F491425

General Info

Members Datasets Scaffolds Average Seq Length
1188 592 993 207

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0177404|Ga0495594_0177404_558_1193
Length 203
Sequence MSEINTNTVSATGADISSRYYVTEHHPENGTLLGFWIYLMSDCLIFACLFATYAVLGRNYAGGPSGAEIFELPTVALNTAFLLVSSITYGFAMLAAQKKNVKGTQVWLAVTGILGLCFLGLELTEFHALIAEGNGPWRSGFLTAFFSLVGTHGLHVTFGIVWLVTLMFAANYRRLACLSMFWHFLDVVWIGVFTFVYLMGVLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
14 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
15 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
16 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
17 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
18 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
19 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
20 2643221569 Achromobacter sp. Root565 Isolate Unclassified
21 2643221591 Devosia sp. Root685 Isolate Unclassified
22 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
23 2643221645 Massilia sp. Root351 Isolate Unclassified
24 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
25 2643221664 Massilia sp. Root418 Isolate Unclassified
26 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
27 2643221733 Bosea sp. Root381 Isolate Unclassified
28 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
29 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
30 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
31 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
32 2734482264 Dyella sp. AD052 Isolate Unclassified
33 2738541280 Massilia sp. GV090 Isolate Unclassified
34 2738541293 Rhizobium sp. GV031 Isolate Unclassified
35 2738541297 Duganella sp. GV083 Isolate Unclassified
36 2738541300 Massilia sp. GV016 Isolate Unclassified
37 2738541307 Variovorax sp. GV008 Isolate Unclassified
38 2738541357 Duganella sp. GV053 Isolate Unclassified
39 2738543003 Duganella sp. GV066 Isolate Unclassified
40 2738543009 Luteibacter sp. OK325 Isolate Unclassified
41 2738543018 Massilia sp. GV045 Isolate Unclassified
42 2738543026 Duganella sp. GV089 Isolate Unclassified
43 2738543029 Duganella sp. GV039 Isolate Unclassified
44 2738543030 Massilia sp. GV097 Isolate Unclassified
45 2739367700 Dyella sp. YR388 Isolate Unclassified
46 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
47 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
48 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
49 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
50 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
51 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
52 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
53 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
54 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
55 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
56 2818991457 Xanthomonas translucens 569 Isolate Unclassified
57 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
58 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
59 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
60 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
61 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
62 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
63 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
64 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
65 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
66 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
67 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
68 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
69 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
70 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
71 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
72 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
73 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
74 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
75 2857564685 Duganella sp. R-74599 Isolate Unclassified
76 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
77 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
78 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
79 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
80 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
81 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
82 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
83 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
84 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
85 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
86 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
87 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
88 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
89 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
90 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
91 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
92 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
93 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
94 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
95 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
96 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
97 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
98 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
99 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
100 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
101 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
102 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
103 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
104 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
105 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
106 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
107 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
108 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
109 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
110 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
111 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
112 2919085039 Luteibacter sp. 1214 Isolate Unclassified
113 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
114 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
115 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
116 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
117 2919404418 Luteibacter sp. 3190 Isolate Unclassified
118 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
119 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
120 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
121 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
122 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
123 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
124 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
125 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
126 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
127 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
128 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
129 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
130 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
131 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
132 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
133 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
134 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
135 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
136 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
137 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
138 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
139 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
140 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
141 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
142 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
143 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
144 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
145 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
146 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
147 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
148 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
149 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
150 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
151 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
152 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
153 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
154 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
155 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
156 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
157 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
158 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
159 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
160 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
161 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
162 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
163 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
164 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
165 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
166 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
167 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
168 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
169 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
170 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
171 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
172 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
173 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
174 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
175 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
176 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
177 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
178 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
179 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
180 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
181 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
182 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
183 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
184 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
185 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
186 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
187 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
188 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
189 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
190 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
191 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
192 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
193 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
194 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
195 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
196 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
197 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
198 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
199 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
200 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
201 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
202 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
203 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
204 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
205 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
206 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
207 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
208 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
209 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
210 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
211 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
212 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
213 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
214 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
215 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
216 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
217 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
218 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
219 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
220 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
221 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
222 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
223 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
224 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
225 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
226 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
227 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
228 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
229 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
230 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
231 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
232 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
233 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
234 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
235 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
236 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
237 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
238 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
239 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
240 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
241 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
242 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
243 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
244 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
245 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
246 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
