025298 | Ga0209050_1001118 | Ga0209050_100111822 | 203 |
| 569 | 3300025304 | Ga0209257_1040888 | Ga0209257_10408882 | 203 |
| 570 | 3300025321 | Ga0207656_10022892 | Ga0207656_100228922 | 203 |
| 571 | 3300025321 | Ga0207656_10086488 | Ga0207656_100864882 | 203 |
| 572 | 3300025904 | Ga0207647_10005263 | Ga0207647_100052637 | 203 |
| 573 | 3300025904 | Ga0207647_10030288 | Ga0207647_100302882 | 203 |
| 574 | 3300025904 | Ga0207647_10181630 | Ga0207647_101816302 | 203 |
| 575 | 3300025905 | Ga0207685_10076528 | Ga0207685_100765282 | 203 |
| 576 | 3300025906 | Ga0207699_10365875 | Ga0207699_103658751 | 203 |
| 577 | 3300025909 | Ga0207705_10023168 | Ga0207705_100231685 | 203 |
| 578 | 3300025909 | Ga0207705_10026499 | Ga0207705_100264992 | 203 |
| 579 | 3300025909 | Ga0207705_10181359 | Ga0207705_101813592 | 203 |
| 580 | 3300025909 | Ga0207705_10342909 | Ga0207705_103429092 | 203 |
| 581 | 3300025911 | Ga0207654_10501962 | Ga0207654_105019622 | 203 |
| 582 | 3300025912 | Ga0207707_10000181 | Ga0207707_1000018147 | 203 |
| 583 | 3300025912 | Ga0207707_10000203 | Ga0207707_1000020330 | 203 |
| 584 | 3300025912 | Ga0207707_10000846 | Ga0207707_100008466 | 203 |
| 585 | 3300025912 | Ga0207707_10006900 | Ga0207707_100069008 | 203 |
| 586 | 3300025912 | Ga0207707_10008967 | Ga0207707_100089672 | 203 |
| 587 | 3300025912 | Ga0207707_10013258 | Ga0207707_100132586 | 203 |
| 588 | 3300025913 | Ga0207695_10002351 | Ga0207695_1000235114 | 203 |
| 589 | 3300025913 | Ga0207695_10014947 | Ga0207695_100149475 | 203 |
| 590 | 3300025914 | Ga0207671_10148244 | Ga0207671_101482443 | 203 |
| 591 | 3300025915 | Ga0207693_10020467 | Ga0207693_100204673 | 203 |
| 592 | 3300025917 | Ga0207660_10000324 | Ga0207660_100003242 | 203 |
| 593 | 3300025917 | Ga0207660_10005067 | Ga0207660_1000506710 | 203 |
| 594 | 3300025917 | Ga0207660_10016000 | Ga0207660_100160002 | 203 |
| 595 | 3300025917 | Ga0207660_10036732 | Ga0207660_100367322 | 203 |
| 596 | 3300025917 | Ga0207660_10062321 | Ga0207660_100623212 | 203 |
| 597 | 3300025919 | Ga0207657_10008206 | Ga0207657_100082062 | 203 |
| 598 | 3300025919 | Ga0207657_10084586 | Ga0207657_100845864 | 203 |
| 599 | 3300025920 | Ga0207649_10000835 | Ga0207649_1000083512 | 203 |
| 600 | 3300025920 | Ga0207649_10004317 | Ga0207649_100043178 | 203 |
| 601 | 3300025920 | Ga0207649_10048759 | Ga0207649_100487592 | 203 |
| 602 | 3300025921 | Ga0207652_10000017 | Ga0207652_10000017158 | 203 |
| 603 | 3300025921 | Ga0207652_10000726 | Ga0207652_1000072624 | 203 |
| 604 | 3300025921 | Ga0207652_10000759 | Ga0207652_100007592 | 203 |
| 605 | 3300025921 | Ga0207652_10021521 | Ga0207652_100215213 | 203 |
| 606 | 3300025921 | Ga0207652_10025885 | Ga0207652_100258856 | 203 |
| 607 | 3300025932 | Ga0207690_10001833 | Ga0207690_100018335 | 203 |
| 608 | 3300025932 | Ga0207690_10026773 | Ga0207690_100267732 | 203 |
| 609 | 3300025932 | Ga0207690_10084247 | Ga0207690_100842472 | 203 |
| 610 | 3300025933 | Ga0207706_10017778 | Ga0207706_100177785 | 203 |
| 611 | 3300025939 | Ga0207665_10018144 | Ga0207665_100181442 | 203 |
| 612 | 3300025944 | Ga0207661_10018367 | Ga0207661_100183672 | 203 |
| 613 | 3300025944 | Ga0207661_10027627 | Ga0207661_100276273 | 203 |
| 614 | 3300025944 | Ga0207661_10168236 | Ga0207661_101682363 | 203 |
| 615 | 3300025945 | Ga0207679_10014117 | Ga0207679_100141174 | 203 |
| 616 | 3300025945 | Ga0207679_10208455 | Ga0207679_102084552 | 203 |
| 617 | 3300025949 | Ga0207667_10000447 | Ga0207667_1000044728 | 203 |
| 618 | 3300025949 | Ga0207667_10000489 | Ga0207667_1000048915 | 203 |
| 619 | 3300025949 | Ga0207667_10055913 | Ga0207667_100559134 | 203 |
| 620 | 3300025949 | Ga0207667_10144688 | Ga0207667_101446882 | 203 |
| 621 | 3300025949 | Ga0207667_10174887 | Ga0207667_101748872 | 203 |
| 622 | 3300025949 | Ga0207667_10203544 | Ga0207667_102035442 | 203 |
| 623 | 3300025981 | Ga0207640_10006018 | Ga0207640_100060182 | 203 |
| 624 | 3300025981 | Ga0207640_10117635 | Ga0207640_101176352 | 203 |
| 625 | 3300026041 | Ga0207639_10012653 | Ga0207639_100126535 | 203 |
| 626 | 3300026041 | Ga0207639_10029105 | Ga0207639_100291056 | 203 |
| 627 | 3300026067 | Ga0207678_10122410 | Ga0207678_101224102 | 203 |
| 628 | 3300026067 | Ga0207678_10388867 | Ga0207678_103888672 | 203 |
| 629 | 3300026067 | Ga0207678_10393108 | Ga0207678_103931082 | 203 |
| 630 | 3300026078 | Ga0207702_10008032 | Ga0207702_100080324 | 203 |
| 631 | 3300026078 | Ga0207702_10025487 | Ga0207702_100254872 | 203 |
| 632 | 3300026078 | Ga0207702_10068668 | Ga0207702_100686683 | 203 |
| 633 | 3300026078 | Ga0207702_10199378 | Ga0207702_101993782 | 203 |
| 634 | 3300026116 | Ga0207674_10000341 | Ga0207674_1000034112 | 203 |
| 635 | 3300026116 | Ga0207674_10039137 | Ga0207674_100391375 | 203 |
| 636 | 3300026116 | Ga0207674_10087758 | Ga0207674_100877582 | 203 |
| 637 | 3300026142 | Ga0207698_10001385 | Ga0207698_100013854 | 203 |
| 638 | 3300026142 | Ga0207698_10002975 | Ga0207698_1000297510 | 203 |
| 639 | 3300026142 | Ga0207698_10118065 | Ga0207698_101180653 | 203 |
| 640 | 3300037418 | Ga0395900_0046132 | Ga0395900_0046132_2317_2943 | 203 |
| 641 | 3300037466 | Ga0395898_0115774 | Ga0395898_0115774_1930_2556 | 203 |
| 642 | 3300037466 | Ga0395898_0266007 | Ga0395898_0266007_293_919 | 203 |
| 643 | 3300038443 | Ga0395901_0030291 | Ga0395901_0030291_440_1066 | 203 |
| 644 | 3300048922 | Ga0496119_0012434 | Ga0496119_0012434_3024_3656 | 203 |
| 645 | 3300048924 | Ga0496121_0140587 | Ga0496121_0140587_560_1183 | 203 |
| 646 | 3300048928 | Ga0496125_0058999 | Ga0496125_0058999_837_1460 | 203 |
| 647 | 3300048929 | Ga0496126_0052739 | Ga0496126_0052739_582_1205 | 203 |
| 648 | 3300049570 | Ga0501033_0051275 | Ga0501033_0051275_1900_2532 | 203 |
| 649 | 3300049570 | Ga0501033_0123340 | Ga0501033_0123340_306_932 | 203 |
| 650 | 3300049571 | Ga0501034_0269958 | Ga0501034_0269958_350_982 | 203 |