247 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
248 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
249 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
250 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
251 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
252 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
253 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
254 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
255 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
256 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
257 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
258 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
259 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
260 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
261 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
262 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
263 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
264 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
265 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
273 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
277 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
278 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
279 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
280 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
281 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
282 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
283 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
284 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
285 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
286 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
287 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
288 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
289 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
290 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
291 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
292 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
293 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
294 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
295 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
296 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
298 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
299 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
300 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
302 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
303 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
304 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
306 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
307 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
308 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
311 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
312 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
313 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
315 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
317 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
319 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
320 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
369 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
373 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
374 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
375 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
376 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
377 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
378 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
379 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
380 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
381 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
382 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
383 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
384 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
385 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
386 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
387 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
388 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
389 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
390 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
391 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
392 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
393 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
394 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
395 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
396 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
397 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
398 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
399 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
400 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
401 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
402 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
403 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
404 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
405 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
406 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
407 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
408 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
409 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
410 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
411 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
412 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
413 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
414 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
415 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
416 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
417 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
418 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
419 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
420 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
421 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
422 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
423 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
424 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
425 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
426 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
427 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
428 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
429 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
430 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
431 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
432 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
433 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
434 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
435 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
436 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
437 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
438 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
439 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
440 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
441 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
442 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
443 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
444 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
445 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
446 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
447 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
448 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
449 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
450 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
451 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
452 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
453 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
454 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
455 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
456 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
457 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
458 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
459 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
460 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
461 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
462 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
463 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
464 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
465 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
466 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
467 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
468 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
469 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
470 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
471 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
472 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
473 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
474 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
475 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
476 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
477 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
478 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
479 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
480 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
481 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
482 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
483 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
484 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
485 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
486 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
487 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
488 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
489 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
490 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
491 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
492 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
493 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
494 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
495 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
496 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
497 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
498 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
499 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
500 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
501 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
502 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
503 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
504 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
505 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
506 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
507 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
508 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
509 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
510 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
511 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
512 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
513 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
514 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
515 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
516 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
517 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
518 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
519 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
520 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
521 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
522 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
523 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
524 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
525 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
526 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
527 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
528 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
529 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
530 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
531 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
532 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
533 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
534 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
535 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
536 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
537 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
538 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
539 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
540 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
541 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
545 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
548 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
549 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
550 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
551 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
552 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
553 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
554 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
555 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
556 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
557 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
559 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
560 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