| 651 | 3300049572 | Ga0501036_0268666 | Ga0501036_0268666_43_669 | 203 |
| 652 | 3300049574 | Ga0501038_0123922 | Ga0501038_0123922_732_1364 | 203 |
| 653 | 3300049579 | Ga0501043_0024778 | Ga0501043_0024778_1144_1776 | 203 |
| 654 | 3300049580 | Ga0501046_0086498 | Ga0501046_0086498_486_1118 | 203 |
| 655 | 3300049581 | Ga0501047_0269925 | Ga0501047_0269925_527_1159 | 203 |
| 656 | 3300049585 | Ga0501069_0160151 | Ga0501069_0160151_323_949 | 203 |
| 657 | 3300049585 | Ga0501069_0256958 | Ga0501069_0256958_240_866 | 203 |
| 658 | 3300049586 | Ga0501070_0000201 | Ga0501070_0000201_1986_2612 | 203 |
| 659 | 3300049586 | Ga0501070_0038943 | Ga0501070_0038943_1152_1778 | 203 |
| 660 | 3300049586 | Ga0501070_0059770 | Ga0501070_0059770_2005_2631 | 203 |
| 661 | 3300049586 | Ga0501070_0150774 | Ga0501070_0150774_631_1257 | 203 |
| 662 | 3300049586 | Ga0501070_0170066 | Ga0501070_0170066_487_1113 | 203 |
| 663 | 3300049589 | Ga0501073_0336638 | Ga0501073_0336638_352_978 | 203 |
| 664 | 3300049590 | Ga0501074_0035073 | Ga0501074_0035073_799_1425 | 203 |
| 665 | 3300049590 | Ga0501074_0067603 | Ga0501074_0067603_1378_2004 | 203 |
| 666 | 3300049590 | Ga0501074_0076002 | Ga0501074_0076002_1023_1649 | 203 |
| 667 | 3300049741 | Ga0501079_0367054 | Ga0501079_0367054_319_945 | 203 |
| 668 | 3300049742 | Ga0501080_0044729 | Ga0501080_0044729_1036_1662 | 203 |
| 669 | 3300049742 | Ga0501080_0062572 | Ga0501080_0062572_265_891 | 203 |
| 670 | 3300049742 | Ga0501080_0470294 | Ga0501080_0470294_336_968 | 203 |
| 671 | 3300049822 | Ga0501035_0013408 | Ga0501035_0013408_4541_5167 | 203 |
| 672 | 3300049822 | Ga0501035_0089749 | Ga0501035_0089749_1779_2405 | 203 |
| 673 | 3300049822 | Ga0501035_0197647 | Ga0501035_0197647_351_977 | 203 |
| 674 | 3300049823 | Ga0501044_0234726 | Ga0501044_0234726_762_1388 | 203 |
| 675 | 3300049823 | Ga0501044_0365919 | Ga0501044_0365919_273_899 | 203 |
| 676 | 3300053131 | Ga0500652_087960 | Ga0500652_087960_373_990 | 203 |
| 677 | 3300053136 | Ga0500559_0000058 | Ga0500559_0000058_29807_30442 | 203 |
| 678 | iso_pu_bacteria | 2643221563 | 2643832543 | 203 |
| 679 | iso_pu_bacteria | 2643221608 | 2644053662 | 203 |
| 680 | iso_pu_bacteria | 2738541297 | 2738828428 | 203 |
| 681 | iso_pu_bacteria | 2738541357 | 2739152224 | 203 |
| 682 | iso_pu_bacteria | 2738543003 | 2739193755 | 203 |
| 683 | iso_pu_bacteria | 2738543026 | 2739320620 | 203 |
| 684 | iso_pu_bacteria | 2738543029 | 2739338472 | 203 |
| 685 | iso_pu_bacteria | 2857564685 | 2857569941 | 203 |
| 686 | 3300001915 | JGI24741J21665_1011473 | JGI24741J21665_10114732 | 204 |
| 687 | 3300005455 | Ga0070663_100325147 | Ga0070663_1003251472 | 204 |
| 688 | 3300005577 | Ga0068857_100078994 | Ga0068857_1000789942 | 204 |
| 689 | 3300005844 | Ga0068862_100760762 | Ga0068862_1007607622 | 204 |
| 690 | 3300009551 | Ga0105238_10745431 | Ga0105238_107454312 | 204 |
| 691 | 3300013100 | Ga0157373_10347880 | Ga0157373_103478802 | 204 |
| 692 | 3300026067 | Ga0207678_10310626 | Ga0207678_103106262 | 204 |
| 693 | 3300026078 | Ga0207702_10146846 | Ga0207702_101468462 | 204 |
| 694 | 3300026116 | Ga0207674_10063158 | Ga0207674_100631583 | 204 |
| 695 | 3300031250 | Ga0265331_10124406 | Ga0265331_101244063 | 204 |
| 696 | 3300047472 | Ga0495686_0000661 | Ga0495686_0000661_22354_23016 | 204 |
| 697 | 3300049570 | Ga0501033_0000259 | Ga0501033_0000259_710_1336 | 204 |
| 698 | 3300049586 | Ga0501070_0045585 | Ga0501070_0045585_2454_3080 | 204 |
| 699 | 3300049742 | Ga0501080_0019509 | Ga0501080_0019509_5479_6105 | 204 |
| 700 | 3300049822 | Ga0501035_0003843 | Ga0501035_0003843_733_1359 | 204 |
| 701 | 3300053122 | Ga0500608_000056 | Ga0500608_000056_47342_47968 | 204 |
| 702 | 3300053140 | Ga0500573_0000021 | Ga0500573_0000021_26614_27240 | 204 |
| 703 | 3300053156 | Ga0500622_0038650 | Ga0500622_0038650_525_1151 | 204 |
| 704 | iso_pu_bacteria | 2841911363 | 2841913616 | 204 |
| 705 | iso_pu_bacteria | 2841917233 | 2841919363 | 204 |
| 706 | iso_pu_bacteria | 8054302542 | 8054306659 | 204 |
| 707 | 3300003187 | JGI25151J46595_10048568 | JGI25151J46595_100485682 | 205 |
| 708 | 3300003771 | Ga0055526_1003976 | Ga0055526_10039765 | 205 |
| 709 | 3300003775 | Ga0055524_1024025 | Ga0055524_10240252 | 205 |
| 710 | 3300003775 | Ga0055524_1070331 | Ga0055524_10703311 | 205 |
| 711 | 3300003775 | Ga0055524_1070420 | Ga0055524_10704201 | 205 |
| 712 | 3300003781 | Ga0055536_1041988 | Ga0055536_10419882 | 205 |
| 713 | 3300003791 | Ga0055530_10003264 | Ga0055530_100032641 | 205 |
| 714 | 3300003794 | Ga0055531_10025287 | Ga0055531_100252872 | 205 |
| 715 | 3300003794 | Ga0055531_10081551 | Ga0055531_100815511 | 205 |
| 716 | 3300003794 | Ga0055531_10087643 | Ga0055531_100876431 | 205 |
| 717 | 3300004625 | Ga0055543_1001100 | Ga0055543_10011007 | 205 |
| 718 | 3300005262 | Ga0065165_1000101 | Ga0065165_100010124 | 205 |
| 719 | 3300005329 | Ga0070683_100753444 | Ga0070683_1007534442 | 205 |
| 720 | 3300010375 | Ga0105239_11424530 | Ga0105239_114245301 | 205 |
| 721 | 3300021377 | Ga0213874_10204541 | Ga0213874_102045411 | 205 |
| 722 | 3300025273 | Ga0209673_1004973 | Ga0209673_10049732 | 205 |
| 723 | 3300025291 | Ga0209675_1005833 | Ga0209675_10058332 | 205 |
| 724 | 3300025291 | Ga0209675_1022564 | Ga0209675_10225642 | 205 |
| 725 | 3300025292 | Ga0209676_1000196 | Ga0209676_100019697 | 205 |
| 726 | 3300025292 | Ga0209676_1001467 | Ga0209676_10014672 | 205 |
| 727 | 3300025292 | Ga0209676_1002185 | Ga0209676_100218511 | 205 |
| 728 | 3300025292 | Ga0209676_1002212 | Ga0209676_10022129 | 205 |
| 729 | 3300025292 | Ga0209676_1008591 | Ga0209676_10085916 | 205 |
| 730 | 3300025294 | Ga0209025_1001945 | Ga0209025_100194516 | 205 |
| 731 | 3300025295 | Ga0209564_1022642 | Ga0209564_10226423 | 205 |
| 732 | 3300025297 | Ga0209758_1054420 | Ga0209758_10544201 | 205 |
| 733 | 3300025297 | Ga0209758_1066704 | Ga0209758_10667042 | 205 |