561 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
562 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
563 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
564 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
565 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
566 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
567 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
568 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
569 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
570 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
571 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
572 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
573 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
574 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
575 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
576 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
577 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
578 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
579 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
580 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
581 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
582 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
583 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
584 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
585 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
586 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
587 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
588 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
589 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
590 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
591 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
592 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.41
Metatranscriptomes 1.18
Isolates 16.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 12.29
Nodule 8.42
Rhizoplane 3.96
Rhizosphere 59.18
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1446302 2162886007 Bacteria 1499
2 SwRhRL2b_contig_3055844 2162886007 Bacteria 22848
3 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
4 JGI24736J21556_1004445 3300001904 Bacteria 2394
5 JGI24741J21665_1005915 3300001915 Bacteria 2503
6 JGI24741J21665_1007918 3300001915 Bacteria 2033
7 JGI24741J21665_1011473 3300001915 Bacteria 1548
8 JGI24741J21665_1032964 3300001915 Bacteria 772
9 JGI24740J21852_10001457 3300001979 Bacteria 10853
10 JGI24740J21852_10008770 3300001979 Bacteria 4011
11 JGI24740J21852_10009141 3300001979 Bacteria 3895
12 JGI24740J21852_10019556 3300001979 Bacteria 2383
13 JGI24739J22299_10010835 3300001989 Bacteria 3375
14 JGI24738J21930_10000448 3300002075 Bacteria 11680
15 JGI25152J39213_1000231 3300002773 Bacteria 37495
16 JGI25152J39213_1001252 3300002773 Bacteria 11547
17 JGI25150J39212_1000095 3300002774 Bacteria 50881
18 JGI25150J39212_1000142 3300002774 Bacteria 40535
19 JGI25150J39212_1000230 3300002774 Bacteria 30285
20 JGI25151J46595_10000031 3300003187 Bacteria 197865
21 JGI25151J46595_10000477 3300003187 Bacteria 37879
22 JGI25151J46595_10048568 3300003187 Bacteria 1465
23 JGI25153J46596_10000291 3300003215 Bacteria 37879
24 JGI25153J46596_10000927 3300003215 Bacteria 17813
25 rootH2_10082605 3300003320 Bacteria 2783
26 Ga0006556J51387_1032851 3300003479 Bacteria 1496
27 Ga0006560J51390_1037325 3300003565 Bacteria 803
28 Ga0006554J51385_1031149 3300003567 Bacteria 1366
29 Ga0007409J51694_1008758 3300003575 Bacteria 3822
30 Ga0006562J51391_1005855 3300003578 Bacteria 3889
31 Ga0006562J51391_1044196 3300003578 Bacteria 3593
32 Ga0055529_1000076 3300003763 Bacteria 156104
33 Ga0055529_1004557 3300003763 Bacteria 2093
34 Ga0055526_1000874 3300003771 Bacteria 22514
35 Ga0055526_1003976 3300003771 Bacteria 9107
36 Ga0055537_1000268 3300003773 Bacteria 37958
37 Ga0055524_1000010 3300003775 Bacteria 282893
38 Ga0055524_1002624 3300003775 Bacteria 9149
39 Ga0055524_1012477 3300003775 Bacteria 3260
40 Ga0055524_1024025 3300003775 Bacteria 1946
41 Ga0055524_1070331 3300003775 Bacteria 677
42 Ga0055524_1070420 3300003775 Bacteria 677
43 Ga0055536_1000385 3300003781 Bacteria 32350
44 Ga0055536_1022660 3300003781 Bacteria 1867
45 Ga0055536_1041988 3300003781 Bacteria 1074
46 Ga0055534_1000362 3300003784 Bacteria 28718
47 Ga0055528_1000367 3300003790 Bacteria 36676
48 Ga0055528_1000370 3300003790 Bacteria 36558
49 Ga0055530_10000573 3300003791 Bacteria 31894
50 Ga0055530_10003264 3300003791 Bacteria 9434
51 Ga0055530_10005644 3300003791 Bacteria 5862
52 Ga0055540_1019751 3300003792 Bacteria 1807
53 Ga0055531_10001002 3300003794 Bacteria 22441
54 Ga0055531_10025287 3300003794 Bacteria 2162
55 Ga0055531_10081551 3300003794 Bacteria 711
56 Ga0055531_10087643 3300003794 Bacteria 668
57 Ga0058692_1000002 3300003856 Bacteria 508401
58 Ga0055543_1001100 3300004625 Bacteria 11684
59 Ga0065165_1000040 3300005262 Bacteria 205767
60 Ga0065165_1000101 3300005262 Bacteria 141486
61 Ga0065165_1000386 3300005262 Bacteria 71435
62 Ga0065165_1015600 3300005262 Bacteria 2890
63 Ga0065704_10023675 3300005289 Bacteria 1486
64 Ga0065704_10393488 3300005289 Bacteria 760
65 Ga0065707_10044585 3300005295 Bacteria 1079
66 Ga0070658_10000464 3300005327 Bacteria 35087
67 Ga0070658_10166907 3300005327 Bacteria 1848
68 Ga0070683_100075438 3300005329 Bacteria 3150
69 Ga0070683_100333408 3300005329 Bacteria 1444
70 Ga0070683_100753444 3300005329 Bacteria 933
71 Ga0070670_100051261 3300005331 Bacteria 3545
72 Ga0070677_10075881 3300005333 Bacteria 1426
73 Ga0070666_10000012 3300005335 Bacteria 244720
74 Ga0070680_100005939 3300005336 Bacteria 9265
75 Ga0070680_100025630 3300005336 Bacteria 4714
76 Ga0070680_100046627 3300005336 Bacteria 3526
77 Ga0070682_100081768 3300005337 Bacteria 2092
78 Ga0070682_100812522 3300005337 Bacteria 761
79 Ga0070660_100121185 3300005339 Bacteria 2087
80 Ga0070660_100282896 3300005339 Bacteria 1357
81 Ga0070660_100406981 3300005339 Bacteria 1125
82 Ga0070660_100593765 3300005339 Bacteria 925
83 Ga0070691_10000414 3300005341 Bacteria 15615
84 Ga0070691_10051018 3300005341 Bacteria 1974
85 Ga0070691_10179152 3300005341 Bacteria 1102
86 Ga0070691_10202859 3300005341 Bacteria 1042
87 Ga0070661_100008252 3300005344 Bacteria 7188
88 Ga0070661_100054589 3300005344 Bacteria 2926
89 Ga0070661_100181726 3300005344 Bacteria 1600
90 Ga0070692_10009461 3300005345 Bacteria 4396
91 Ga0070692_10021858 3300005345 Bacteria 3117
92 Ga0070668_100029042 3300005347 Bacteria 4198
93 Ga0070669_100065888 3300005353 Bacteria 2669
94 Ga0070671_100118023 3300005355 Bacteria 2231
95 Ga0070671_100270334 3300005355 Bacteria 1445
96 Ga0070659_100607313 3300005366 Bacteria 940
97 Ga0070667_100029599 3300005367 Bacteria 4565
98 Ga0070667_100805793 3300005367 Bacteria 872
99 Ga0070713_100379402 3300005436 Bacteria 1317
100 Ga0070663_100325147 3300005455 Bacteria 1238
101 Ga0070663_100438417 3300005455 Bacteria 1074
102 Ga0070678_100036678 3300005456 Bacteria 3434
103 Ga0070662_100002976 3300005457 Bacteria 10530
104 Ga0070681_10001054 3300005458 Bacteria 23444
105 Ga0070681_10046305 3300005458 Bacteria 4348
106 Ga0070681_10106849 3300005458 Bacteria 2740
107 Ga0068867_100496952 3300005459 Bacteria 1048
108 Ga0070699_100536014 3300005518 Bacteria 1065
109 Ga0070699_100610319 3300005518 Bacteria 995
110 Ga0070679_100000116 3300005530 Bacteria 63019
111 Ga0070679_100039125 3300005530 Bacteria 4714
112 Ga0070679_100068995 3300005530 Bacteria 3526
113 Ga0070684_100060950 3300005535 Bacteria 3301
114 Ga0070684_100089262 3300005535 Bacteria 2739
115 Ga0068853_100067525 3300005539 Bacteria 3106
116 Ga0068853_100070406 3300005539 Bacteria 3044
117 Ga0068853_100307243 3300005539 Bacteria 1467
118 Ga0068853_100342344 3300005539 Bacteria 1390
119 Ga0068853_100545339 3300005539 Bacteria 1098
120 Ga0068853_100663109 3300005539 Bacteria 993
121 Ga0068853_100761879 3300005539 Bacteria 925
122 Ga0070672_100064190 3300005543 Bacteria 2901
123 Ga0070686_100321305 3300005544 Bacteria 1154
124 Ga0070696_100046009 3300005546 Bacteria 3025
125 Ga0070696_100174920 3300005546 Bacteria 1589
126 Ga0070693_100001124 3300005547 Bacteria 11992
127 Ga0070665_100217358 3300005548 Bacteria 1912
128 Ga0068855_100100356 3300005563 Bacteria 3333
129 Ga0068855_100171819 3300005563 Bacteria 2454
130 Ga0068855_100393934 3300005563 Bacteria 1519
131 Ga0068855_100949028 3300005563 Bacteria 906
132 Ga0070664_100050389 3300005564 Bacteria 3523
133 Ga0070664_100096297 3300005564 Bacteria 2568
134 Ga0068857_100066946 3300005577 Bacteria 3196
135 Ga0068857_100074737 3300005577 Bacteria 3020
136 Ga0068857_100078994 3300005577 Bacteria 2937
137 Ga0068857_100797943 3300005577 Bacteria 901
138 Ga0068854_100103909 3300005578 Bacteria 2133
139 Ga0068854_100238794 3300005578 Bacteria 1446
140 Ga0068854_100247328 3300005578 Bacteria 1422
141 Ga0068854_100378785 3300005578 Bacteria 1165
142 Ga0068854_100417520 3300005578 Bacteria 1114
143 Ga0068856_100179946 3300005614 Bacteria 2127
144 Ga0068856_100452758 3300005614 Bacteria 1304
145 Ga0068856_100562660 3300005614 Bacteria 1161
146 Ga0068852_100036629 3300005616 Bacteria 4108
147 Ga0068852_100250925 3300005616 Bacteria 1695
148 Ga0068852_100385620 3300005616 Bacteria 1375
149 Ga0068852_100893102 3300005616 Bacteria 905
150 Ga0068864_100244820 3300005618 Bacteria 1662
151 Ga0068866_10197397 3300005718 Bacteria 1200
152 Ga0068851_10010821 3300005834 Bacteria 4263
153 Ga0068858_100449226 3300005842 Bacteria 1242
154 Ga0068860_100230707 3300005843 Bacteria 1799
155 Ga0068862_100760762 3300005844 Bacteria 943
156 Ga0081455_10000120 3300005937 Bacteria 89920
157 Ga0075364_10092343 3300006051 Bacteria 2009
158 Ga0075364_10208274 3300006051 Bacteria 1326
159 Ga0070715_10076191 3300006163 Bacteria 1511
160 Ga0070712_100057928 3300006175 Bacteria 2723
161 Ga0075369_10081602 3300006186 Bacteria 1435
162 Ga0075369_10202324 3300006186 Bacteria 916
163 Ga0097621_100043182 3300006237 Bacteria 3634
164 Ga0075370_10226356 3300006353 Bacteria 1106
165 Ga0068871_100053473 3300006358 Bacteria 3273
166 Ga0097620_101224099 3300006931 Bacteria 827
167 Ga0099826_10000002 3300006948 Bacteria 1125830
168 Ga0105251_10001750 3300009011 Bacteria 18123
169 Ga0105244_10009858 3300009036 Bacteria 5831
170 Ga0105244_10025146 3300009036 Bacteria 3241
171 Ga0105244_10128061 3300009036 Bacteria 1226
172 Ga0105250_10000005 3300009092 Bacteria 422580
173 Ga0105250_10069397 3300009092 Bacteria 1423
174 Ga0105240_10008512 3300009093 Bacteria 14670
175 Ga0105240_10008765 3300009093 Bacteria 14414
176 Ga0105240_10123556 3300009093 Bacteria 3114
177 Ga0105240_10193184 3300009093 Bacteria 2392
178 Ga0105240_10255133 3300009093 Bacteria 2026
179 Ga0105240_10460024 3300009093 Bacteria 1422
180 Ga0105240_10463790 3300009093 Bacteria 1415
181 Ga0105240_11223492 3300009093 Bacteria 795
182 Ga0105247_10000719 3300009101 Bacteria 25791
183 Ga0105242_10198237 3300009176 Bacteria 1782
184 Ga0105248_10394626 3300009177 Bacteria 1558
185 Ga0105248_10711288 3300009177 Bacteria 1133
186 Ga0105248_11055962 3300009177 Bacteria 918
187 Ga0105248_11363830 3300009177 Bacteria 802
188 Ga0105237_10000202 3300009545 Bacteria 84889
189 Ga0105237_10050473 3300009545 Bacteria 4180
190 Ga0105238_10000109 3300009551 Bacteria 90227
191 Ga0105238_10002754 3300009551 Bacteria 17526
192 Ga0105238_10285677 3300009551 Bacteria 1632
193 Ga0105238_10707001 3300009551 Bacteria 1020
194 Ga0105238_10745431 3300009551 Bacteria 993
195 Ga0105148_100086 3300009978 Bacteria 14695
196 Ga0105147_111069 3300009982 Bacteria 765
197 Ga0105239_10000022 3300010375 Bacteria 257744
198 Ga0105239_10011676 3300010375 Bacteria 9805
199 Ga0105239_10214394 3300010375 Bacteria 2158
200 Ga0105239_10501147 3300010375 Bacteria 1380
201 Ga0105239_11424530 3300010375 Bacteria 800
202 Ga0105246_10191418 3300011119 Bacteria 1584
203 Ga0157327_1013548 3300012512 Bacteria 821
204 Ga0157373_10020888 3300013100 Bacteria 4753
205 Ga0157373_10347880 3300013100 Bacteria 1057
206 Ga0157371_10012688 3300013102 Bacteria 6428
207 Ga0157371_10035605 3300013102 Bacteria 3567
208 Ga0157371_10210343 3300013102 Bacteria 1396
209 Ga0157371_10351170 3300013102 Bacteria 1073
210 Ga0157370_10004006 3300013104 Bacteria 17114
211 Ga0157370_10006361 3300013104 Bacteria 13038
212 Ga0157370_10028770 3300013104 Bacteria 5463
213 Ga0157370_10064244 3300013104 Bacteria 3475
214 Ga0157370_10096501 3300013104 Bacteria 2773
215 Ga0157370_10109162 3300013104 Bacteria 2587
216 Ga0157370_10176959 3300013104 Bacteria 1983
217 Ga0157370_10588822 3300013104 Bacteria 1019
218 Ga0157369_10155544 3300013105 Bacteria 2415
219 Ga0157369_10414277 3300013105 Bacteria 1397
220 Ga0157369_10687233 3300013105 Bacteria 1054
221 Ga0163162_10000324 3300013306 Bacteria 43904
222 Ga0163162_10469613 3300013306 Bacteria 1390
223 Ga0157372_10119219 3300013307 Bacteria 3029
224 Ga0157372_10190386 3300013307 Bacteria 2376
225 Ga0157372_12005137 3300013307 Bacteria 665
226 Ga0157375_10005255 3300013308 Bacteria 11243
227 Ga0157375_10216357 3300013308 Bacteria 2074
228 Ga0157380_10436269 3300014326 Bacteria 1254
229 Ga0157380_10481611 3300014326 Bacteria 1200
230 Ga0182008_10003366 3300014497 Bacteria 9700
231 Ga0182008_10045595 3300014497 Bacteria 2180
232 Ga0157379_10000199 3300014968 Bacteria 46395
233 Ga0182006_1000041 3300015261 Bacteria 203413
234 Ga0182006_1000133 3300015261 Bacteria 80418
235 Ga0182006_1036383 3300015261 Bacteria 1958
236 Ga0182007_10001735 3300015262 Bacteria 11472
237 Ga0182007_10004669 3300015262 Bacteria 6177
238 Ga0182005_1000027 3300015265 Bacteria 223652
239 Ga0182005_1001033 3300015265 Bacteria 11788
240 Ga0182005_1004597 3300015265 Bacteria 4430
241 Ga0182005_1009656 3300015265 Bacteria 2800
242 Ga0163161_10005751 3300017792 Bacteria 8592
243 Ga0163161_10007960 3300017792 Bacteria 7333