| 734 | 3300025298 | Ga0209050_1001542 | Ga0209050_10015421 | 205 |
| 735 | 3300025298 | Ga0209050_1008975 | Ga0209050_10089754 | 205 |
| 736 | 3300025299 | Ga0209256_1002799 | Ga0209256_100279911 | 205 |
| 737 | 3300025299 | Ga0209256_1004756 | Ga0209256_10047562 | 205 |
| 738 | 3300025302 | Ga0207426_1041846 | Ga0207426_10418462 | 205 |
| 739 | 3300025303 | Ga0209051_1032710 | Ga0209051_10327103 | 205 |
| 740 | 3300025304 | Ga0209257_1000065 | Ga0209257_100006542 | 205 |
| 741 | 3300025304 | Ga0209257_1000737 | Ga0209257_100073711 | 205 |
| 742 | 3300025304 | Ga0209257_1000846 | Ga0209257_10008462 | 205 |
| 743 | 3300025304 | Ga0209257_1056445 | Ga0209257_10564452 | 205 |
| 744 | 3300042876 | Ga0451577_0004095 | Ga0451577_0004095_11227_11856 | 205 |
| 745 | 3300044712 | Ga0453684_0320696 | Ga0453684_0320696_583_1212 | 205 |
| 746 | 3300046507 | Ga0495606_0009523 | Ga0495606_0009523_6935_7558 | 205 |
| 747 | 3300047472 | Ga0495686_0003752 | Ga0495686_0003752_4958_5635 | 205 |
| 748 | 3300048914 | Ga0496111_0191031 | Ga0496111_0191031_502_1131 | 205 |
| 749 | 3300048919 | Ga0496116_0170428 | Ga0496116_0170428_488_1117 | 205 |
| 750 | 3300048928 | Ga0496125_0001513 | Ga0496125_0001513_16011_16640 | 205 |
| 751 | 3300049513 | Ga0501290_001270 | Ga0501290_001270_1820_2449 | 205 |
| 752 | 3300049523 | Ga0501300_004769 | Ga0501300_004769_512_1141 | 205 |
| 753 | 3300049580 | Ga0501046_0560948 | Ga0501046_0560948_70_690 | 205 |
| 754 | 3300049581 | Ga0501047_0758572 | Ga0501047_0758572_15_650 | 205 |
| 755 | 3300049762 | Ga0501265_000506 | Ga0501265_000506_429_1058 | 205 |
| 756 | 3300049772 | Ga0501275_000287 | Ga0501275_000287_963_1592 | 205 |
| 757 | 3300053131 | Ga0500652_170828 | Ga0500652_170828_102_734 | 205 |
| 758 | 3300053136 | Ga0500559_0083446 | Ga0500559_0083446_677_1354 | 205 |
| 759 | 3300053156 | Ga0500622_0029876 | Ga0500622_0029876_742_1365 | 205 |
| 760 | iso_pu_bacteria | 2508501128 | 2509146787 | 205 |
| 761 | iso_pu_bacteria | 2593339238 | 2595448798 | 205 |
| 762 | iso_pu_bacteria | 2593339239 | 2595450660 | 205 |
| 763 | iso_pu_bacteria | 2818991440 | 2819564346 | 205 |
| 764 | iso_pu_bacteria | 2842914999 | 2842915788 | 205 |
| 765 | iso_pu_bacteria | 2842918807 | 2842921018 | 205 |
| 766 | iso_pu_bacteria | 2884338543 | 2884338753 | 205 |
| 767 | iso_pu_bacteria | 2904463128 | 2904464989 | 205 |
| 768 | iso_pu_bacteria | 2919085039 | 2919086548 | 205 |
| 769 | iso_pu_bacteria | 2919404418 | 2919407422 | 205 |
| 770 | iso_pu_bacteria | 2953994433 | 2953996282 | 205 |
| 771 | iso_pu_bacteria | 8006926726 | 8006932033 | 205 |
| 772 | 3300003763 | Ga0055529_1000076 | Ga0055529_1000076114 | 206 |
| 773 | 3300003791 | Ga0055530_10005644 | Ga0055530_100056442 | 206 |
| 774 | 3300003794 | Ga0055531_10001002 | Ga0055531_1000100224 | 206 |
| 775 | 3300005355 | Ga0070671_100270334 | Ga0070671_1002703342 | 206 |
| 776 | 3300005367 | Ga0070667_100805793 | Ga0070667_1008057931 | 206 |
| 777 | 3300005539 | Ga0068853_100070406 | Ga0068853_1000704064 | 206 |
| 778 | 3300005543 | Ga0070672_100064190 | Ga0070672_1000641903 | 206 |
| 779 | 3300005618 | Ga0068864_100244820 | Ga0068864_1002448203 | 206 |
| 780 | 3300005718 | Ga0068866_10197397 | Ga0068866_101973972 | 206 |
| 781 | 3300005842 | Ga0068858_100449226 | Ga0068858_1004492262 | 206 |
| 782 | 3300006237 | Ga0097621_100043182 | Ga0097621_1000431824 | 206 |
| 783 | 3300006358 | Ga0068871_100053473 | Ga0068871_1000534734 | 206 |
| 784 | 3300006931 | Ga0097620_101224099 | Ga0097620_1012240992 | 206 |
| 785 | 3300009036 | Ga0105244_10009858 | Ga0105244_100098586 | 206 |
| 786 | 3300009092 | Ga0105250_10000005 | Ga0105250_10000005215 | 206 |
| 787 | 3300009177 | Ga0105248_10394626 | Ga0105248_103946262 | 206 |
| 788 | 3300009545 | Ga0105237_10050473 | Ga0105237_100504732 | 206 |
| 789 | 3300012512 | Ga0157327_1013548 | Ga0157327_10135482 | 206 |
| 790 | 3300013104 | Ga0157370_10176959 | Ga0157370_101769593 | 206 |
| 791 | 3300014326 | Ga0157380_10481611 | Ga0157380_104816112 | 206 |
| 792 | 3300014497 | Ga0182008_10003366 | Ga0182008_100033668 | 206 |
| 793 | 3300014968 | Ga0157379_10000199 | Ga0157379_1000019934 | 206 |
| 794 | 3300015261 | Ga0182006_1000133 | Ga0182006_100013382 | 206 |
| 795 | 3300015265 | Ga0182005_1009656 | Ga0182005_10096562 | 206 |
| 796 | 3300017792 | Ga0163161_10005751 | Ga0163161_100057514 | 206 |
| 797 | 3300025245 | Ga0207425_1000950 | Ga0207425_100095010 | 206 |
| 798 | 3300025292 | Ga0209676_1000243 | Ga0209676_10002432 | 206 |
| 799 | 3300025294 | Ga0209025_1006637 | Ga0209025_10066377 | 206 |
| 800 | 3300025295 | Ga0209564_1000011 | Ga0209564_1000011573 | 206 |
| 801 | 3300025297 | Ga0209758_1001782 | Ga0209758_100178214 | 206 |
| 802 | 3300025298 | Ga0209050_1000244 | Ga0209050_10002442 | 206 |
| 803 | 3300025304 | Ga0209257_1000140 | Ga0209257_1000140121 | 206 |
| 804 | 3300025711 | Ga0207696_1000181 | Ga0207696_100018144 | 206 |
| 805 | 3300025728 | Ga0207655_1003240 | Ga0207655_100324011 | 206 |
| 806 | 3300025931 | Ga0207644_10067091 | Ga0207644_100670914 | 206 |
| 807 | 3300025940 | Ga0207691_10049529 | Ga0207691_100495295 | 206 |
| 808 | 3300025941 | Ga0207711_10025799 | Ga0207711_100257993 | 206 |
| 809 | 3300026035 | Ga0207703_10463520 | Ga0207703_104635202 | 206 |
| 810 | 3300026041 | Ga0207639_10080835 | Ga0207639_100808351 | 206 |
| 811 | 3300031731 | Ga0307405_10218475 | Ga0307405_102184752 | 206 |
| 812 | 3300032126 | Ga0307415_100031417 | Ga0307415_1000314173 | 206 |
| 813 | 3300035114 | Ga0373939_0135111 | Ga0373939_0135111_190_819 | 206 |
| 814 | 3300041404 | Ga0439436_0000004 | Ga0439436_0000004_85487_86113 | 206 |
| 815 | 3300041406 | Ga0439439_0027845 | Ga0439439_0027845_729_1361 | 206 |
| 816 | 3300041410 | Ga0439461_0000338 | Ga0439461_0000338_762_1394 | 206 |
| 817 | 3300041413 | Ga0439465_0001362 | Ga0439465_0001362_731_1363 | 206 |
| 818 | 3300041413 | Ga0439465_0012861 | Ga0439465_0012861_527_1153 | 206 |
| 819 | 3300041997 | Ga0439431_0006417 | Ga0439431_0006417_1803_2435 | 206 |
| 820 | 3300042002 | Ga0439442_002014 | Ga0439442_002014_824_1456 | 206 |
| 821 | 3300042004 | Ga0439445_0000584 | Ga0439445_0000584_6563_7195 | 206 |
| 822 | 3300042006 | Ga0439432_001838 | Ga0439432_001838_7080_7712 | 206 |
| 823 | 3300042015 | Ga0439462_0001500 | Ga0439462_0001500_1123_1755 | 206 |
| 824 | 3300042435 | Ga0439434_0000210 | Ga0439434_0000210_11892_12524 | 206 |
| 825 | 3300044658 | Ga0466972_0087501 | Ga0466972_0087501_400_1020 | 206 |
| 826 | 3300044735 | Ga0466968_0032371 | Ga0466968_0032371_867_1499 | 206 |
| 827 | 3300046452 | Ga0495617_000018 | Ga0495617_000018_104442_105071 | 206 |
| 828 | 3300046460 | Ga0495638_0025571 | Ga0495638_0025571_608_1237 | 206 |
| 829 | 3300046471 | Ga0495650_0000067 | Ga0495650_0000067_188253_188882 | 206 |
| 830 | 3300046471 | Ga0495650_0000170 | Ga0495650_0000170_74775_75404 | 206 |
| 831 | 3300046471 | Ga0495650_0000932 | Ga0495650_0000932_32477_33106 | 206 |
| 832 | 3300046474 | Ga0495605_0000107 | Ga0495605_0000107_92459_93088 | 206 |
| 833 | 3300046492 | Ga0495585_0002320 | Ga0495585_0002320_791_1420 | 206 |
| 834 | 3300046501 | Ga0495607_0066061 | Ga0495607_0066061_1096_1725 | 206 |
| 835 | 3300046507 | Ga0495606_0000118 | Ga0495606_0000118_74245_74874 | 206 |
| 836 | 3300046512 | Ga0495610_0000012 | Ga0495610_0000012_293580_294209 | 206 |
| 837 | 3300046512 | Ga0495610_0000261 | Ga0495610_0000261_840_1466 | 206 |
| 838 | 3300046512 | Ga0495610_0002368 | Ga0495610_0002368_6250_6879 | 206 |
| 839 | 3300046520 | Ga0495637_0000342 | Ga0495637_0000342_34341_34970 | 206 |
| 840 | 3300046524 | Ga0495648_0012310 | Ga0495648_0012310_3726_4355 | 206 |
| 841 | 3300046530 | Ga0495654_0000011 | Ga0495654_0000011_245877_246506 | 206 |
| 842 | 3300046558 | Ga0495633_0013550 | Ga0495633_0013550_2862_3491 | 206 |
| 843 | 3300046616 | Ga0495668_0000137 | Ga0495668_0000137_36156_36785 | 206 |
| 844 | 3300046616 | Ga0495668_0000983 | Ga0495668_0000983_1610_2239 | 206 |
| 845 | 3300046660 | Ga0495625_0017582 | Ga0495625_0017582_1198_1827 | 206 |
| 846 | 3300046660 | Ga0495625_0110131 | Ga0495625_0110131_835_1464 | 206 |
| 847 | 3300046665 | Ga0495661_0108212 | Ga0495661_0108212_180_809 | 206 |
| 848 | 3300046691 | Ga0495670_0011181 | Ga0495670_0011181_673_1299 | 206 |
| 849 | 3300046692 | Ga0495671_0000006 | Ga0495671_0000006_201274_201903 | 206 |
| 850 | 3300046810 | Ga0495660_0004327 | Ga0495660_0004327_7139_7768 | 206 |
| 851 | 3300047446 | Ga0495679_004248 | Ga0495679_004248_2734_3363 | 206 |
| 852 | 3300047469 | Ga0495673_0000050 | Ga0495673_0000050_76656_77285 | 206 |
| 853 | 3300047472 | Ga0495686_0022911 | Ga0495686_0022911_2410_3039 | 206 |
| 854 | 3300047472 | Ga0495686_0066613 | Ga0495686_0066613_1217_1846 | 206 |
| 855 | 3300048904 | Ga0496101_0319910 | Ga0496101_0319910_495_1127 | 206 |
| 856 | 3300048910 | Ga0496107_0172724 | Ga0496107_0172724_98_730 | 206 |
| 857 | 3300048911 | Ga0496108_0056207 | Ga0496108_0056207_982_1614 | 206 |
| 858 | 3300048912 | Ga0496109_0118637 | Ga0496109_0118637_1710_2342 | 206 |
| 859 | 3300048913 | Ga0496110_0112716 | Ga0496110_0112716_133_765 | 206 |
| 860 | 3300048914 | Ga0496111_0094542 | Ga0496111_0094542_825_1457 | 206 |
| 861 | 3300048917 | Ga0496114_0007473 | Ga0496114_0007473_1750_2382 | 206 |
| 862 | 3300048919 | Ga0496116_0027637 | Ga0496116_0027637_855_1484 | 206 |
| 863 | 3300048922 | Ga0496119_0036466 | Ga0496119_0036466_1587_2213 | 206 |
| 864 | 3300048923 | Ga0496120_0213239 | Ga0496120_0213239_160_786 | 206 |
| 865 | 3300053125 | Ga0500618_000476 | Ga0500618_000476_3712_4341 | 206 |
| 866 | 3300053134 | Ga0500658_0005690 | Ga0500658_0005690_2870_3499 | 206 |
| 867 | 3300053730 | Ga0500645_038014 | Ga0500645_038014_504_1133 | 206 |
| 868 | iso_pu_bacteria | 2643221733 | 2644727597 | 206 |
| 869 | iso_pu_bacteria | 2718218334 | 2721025408 | 206 |
| 870 | iso_pu_bacteria | 2734482264 | 2735834615 | 206 |
| 871 | iso_pu_bacteria | 2738543009 | 2739226073 | 206 |
| 872 | 3300001979 | JGI24740J21852_10008770 | JGI24740J21852_100087705 | 207 |
| 873 | 3300005539 | Ga0068853_100545339 | Ga0068853_1005453391 | 207 |
| 874 | 3300005616 | Ga0068852_100036629 | Ga0068852_1000366293 | 207 |
| 875 | 3300009093 | Ga0105240_10008765 | Ga0105240_1000876515 | 207 |
| 876 | 3300009093 | Ga0105240_10463790 | Ga0105240_104637901 | 207 |
| 877 | 3300009177 | Ga0105248_11363830 | Ga0105248_113638302 | 207 |
| 878 | 3300009551 | Ga0105238_10000109 | Ga0105238_100001096 | 207 |
| 879 | 3300010375 | Ga0105239_10011676 | Ga0105239_100116767 | 207 |
| 880 | 3300013306 | Ga0163162_10000324 | Ga0163162_1000032426 | 207 |
| 881 | 3300017792 | Ga0163161_10198269 | Ga0163161_101982692 | 207 |
| 882 | 3300025304 | Ga0209257_1000155 | Ga0209257_1000155154 | 207 |
| 883 | 3300025913 | Ga0207695_10023535 | Ga0207695_100235359 | 207 |
| 884 | 3300025914 | Ga0207671_10004748 | Ga0207671_100047487 | 207 |
| 885 | 3300026041 | Ga0207639_10444592 | Ga0207639_104445921 | 207 |
| 886 | 3300038705 | Ga0237819_00145 | Ga0237819_00145_25252_25881 | 207 |
| 887 | 3300039145 | Ga0237816_03427 | Ga0237816_03427_437_1066 | 207 |
| 888 | 3300046460 | Ga0495638_0001219 | Ga0495638_0001219_22329_22958 | 207 |
| 889 | 3300046513 | Ga0495616_0000001 | Ga0495616_0000001_421005_421640 | 207 |
| 890 | 3300046519 | Ga0495632_0000196 | Ga0495632_0000196_59526_60155 | 207 |
| 891 | 3300046616 | Ga0495668_0001476 | Ga0495668_0001476_993_1622 | 207 |
| 892 | 3300046648 | Ga0495611_0035087 | Ga0495611_0035087_1343_1975 | 207 |
| 893 | 3300046660 | Ga0495625_0009860 | Ga0495625_0009860_6945_7574 | 207 |
| 894 | 3300046810 | Ga0495660_0000669 | Ga0495660_0000669_126_755 | 207 |
| 895 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_1352912_1353541 | 207 |
| 896 | 3300048089 | Ga0495614_0028898 | Ga0495614_0028898_558_1217 | 207 |