244 Ga0163161_10198269 3300017792 Bacteria 1546
245 Ga0206356_11511824 3300020070 Bacteria 1655
246 Ga0206356_11757027 3300020070 Bacteria 1259
247 Ga0206351_10803103 3300020077 Bacteria 3229
248 Ga0206352_10117821 3300020078 Bacteria 2825
249 Ga0206354_10084669 3300020081 Bacteria 1518
250 Ga0206354_10440027 3300020081 Bacteria 944
251 Ga0206353_10964244 3300020082 Bacteria 3445
252 Ga0154015_1188516 3300020610 Bacteria 4382
253 Ga0213872_10003040 3300021361 Bacteria 9463
254 Ga0213872_10052683 3300021361 Bacteria 1846
255 Ga0213874_10204541 3300021377 Bacteria 712
256 Ga0213876_10113987 3300021384 Bacteria 1435
257 Ga0209674_101868 3300025226 Bacteria 4983
258 Ga0209437_102902 3300025233 Bacteria 3202
259 Ga0207425_1000028 3300025245 Bacteria 286333
260 Ga0207425_1000070 3300025245 Bacteria 116438
261 Ga0207425_1000950 3300025245 Bacteria 13726
262 Ga0209026_1001092 3300025250 Bacteria 13010
263 Ga0209148_1001455 3300025254 Bacteria 11982
264 Ga0209759_1004246 3300025256 Bacteria 5409
265 Ga0209129_1000065 3300025258 Bacteria 232568
266 Ga0209129_1000172 3300025258 Bacteria 95144
267 Ga0209129_1000232 3300025258 Bacteria 61645
268 Ga0209129_1000647 3300025258 Bacteria 23358
269 Ga0209233_1021961 3300025261 Bacteria 1642
270 Ga0209565_1000017 3300025263 Bacteria 462438
271 Ga0209565_1006338 3300025263 Bacteria 3327
272 Ga0209455_1000766 3300025272 Bacteria 18068
273 Ga0209673_1000005 3300025273 Bacteria 692788
274 Ga0209673_1000007 3300025273 Bacteria 634477
275 Ga0209673_1004973 3300025273 Bacteria 6892
276 Ga0209130_1004306 3300025284 Bacteria 5492
277 Ga0209675_1000009 3300025291 Bacteria 562872
278 Ga0209675_1005833 3300025291 Bacteria 5061
279 Ga0209675_1022564 3300025291 Bacteria 1650
280 Ga0209676_1000128 3300025292 Bacteria 188099
281 Ga0209676_1000196 3300025292 Bacteria 135726
282 Ga0209676_1000225 3300025292 Bacteria 124018
283 Ga0209676_1000243 3300025292 Bacteria 117113
284 Ga0209676_1001452 3300025292 Bacteria 22273
285 Ga0209676_1001467 3300025292 Bacteria 21936
286 Ga0209676_1002185 3300025292 Bacteria 14659
287 Ga0209676_1002212 3300025292 Bacteria 14505
288 Ga0209676_1003114 3300025292 Bacteria 10656
289 Ga0209676_1008591 3300025292 Bacteria 4529
290 Ga0209025_1000002 3300025294 Bacteria 1393142
291 Ga0209025_1000083 3300025294 Bacteria 265556
292 Ga0209025_1001945 3300025294 Bacteria 23845
293 Ga0209025_1006637 3300025294 Bacteria 8900
294 Ga0209564_1000011 3300025295 Bacteria 822327
295 Ga0209564_1000036 3300025295 Bacteria 423455
296 Ga0209564_1022642 3300025295 Bacteria 2211
297 Ga0209758_1000003 3300025297 Bacteria 1398533
298 Ga0209758_1000090 3300025297 Bacteria 246564
299 Ga0209758_1001782 3300025297 Bacteria 23823
300 Ga0209758_1019590 3300025297 Bacteria 3255
301 Ga0209758_1054420 3300025297 Bacteria 1367
302 Ga0209758_1066704 3300025297 Bacteria 1154
303 Ga0209050_1000244 3300025298 Bacteria 117105
304 Ga0209050_1001118 3300025298 Bacteria 32421
305 Ga0209050_1001542 3300025298 Bacteria 24144
306 Ga0209050_1008975 3300025298 Bacteria 5213
307 Ga0209050_1010537 3300025298 Bacteria 4540
308 Ga0209050_1026358 3300025298 Bacteria 1947
309 Ga0209256_1000007 3300025299 Bacteria 1136599
310 Ga0209256_1000091 3300025299 Bacteria 210945
311 Ga0209256_1000477 3300025299 Bacteria 59886
312 Ga0209256_1002799 3300025299 Bacteria 13356
313 Ga0209256_1004756 3300025299 Bacteria 8287
314 Ga0207426_1000004 3300025302 Bacteria 1047900
315 Ga0207426_1018654 3300025302 Bacteria 2441
316 Ga0207426_1041846 3300025302 Bacteria 1417
317 Ga0209051_1005647 3300025303 Bacteria 7244
318 Ga0209051_1017203 3300025303 Bacteria 3237
319 Ga0209051_1032710 3300025303 Bacteria 1979
320 Ga0209257_1000065 3300025304 Bacteria 353604
321 Ga0209257_1000140 3300025304 Bacteria 201515
322 Ga0209257_1000155 3300025304 Bacteria 182928
323 Ga0209257_1000208 3300025304 Bacteria 141393
324 Ga0209257_1000737 3300025304 Bacteria 49659
325 Ga0209257_1000846 3300025304 Bacteria 43824
326 Ga0209257_1020284 3300025304 Bacteria 2463
327 Ga0209257_1040888 3300025304 Bacteria 1379
328 Ga0209257_1045513 3300025304 Bacteria 1274
329 Ga0209257_1056445 3300025304 Bacteria 1084
330 Ga0207656_10022892 3300025321 Bacteria 2510
331 Ga0207656_10086488 3300025321 Bacteria 1417
332 Ga0207696_1000181 3300025711 Bacteria 98281
333 Ga0207655_1003240 3300025728 Bacteria 12217
334 Ga0207655_1034076 3300025728 Bacteria 2294
335 Ga0207713_1000393 3300025735 Bacteria 47322
336 Ga0207710_10003656 3300025900 Bacteria 6820
337 Ga0207710_10144941 3300025900 Bacteria 1149
338 Ga0207688_10345180 3300025901 Bacteria 916
339 Ga0207680_10000013 3300025903 Bacteria 244716
340 Ga0207647_10005263 3300025904 Bacteria 9520
341 Ga0207647_10030288 3300025904 Bacteria 3492
342 Ga0207647_10181630 3300025904 Bacteria 1222
343 Ga0207685_10076528 3300025905 Bacteria 1372
344 Ga0207699_10365875 3300025906 Bacteria 1021
345 Ga0207705_10004077 3300025909 Bacteria 11089
346 Ga0207705_10023168 3300025909 Bacteria 4429
347 Ga0207705_10026499 3300025909 Bacteria 4133
348 Ga0207705_10181359 3300025909 Bacteria 1589
349 Ga0207705_10342909 3300025909 Bacteria 1150
350 Ga0207654_10501962 3300025911 Bacteria 857
351 Ga0207707_10000181 3300025912 Bacteria 66031
352 Ga0207707_10000203 3300025912 Bacteria 63383
353 Ga0207707_10000846 3300025912 Bacteria 29949
354 Ga0207707_10006900 3300025912 Bacteria 9907
355 Ga0207707_10008967 3300025912 Bacteria 8690
356 Ga0207707_10013258 3300025912 Bacteria 7182
357 Ga0207695_10000654 3300025913 Bacteria 68735
358 Ga0207695_10002351 3300025913 Bacteria 28102
359 Ga0207695_10006761 3300025913 Bacteria 14788
360 Ga0207695_10014947 3300025913 Bacteria 9161
361 Ga0207695_10023535 3300025913 Bacteria 6956
362 Ga0207671_10000726 3300025914 Bacteria 41902
363 Ga0207671_10004748 3300025914 Bacteria 12824
364 Ga0207671_10148244 3300025914 Bacteria 1811
365 Ga0207693_10020467 3300025915 Bacteria 5262
366 Ga0207660_10000324 3300025917 Bacteria 30906
367 Ga0207660_10005067 3300025917 Bacteria 8579
368 Ga0207660_10016000 3300025917 Bacteria 4958
369 Ga0207660_10036732 3300025917 Bacteria 3407
370 Ga0207660_10062321 3300025917 Bacteria 2686
371 Ga0207657_10008206 3300025919 Bacteria 10637
372 Ga0207657_10084586 3300025919 Bacteria 2658
373 Ga0207649_10000835 3300025920 Bacteria 19841
374 Ga0207649_10004317 3300025920 Bacteria 7725
375 Ga0207649_10048759 3300025920 Bacteria 2613
376 Ga0207649_10198589 3300025920 Bacteria 1415
377 Ga0207652_10000017 3300025921 Bacteria 188391
378 Ga0207652_10000726 3300025921 Bacteria 32004
379 Ga0207652_10000759 3300025921 Bacteria 31000
380 Ga0207652_10021521 3300025921 Bacteria 5322
381 Ga0207652_10025885 3300025921 Bacteria 4881
382 Ga0207694_10000122 3300025924 Bacteria 82443
383 Ga0207694_10335999 3300025924 Bacteria 1249
384 Ga0207650_10060634 3300025925 Bacteria 2823
385 Ga0207687_10698688 3300025927 Bacteria 861
386 Ga0207644_10067091 3300025931 Bacteria 2614
387 Ga0207690_10001833 3300025932 Bacteria 13050
388 Ga0207690_10026773 3300025932 Bacteria 3635
389 Ga0207690_10084247 3300025932 Bacteria 2228
390 Ga0207690_10104732 3300025932 Bacteria 2027
391 Ga0207706_10017778 3300025933 Bacteria 6403
392 Ga0207686_10149641 3300025934 Bacteria 1624
393 Ga0207665_10018144 3300025939 Bacteria 4624
394 Ga0207691_10049529 3300025940 Bacteria 3849
395 Ga0207691_10202201 3300025940 Bacteria 1728
396 Ga0207711_10025799 3300025941 Bacteria 4928
397 Ga0207661_10018367 3300025944 Bacteria 5194
398 Ga0207661_10027627 3300025944 Bacteria 4336
399 Ga0207661_10168236 3300025944 Bacteria 1906
400 Ga0207679_10014117 3300025945 Bacteria 5243
401 Ga0207679_10208455 3300025945 Bacteria 1637
402 Ga0207667_10000447 3300025949 Bacteria 55327
403 Ga0207667_10000489 3300025949 Bacteria 52384
404 Ga0207667_10055913 3300025949 Bacteria 4147
405 Ga0207667_10144688 3300025949 Bacteria 2447
406 Ga0207667_10174887 3300025949 Bacteria 2206
407 Ga0207667_10203544 3300025949 Bacteria 2030
408 Ga0207667_10497627 3300025949 Bacteria 1237
409 Ga0207667_10805369 3300025949 Bacteria 936
410 Ga0207668_10162988 3300025972 Bacteria 1739
411 Ga0207640_10006018 3300025981 Bacteria 6629
412 Ga0207640_10117635 3300025981 Bacteria 1897
413 Ga0207640_10241125 3300025981 Bacteria 1397
414 Ga0207640_10494080 3300025981 Bacteria 1018
415 Ga0207658_10191811 3300025986 Bacteria 1699
416 Ga0207703_10463520 3300026035 Bacteria 1185
417 Ga0207703_11035931 3300026035 Bacteria 788
418 Ga0207639_10012653 3300026041 Bacteria 5882
419 Ga0207639_10029105 3300026041 Bacteria 4041
420 Ga0207639_10080835 3300026041 Bacteria 2572
421 Ga0207639_10444592 3300026041 Bacteria 1176
422 Ga0207678_10012569 3300026067 Bacteria 7439
423 Ga0207678_10122410 3300026067 Bacteria 2220
424 Ga0207678_10310626 3300026067 Bacteria 1355
425 Ga0207678_10388867 3300026067 Bacteria 1206
426 Ga0207678_10393108 3300026067 Bacteria 1200
427 Ga0207702_10000456 3300026078 Bacteria 46149
428 Ga0207702_10008032 3300026078 Bacteria 8929
429 Ga0207702_10025487 3300026078 Bacteria 4908
430 Ga0207702_10068668 3300026078 Bacteria 3045
431 Ga0207702_10146846 3300026078 Bacteria 2141
432 Ga0207702_10199378 3300026078 Bacteria 1854
433 Ga0207648_10651237 3300026089 Bacteria 974
434 Ga0207674_10000341 3300026116 Bacteria 60004
435 Ga0207674_10039137 3300026116 Bacteria 4917
436 Ga0207674_10063158 3300026116 Bacteria 3738
437 Ga0207674_10087758 3300026116 Bacteria 3104
438 Ga0207674_10548626 3300026116 Bacteria 1117
439 Ga0207675_100478257 3300026118 Bacteria 1238
440 Ga0207683_10112193 3300026121 Bacteria 2442
441 Ga0207698_10001385 3300026142 Bacteria 14093
442 Ga0207698_10002975 3300026142 Bacteria 10154
443 Ga0207698_10118065 3300026142 Bacteria 2239
444 Ga0207698_10322420 3300026142 Bacteria 1447
445 Ga0207698_11077752 3300026142 Bacteria 816
446 Ga0209371_1000004 3300027312 Bacteria 1098197
447 Ga0209371_1000044 3300027312 Bacteria 327086
448 Ga0209282_1000001 3300027666 Bacteria 2450367
449 Ga0268266_10000021 3300028379 Bacteria 522453
450 Ga0268266_10177480 3300028379 Bacteria 1937
451 Ga0268265_10216500 3300028380 Bacteria 1673
452 Ga0268264_10249649 3300028381 Bacteria 1648
453 Ga0265337_1003670 3300028556 Bacteria 6575
454 Ga0265326_10003092 3300028558 Bacteria 5516
455 Ga0265319_1000598 3300028563 Bacteria 24079
456 Ga0265334_10000692 3300028573 Bacteria 16893
457 Ga0265318_10005512 3300028577 Bacteria 5939
458 Ga0265323_10000487 3300028653 Bacteria 22352
459 Ga0265336_10001123 3300028666 Bacteria 12840
460 Ga0307515_10327313 3300028794 Bacteria 1193
461 Ga0265338_10000094 3300028800 Bacteria 168366
462 Ga0265324_10001770 3300029957 Bacteria 11823
463 Ga0268256_1000005 3300030500 Bacteria 1082342
464 Ga0268256_1000046 3300030500 Bacteria 327003
465 Ga0316176_1040965 3300030732 Bacteria 3598
466 Ga0316183_1037672 3300030742 Bacteria 3234
467 Ga0316182_1113340 3300030745 Bacteria 1590
468 Ga0265339_10010885 3300031249 Bacteria 5624
469 Ga0265331_10124406 3300031250 Bacteria 1178
470 Ga0265316_10006562 3300031344 Bacteria 11097
471 Ga0307513_10304043 3300031456 Bacteria 1360
472 Ga0307509_10261629 3300031507 Bacteria 1505
473 Ga0307509_10262360 3300031507 Bacteria 1502
474 Ga0307408_100006936 3300031548 Bacteria 7498
475 Ga0265313_10000181 3300031595 Bacteria 67263
476 Ga0265342_10073510 3300031712 Bacteria 1988
477 Ga0307405_10008120 3300031731 Bacteria 5302
478 Ga0307405_10218475 3300031731 Bacteria 1397
479 Ga0307413_10224612 3300031824 Bacteria 1374
480 Ga0307412_10000575 3300031911 Bacteria 21817
481 Ga0307412_10001031 3300031911 Bacteria 15911
482 Ga0307414_10116095 3300032004 Bacteria 2048
483 Ga0307414_10325666 3300032004 Bacteria 1309
484 Ga0307411_10534239 3300032005 Bacteria 998
485 Ga0307415_100031417 3300032126 Bacteria 3421
486 Ga0307510_10003060 3300033180 Bacteria 19310
487 Ga0307510_10155503 3300033180 Bacteria 1894
488 Ga0373939_0135111 3300035114 Bacteria 884
489 Ga0395899_0000086 3300037312 Bacteria 157725
490 Ga0395900_0046132 3300037418 Bacteria 4487
491 Ga0395900_0097263 3300037418 Bacteria 3024
492 Ga0395900_0749780 3300037418 Bacteria 907
493 Ga0395898_0115774 3300037466 Bacteria 2568
494 Ga0395898_0266007 3300037466 Bacteria 1635
495 Ga0395905_0146690 3300037471 Bacteria 2220
496 Ga0395905_0199330 3300037471 Bacteria 1877
497 Ga0395901_0000263 3300038443 Bacteria 65735
498 Ga0395901_0030291 3300038443 Bacteria 5574
499 Ga0395901_1296731 3300038443 Bacteria 690
500 Ga0237819_00145 3300038705 Bacteria 26084
501 Ga0237819_12915 3300038705 Bacteria 1020
502 Ga0237816_03427 3300039145 Bacteria 1161
503 Ga0436361_0022175 3300039447 Bacteria 2302
504 Ga0436361_0170645 3300039447 Bacteria 9136
505 Ga0436361_0673292 3300039447 Bacteria 2911
506 Ga0436361_0795199 3300039447 Bacteria 71391
507 Ga0436361_0835169 3300039447 Bacteria 5290
508 Ga0436361_1083332 3300039447 Bacteria 905
509 Ga0439436_0000004 3300041404 Bacteria 175137
510 Ga0439439_0027845 3300041406 Bacteria 1429
511 Ga0439461_0000338 3300041410 Bacteria 6676
512 Ga0439465_0001362 3300041413 Bacteria 7874
513 Ga0439465_0012861 3300041413 Bacteria 2616
514 Ga0451793_0151939 3300041452 Bacteria 1983
515 Ga0451798_0004380 3300041458 Bacteria 1709
516 Ga0451800_0510821 3300041459 Bacteria 768
517 Ga0451800_1204646 3300041459 Bacteria 7949
518 Ga0451806_700263 3300041462 Bacteria 8682
519 Ga0451804_0156193 3300041463 Bacteria 5411
520 Ga0451807_0057674 3300041486 Bacteria 4378
521 Ga0451845_0500926 3300041501 Bacteria 1503
522 Ga0439431_0006417 3300041997 Bacteria 2600
523 Ga0439442_002014 3300042002 Bacteria 3995
524 Ga0439445_0000584 3300042004 Bacteria 7463
525 Ga0439432_001838 3300042006 Bacteria 7972
526 Ga0439462_0001500 3300042015 Bacteria 5213
527 Ga0439434_0000210 3300042435 Bacteria 16132
528 Ga0451577_0004095 3300042876 Bacteria 15657
529 Ga0466969_0299580 3300044656 Bacteria 728
530 Ga0466972_0087501 3300044658 Bacteria 1480
531 Ga0466965_0312279 3300044683 Bacteria 855
532 Ga0453684_0320696 3300044712 Bacteria 1755
533 Ga0466968_0018240 3300044735 Bacteria 2813
534 Ga0466968_0032371 3300044735 Bacteria 2174
535 Ga0466957_0065217 3300044842 Bacteria 2242
536 Ga0495617_000018 3300046452 Bacteria 248300
537 Ga0495617_000071 3300046452 Bacteria 83031
538 Ga0495617_000222 3300046452 Bacteria 34541
539 Ga0495627_007672 3300046453 Bacteria 4118
540 Ga0495627_052017 3300046453 Bacteria 1229
541 Ga0495603_0214038 3300046455 Bacteria 1112
542 Ga0495590_0001652 3300046457 Bacteria 9510
543 Ga0495590_0031634 3300046457 Bacteria 1852
544 Ga0495590_0046903 3300046457 Bacteria 1507
545 Ga0495638_0000041 3300046460 Bacteria 235584
546 Ga0495638_0001219 3300046460 Bacteria 24403
547 Ga0495638_0003487 3300046460 Bacteria 12359
548 Ga0495638_0025571 3300046460 Bacteria 3835
549 Ga0495653_0123525 3300046463 Bacteria 1841
550 Ga0495650_0000067 3300046471 Bacteria 269882
551 Ga0495650_0000170 3300046471 Bacteria 143177
552 Ga0495650_0000920 3300046471 Bacteria 34562
553 Ga0495650_0000932 3300046471 Bacteria 33965
554 Ga0495650_0001241 3300046471 Bacteria 26496
555 Ga0495650_0051957 3300046471 Bacteria 1685
556 Ga0495650_0116780 3300046471 Bacteria 985
557 Ga0495582_0040520 3300046473 Bacteria 2565
558 Ga0495605_0000107 3300046474 Bacteria 105085
559 Ga0495605_0074648 3300046474 Bacteria 1596
560 Ga0495584_0000002 3300046491 Bacteria 512179
561 Ga0495584_0002229 3300046491 Bacteria 11057
562 Ga0495585_0000003 3300046492 Bacteria 406344
563 Ga0495585_0000008 3300046492 Bacteria 278949
564 Ga0495585_0000303 3300046492 Bacteria 49270
565 Ga0495585_0002320 3300046492 Bacteria 13712
566 Ga0495585_0096768 3300046492 Bacteria 1583
567 Ga0495594_0078129 3300046499 Bacteria 1846
568 Ga0495594_0089973 3300046499 Bacteria 1719
569 Ga0495594_0177404 3300046499 Bacteria 1212
570 Ga0495607_0000141 3300046501 Bacteria 75379
571 Ga0495607_0018714 3300046501 Bacteria 4407
572 Ga0495607_0066061 3300046501 Bacteria 2037
573 Ga0495607_0280906 3300046501 Bacteria 790
574 Ga0495583_0006252 3300046506 Bacteria 7833
575 Ga0495583_0022480 3300046506 Bacteria 3216
576 Ga0495583_0050191 3300046506 Bacteria 1907
577 Ga0495606_0000117 3300046507 Bacteria 134593
578 Ga0495606_0000118 3300046507 Bacteria 134504
579 Ga0495606_0001825 3300046507 Bacteria 26986
580 Ga0495606_0009523 3300046507 Bacteria 8205
581 Ga0495606_0040331 3300046507 Bacteria 3138
582 Ga0495606_0088286 3300046507 Bacteria 1912
583 Ga0495606_0303889 3300046507 Bacteria 863
584 Ga0495606_0334266 3300046507 Bacteria 809
585 Ga0495610_0000012 3300046512 Bacteria 517442
586 Ga0495610_0000250 3300046512 Bacteria 56512
587 Ga0495610_0000261 3300046512 Bacteria 55310
588 Ga0495610_0000303 3300046512 Bacteria 51903
589 Ga0495610_0002368 3300046512 Bacteria 15929
590 Ga0495610_0049710 3300046512 Bacteria 2052
591 Ga0495616_0000001 3300046513 Bacteria 780061
592 Ga0495616_0000002 3300046513 Bacteria 297337
593 Ga0495616_0000228 3300046513 Bacteria 46105
594 Ga0495616_0001259 3300046513 Bacteria 17823
595 Ga0495616_0007214 3300046513 Bacteria 6662
596 Ga0495620_0000008 3300046515 Bacteria 186489
597 Ga0495620_0022151 3300046515 Bacteria 3068
598 Ga0495620_0027255 3300046515 Bacteria 2676
599 Ga0495630_0095365 3300046517 Bacteria 2250
600 Ga0495630_0371981 3300046517 Bacteria 1094
601 Ga0495631_0000001 3300046518 Bacteria 216492
602 Ga0495631_0000093 3300046518 Bacteria 59068
603 Ga0495632_0000196 3300046519 Bacteria 61287
604 Ga0495632_0001811 3300046519 Bacteria 17226
605 Ga0495632_0007983 3300046519 Bacteria 6569
606 Ga0495632_0085766 3300046519 Bacteria 1498
607 Ga0495637_0000342 3300046520 Bacteria 35805
608 Ga0495637_0019179 3300046520 Bacteria 3163
609 Ga0495637_0085954 3300046520 Bacteria 1247
610 Ga0495643_0000341 3300046522 Bacteria 63337
611 Ga0495643_0167060 3300046522 Bacteria 1078
612 Ga0495648_0000063 3300046524 Bacteria 147540
613 Ga0495648_0000171 3300046524 Bacteria 74494
614 Ga0495648_0012310 3300046524 Bacteria 6389
615 Ga0495648_0053226 3300046524 Bacteria 2453
616 Ga0495648_0122160 3300046524 Bacteria 1398
617 Ga0495648_0127445 3300046524 Bacteria 1358
618 Ga0495648_0176545 3300046524 Bacteria 1090
619 Ga0495648_0192516 3300046524 Bacteria 1028
620 Ga0495663_0042232 3300046525 Bacteria 1389
621 Ga0495666_0007754 3300046526 Bacteria 5372
622 Ga0495666_0012710 3300046526 Bacteria 4195
623 Ga0495666_0271178 3300046526 Bacteria 770
624 Ga0495642_0008640 3300046528 Bacteria 3893
625 Ga0495642_0134275 3300046528 Bacteria 1066
626 Ga0495652_0139886 3300046529 Bacteria 1904
627 Ga0495652_0141168 3300046529 Bacteria 1894
628 Ga0495654_0000011 3300046530 Bacteria 363172
629 Ga0495654_0238031 3300046530 Bacteria 763
630 Ga0495665_0000780 3300046531 Bacteria 16583
631 Ga0495665_0005867 3300046531 Bacteria 6621
632 Ga0495665_0105312 3300046531 Bacteria 1480
633 Ga0495586_0019616 3300046535 Bacteria 3600
634 Ga0495586_0148621 3300046535 Bacteria 1317
635 Ga0495587_0067776 3300046536 Bacteria 2079
636 Ga0495587_0085335 3300046536 Bacteria 1828
637 Ga0495587_0110097 3300046536 Bacteria 1582
638 Ga0495609_0008465 3300046538 Bacteria 5038
639 Ga0495597_0036025 3300046542 Bacteria 2229
640 Ga0495622_0021124 3300046557 Bacteria 3033
641 Ga0495622_0187334 3300046557 Bacteria 926
642 Ga0495633_0005961 3300046558 Bacteria 7322
643 Ga0495633_0013550 3300046558 Bacteria 4291
644 Ga0495633_0067299 3300046558 Bacteria 1672
645 Ga0495633_0164170 3300046558 Bacteria 1024
646 Ga0495656_0150867 3300046615 Bacteria 1122
647 Ga0495668_0000137 3300046616 Bacteria 111150
648 Ga0495668_0000983 3300046616 Bacteria 31139
649 Ga0495668_0001476 3300046616 Bacteria 22557
650 Ga0495668_0095350 3300046616 Bacteria 1628
651 Ga0495668_0193207 3300046616 Bacteria 1115
652 Ga0495634_0031183 3300046642 Bacteria 3673
653 Ga0495611_0000002 3300046648 Bacteria 705677
654 Ga0495611_0000097 3300046648 Bacteria 60484
655 Ga0495611_0032636 3300046648 Bacteria 2295
656 Ga0495611_0035087 3300046648 Bacteria 2220
657 Ga0495611_0200438 3300046648 Bacteria 931
658 Ga0495625_0000002 3300046660 Bacteria 813323
659 Ga0495625_0009860 3300046660 Bacteria 7944
660 Ga0495625_0013228 3300046660 Bacteria 6642
661 Ga0495625_0017582 3300046660 Bacteria 5595
662 Ga0495625_0025312 3300046660 Bacteria 4502
663 Ga0495625_0054020 3300046660 Bacteria 2870
664 Ga0495625_0075451 3300046660 Bacteria 2359
665 Ga0495625_0110131 3300046660 Bacteria 1883
666 Ga0495659_0000286 3300046664 Bacteria 20508
667 Ga0495661_0001175 3300046665 Bacteria 22763
668 Ga0495661_0087338 3300046665 Bacteria 1783
669 Ga0495661_0108212 3300046665 Bacteria 1553
670 Ga0495661_0206495 3300046665 Bacteria 1025
671 Ga0495588_0034196 3300046674 Bacteria 2571
672 Ga0495588_0083805 3300046674 Bacteria 1665
673 Ga0495588_0117530 3300046674 Bacteria 1401
674 Ga0495623_0016435 3300046679 Bacteria 4779
675 Ga0495646_0325177 3300046680 Bacteria 809
676 Ga0495613_0167018 3300046689 Bacteria 1563
677 Ga0495624_0005352 3300046690 Bacteria 9257
678 Ga0495670_0011181 3300046691 Bacteria 4412
679 Ga0495670_0049212 3300046691 Bacteria 2108
680 Ga0495670_0074370 3300046691 Bacteria 1723
681 Ga0495671_0000006 3300046692 Bacteria 500471
682 Ga0495671_0000163 3300046692 Bacteria 58489
683 Ga0495671_0000598 3300046692 Bacteria 26613
684 Ga0495671_0055817 3300046692 Bacteria 1956
685 Ga0495671_0126603 3300046692 Bacteria 1245
686 Ga0495649_0185523 3300046694 Bacteria 1084
687 Ga0495649_0331677 3300046694 Bacteria 771
688 Ga0495589_0000111 3300046794 Bacteria 77466
689 Ga0495600_0037890 3300046809 Bacteria 3136
690 Ga0495600_0073845 3300046809 Bacteria 2227
691 Ga0495660_0000669 3300046810 Bacteria 26377
692 Ga0495660_0000760 3300046810 Bacteria 24270
693 Ga0495660_0004327 3300046810 Bacteria 8602
694 Ga0495581_0039471 3300047315 Bacteria 2732
695 Ga0495581_0059343 3300047315 Bacteria 2211
696 Ga0495581_0113646 3300047315 Bacteria 1574
697 Ga0495604_0077424 3300047317 Bacteria 2499
698 Ga0495604_0343819 3300047317 Bacteria 993
699 Ga0495674_0008731 3300047319 Bacteria 9638
700 Ga0495672_0000023 3300047320 Bacteria 419080
701 Ga0495672_0054754 3300047320 Bacteria 2329
702 Ga0495672_0171919 3300047320 Bacteria 1104
703 Ga0495676_0162272 3300047321 Bacteria 1580
704 Ga0495680_0225456 3300047322 Bacteria 1336
705 Ga0495683_0000468 3300047323 Bacteria 31520
706 Ga0495683_0290085 3300047323 Bacteria 705
707 Ga0495687_034441 3300047443 Bacteria 2288
708 Ga0495675_0042443 3300047444 Bacteria 2897
709 Ga0495675_0310952 3300047444 Bacteria 934
710 Ga0495677_0039380 3300047445 Bacteria 1728
711 Ga0495679_000003 3300047446 Bacteria 787868
712 Ga0495679_004248 3300047446 Bacteria 6655
713 Ga0495673_0000004 3300047469 Bacteria 1354526
714 Ga0495673_0000050 3300047469 Bacteria 262267
715 Ga0495673_0000062 3300047469 Bacteria 226461
716 Ga0495673_0000283 3300047469 Bacteria 68581
717 Ga0495673_0019046 3300047469 Bacteria 3446
718 Ga0495673_0019288 3300047469 Bacteria 3418
719 Ga0495673_0082015 3300047469 Bacteria 1334
720 Ga0495673_0085027 3300047469 Bacteria 1303
721 Ga0495681_0054898 3300047470 Bacteria 1860
722 Ga0495681_0103540 3300047470 Bacteria 1241
723 Ga0495686_0000028 3300047472 Bacteria 369493
724 Ga0495686_0000068 3300047472 Bacteria 218060
725 Ga0495686_0000164 3300047472 Bacteria 126101
726 Ga0495686_0000661 3300047472 Bacteria 46810
727 Ga0495686_0003752 3300047472 Bacteria 12924
728 Ga0495686_0007171 3300047472 Bacteria 8392
729 Ga0495686_0011381 3300047472 Bacteria 6271
730 Ga0495686_0022911 3300047472 Bacteria 4126
731 Ga0495686_0051119 3300047472 Bacteria 2594
732 Ga0495686_0066613 3300047472 Bacteria 2225
733 Ga0495686_0129929 3300047472 Bacteria 1494
734 Ga0495593_0023745 3300047673 Bacteria 3404
735 Ga0495602_0020013 3300048088 Bacteria 6624
736 Ga0495602_0033930 3300048088 Bacteria 4781
737 Ga0495602_0087077 3300048088 Bacteria 2605
738 Ga0495614_0028898 3300048089 Bacteria 2387
739 Ga0495615_0000440 3300048090 Bacteria 6099
740 Ga0496100_0000969 3300048903 Bacteria 13774
741 Ga0496100_0036158 3300048903 Bacteria 3112
742 Ga0496100_0197319 3300048903 Bacteria 1465
743 Ga0496101_0000134 3300048904 Bacteria 65710
744 Ga0496101_0215785 3300048904 Bacteria 1488
745 Ga0496101_0319910 3300048904 Bacteria 1217
746 Ga0496101_0442365 3300048904 Bacteria 1025
747 Ga0496102_0000181 3300048905 Bacteria 85605
748 Ga0496102_0000315 3300048905 Bacteria 60883
749 Ga0496102_0614110 3300048905 Bacteria 1010
750 Ga0496103_0001484 3300048906 Bacteria 15672
751 Ga0496103_0004132 3300048906 Bacteria 8813
752 Ga0496103_0334834 3300048906 Bacteria 973
753 Ga0496104_0104084 3300048907 Bacteria 2719
754 Ga0496104_0189387 3300048907 Bacteria 1968
755 Ga0496104_0216485 3300048907 Bacteria 1827
756 Ga0496105_0001129 3300048908 Bacteria 18595
757 Ga0496105_0014113 3300048908 Bacteria 6357
758 Ga0496105_0025048 3300048908 Bacteria 4851
759 Ga0496106_0170803 3300048909 Bacteria 1723
760 Ga0496106_0644769 3300048909 Bacteria 846
761 Ga0496107_0122689 3300048910 Bacteria 1914
762 Ga0496107_0172724 3300048910 Bacteria 1604
763 Ga0496108_0056207 3300048911 Bacteria 3306
764 Ga0496108_0727153 3300048911 Bacteria 860
765 Ga0496108_1003661 3300048911 Bacteria 713
766 Ga0496109_0118637 3300048912 Bacteria 2463
767 Ga0496109_0978616 3300048912 Bacteria 784
768 Ga0496110_0112716 3300048913 Bacteria 2445
769 Ga0496110_0789013 3300048913 Bacteria 854
770 Ga0496110_0971428 3300048913 Bacteria 756
771 Ga0496111_0094542 3300048914 Bacteria 2192
772 Ga0496111_0191031 3300048914 Bacteria 1522
773 Ga0496112_0032873 3300048915 Bacteria 5037
774 Ga0496113_0005357 3300048916 Bacteria 7995
775 Ga0496114_0007473 3300048917 Bacteria 8640
776 Ga0496114_0371498 3300048917 Bacteria 1266
777 Ga0496114_0652438 3300048917 Bacteria 925
778 Ga0496115_0007853 3300048918 Bacteria 7869
779 Ga0496115_0445070 3300048918 Bacteria 1047
780 Ga0496116_0005234 3300048919 Bacteria 12129
781 Ga0496116_0008944 3300048919 Bacteria 8615
782 Ga0496116_0027637 3300048919 Bacteria 4127
783 Ga0496116_0074369 3300048919 Bacteria 2137
784 Ga0496116_0130584 3300048919 Bacteria 1433
785 Ga0496116_0170428 3300048919 Bacteria 1180
786 Ga0496116_0194811 3300048919 Bacteria 1068
787 Ga0496116_0198881 3300048919 Bacteria 1051
788 Ga0496116_0222156 3300048919 Bacteria 967
789 Ga0496117_0000484 3300048920 Bacteria 65863
790 Ga0496117_0001420 3300048920 Bacteria 34726
791 Ga0496117_0004049 3300048920 Bacteria 16474
792 Ga0496117_0004800 3300048920 Bacteria 14649
793 Ga0496117_0004899 3300048920 Bacteria 14419
794 Ga0496117_0016813 3300048920 Bacteria 6147
795 Ga0496117_0018675 3300048920 Bacteria 5731
796 Ga0496117_0165643 3300048920 Bacteria 1289
797 Ga0496118_0000135 3300048921 Bacteria 130330
798 Ga0496118_0000486 3300048921 Bacteria 65791
799 Ga0496118_0001019 3300048921 Bacteria 43569
800 Ga0496118_0011231 3300048921 Bacteria 8768
801 Ga0496118_0011915 3300048921 Bacteria 8416
802 Ga0496118_0032231 3300048921 Bacteria 4323
803 Ga0496118_0045381 3300048921 Bacteria 3432
804 Ga0496118_0063391 3300048921 Bacteria 2720
805 Ga0496118_0101584 3300048921 Bacteria 1941
806 Ga0496118_0116457 3300048921 Bacteria 1756
807 Ga0496118_0126003 3300048921 Bacteria 1657
808 Ga0496118_0153253 3300048921 Bacteria 1439
809 Ga0496119_0001058 3300048922 Bacteria 35115
810 Ga0496119_0001587 3300048922 Bacteria 27028
811 Ga0496119_0004632 3300048922 Bacteria 13573
812 Ga0496119_0012434 3300048922 Bacteria 6912
813 Ga0496119_0036466 3300048922 Bacteria 3209
814 Ga0496119_0036896 3300048922 Bacteria 3183
815 Ga0496119_0038389 3300048922 Bacteria 3095
816 Ga0496119_0049366 3300048922 Bacteria 2602
817 Ga0496119_0058521 3300048922 Bacteria 2322
818 Ga0496119_0282164 3300048922 Bacteria 825
819 Ga0496120_0000313 3300048923 Bacteria 80663
820 Ga0496120_0002147 3300048923 Bacteria 21033
821 Ga0496120_0002531 3300048923 Bacteria 18257
822 Ga0496120_0010752 3300048923 Bacteria 6346
823 Ga0496120_0035630 3300048923 Bacteria 2970
824 Ga0496120_0036565 3300048923 Bacteria 2921
825 Ga0496120_0083080 3300048923 Bacteria 1730