| 897 | 3300048905 | Ga0496102_0000315 | Ga0496102_0000315_20903_21532 | 207 |
| 898 | 3300048905 | Ga0496102_0614110 | Ga0496102_0614110_228_857 | 207 |
| 899 | 3300048906 | Ga0496103_0001484 | Ga0496103_0001484_820_1449 | 207 |
| 900 | 3300048919 | Ga0496116_0008944 | Ga0496116_0008944_518_1147 | 207 |
| 901 | 3300048920 | Ga0496117_0000484 | Ga0496117_0000484_44089_44718 | 207 |
| 902 | 3300048920 | Ga0496117_0016813 | Ga0496117_0016813_899_1531 | 207 |
| 903 | 3300048921 | Ga0496118_0000486 | Ga0496118_0000486_20964_21593 | 207 |
| 904 | 3300048921 | Ga0496118_0063391 | Ga0496118_0063391_1328_1960 | 207 |
| 905 | 3300048921 | Ga0496118_0101584 | Ga0496118_0101584_118_750 | 207 |
| 906 | 3300048924 | Ga0496121_0000515 | Ga0496121_0000515_71813_72445 | 207 |
| 907 | 3300048924 | Ga0496121_0000770 | Ga0496121_0000770_570_1199 | 207 |
| 908 | 3300048924 | Ga0496121_0023471 | Ga0496121_0023471_4620_5252 | 207 |
| 909 | 3300048924 | Ga0496121_0050373 | Ga0496121_0050373_925_1554 | 207 |
| 910 | 3300048928 | Ga0496125_0078631 | Ga0496125_0078631_851_1480 | 207 |
| 911 | 3300048928 | Ga0496125_0079049 | Ga0496125_0079049_1228_1857 | 207 |
| 912 | 3300048929 | Ga0496126_0007075 | Ga0496126_0007075_3494_4126 | 207 |
| 913 | 3300048929 | Ga0496126_0048208 | Ga0496126_0048208_1049_1678 | 207 |
| 914 | 3300049580 | Ga0501046_0328112 | Ga0501046_0328112_85_717 | 207 |
| 915 | 3300049742 | Ga0501080_0111958 | Ga0501080_0111958_612_1244 | 207 |
| 916 | 3300049822 | Ga0501035_0426974 | Ga0501035_0426974_305_937 | 207 |
| 917 | 3300049823 | Ga0501044_0035800 | Ga0501044_0035800_3788_4420 | 207 |
| 918 | iso_pu_bacteria | 2808606401 | 2809061852 | 207 |
| 919 | iso_pu_bacteria | 2808606404 | 2809077816 | 207 |
| 920 | iso_pu_bacteria | 2808606405 | 2809082476 | 207 |
| 921 | iso_pu_bacteria | 2880518877 | 2880519965 | 207 |
| 922 | 3300002075 | JGI24738J21930_10000448 | JGI24738J21930_100004486 | 208 |
| 923 | 3300003479 | Ga0006556J51387_1032851 | Ga0006556J51387_10328512 | 208 |
| 924 | 3300003565 | Ga0006560J51390_1037325 | Ga0006560J51390_10373251 | 208 |
| 925 | 3300003567 | Ga0006554J51385_1031149 | Ga0006554J51385_10311492 | 208 |
| 926 | 3300003575 | Ga0007409J51694_1008758 | Ga0007409J51694_10087583 | 208 |
| 927 | 3300003578 | Ga0006562J51391_1044196 | Ga0006562J51391_10441962 | 208 |
| 928 | 3300005262 | Ga0065165_1000386 | Ga0065165_100038627 | 208 |
| 929 | 3300005289 | Ga0065704_10393488 | Ga0065704_103934881 | 208 |
| 930 | 3300005353 | Ga0070669_100065888 | Ga0070669_1000658882 | 208 |
| 931 | 3300005355 | Ga0070671_100118023 | Ga0070671_1001180233 | 208 |
| 932 | 3300005459 | Ga0068867_100496952 | Ga0068867_1004969522 | 208 |
| 933 | 3300005544 | Ga0070686_100321305 | Ga0070686_1003213052 | 208 |
| 934 | 3300005548 | Ga0070665_100217358 | Ga0070665_1002173583 | 208 |
| 935 | 3300006186 | Ga0075369_10202324 | Ga0075369_102023242 | 208 |
| 936 | 3300009176 | Ga0105242_10198237 | Ga0105242_101982372 | 208 |
| 937 | 3300009551 | Ga0105238_10285677 | Ga0105238_102856773 | 208 |
| 938 | 3300010375 | Ga0105239_10501147 | Ga0105239_105011472 | 208 |
| 939 | 3300013104 | Ga0157370_10004006 | Ga0157370_100040067 | 208 |
| 940 | 3300013308 | Ga0157375_10005255 | Ga0157375_1000525511 | 208 |
| 941 | 3300015265 | Ga0182005_1000027 | Ga0182005_100002755 | 208 |
| 942 | 3300025226 | Ga0209674_101868 | Ga0209674_1018685 | 208 |
| 943 | 3300025233 | Ga0209437_102902 | Ga0209437_1029022 | 208 |
| 944 | 3300025254 | Ga0209148_1001455 | Ga0209148_10014558 | 208 |
| 945 | 3300025258 | Ga0209129_1000647 | Ga0209129_100064710 | 208 |
| 946 | 3300025297 | Ga0209758_1019590 | Ga0209758_10195903 | 208 |
| 947 | 3300025302 | Ga0207426_1018654 | Ga0207426_10186542 | 208 |
| 948 | 3300025303 | Ga0209051_1017203 | Ga0209051_10172032 | 208 |
| 949 | 3300025304 | Ga0209257_1045513 | Ga0209257_10455132 | 208 |
| 950 | 3300025924 | Ga0207694_10335999 | Ga0207694_103359992 | 208 |
| 951 | 3300025927 | Ga0207687_10698688 | Ga0207687_106986881 | 208 |
| 952 | 3300025932 | Ga0207690_10104732 | Ga0207690_101047321 | 208 |
| 953 | 3300025934 | Ga0207686_10149641 | Ga0207686_101496412 | 208 |
| 954 | 3300025940 | Ga0207691_10202201 | Ga0207691_102022012 | 208 |
| 955 | 3300026089 | Ga0207648_10651237 | Ga0207648_106512372 | 208 |
| 956 | 3300026142 | Ga0207698_10322420 | Ga0207698_103224202 | 208 |
| 957 | 3300028379 | Ga0268266_10177480 | Ga0268266_101774802 | 208 |
| 958 | 3300031911 | Ga0307412_10000575 | Ga0307412_100005752 | 208 |
| 959 | 3300037312 | Ga0395899_0000086 | Ga0395899_0000086_147752_148387 | 208 |
| 960 | 3300037418 | Ga0395900_0749780 | Ga0395900_0749780_245_880 | 208 |
| 961 | 3300037471 | Ga0395905_0199330 | Ga0395905_0199330_982_1617 | 208 |
| 962 | 3300038443 | Ga0395901_0000263 | Ga0395901_0000263_121_756 | 208 |
| 963 | 3300041501 | Ga0451845_0500926 | Ga0451845_0500926_397_1035 | 208 |
| 964 | 3300044735 | Ga0466968_0018240 | Ga0466968_0018240_1422_2057 | 208 |
| 965 | 3300044842 | Ga0466957_0065217 | Ga0466957_0065217_1533_2168 | 208 |
| 966 | 3300046457 | Ga0495590_0001652 | Ga0495590_0001652_7927_8571 | 208 |
| 967 | 3300046473 | Ga0495582_0040520 | Ga0495582_0040520_1161_1805 | 208 |
| 968 | 3300046491 | Ga0495584_0000002 | Ga0495584_0000002_419100_419735 | 208 |
| 969 | 3300046492 | Ga0495585_0000003 | Ga0495585_0000003_72665_73300 | 208 |
| 970 | 3300046492 | Ga0495585_0096768 | Ga0495585_0096768_23_658 | 208 |
| 971 | 3300046499 | Ga0495594_0078129 | Ga0495594_0078129_418_1062 | 208 |
| 972 | 3300046499 | Ga0495594_0089973 | Ga0495594_0089973_168_803 | 208 |
| 973 | 3300046501 | Ga0495607_0018714 | Ga0495607_0018714_2892_3527 | 208 |
| 974 | 3300046506 | Ga0495583_0022480 | Ga0495583_0022480_1757_2392 | 208 |
| 975 | 3300046507 | Ga0495606_0303889 | Ga0495606_0303889_82_717 | 208 |
| 976 | 3300046512 | Ga0495610_0000303 | Ga0495610_0000303_917_1561 | 208 |
| 977 | 3300046513 | Ga0495616_0000228 | Ga0495616_0000228_44830_45465 | 208 |