826 Ga0496120_0213239 3300048923 Bacteria 927
827 Ga0496121_0000361 3300048924 Bacteria 93571
828 Ga0496121_0000515 3300048924 Bacteria 73665
829 Ga0496121_0000532 3300048924 Bacteria 72417
830 Ga0496121_0000770 3300048924 Bacteria 58816
831 Ga0496121_0001028 3300048924 Bacteria 49706
832 Ga0496121_0008433 3300048924 Bacteria 12122
833 Ga0496121_0023471 3300048924 Bacteria 5939
834 Ga0496121_0033869 3300048924 Bacteria 4610
835 Ga0496121_0050373 3300048924 Bacteria 3519
836 Ga0496121_0059709 3300048924 Bacteria 3142
837 Ga0496121_0063489 3300048924 Bacteria 3017
838 Ga0496121_0077097 3300048924 Bacteria 2655
839 Ga0496121_0134324 3300048924 Bacteria 1845
840 Ga0496121_0140587 3300048924 Bacteria 1792
841 Ga0496121_0145784 3300048924 Bacteria 1749
842 Ga0496121_0557580 3300048924 Bacteria 715
843 Ga0496122_0003345 3300048925 Bacteria 21155
844 Ga0496122_0013233 3300048925 Bacteria 8093
845 Ga0496122_0039578 3300048925 Bacteria 3758
846 Ga0496122_0041456 3300048925 Bacteria 3639
847 Ga0496122_0091290 3300048925 Bacteria 2074
848 Ga0496122_0127937 3300048925 Bacteria 1621
849 Ga0496122_0157445 3300048925 Bacteria 1391
850 Ga0496122_0239470 3300048925 Bacteria 1024
851 Ga0496122_0252598 3300048925 Bacteria 984
852 Ga0496123_0001685 3300048926 Bacteria 29584
853 Ga0496123_0002721 3300048926 Bacteria 21201
854 Ga0496123_0007763 3300048926 Bacteria 10009
855 Ga0496123_0041995 3300048926 Bacteria 3163
856 Ga0496123_0052947 3300048926 Bacteria 2687
857 Ga0496123_0062669 3300048926 Bacteria 2381
858 Ga0496123_0140614 3300048926 Bacteria 1320
859 Ga0496123_0266656 3300048926 Bacteria 836
860 Ga0496123_0313962 3300048926 Bacteria 743
861 Ga0496124_0006165 3300048927 Bacteria 13145
862 Ga0496124_0012352 3300048927 Bacteria 8434
863 Ga0496124_0028088 3300048927 Bacteria 5035
864 Ga0496124_0041671 3300048927 Bacteria 3959
865 Ga0496124_0089365 3300048927 Bacteria 2515
866 Ga0496124_0095201 3300048927 Bacteria 2420
867 Ga0496124_0156147 3300048927 Bacteria 1784
868 Ga0496124_0184948 3300048927 Bacteria 1600
869 Ga0496124_0190942 3300048927 Bacteria 1567
870 Ga0496124_0198029 3300048927 Bacteria 1530
871 Ga0496124_0343835 3300048927 Bacteria 1058
872 Ga0496124_0344211 3300048927 Bacteria 1057
873 Ga0496124_0414141 3300048927 Bacteria 931
874 Ga0496125_0001513 3300048928 Bacteria 33304
875 Ga0496125_0002637 3300048928 Bacteria 22956
876 Ga0496125_0009701 3300048928 Bacteria 9831
877 Ga0496125_0010823 3300048928 Bacteria 9185
878 Ga0496125_0015861 3300048928 Bacteria 7258
879 Ga0496125_0018703 3300048928 Bacteria 6569
880 Ga0496125_0058999 3300048928 Bacteria 3095
881 Ga0496125_0078631 3300048928 Bacteria 2534
882 Ga0496125_0079049 3300048928 Bacteria 2525
883 Ga0496126_0000581 3300048929 Bacteria 69541
884 Ga0496126_0007075 3300048929 Bacteria 12358
885 Ga0496126_0047998 3300048929 Bacteria 3906
886 Ga0496126_0048208 3300048929 Bacteria 3895
887 Ga0496126_0052739 3300048929 Bacteria 3694
888 Ga0496126_0070369 3300048929 Bacteria 3117
889 Ga0496126_0215948 3300048929 Bacteria 1613
890 Ga0496126_0248031 3300048929 Bacteria 1485
891 Ga0495678_000019 3300049459 Bacteria 269723
892 Ga0495678_000288 3300049459 Bacteria 55368
893 Ga0495678_106556 3300049459 Bacteria 963
894 Ga0495682_0004816 3300049460 Bacteria 5698
895 Ga0495682_0034109 3300049460 Bacteria 1877
896 Ga0501290_001270 3300049513 Bacteria 3514
897 Ga0501300_004769 3300049523 Bacteria 2005
898 Ga0501032_0048794 3300049569 Bacteria 2858
899 Ga0501033_0000259 3300049570 Bacteria 50619
900 Ga0501033_0051275 3300049570 Bacteria 3058
901 Ga0501033_0123340 3300049570 Bacteria 1879
902 Ga0501034_0005872 3300049571 Bacteria 13347
903 Ga0501034_0013222 3300049571 Bacteria 8505
904 Ga0501034_0195238 3300049571 Bacteria 1984
905 Ga0501034_0269958 3300049571 Bacteria 1642
906 Ga0501036_0044409 3300049572 Bacteria 3764
907 Ga0501036_0268666 3300049572 Bacteria 1428
908 Ga0501037_0015430 3300049573 Bacteria 5621
909 Ga0501038_0011847 3300049574 Bacteria 7959
910 Ga0501038_0123922 3300049574 Bacteria 2128
911 Ga0501038_0214165 3300049574 Bacteria 1540
912 Ga0501043_0001256 3300049579 Bacteria 22358
913 Ga0501043_0024778 3300049579 Bacteria 4706
914 Ga0501043_0146151 3300049579 Bacteria 1851
915 Ga0501046_0086498 3300049580 Bacteria 2416
916 Ga0501046_0276152 3300049580 Bacteria 1232
917 Ga0501046_0328112 3300049580 Bacteria 1114
918 Ga0501046_0560948 3300049580 Bacteria 813
919 Ga0501047_0025460 3300049581 Bacteria 5688
920 Ga0501047_0269925 3300049581 Bacteria 1547
921 Ga0501047_0758572 3300049581 Bacteria 786
922 Ga0501048_0605371 3300049582 Bacteria 787
923 Ga0501069_0160151 3300049585 Bacteria 1296
924 Ga0501069_0167538 3300049585 Bacteria 1267
925 Ga0501069_0256958 3300049585 Bacteria 1019
926 Ga0501070_0000201 3300049586 Bacteria 56006
927 Ga0501070_0038943 3300049586 Bacteria 3966
928 Ga0501070_0041143 3300049586 Bacteria 3850
929 Ga0501070_0045585 3300049586 Bacteria 3647
930 Ga0501070_0059770 3300049586 Bacteria 3159
931 Ga0501070_0092416 3300049586 Bacteria 2504
932 Ga0501070_0112254 3300049586 Bacteria 2253
933 Ga0501070_0150774 3300049586 Bacteria 1918
934 Ga0501070_0170066 3300049586 Bacteria 1795
935 Ga0501073_0336638 3300049589 Bacteria 1042
936 Ga0501074_0035073 3300049590 Bacteria 3635
937 Ga0501074_0067603 3300049590 Bacteria 2569
938 Ga0501074_0076002 3300049590 Bacteria 2411
939 Ga0501206_009653 3300049653 Bacteria 1286
940 Ga0501079_0367054 3300049741 Bacteria 1128
941 Ga0501080_0015803 3300049742 Bacteria 6963
942 Ga0501080_0019509 3300049742 Bacteria 6280
943 Ga0501080_0044729 3300049742 Bacteria 4121
944 Ga0501080_0062572 3300049742 Bacteria 3463
945 Ga0501080_0111958 3300049742 Bacteria 2530
946 Ga0501080_0470294 3300049742 Bacteria 1125
947 Ga0501263_002145 3300049760 Bacteria 1975
948 Ga0501265_000506 3300049762 Bacteria 4137
949 Ga0501275_000287 3300049772 Bacteria 5733
950 Ga0501035_0003843 3300049822 Bacteria 14317
951 Ga0501035_0009828 3300049822 Bacteria 8886
952 Ga0501035_0013408 3300049822 Bacteria 7565
953 Ga0501035_0089749 3300049822 Bacteria 2706
954 Ga0501035_0197647 3300049822 Bacteria 1726
955 Ga0501035_0234169 3300049822 Bacteria 1564
956 Ga0501035_0426974 3300049822 Bacteria 1100
957 Ga0501044_0001901 3300049823 Bacteria 24163
958 Ga0501044_0015720 3300049823 Bacteria 8150
959 Ga0501044_0035800 3300049823 Bacteria 5196
960 Ga0501044_0043685 3300049823 Bacteria 4655
961 Ga0501044_0129050 3300049823 Bacteria 2523
962 Ga0501044_0234726 3300049823 Bacteria 1780
963 Ga0501044_0365919 3300049823 Bacteria 1359
964 nmdc:mga07m45_285943_c1 3300050496 Bacteria 959
965 nmdc:mga0sz30_33831_c2 3300050516 Bacteria 1407
966 Ga0500643_000054 3300053087 Bacteria 135351
967 Ga0500644_0072872 3300053088 Bacteria 1242
968 Ga0500583_0295266 3300053092 Bacteria 794
969 Ga0500641_0074051 3300053096 Bacteria 1438
970 Ga0500641_0111080 3300053096 Bacteria 1180
971 Ga0500641_0177754 3300053096 Bacteria 914
972 Ga0500555_001223 3300053103 Bacteria 8295
973 Ga0500607_027544 3300053121 Bacteria 3153
974 Ga0500608_000056 3300053122 Bacteria 48877
975 Ga0500618_000476 3300053125 Bacteria 25891
976 Ga0500618_076521 3300053125 Bacteria 750
977 Ga0500642_0188971 3300053130 Bacteria 961
978 Ga0500652_087960 3300053131 Bacteria 1296
979 Ga0500652_170828 3300053131 Bacteria 895
980 Ga0500658_0005690 3300053134 Bacteria 4641
981 Ga0500559_0000058 3300053136 Bacteria 88268
982 Ga0500559_0083446 3300053136 Bacteria 1455
983 Ga0500568_0045537 3300053139 Bacteria 1745
984 Ga0500568_0112641 3300053139 Bacteria 1016
985 Ga0500573_0000021 3300053140 Bacteria 159093
986 Ga0500616_0000011 3300053153 Bacteria 732880
987 Ga0500616_0005790 3300053153 Bacteria 8296
988 Ga0500616_0034466 3300053153 Bacteria 2757
989 Ga0500622_0007115 3300053156 Bacteria 6390
990 Ga0500622_0029876 3300053156 Bacteria 2863
991 Ga0500622_0038650 3300053156 Bacteria 2490
992 Ga0500622_0108173 3300053156 Bacteria 1361
993 Ga0500645_038014 3300053730 Bacteria 1429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10010835 JGI24739J22299_100108353 190
2 3300005563 Ga0068855_100393934 Ga0068855_1003939342 191
3 3300030745 Ga0316182_1113340 Ga0316182_11133402 191
4 3300032004 Ga0307414_10325666 Ga0307414_103256662 191
5 3300046615 Ga0495656_0150867 Ga0495656_0150867_326_946 191
6 3300046648 Ga0495611_0032636 Ga0495611_0032636_910_1530 191
7 iso_pu_bacteria 2501025504 2501409081 191
8 iso_pu_bacteria 2510917014 2511101172 191
9 3300021361 Ga0213872_10003040 Ga0213872_100030405 192
10 3300031249 Ga0265339_10010885 Ga0265339_100108854 192
11 3300031344 Ga0265316_10006562 Ga0265316_1000656211 192
12 3300031595 Ga0265313_10000181 Ga0265313_1000018166 192
13 3300031712 Ga0265342_10073510 Ga0265342_100735104 192
14 3300037471 Ga0395905_0146690 Ga0395905_0146690_100_714 192
15 3300039447 Ga0436361_0170645 Ga0436361_0170645_4294_4929 192
16 3300046453 Ga0495627_007672 Ga0495627_007672_388_1014 192
17 3300048925 Ga0496122_0039578 Ga0496122_0039578_2509_3132 192
18 3300048926 Ga0496123_0041995 Ga0496123_0041995_2054_2677 192
19 3300048927 Ga0496124_0156147 Ga0496124_0156147_518_1144 192
20 3300053121 Ga0500607_027544 Ga0500607_027544_565_1215 192
21 3300003320 rootH2_10082605 rootH2_100826053 193
22 3300003856 Ga0058692_1000002 Ga0058692_1000002474 193
23 3300005456 Ga0070678_100036678 Ga0070678_1000366783 193
24 3300005578 Ga0068854_100238794 Ga0068854_1002387942 193
25 3300006051 Ga0075364_10092343 Ga0075364_100923432 193
26 3300009036 Ga0105244_10025146 Ga0105244_100251462 193
27 3300025981 Ga0207640_10241125 Ga0207640_102411252 193
28 3300026121 Ga0207683_10112193 Ga0207683_101121932 193
29 3300027312 Ga0209371_1000004 Ga0209371_1000004680 193
30 3300030500 Ga0268256_1000005 Ga0268256_1000005366 193
31 3300030742 Ga0316183_1037672 Ga0316183_10376722 193
32 3300046455 Ga0495603_0214038 Ga0495603_0214038_358_981 193
33 3300046457 Ga0495590_0031634 Ga0495590_0031634_282_905 193
34 3300046474 Ga0495605_0074648 Ga0495605_0074648_395_1018 193
35 3300046501 Ga0495607_0280906 Ga0495607_0280906_86_709 193
36 3300046513 Ga0495616_0007214 Ga0495616_0007214_1969_2592 193
37 3300046524 Ga0495648_0053226 Ga0495648_0053226_1604_2227 193
38 3300046557 Ga0495622_0187334 Ga0495622_0187334_104_727 193
39 3300047319 Ga0495674_0008731 Ga0495674_0008731_5917_6540 193
40 3300047323 Ga0495683_0290085 Ga0495683_0290085_35_658 193
41 3300047443 Ga0495687_034441 Ga0495687_034441_1606_2229 193
42 3300047445 Ga0495677_0039380 Ga0495677_0039380_479_1102 193
43 3300047469 Ga0495673_0019288 Ga0495673_0019288_378_1001 193
44 3300048903 Ga0496100_0000969 Ga0496100_0000969_11265_11888 193
45 3300048903 Ga0496100_0036158 Ga0496100_0036158_1070_1693 193
46 3300048904 Ga0496101_0000134 Ga0496101_0000134_1705_2328 193
47 3300048904 Ga0496101_0442365 Ga0496101_0442365_249_872 193
48 3300048905 Ga0496102_0000181 Ga0496102_0000181_35130_35753 193
49 3300048906 Ga0496103_0004132 Ga0496103_0004132_733_1356 193
50 3300048907 Ga0496104_0104084 Ga0496104_0104084_885_1508 193
51 3300048907 Ga0496104_0189387 Ga0496104_0189387_219_842 193
52 3300048909 Ga0496106_0170803 Ga0496106_0170803_1086_1709 193
53 3300048909 Ga0496106_0644769 Ga0496106_0644769_24_647 193
54 3300048910 Ga0496107_0122689 Ga0496107_0122689_425_1045 193
55 3300048913 Ga0496110_0789013 Ga0496110_0789013_13_636 193
56 3300048915 Ga0496112_0032873 Ga0496112_0032873_3919_4542 193
57 3300048916 Ga0496113_0005357 Ga0496113_0005357_5052_5675 193
58 3300048919 Ga0496116_0130584 Ga0496116_0130584_67_690 193
59 3300048920 Ga0496117_0004049 Ga0496117_0004049_871_1494 193
60 3300048920 Ga0496117_0004800 Ga0496117_0004800_3706_4323 193
61 3300048921 Ga0496118_0000135 Ga0496118_0000135_42154_42777 193
62 3300048921 Ga0496118_0011915 Ga0496118_0011915_7068_7685 193
63 3300048922 Ga0496119_0049366 Ga0496119_0049366_1830_2453 193
64 3300048923 Ga0496120_0083080 Ga0496120_0083080_378_1001 193
65 3300048924 Ga0496121_0000361 Ga0496121_0000361_13604_14227 193
66 3300048924 Ga0496121_0000532 Ga0496121_0000532_71110_71730 193
67 3300048924 Ga0496121_0008433 Ga0496121_0008433_732_1349 193
68 3300048924 Ga0496121_0077097 Ga0496121_0077097_1231_1854 193
69 3300048925 Ga0496122_0157445 Ga0496122_0157445_415_1038 193
70 3300048926 Ga0496123_0266656 Ga0496123_0266656_199_822 193
71 3300048928 Ga0496125_0015861 Ga0496125_0015861_793_1410 193
72 3300048929 Ga0496126_0248031 Ga0496126_0248031_658_1281 193
73 3300049460 Ga0495682_0034109 Ga0495682_0034109_552_1175 193
74 iso_pu_bacteria 2501025501 2501072490 193
75 iso_pu_bacteria 2510917015 2511107112 193
76 iso_pu_bacteria 2513237082 2513552407 193
77 iso_pu_bacteria 2513237083 2513565695 193
78 iso_pu_bacteria 8003955200 8003959322 193
79 3300003781 Ga0055536_1022660 Ga0055536_10226602 194
80 3300005262 Ga0065165_1000040 Ga0065165_1000040108 194
81 3300013104 Ga0157370_10588822 Ga0157370_105888222 194
82 3300025284 Ga0209130_1004306 Ga0209130_10043067 194
83 3300025292 Ga0209676_1000225 Ga0209676_1000225107 194
84 3300025298 Ga0209050_1010537 Ga0209050_10105374 194
85 3300025302 Ga0207426_1000004 Ga0207426_1000004786 194
86 3300025981 Ga0207640_10494080 Ga0207640_104940802 194
87 3300026142 Ga0207698_11077752 Ga0207698_110777522 194
88 3300031824 Ga0307413_10224612 Ga0307413_102246123 194
89 3300046558 Ga0495633_0164170 Ga0495633_0164170_28_618 194
90 3300048922 Ga0496119_0058521 Ga0496119_0058521_957_1571 194
91 3300053096 Ga0500641_0177754 Ga0500641_0177754_212_820 194
92 3300053153 Ga0500616_0034466 Ga0500616_0034466_86_694 194
93 iso_pu_bacteria 2515154189 2516018856 194
94 iso_pu_bacteria 2738543030 2739342855 194
95 iso_pu_bacteria 2808606384 2808969127 194
96 iso_pu_bacteria 2808606390 2809003958 194
97 iso_pu_bacteria 2808606391 2809011235 194
98 iso_pu_bacteria 8021622325 8021624860 194
99 3300003775 Ga0055524_1012477 Ga0055524_10124773 195
100 3300003790 Ga0055528_1000367 Ga0055528_100036734 195
101 3300013104 Ga0157370_10109162 Ga0157370_101091623 195
102 3300013306 Ga0163162_10469613 Ga0163162_104696132 195
103 3300025273 Ga0209673_1000005 Ga0209673_1000005573 195
104 3300025299 Ga0209256_1000477 Ga0209256_100047741 195
105 3300026118 Ga0207675_100478257 Ga0207675_1004782572 195
106 3300030732 Ga0316176_1040965 Ga0316176_10409653 195
107 3300032004 Ga0307414_10116095 Ga0307414_101160952 195
108 3300046453 Ga0495627_052017 Ga0495627_052017_376_993 195
109 3300046460 Ga0495638_0003487 Ga0495638_0003487_710_1351 195
110 3300046524 Ga0495648_0127445 Ga0495648_0127445_435_1037 195
111 3300046524 Ga0495648_0176545 Ga0495648_0176545_127_768 195
112 3300047470 Ga0495681_0103540 Ga0495681_0103540_127_768 195
113 3300048911 Ga0496108_1003661 Ga0496108_1003661_22_645 195
114 3300048922 Ga0496119_0038389 Ga0496119_0038389_16_639 195
115 3300048924 Ga0496121_0557580 Ga0496121_0557580_28_636 195
116 3300048925 Ga0496122_0252598 Ga0496122_0252598_75_716 195
117 3300048926 Ga0496123_0140614 Ga0496123_0140614_435_1052 195
118 3300048927 Ga0496124_0012352 Ga0496124_0012352_7719_8360 195
119 3300048927 Ga0496124_0095201 Ga0496124_0095201_133_750 195
120 3300048928 Ga0496125_0018703 Ga0496125_0018703_5796_6437 195
121 3300049571 Ga0501034_0005872 Ga0501034_0005872_7961_8599 195
122 iso_pu_bacteria 2501025502 2501080443 195
123 iso_pu_bacteria 2510917013 2511088276 195
124 iso_pu_bacteria 2738543009 2739226565 195
125 iso_pu_bacteria 2791355137 2792838133 195
126 iso_pu_bacteria 2818991457 2819660328 195
127 iso_pu_bacteria 2852684882 2852689138 195
128 iso_pu_bacteria 2883087390 2883092170 195
129 iso_pu_bacteria 2904615490 2904616826 195
130 iso_pu_bacteria 2919130084 2919130400 195
131 iso_pu_bacteria 2929195423 2929198592 195
132 iso_pu_bacteria 8021626552 8021627842 195
133 iso_pu_bacteria 8021648035 8021650786 195
134 3300003792 Ga0055540_1019751 Ga0055540_10197512 196
135 3300005563 Ga0068855_100949028 Ga0068855_1009490282 196
136 3300009093 Ga0105240_10008512 Ga0105240_100085122 196
137 3300009093 Ga0105240_10193184 Ga0105240_101931843 196
138 3300010375 Ga0105239_10000022 Ga0105239_1000002286 196
139 3300021361 Ga0213872_10052683 Ga0213872_100526832 196
140 3300025292 Ga0209676_1001452 Ga0209676_10014522 196
141 3300025292 Ga0209676_1003114 Ga0209676_100311410 196
142 3300025298 Ga0209050_1026358 Ga0209050_10263582 196
143 3300025303 Ga0209051_1005647 Ga0209051_10056476 196
144 3300025304 Ga0209257_1000208 Ga0209257_1000208131 196
145 3300025304 Ga0209257_1020284 Ga0209257_10202842 196
146 3300025913 Ga0207695_10000654 Ga0207695_1000065421 196
147 3300025913 Ga0207695_10006761 Ga0207695_1000676118 196
148 3300025949 Ga0207667_10805369 Ga0207667_108053692 196
149 3300038705 Ga0237819_12915 Ga0237819_12915_79_720 196
150 3300039447 Ga0436361_0022175 Ga0436361_0022175_1344_1949 196
151 3300039447 Ga0436361_0835169 Ga0436361_0835169_1562_2167 196
152 3300044656 Ga0466969_0299580 Ga0466969_0299580_121_711 196
153 3300048904 Ga0496101_0215785 Ga0496101_0215785_423_1043 196
154 3300048906 Ga0496103_0334834 Ga0496103_0334834_285_914 196
155 3300048924 Ga0496121_0059709 Ga0496121_0059709_784_1404 196
156 3300048927 Ga0496124_0184948 Ga0496124_0184948_109_753 196
157 3300048929 Ga0496126_0000581 Ga0496126_0000581_49348_49968 196
158 iso_pu_bacteria 2738541307 2738883224 196
159 iso_pu_bacteria 2848694841 2848700141 196
160 iso_pu_bacteria 2891048133 2891048377 196
161 3300002773 JGI25152J39213_1000231 JGI25152J39213_100023119 197
162 3300002774 JGI25150J39212_1000095 JGI25150J39212_100009518 197
163 3300003187 JGI25151J46595_10000477 JGI25151J46595_1000047724 197
164 3300003215 JGI25153J46596_10000291 JGI25153J46596_1000029124 197
165 3300005333 Ga0070677_10075881 Ga0070677_100758812 197
166 3300006051 Ga0075364_10208274 Ga0075364_102082742 197
167 3300009036 Ga0105244_10128061 Ga0105244_101280612 197
168 3300013102 Ga0157371_10012688 Ga0157371_100126882 197
169 3300015261 Ga0182006_1036383 Ga0182006_10363832 197
170 3300015262 Ga0182007_10001735 Ga0182007_100017358 197
171 3300015265 Ga0182005_1001033 Ga0182005_10010338 197
172 3300021384 Ga0213876_10113987 Ga0213876_101139872 197
173 3300025245 Ga0207425_1000028 Ga0207425_1000028132 197
174 3300025258 Ga0209129_1000065 Ga0209129_100006580 197
175 3300025294 Ga0209025_1000002 Ga0209025_1000002140 197
176 3300025297 Ga0209758_1000003 Ga0209758_1000003147 197
177 3300025728 Ga0207655_1034076 Ga0207655_10340763 197
178 3300039447 Ga0436361_0673292 Ga0436361_0673292_918_1517 197
179 3300047317 Ga0495604_0343819 Ga0495604_0343819_87_689 197
180 3300047472 Ga0495686_0051119 Ga0495686_0051119_659_1255 197
181 3300047472 Ga0495686_0129929 Ga0495686_0129929_538_1182 197
182 3300048919 Ga0496116_0198881 Ga0496116_0198881_235_876 197
183 3300048921 Ga0496118_0032231 Ga0496118_0032231_164_805 197
184 3300048922 Ga0496119_0001587 Ga0496119_0001587_730_1371 197
185 3300048923 Ga0496120_0000313 Ga0496120_0000313_739_1380 197
186 3300048924 Ga0496121_0145784 Ga0496121_0145784_627_1268 197
187 3300048929 Ga0496126_0047998 Ga0496126_0047998_2536_3177 197
188 iso_pu_bacteria 2513237166 2514047121 197
189 iso_pu_bacteria 2739367700 2739733274 197
190 iso_pu_bacteria 2765235840 2765578195 197
191 iso_pu_bacteria 2816332141 2816516239 197
192 iso_pu_bacteria 2842391507 2842393576 197
193 iso_pu_bacteria 2842757796 2842759395 197
194 iso_pu_bacteria 2871435913 2871439005 197
195 iso_pu_bacteria 2919089067 2919090861 197
196 iso_pu_bacteria 2919134579 2919136953 197
197 iso_pu_bacteria 2928496128 2928496845 197
198 iso_pu_bacteria 2931380184 2931381545 197
199 iso_pu_bacteria 2937610967 2937611662 197
200 iso_pu_bacteria 2939626828 2939627596 197
201 iso_pu_bacteria 2961047084 2961047596 197
202 iso_pu_bacteria 2961064222 2961068427 197
203 iso_pu_bacteria 2995392953 2995394332 197
204 iso_pu_bacteria 642555112 642597536 197
205 iso_pu_bacteria 8057575449 8057579245 197
206 3300005518 Ga0070699_100610319 Ga0070699_1006103191 198
207 3300038443 Ga0395901_1296731 Ga0395901_1296731_56_658 198
208 3300046507 Ga0495606_0088286 Ga0495606_0088286_536_1138 198
209 iso_pu_bacteria 2576861471 2578459146 198
210 iso_pu_bacteria 2643221645 2644252791 198
211 iso_pu_bacteria 2643221664 2644355163 198
212 iso_pu_bacteria 2711768613 2713480284 198
213 iso_pu_bacteria 2738541280 2738737691 198
214 iso_pu_bacteria 2738541300 2738841894 198
215 iso_pu_bacteria 2738543018 2739272753 198
216 iso_pu_bacteria 2738543030 2739341797 198
217 iso_pu_bacteria 2857442823 2857443022 198
218 iso_pu_bacteria 2921643360 2921643945 198
219 iso_pu_bacteria 2939589442 2939592240 198
220 iso_pu_bacteria 2939622612 2939626397 198
221 iso_pu_bacteria 2941475908 2941476935 198
222 iso_pu_bacteria 2974307012 2974309581 198
223 iso_pu_bacteria 2977247770 2977250319 198
224 iso_pu_bacteria 2984514374 2984515206 198
225 iso_pu_bacteria 3005409236 3005416253 198
226 2162886007 SwRhRL2b_contig_3055844 SwRhRL2b_0833.00004610 199
227 3300005331 Ga0070670_100051261 Ga0070670_1000512615 199
228 3300009011 Ga0105251_10001750 Ga0105251_100017507 199
229 3300011119 Ga0105246_10191418 Ga0105246_101914182 199
230 3300013102 Ga0157371_10351170 Ga0157371_103511701 199
231 3300015265 Ga0182005_1004597 Ga0182005_10045973 199
232 3300025735 Ga0207713_1000393 Ga0207713_100039330 199
233 3300025925 Ga0207650_10060634 Ga0207650_100606344 199
234 3300026116 Ga0207674_10548626 Ga0207674_105486261 199
235 3300031548 Ga0307408_100006936 Ga0307408_1000069366 199
236 3300039447 Ga0436361_1083332 Ga0436361_1083332_29_643 199
237 3300046463 Ga0495653_0123525 Ga0495653_0123525_1187_1801 199
238 3300046680 Ga0495646_0325177 Ga0495646_0325177_53_667 199
239 3300048088 Ga0495602_0020013 Ga0495602_0020013_1159_1773 199
240 3300048907 Ga0496104_0216485 Ga0496104_0216485_284_901 199
241 3300048908 Ga0496105_0025048 Ga0496105_0025048_1255_1872 199
242 3300048919 Ga0496116_0074369 Ga0496116_0074369_1479_2087 199
243 3300048919 Ga0496116_0194811 Ga0496116_0194811_85_702 199
244 3300048920 Ga0496117_0001420 Ga0496117_0001420_33251_33874 199
245 3300048920 Ga0496117_0004899 Ga0496117_0004899_8640_9257 199
246 3300048921 Ga0496118_0011231 Ga0496118_0011231_925_1542 199
247 3300048921 Ga0496118_0116457 Ga0496118_0116457_893_1501 199
248 3300048921 Ga0496118_0126003 Ga0496118_0126003_694_1317 199
249 3300048922 Ga0496119_0001058 Ga0496119_0001058_29336_29953 199
250 3300048922 Ga0496119_0036896 Ga0496119_0036896_396_1004 199
251 3300048922 Ga0496119_0282164 Ga0496119_0282164_175_792 199
252 3300048923 Ga0496120_0002147 Ga0496120_0002147_688_1311 199
253 3300048923 Ga0496120_0002531 Ga0496120_0002531_16690_17307 199
254 3300048923 Ga0496120_0010752 Ga0496120_0010752_5167_5784 199
255 3300048923 Ga0496120_0035630 Ga0496120_0035630_1410_2018 199
256 3300048924 Ga0496121_0063489 Ga0496121_0063489_1623_2231 199
257 3300048925 Ga0496122_0003345 Ga0496122_0003345_19946_20569 199
258 3300048925 Ga0496122_0091290 Ga0496122_0091290_112_720 199
259 3300048925 Ga0496122_0239470 Ga0496122_0239470_395_1003 199
260 3300048926 Ga0496123_0002721 Ga0496123_0002721_19904_20527 199
261 3300048926 Ga0496123_0052947 Ga0496123_0052947_819_1427 199
262 3300048927 Ga0496124_0190942 Ga0496124_0190942_25_633 199
263 3300048928 Ga0496125_0002637 Ga0496125_0002637_7240_7848 199
264 3300048929 Ga0496126_0070369 Ga0496126_0070369_659_1267 199
265 3300048929 Ga0496126_0215948 Ga0496126_0215948_481_1098 199
266 3300049579 Ga0501043_0001256 Ga0501043_0001256_7154_7765 199
267 3300049653 Ga0501206_009653 Ga0501206_009653_173_778 199
268 3300049760 Ga0501263_002145 Ga0501263_002145_1045_1656 199
269 3300049822 Ga0501035_0234169 Ga0501035_0234169_12_623 199
270 iso_pu_bacteria 2513237098 2513678071 199
271 iso_pu_bacteria 2513237305 2514423417 199
272 iso_pu_bacteria 2687453392 2688599150 199
273 iso_pu_bacteria 2721755686 2723578225 199
274 iso_pu_bacteria 2818991461 2819682929 199
275 iso_pu_bacteria 2844009547 2844014329 199
276 iso_pu_bacteria 2856328259 2856329099 199
277 iso_pu_bacteria 2856334872 2856341988 199
278 iso_pu_bacteria 2857367948 2857372336 199
279 iso_pu_bacteria 2869169390 2869174037 199
280 iso_pu_bacteria 2869234852 2869240697 199
281 iso_pu_bacteria 2869242130 2869244930 199
282 iso_pu_bacteria 2869249662 2869252222 199
283 iso_pu_bacteria 2869256925 2869263518 199
284 iso_pu_bacteria 2869264136 2869268171 199
285 iso_pu_bacteria 2869271264 2869278016 199
286 iso_pu_bacteria 2871451962 2871452008 199
287 iso_pu_bacteria 2871459585 2871460127 199
288 iso_pu_bacteria 2871481445 2871483950 199
289 iso_pu_bacteria 2874109183 2874110944 199
290 iso_pu_bacteria 2874116593 2874121780 199
291 iso_pu_bacteria 2874131515 2874135795 199
292 iso_pu_bacteria 2874162495 2874167871 199
293 iso_pu_bacteria 2876386047 2876386564 199
294 iso_pu_bacteria 2876399893 2876403335 199
295 iso_pu_bacteria 2876406927 2876408956 199
296 iso_pu_bacteria 2876420981 2876422220 199
297 iso_pu_bacteria 2878730984 2878738061 199
298 iso_pu_bacteria 2878774303 2878775639 199
299 iso_pu_bacteria 2878781027 2878783640 199
300 iso_pu_bacteria 2882632389 2882637502 199
301 iso_pu_bacteria 2903513507 2903520512 199
302 iso_pu_bacteria 2906363423 2906365028 199
303 iso_pu_bacteria 2906370794 2906376921 199
304 iso_pu_bacteria 2906393657 2906395347 199
305 iso_pu_bacteria 2906401398 2906402107 199
306 iso_pu_bacteria 2906408224 2906414359 199
307 iso_pu_bacteria 2906427513 2906434314 199
308 iso_pu_bacteria 2919138771 2919139797 199
309 iso_pu_bacteria 2922151315 2922153772 199
310 iso_pu_bacteria 2922172374 2922173102 199
311 iso_pu_bacteria 2922178524 2922184320 199
312 iso_pu_bacteria 2924733363 2924734656 199
313 iso_pu_bacteria 2924741084 2924743182 199
314 iso_pu_bacteria 2924748358 2924752106 199
315 iso_pu_bacteria 2935638405 2935647795 199
316 iso_pu_bacteria 2935665750 2935666830 199
317 iso_pu_bacteria 2935827899 2935837279 199
318 iso_pu_bacteria 2937861824 2937864229 199
319 iso_pu_bacteria 2937980651 2937988297 199
320 iso_pu_bacteria 2958108152 2958108934 199
321 iso_pu_bacteria 2958122699 2958123340 199
322 iso_pu_bacteria 2958137437 2958143996 199
323 iso_pu_bacteria 2958158011 2958161059 199
324 iso_pu_bacteria 2961136820 2961138990 199
325 iso_pu_bacteria 2961183825 2961186784 199
326 iso_pu_bacteria 2965025482 2965029253 199
327 iso_pu_bacteria 2965032056 2965036432 199
328 iso_pu_bacteria 2965040258 2965045848 199
329 iso_pu_bacteria 2965047637 2965049866 199
330 iso_pu_bacteria 2965089291 2965091097 199
331 iso_pu_bacteria 2970489779 2970489800 199
332 iso_pu_bacteria 2970510686 2970517933 199
333 iso_pu_bacteria 2970532167 2970538793 199
334 iso_pu_bacteria 2970547951 2970551921 199
335 iso_pu_bacteria 2970627176 2970629719 199
336 iso_pu_bacteria 2977851361 2977853983 199
337 iso_pu_bacteria 2977872689 2977879637 199
338 iso_pu_bacteria 2977907340 2977911246 199
339 iso_pu_bacteria 2977915119 2977918298 199
340 iso_pu_bacteria 2977935797 2977937536 199
341 iso_pu_bacteria 2977950692 2977954001 199
342 iso_pu_bacteria 2977957713 2977963292 199
343 iso_pu_bacteria 2979764755 2979769019 199
344 iso_pu_bacteria 2979772303 2979774792 199
345 iso_pu_bacteria 2979793036 2979798502 199
346 iso_pu_bacteria 2987645492 2987647285 199
347 iso_pu_bacteria 2987673487 2987675862 199
348 iso_pu_bacteria 2996386984 2996388311 199
349 iso_pu_bacteria 3004195979 3004196985 199
350 iso_pu_bacteria 3004232784 3004238463 199
351 iso_pu_bacteria 3004239961 3004242840 199
352 iso_pu_bacteria 3004248173 3004252801 199
353 iso_pu_bacteria 3004268573 3004269808 199
354 iso_pu_bacteria 649633066 649873581 199
355 iso_pu_bacteria 8004300914 8004306606 199
356 iso_pu_bacteria 8004312739 8004316980 199
357 iso_pu_bacteria 8004361976 8004367528 199
358 iso_pu_bacteria 8004695233 8004699132 199
359 iso_pu_bacteria 8004727605 8004728590 199
360 3300003763 Ga0055529_1004557 Ga0055529_10045572 200
361 3300009545 Ga0105237_10000202 Ga0105237_1000020284 200