| 978 | 3300046515 | Ga0495620_0027255 | Ga0495620_0027255_183_818 | 208 |
| 979 | 3300046517 | Ga0495630_0095365 | Ga0495630_0095365_774_1418 | 208 |
| 980 | 3300046517 | Ga0495630_0371981 | Ga0495630_0371981_442_1077 | 208 |
| 981 | 3300046522 | Ga0495643_0000341 | Ga0495643_0000341_55984_56628 | 208 |
| 982 | 3300046524 | Ga0495648_0000171 | Ga0495648_0000171_72920_73555 | 208 |
| 983 | 3300046524 | Ga0495648_0192516 | Ga0495648_0192516_350_994 | 208 |
| 984 | 3300046526 | Ga0495666_0007754 | Ga0495666_0007754_747_1391 | 208 |
| 985 | 3300046526 | Ga0495666_0012710 | Ga0495666_0012710_2926_3561 | 208 |
| 986 | 3300046526 | Ga0495666_0271178 | Ga0495666_0271178_66_701 | 208 |
| 987 | 3300046528 | Ga0495642_0008640 | Ga0495642_0008640_3224_3859 | 208 |
| 988 | 3300046528 | Ga0495642_0134275 | Ga0495642_0134275_397_1032 | 208 |
| 989 | 3300046529 | Ga0495652_0139886 | Ga0495652_0139886_491_1135 | 208 |
| 990 | 3300046529 | Ga0495652_0141168 | Ga0495652_0141168_540_1175 | 208 |
| 991 | 3300046531 | Ga0495665_0000780 | Ga0495665_0000780_845_1480 | 208 |
| 992 | 3300046531 | Ga0495665_0005867 | Ga0495665_0005867_3940_4584 | 208 |
| 993 | 3300046535 | Ga0495586_0019616 | Ga0495586_0019616_1746_2381 | 208 |
| 994 | 3300046535 | Ga0495586_0148621 | Ga0495586_0148621_256_900 | 208 |
| 995 | 3300046536 | Ga0495587_0067776 | Ga0495587_0067776_1180_1824 | 208 |
| 996 | 3300046536 | Ga0495587_0085335 | Ga0495587_0085335_328_963 | 208 |
| 997 | 3300046536 | Ga0495587_0110097 | Ga0495587_0110097_775_1410 | 208 |
| 998 | 3300046557 | Ga0495622_0021124 | Ga0495622_0021124_2243_2878 | 208 |
| 999 | 3300046558 | Ga0495633_0005961 | Ga0495633_0005961_5761_6396 | 208 |
| 1000 | 3300046558 | Ga0495633_0067299 | Ga0495633_0067299_352_1014 | 208 |
| 1001 | 3300046616 | Ga0495668_0095350 | Ga0495668_0095350_102_764 | 208 |
| 1002 | 3300046616 | Ga0495668_0193207 | Ga0495668_0193207_49_711 | 208 |
| 1003 | 3300046642 | Ga0495634_0031183 | Ga0495634_0031183_2062_2706 | 208 |
| 1004 | 3300046660 | Ga0495625_0075451 | Ga0495625_0075451_804_1439 | 208 |
| 1005 | 3300046665 | Ga0495661_0087338 | Ga0495661_0087338_895_1530 | 208 |
| 1006 | 3300046674 | Ga0495588_0034196 | Ga0495588_0034196_921_1556 | 208 |
| 1007 | 3300046674 | Ga0495588_0083805 | Ga0495588_0083805_119_781 | 208 |
| 1008 | 3300046674 | Ga0495588_0117530 | Ga0495588_0117530_405_1040 | 208 |
| 1009 | 3300046679 | Ga0495623_0016435 | Ga0495623_0016435_2924_3559 | 208 |
| 1010 | 3300046689 | Ga0495613_0167018 | Ga0495613_0167018_10_645 | 208 |
| 1011 | 3300046690 | Ga0495624_0005352 | Ga0495624_0005352_7884_8546 | 208 |
| 1012 | 3300046692 | Ga0495671_0055817 | Ga0495671_0055817_897_1559 | 208 |
| 1013 | 3300046692 | Ga0495671_0126603 | Ga0495671_0126603_499_1134 | 208 |
| 1014 | 3300046809 | Ga0495600_0037890 | Ga0495600_0037890_1448_2083 | 208 |
| 1015 | 3300046809 | Ga0495600_0073845 | Ga0495600_0073845_792_1436 | 208 |
| 1016 | 3300047315 | Ga0495581_0039471 | Ga0495581_0039471_1245_1880 | 208 |
| 1017 | 3300047315 | Ga0495581_0059343 | Ga0495581_0059343_467_1129 | 208 |
| 1018 | 3300047315 | Ga0495581_0113646 | Ga0495581_0113646_256_918 | 208 |
| 1019 | 3300047317 | Ga0495604_0077424 | Ga0495604_0077424_821_1465 | 208 |
| 1020 | 3300047320 | Ga0495672_0054754 | Ga0495672_0054754_1453_2082 | 208 |
| 1021 | 3300047321 | Ga0495676_0162272 | Ga0495676_0162272_753_1388 | 208 |
| 1022 | 3300047322 | Ga0495680_0225456 | Ga0495680_0225456_609_1253 | 208 |
| 1023 | 3300047444 | Ga0495675_0042443 | Ga0495675_0042443_1375_2019 | 208 |
| 1024 | 3300047444 | Ga0495675_0310952 | Ga0495675_0310952_24_659 | 208 |
| 1025 | 3300047472 | Ga0495686_0000028 | Ga0495686_0000028_79678_80313 | 208 |
| 1026 | 3300047673 | Ga0495593_0023745 | Ga0495593_0023745_1767_2429 | 208 |
| 1027 | 3300048088 | Ga0495602_0033930 | Ga0495602_0033930_3643_4287 | 208 |
| 1028 | 3300048088 | Ga0495602_0087077 | Ga0495602_0087077_1155_1790 | 208 |
| 1029 | 3300048090 | Ga0495615_0000440 | Ga0495615_0000440_4713_5354 | 208 |
| 1030 | 3300048917 | Ga0496114_0652438 | Ga0496114_0652438_246_881 | 208 |
| 1031 | 3300048918 | Ga0496115_0007853 | Ga0496115_0007853_6393_7022 | 208 |
| 1032 | 3300048918 | Ga0496115_0445070 | Ga0496115_0445070_245_880 | 208 |
| 1033 | 3300048919 | Ga0496116_0222156 | Ga0496116_0222156_302_940 | 208 |
| 1034 | 3300048921 | Ga0496118_0001019 | Ga0496118_0001019_15428_16063 | 208 |
| 1035 | 3300048921 | Ga0496118_0153253 | Ga0496118_0153253_766_1401 | 208 |
| 1036 | 3300048925 | Ga0496122_0013233 | Ga0496122_0013233_712_1353 | 208 |
| 1037 | 3300048926 | Ga0496123_0001685 | Ga0496123_0001685_28304_28945 | 208 |
| 1038 | 3300048927 | Ga0496124_0028088 | Ga0496124_0028088_3213_3848 | 208 |
| 1039 | 3300048927 | Ga0496124_0343835 | Ga0496124_0343835_195_827 | 208 |
| 1040 | 3300049459 | Ga0495678_000288 | Ga0495678_000288_791_1426 | 208 |
| 1041 | 3300049571 | Ga0501034_0195238 | Ga0501034_0195238_628_1260 | 208 |
| 1042 | 3300049582 | Ga0501048_0605371 | Ga0501048_0605371_121_759 | 208 |
| 1043 | 3300049823 | Ga0501044_0001901 | Ga0501044_0001901_22727_23365 | 208 |
| 1044 | 3300050516 | nmdc:mga0sz30_33831_c2 | nmdc:mga0sz30_33831_c2_73_708 | 208 |
| 1045 | 3300053139 | Ga0500568_0045537 | Ga0500568_0045537_869_1501 | 208 |
| 1046 | 3300053156 | Ga0500622_0007115 | Ga0500622_0007115_748_1380 | 208 |
| 1047 | 2162886007 | SwRhRL2b_contig_3207873 | SwRhRL2b_0996.00002580 | 209 |
| 1048 | 3300005327 | Ga0070658_10000464 | Ga0070658_1000046433 | 209 |
| 1049 | 3300005335 | Ga0070666_10000012 | Ga0070666_10000012101 | 209 |
| 1050 | 3300005337 | Ga0070682_100812522 | Ga0070682_1008125221 | 209 |
| 1051 | 3300005367 | Ga0070667_100029599 | Ga0070667_1000295993 | 209 |
| 1052 | 3300005539 | Ga0068853_100342344 | Ga0068853_1003423441 | 209 |
| 1053 | 3300005578 | Ga0068854_100417520 | Ga0068854_1004175202 | 209 |
| 1054 | 3300005843 | Ga0068860_100230707 | Ga0068860_1002307073 | 209 |
| 1055 | 3300005937 | Ga0081455_10000120 | Ga0081455_1000012025 | 209 |
| 1056 | 3300006353 | Ga0075370_10226356 | Ga0075370_102263562 | 209 |
| 1057 | 3300009101 | Ga0105247_10000719 | Ga0105247_1000071919 | 209 |
| 1058 | 3300009177 | Ga0105248_10711288 | Ga0105248_107112882 | 209 |
| 1059 | 3300009177 | Ga0105248_11055962 | Ga0105248_110559622 | 209 |
| 1060 | 3300009551 | Ga0105238_10707001 | Ga0105238_107070012 | 209 |
| 1061 | 3300010375 | Ga0105239_10214394 | Ga0105239_102143943 | 209 |
| 1062 | 3300013104 | Ga0157370_10064244 | Ga0157370_100642444 | 209 |
| 1063 | 3300013308 | Ga0157375_10216357 | Ga0157375_102163572 | 209 |
| 1064 | 3300014497 | Ga0182008_10045595 | Ga0182008_100455952 | 209 |
| 1065 | 3300015261 | Ga0182006_1000041 | Ga0182006_100004198 | 209 |
| 1066 | 3300015262 | Ga0182007_10004669 | Ga0182007_100046694 | 209 |
| 1067 | 3300017792 | Ga0163161_10007960 | Ga0163161_100079602 | 209 |
| 1068 | 3300025900 | Ga0207710_10003656 | Ga0207710_100036565 | 209 |
| 1069 | 3300025900 | Ga0207710_10144941 | Ga0207710_101449412 | 209 |
| 1070 | 3300025901 | Ga0207688_10345180 | Ga0207688_103451802 | 209 |
| 1071 | 3300025903 | Ga0207680_10000013 | Ga0207680_10000013101 | 209 |
| 1072 | 3300025909 | Ga0207705_10004077 | Ga0207705_1000407710 | 209 |
| 1073 | 3300025920 | Ga0207649_10198589 | Ga0207649_101985892 | 209 |
| 1074 | 3300025924 | Ga0207694_10000122 | Ga0207694_1000012256 | 209 |
| 1075 | 3300025949 | Ga0207667_10497627 | Ga0207667_104976272 | 209 |
| 1076 | 3300025986 | Ga0207658_10191811 | Ga0207658_101918112 | 209 |
| 1077 | 3300028379 | Ga0268266_10000021 | Ga0268266_10000021104 | 209 |
| 1078 | 3300028380 | Ga0268265_10216500 | Ga0268265_102165002 | 209 |
| 1079 | 3300028381 | Ga0268264_10249649 | Ga0268264_102496492 | 209 |
| 1080 | 3300028556 | Ga0265337_1003670 | Ga0265337_10036705 | 209 |
| 1081 | 3300028558 | Ga0265326_10003092 | Ga0265326_100030922 | 209 |
| 1082 | 3300028563 | Ga0265319_1000598 | Ga0265319_10005982 | 209 |
| 1083 | 3300028573 | Ga0265334_10000692 | Ga0265334_100006927 | 209 |
| 1084 | 3300028577 | Ga0265318_10005512 | Ga0265318_100055127 | 209 |
| 1085 | 3300028653 | Ga0265323_10000487 | Ga0265323_100004879 | 209 |
| 1086 | 3300028666 | Ga0265336_10001123 | Ga0265336_100011239 | 209 |
| 1087 | 3300028794 | Ga0307515_10327313 | Ga0307515_103273132 | 209 |
| 1088 | 3300028800 | Ga0265338_10000094 | Ga0265338_10000094147 | 209 |
| 1089 | 3300029957 | Ga0265324_10001770 | Ga0265324_100017708 | 209 |
| 1090 | 3300031456 | Ga0307513_10304043 | Ga0307513_103040432 | 209 |
| 1091 | 3300031507 | Ga0307509_10261629 | Ga0307509_102616292 | 209 |
| 1092 | 3300033180 | Ga0307510_10003060 | Ga0307510_1000306012 | 209 |
| 1093 | 3300033180 | Ga0307510_10155503 | Ga0307510_101555033 | 209 |
| 1094 | 3300037418 | Ga0395900_0097263 | Ga0395900_0097263_507_1193 | 209 |
| 1095 | 3300041459 | Ga0451800_0510821 | Ga0451800_0510821_55_684 | 209 |
| 1096 | 3300046452 | Ga0495617_000071 | Ga0495617_000071_81466_82104 | 209 |
| 1097 | 3300046452 | Ga0495617_000222 | Ga0495617_000222_928_1566 | 209 |
| 1098 | 3300046457 | Ga0495590_0046903 | Ga0495590_0046903_522_1160 | 209 |
| 1099 | 3300046460 | Ga0495638_0000041 | Ga0495638_0000041_160631_161269 | 209 |
| 1100 | 3300046471 | Ga0495650_0000920 | Ga0495650_0000920_12458_13096 | 209 |
| 1101 | 3300046471 | Ga0495650_0001241 | Ga0495650_0001241_25745_26383 | 209 |
| 1102 | 3300046471 | Ga0495650_0051957 | Ga0495650_0051957_114_752 | 209 |
| 1103 | 3300046491 | Ga0495584_0002229 | Ga0495584_0002229_4522_5160 | 209 |
| 1104 | 3300046492 | Ga0495585_0000008 | Ga0495585_0000008_90972_91610 | 209 |
| 1105 | 3300046492 | Ga0495585_0000303 | Ga0495585_0000303_309_947 | 209 |
| 1106 | 3300046501 | Ga0495607_0000141 | Ga0495607_0000141_903_1541 | 209 |
| 1107 | 3300046506 | Ga0495583_0006252 | Ga0495583_0006252_5306_5944 | 209 |
| 1108 | 3300046507 | Ga0495606_0000117 | Ga0495606_0000117_51395_52033 | 209 |
| 1109 | 3300046507 | Ga0495606_0001825 | Ga0495606_0001825_24886_25524 | 209 |
| 1110 | 3300046507 | Ga0495606_0040331 | Ga0495606_0040331_1120_1758 | 209 |
| 1111 | 3300046513 | Ga0495616_0000002 | Ga0495616_0000002_48354_48992 | 209 |
| 1112 | 3300046513 | Ga0495616_0001259 | Ga0495616_0001259_2452_3090 | 209 |
| 1113 | 3300046515 | Ga0495620_0000008 | Ga0495620_0000008_62118_62756 | 209 |
| 1114 | 3300046515 | Ga0495620_0022151 | Ga0495620_0022151_1744_2382 | 209 |
| 1115 | 3300046518 | Ga0495631_0000001 | Ga0495631_0000001_117829_118467 | 209 |
| 1116 | 3300046518 | Ga0495631_0000093 | Ga0495631_0000093_1219_1857 | 209 |
| 1117 | 3300046519 | Ga0495632_0001811 | Ga0495632_0001811_6158_6796 | 209 |
| 1118 | 3300046519 | Ga0495632_0007983 | Ga0495632_0007983_113_751 | 209 |
| 1119 | 3300046519 | Ga0495632_0085766 | Ga0495632_0085766_551_1183 | 209 |
| 1120 | 3300046520 | Ga0495637_0085954 | Ga0495637_0085954_35_673 | 209 |
| 1121 | 3300046522 | Ga0495643_0167060 | Ga0495643_0167060_346_984 | 209 |
| 1122 | 3300046524 | Ga0495648_0000063 | Ga0495648_0000063_145701_146339 | 209 |
| 1123 | 3300046538 | Ga0495609_0008465 | Ga0495609_0008465_3860_4498 | 209 |
| 1124 | 3300046648 | Ga0495611_0000002 | Ga0495611_0000002_390886_391524 | 209 |
| 1125 | 3300046648 | Ga0495611_0000097 | Ga0495611_0000097_58623_59261 | 209 |
| 1126 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_395371_396009 | 209 |
| 1127 | 3300046660 | Ga0495625_0013228 | Ga0495625_0013228_4824_5462 | 209 |
| 1128 | 3300046660 | Ga0495625_0025312 | Ga0495625_0025312_1001_1639 | 209 |
| 1129 | 3300046665 | Ga0495661_0001175 | Ga0495661_0001175_3415_4053 | 209 |
| 1130 | 3300046665 | Ga0495661_0206495 | Ga0495661_0206495_21_659 | 209 |
| 1131 | 3300046691 | Ga0495670_0049212 | Ga0495670_0049212_1420_2058 | 209 |
| 1132 | 3300046691 | Ga0495670_0074370 | Ga0495670_0074370_51_689 | 209 |
| 1133 | 3300046692 | Ga0495671_0000598 | Ga0495671_0000598_24964_25602 | 209 |