362 3300025250 Ga0209026_1001092 Ga0209026_10010928 200
363 3300025256 Ga0209759_1004246 Ga0209759_10042462 200
364 3300025272 Ga0209455_1000766 Ga0209455_10007663 200
365 3300025914 Ga0207671_10000726 Ga0207671_1000072635 200
366 3300026067 Ga0207678_10012569 Ga0207678_100125695 200
367 3300026078 Ga0207702_10000456 Ga0207702_1000045619 200
368 3300027312 Ga0209371_1000044 Ga0209371_1000044228 200
369 3300030500 Ga0268256_1000046 Ga0268256_1000046228 200
370 3300031507 Ga0307509_10262360 Ga0307509_102623601 200
371 3300039447 Ga0436361_0795199 Ga0436361_0795199_17359_17982 200
372 3300041452 Ga0451793_0151939 Ga0451793_0151939_682_1308 200
373 3300041458 Ga0451798_0004380 Ga0451798_0004380_53_679 200
374 3300041459 Ga0451800_1204646 Ga0451800_1204646_676_1302 200
375 3300041462 Ga0451806_700263 Ga0451806_700263_696_1322 200
376 3300041463 Ga0451804_0156193 Ga0451804_0156193_676_1302 200
377 3300041486 Ga0451807_0057674 Ga0451807_0057674_710_1336 200
378 3300046499 Ga0495594_0177404 Ga0495594_0177404_558_1193 200
379 3300046507 Ga0495606_0334266 Ga0495606_0334266_135_746 200
380 3300046520 Ga0495637_0019179 Ga0495637_0019179_588_1244 200
381 3300046524 Ga0495648_0122160 Ga0495648_0122160_522_1133 200
382 3300046530 Ga0495654_0238031 Ga0495654_0238031_134_745 200
383 3300046542 Ga0495597_0036025 Ga0495597_0036025_759_1370 200
384 3300046660 Ga0495625_0054020 Ga0495625_0054020_1017_1628 200
385 3300046664 Ga0495659_0000286 Ga0495659_0000286_1544_2155 200
386 3300046692 Ga0495671_0000163 Ga0495671_0000163_56967_57578 200
387 3300046694 Ga0495649_0185523 Ga0495649_0185523_56_664 200
388 3300047320 Ga0495672_0000023 Ga0495672_0000023_184781_185392 200
389 3300047469 Ga0495673_0019046 Ga0495673_0019046_1216_1830 200
390 3300047472 Ga0495686_0000164 Ga0495686_0000164_58708_59322 200
391 3300048926 Ga0496123_0313962 Ga0496123_0313962_119_733 200
392 iso_pu_bacteria 2585427594 2585845312 200
393 iso_pu_bacteria 2643221569 2643858564 200
394 iso_pu_bacteria 2738541293 2738800482 200
395 3300003771 Ga0055526_1000874 Ga0055526_10008744 201
396 3300003773 Ga0055537_1000268 Ga0055537_100026818 201
397 3300003775 Ga0055524_1002624 Ga0055524_100262412 201
398 3300003784 Ga0055534_1000362 Ga0055534_10003628 201
399 3300003790 Ga0055528_1000370 Ga0055528_100037017 201
400 3300005347 Ga0070668_100029042 Ga0070668_1000290423 201
401 3300009092 Ga0105250_10069397 Ga0105250_100693972 201
402 3300025263 Ga0209565_1000017 Ga0209565_1000017404 201
403 3300025273 Ga0209673_1000007 Ga0209673_100000725 201
404 3300025291 Ga0209675_1000009 Ga0209675_1000009493 201
405 3300025295 Ga0209564_1000036 Ga0209564_100003625 201
406 3300025299 Ga0209256_1000091 Ga0209256_100009125 201
407 3300025972 Ga0207668_10162988 Ga0207668_101629882 201
408 3300044683 Ga0466965_0312279 Ga0466965_0312279_138_752 201
409 3300046506 Ga0495583_0050191 Ga0495583_0050191_563_1186 201
410 3300046512 Ga0495610_0049710 Ga0495610_0049710_1386_2012 201
411 3300046531 Ga0495665_0105312 Ga0495665_0105312_775_1398 201
412 3300046648 Ga0495611_0200438 Ga0495611_0200438_198_821 201
413 3300047320 Ga0495672_0171919 Ga0495672_0171919_435_1058 201
414 3300048908 Ga0496105_0014113 Ga0496105_0014113_3675_4298 201
415 3300048927 Ga0496124_0414141 Ga0496124_0414141_178_792 201
416 3300053125 Ga0500618_076521 Ga0500618_076521_26_652 201
417 iso_pu_bacteria 2643221591 2643965005 201
418 iso_pu_bacteria 2643221663 2644352183 201
419 iso_pu_bacteria 2643221699 2644548439 201
420 iso_pu_bacteria 2830075706 2830078969 201
421 iso_pu_bacteria 2857504554 2857506516 201
422 iso_pu_bacteria 8003014200 8003014248 201
423 3300002773 JGI25152J39213_1001252 JGI25152J39213_10012529 202
424 3300002774 JGI25150J39212_1000142 JGI25150J39212_100014232 202
425 3300002774 JGI25150J39212_1000230 JGI25150J39212_10002304 202
426 3300003187 JGI25151J46595_10000031 JGI25151J46595_10000031140 202
427 3300003215 JGI25153J46596_10000927 JGI25153J46596_100009274 202
428 3300003578 Ga0006562J51391_1005855 Ga0006562J51391_10058553 202
429 3300003775 Ga0055524_1000010 Ga0055524_1000010193 202
430 3300005262 Ga0065165_1015600 Ga0065165_10156004 202
431 3300006186 Ga0075369_10081602 Ga0075369_100816022 202
432 3300006948 Ga0099826_10000002 Ga0099826_10000002228 202
433 3300025245 Ga0207425_1000070 Ga0207425_100007079 202
434 3300025258 Ga0209129_1000172 Ga0209129_100017279 202
435 3300025258 Ga0209129_1000232 Ga0209129_100023238 202
436 3300025263 Ga0209565_1006338 Ga0209565_10063383 202
437 3300025294 Ga0209025_1000083 Ga0209025_1000083184 202
438 3300025297 Ga0209758_1000090 Ga0209758_100009079 202
439 3300025299 Ga0209256_1000007 Ga0209256_1000007571 202
440 3300026035 Ga0207703_11035931 Ga0207703_110359312 202
441 3300027666 Ga0209282_1000001 Ga0209282_1000001919 202
442 3300031731 Ga0307405_10008120 Ga0307405_100081204 202
443 3300031911 Ga0307412_10001031 Ga0307412_1000103112 202
444 3300032005 Ga0307411_10534239 Ga0307411_105342391 202
445 3300046471 Ga0495650_0116780 Ga0495650_0116780_166_795 202
446 3300046512 Ga0495610_0000250 Ga0495610_0000250_39342_39971 202
447 3300046525 Ga0495663_0042232 Ga0495663_0042232_40_681 202
448 3300047469 Ga0495673_0085027 Ga0495673_0085027_248_877 202
449 3300047472 Ga0495686_0011381 Ga0495686_0011381_1278_1907 202
450 3300048903 Ga0496100_0197319 Ga0496100_0197319_247_876 202
451 3300048908 Ga0496105_0001129 Ga0496105_0001129_8841_9464 202
452 3300048912 Ga0496109_0978616 Ga0496109_0978616_85_714 202
453 3300048919 Ga0496116_0005234 Ga0496116_0005234_3709_4338 202
454 3300048920 Ga0496117_0018675 Ga0496117_0018675_2761_3390 202
455 3300048920 Ga0496117_0165643 Ga0496117_0165643_92_721 202
456 3300048921 Ga0496118_0045381 Ga0496118_0045381_1905_2534 202
457 3300048922 Ga0496119_0004632 Ga0496119_0004632_8942_9565 202
458 3300048923 Ga0496120_0036565 Ga0496120_0036565_1771_2394 202
459 3300048924 Ga0496121_0033869 Ga0496121_0033869_922_1551 202
460 3300048924 Ga0496121_0134324 Ga0496121_0134324_923_1552 202
461 3300048925 Ga0496122_0041456 Ga0496122_0041456_922_1551 202
462 3300048925 Ga0496122_0127937 Ga0496122_0127937_923_1552 202
463 3300048926 Ga0496123_0007763 Ga0496123_0007763_6765_7394 202
464 3300048926 Ga0496123_0062669 Ga0496123_0062669_923_1552 202
465 3300048927 Ga0496124_0006165 Ga0496124_0006165_10594_11217 202
466 3300048927 Ga0496124_0041671 Ga0496124_0041671_120_749 202
467 3300048927 Ga0496124_0089365 Ga0496124_0089365_1767_2396 202
468 3300048927 Ga0496124_0198029 Ga0496124_0198029_888_1517 202
469 3300048928 Ga0496125_0009701 Ga0496125_0009701_8460_9083 202
470 3300048928 Ga0496125_0010823 Ga0496125_0010823_5011_5640 202
471 3300049459 Ga0495678_106556 Ga0495678_106556_265_894 202
472 iso_pu_bacteria 2842698319 2842702357 202
473 3300001904 JGI24736J21556_1004445 JGI24736J21556_10044453 203
474 3300001915 JGI24741J21665_1005915 JGI24741J21665_10059152 203
475 3300001915 JGI24741J21665_1007918 JGI24741J21665_10079182 203
476 3300001915 JGI24741J21665_1032964 JGI24741J21665_10329641 203
477 3300001979 JGI24740J21852_10001457 JGI24740J21852_100014577 203
478 3300001979 JGI24740J21852_10009141 JGI24740J21852_100091412 203
479 3300001979 JGI24740J21852_10019556 JGI24740J21852_100195562 203
480 3300003781 Ga0055536_1000385 Ga0055536_10003852 203
481 3300003791 Ga0055530_10000573 Ga0055530_1000057322 203
482 3300005327 Ga0070658_10166907 Ga0070658_101669072 203
483 3300005329 Ga0070683_100075438 Ga0070683_1000754384 203
484 3300005329 Ga0070683_100333408 Ga0070683_1003334082 203
485 3300005336 Ga0070680_100005939 Ga0070680_10000593911 203
486 3300005336 Ga0070680_100025630 Ga0070680_1000256302 203
487 3300005336 Ga0070680_100046627 Ga0070680_1000466272 203
488 3300005337 Ga0070682_100081768 Ga0070682_1000817682 203
489 3300005339 Ga0070660_100121185 Ga0070660_1001211852 203
490 3300005339 Ga0070660_100282896 Ga0070660_1002828962 203
491 3300005339 Ga0070660_100406981 Ga0070660_1004069811 203
492 3300005339 Ga0070660_100593765 Ga0070660_1005937652 203
493 3300005341 Ga0070691_10000414 Ga0070691_1000041416 203
494 3300005341 Ga0070691_10051018 Ga0070691_100510183 203
495 3300005341 Ga0070691_10179152 Ga0070691_101791521 203
496 3300005341 Ga0070691_10202859 Ga0070691_102028592 203
497 3300005344 Ga0070661_100008252 Ga0070661_1000082529 203
498 3300005344 Ga0070661_100054589 Ga0070661_1000545894 203
499 3300005344 Ga0070661_100181726 Ga0070661_1001817262 203
500 3300005345 Ga0070692_10009461 Ga0070692_100094615 203
501 3300005345 Ga0070692_10021858 Ga0070692_100218584 203
502 3300005366 Ga0070659_100607313 Ga0070659_1006073132 203
503 3300005436 Ga0070713_100379402 Ga0070713_1003794022 203
504 3300005455 Ga0070663_100438417 Ga0070663_1004384172 203
505 3300005457 Ga0070662_100002976 Ga0070662_1000029765 203
506 3300005458 Ga0070681_10001054 Ga0070681_100010542 203
507 3300005458 Ga0070681_10046305 Ga0070681_100463052 203
508 3300005458 Ga0070681_10106849 Ga0070681_101068492 203
509 3300005518 Ga0070699_100536014 Ga0070699_1005360141 203
510 3300005530 Ga0070679_100000116 Ga0070679_10000011645 203
511 3300005530 Ga0070679_100039125 Ga0070679_1000391255 203
512 3300005530 Ga0070679_100068995 Ga0070679_1000689952 203
513 3300005535 Ga0070684_100060950 Ga0070684_1000609504 203
514 3300005535 Ga0070684_100089262 Ga0070684_1000892622 203
515 3300005539 Ga0068853_100067525 Ga0068853_1000675255 203
516 3300005539 Ga0068853_100307243 Ga0068853_1003072432 203
517 3300005539 Ga0068853_100663109 Ga0068853_1006631092 203
518 3300005539 Ga0068853_100761879 Ga0068853_1007618791 203
519 3300005546 Ga0070696_100046009 Ga0070696_1000460092 203
520 3300005546 Ga0070696_100174920 Ga0070696_1001749202 203
521 3300005547 Ga0070693_100001124 Ga0070693_1000011246 203
522 3300005563 Ga0068855_100100356 Ga0068855_1001003562 203
523 3300005563 Ga0068855_100171819 Ga0068855_1001718192 203
524 3300005564 Ga0070664_100050389 Ga0070664_1000503894 203
525 3300005564 Ga0070664_100096297 Ga0070664_1000962972 203
526 3300005577 Ga0068857_100066946 Ga0068857_1000669464 203
527 3300005577 Ga0068857_100074737 Ga0068857_1000747375 203
528 3300005577 Ga0068857_100797943 Ga0068857_1007979432 203
529 3300005578 Ga0068854_100103909 Ga0068854_1001039092 203
530 3300005578 Ga0068854_100247328 Ga0068854_1002473282 203
531 3300005578 Ga0068854_100378785 Ga0068854_1003787852 203
532 3300005614 Ga0068856_100179946 Ga0068856_1001799461 203
533 3300005614 Ga0068856_100452758 Ga0068856_1004527582 203
534 3300005614 Ga0068856_100562660 Ga0068856_1005626602 203
535 3300005616 Ga0068852_100250925 Ga0068852_1002509251 203
536 3300005616 Ga0068852_100385620 Ga0068852_1003856202 203
537 3300005616 Ga0068852_100893102 Ga0068852_1008931022 203
538 3300005834 Ga0068851_10010821 Ga0068851_100108214 203
539 3300006163 Ga0070715_10076191 Ga0070715_100761912 203
540 3300006175 Ga0070712_100057928 Ga0070712_1000579282 203
541 3300009093 Ga0105240_10123556 Ga0105240_101235562 203
542 3300009093 Ga0105240_10255133 Ga0105240_102551333 203
543 3300009093 Ga0105240_10460024 Ga0105240_104600242 203
544 3300009093 Ga0105240_11223492 Ga0105240_112234921 203
545 3300009551 Ga0105238_10002754 Ga0105238_100027542 203
546 3300013100 Ga0157373_10020888 Ga0157373_100208884 203
547 3300013102 Ga0157371_10035605 Ga0157371_100356052 203
548 3300013102 Ga0157371_10210343 Ga0157371_102103432 203
549 3300013104 Ga0157370_10006361 Ga0157370_1000636112 203
550 3300013104 Ga0157370_10028770 Ga0157370_100287702 203
551 3300013104 Ga0157370_10096501 Ga0157370_100965012 203
552 3300013105 Ga0157369_10155544 Ga0157369_101555442 203
553 3300013105 Ga0157369_10414277 Ga0157369_104142771 203
554 3300013105 Ga0157369_10687233 Ga0157369_106872332 203
555 3300013307 Ga0157372_10119219 Ga0157372_101192192 203
556 3300013307 Ga0157372_10190386 Ga0157372_101903863 203
557 3300013307 Ga0157372_12005137 Ga0157372_120051371 203
558 3300020070 Ga0206356_11511824 Ga0206356_115118242 203
559 3300020070 Ga0206356_11757027 Ga0206356_117570271 203
560 3300020077 Ga0206351_10803103 Ga0206351_108031032 203
561 3300020078 Ga0206352_10117821 Ga0206352_101178212 203
562 3300020081 Ga0206354_10084669 Ga0206354_100846692 203
563 3300020081 Ga0206354_10440027 Ga0206354_104400272 203
564 3300020082 Ga0206353_10964244 Ga0206353_109642443 203
565 3300020610 Ga0154015_1188516 Ga0154015_11885162 203
566 3300025261 Ga0209233_1021961 Ga0209233_10219612 203
567 3300025292 Ga0209676_1000128 Ga0209676_1000128142 203
568 3300025298 Ga0209050_1001118 Ga0209050_100111822 203
569 3300025304 Ga0209257_1040888 Ga0209257_10408882 203
570 3300025321 Ga0207656_10022892 Ga0207656_100228922 203
571 3300025321 Ga0207656_10086488 Ga0207656_100864882 203
572 3300025904 Ga0207647_10005263 Ga0207647_100052637 203
573 3300025904 Ga0207647_10030288 Ga0207647_100302882 203
574 3300025904 Ga0207647_10181630 Ga0207647_101816302 203
575 3300025905 Ga0207685_10076528 Ga0207685_100765282 203
576 3300025906 Ga0207699_10365875 Ga0207699_103658751 203
577 3300025909 Ga0207705_10023168 Ga0207705_100231685 203
578 3300025909 Ga0207705_10026499 Ga0207705_100264992 203
579 3300025909 Ga0207705_10181359 Ga0207705_101813592 203
580 3300025909 Ga0207705_10342909 Ga0207705_103429092 203
581 3300025911 Ga0207654_10501962 Ga0207654_105019622 203
582 3300025912 Ga0207707_10000181 Ga0207707_1000018147 203
583 3300025912 Ga0207707_10000203 Ga0207707_1000020330 203
584 3300025912 Ga0207707_10000846 Ga0207707_100008466 203
585 3300025912 Ga0207707_10006900 Ga0207707_100069008 203
586 3300025912 Ga0207707_10008967 Ga0207707_100089672 203
587 3300025912 Ga0207707_10013258 Ga0207707_100132586 203
588 3300025913 Ga0207695_10002351 Ga0207695_1000235114 203
589 3300025913 Ga0207695_10014947 Ga0207695_100149475 203
590 3300025914 Ga0207671_10148244 Ga0207671_101482443 203
591 3300025915 Ga0207693_10020467 Ga0207693_100204673 203
592 3300025917 Ga0207660_10000324 Ga0207660_100003242 203
593 3300