| 1134 | 3300046694 | Ga0495649_0331677 | Ga0495649_0331677_25_654 | 209 |
| 1135 | 3300046794 | Ga0495589_0000111 | Ga0495589_0000111_9897_10535 | 209 |
| 1136 | 3300046810 | Ga0495660_0000760 | Ga0495660_0000760_23516_24154 | 209 |
| 1137 | 3300047323 | Ga0495683_0000468 | Ga0495683_0000468_30139_30777 | 209 |
| 1138 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_404394_405032 | 209 |
| 1139 | 3300047469 | Ga0495673_0000062 | Ga0495673_0000062_159511_160149 | 209 |
| 1140 | 3300047469 | Ga0495673_0000283 | Ga0495673_0000283_418_1056 | 209 |
| 1141 | 3300047469 | Ga0495673_0082015 | Ga0495673_0082015_568_1293 | 209 |
| 1142 | 3300047470 | Ga0495681_0054898 | Ga0495681_0054898_432_1070 | 209 |
| 1143 | 3300047472 | Ga0495686_0000068 | Ga0495686_0000068_68083_68721 | 209 |
| 1144 | 3300047472 | Ga0495686_0007171 | Ga0495686_0007171_2980_3618 | 209 |
| 1145 | 3300048911 | Ga0496108_0727153 | Ga0496108_0727153_99_728 | 209 |
| 1146 | 3300048913 | Ga0496110_0971428 | Ga0496110_0971428_61_690 | 209 |
| 1147 | 3300048917 | Ga0496114_0371498 | Ga0496114_0371498_534_1175 | 209 |
| 1148 | 3300048924 | Ga0496121_0001028 | Ga0496121_0001028_699_1337 | 209 |
| 1149 | 3300048927 | Ga0496124_0344211 | Ga0496124_0344211_367_996 | 209 |
| 1150 | 3300049459 | Ga0495678_000019 | Ga0495678_000019_122234_122872 | 209 |
| 1151 | 3300049460 | Ga0495682_0004816 | Ga0495682_0004816_4895_5533 | 209 |
| 1152 | 3300049569 | Ga0501032_0048794 | Ga0501032_0048794_722_1360 | 209 |
| 1153 | 3300049571 | Ga0501034_0013222 | Ga0501034_0013222_3402_4040 | 209 |
| 1154 | 3300049572 | Ga0501036_0044409 | Ga0501036_0044409_894_1532 | 209 |
| 1155 | 3300049573 | Ga0501037_0015430 | Ga0501037_0015430_4178_4816 | 209 |
| 1156 | 3300049574 | Ga0501038_0011847 | Ga0501038_0011847_3261_3899 | 209 |
| 1157 | 3300049581 | Ga0501047_0025460 | Ga0501047_0025460_4098_4736 | 209 |
| 1158 | 3300049585 | Ga0501069_0167538 | Ga0501069_0167538_88_753 | 209 |
| 1159 | 3300049586 | Ga0501070_0041143 | Ga0501070_0041143_82_747 | 209 |
| 1160 | 3300049586 | Ga0501070_0092416 | Ga0501070_0092416_495_1133 | 209 |
| 1161 | 3300049742 | Ga0501080_0015803 | Ga0501080_0015803_466_1104 | 209 |
| 1162 | 3300049822 | Ga0501035_0009828 | Ga0501035_0009828_7258_7896 | 209 |
| 1163 | 3300049823 | Ga0501044_0015720 | Ga0501044_0015720_3789_4427 | 209 |
| 1164 | 3300049823 | Ga0501044_0043685 | Ga0501044_0043685_1002_1667 | 209 |
| 1165 | 3300050496 | nmdc:mga07m45_285943_c1 | nmdc:mga07m45_285943_c1_163_855 | 209 |
| 1166 | 3300053087 | Ga0500643_000054 | Ga0500643_000054_100499_101137 | 209 |
| 1167 | 3300053092 | Ga0500583_0295266 | Ga0500583_0295266_52_681 | 209 |
| 1168 | 3300053096 | Ga0500641_0074051 | Ga0500641_0074051_476_1105 | 209 |
| 1169 | 3300053096 | Ga0500641_0111080 | Ga0500641_0111080_460_1092 | 209 |
| 1170 | 3300053103 | Ga0500555_001223 | Ga0500555_001223_748_1386 | 209 |
| 1171 | 3300053130 | Ga0500642_0188971 | Ga0500642_0188971_319_948 | 209 |
| 1172 | 3300053139 | Ga0500568_0112641 | Ga0500568_0112641_230_859 | 209 |
| 1173 | 3300053153 | Ga0500616_0000011 | Ga0500616_0000011_70556_71185 | 209 |
| 1174 | 3300053153 | Ga0500616_0005790 | Ga0500616_0005790_6981_7610 | 209 |
| 1175 | 3300053156 | Ga0500622_0108173 | Ga0500622_0108173_415_1047 | 209 |
| 1176 | iso_pu_bacteria | 2848297114 | 2848297692 | 209 |
| 1177 | 2162886007 | SwRhRL2b_contig_1446302 | SwRhRL2b_0021.00007070 | 211 |
| 1178 | 3300005289 | Ga0065704_10023675 | Ga0065704_100236752 | 211 |
| 1179 | 3300005295 | Ga0065707_10044585 | Ga0065707_100445852 | 211 |
| 1180 | 3300009978 | Ga0105148_100086 | Ga0105148_1000862 | 211 |
| 1181 | 3300009982 | Ga0105147_111069 | Ga0105147_1110691 | 211 |
| 1182 | 3300014326 | Ga0157380_10436269 | Ga0157380_104362692 | 211 |
| 1183 | 3300049574 | Ga0501038_0214165 | Ga0501038_0214165_225_872 | 211 |
| 1184 | 3300049579 | Ga0501043_0146151 | Ga0501043_0146151_1187_1834 | 211 |
| 1185 | 3300049580 | Ga0501046_0276152 | Ga0501046_0276152_320_967 | 211 |
| 1186 | 3300049586 | Ga0501070_0112254 | Ga0501070_0112254_1271_1918 | 211 |
| 1187 | 3300049823 | Ga0501044_0129050 | Ga0501044_0129050_648_1295 | 211 |
| 1188 | 3300053088 | Ga0500644_0072872 | Ga0500644_0072872_164_802 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.9387 | 28 | 208 |
| 6uxt-assembly1.cif.gz_A | crystal structure of unknown function protein yfdx from shigella flexneri | 0.9236 | 79 | 115 |
| 8hcr-assembly1.cif.gz_S | cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci | 0.923 | 33 | 205 |
| 7cub-assembly1.cif.gz_C | 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane | 0.9192 | 28 | 208 |
| 7e1v-assembly1.cif.gz_G | cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv | 0.9116 | 33 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.9416 | 27 | 209 | 1.20.120.80 |
| af_Q2FZK1_13_198_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.9223 | 27 | 209 | 1.20.120.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.9052 | 33 | 211 | 1.20.120.80 |
| 1fftH00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8733 | 25 | 208 | 1.20.120.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8676 | 33 | 211 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M9TGN6-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) | 0.9812 | 61 | 208 |
GO:0004129
GO:0005886 GO:0009486 GO:0019646 GO:0020037 |
| AF-A0A212ID19-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) | 0.9713 | 41 | 208 |
GO:0004129
GO:0005886 GO:0009486 GO:0019646 |
| AF-A0A3Q9CPG2-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 | 0.9697 | 41 | 208 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A127QXW6-F1-model_v4 | deleted | 0.9693 | 33 | 211 |
|
| AF-A0A5U6TQ07-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) | 0.9692 | 65 | 208 |
GO:0004129
GO:0005886 GO:0009486 GO:0019646 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar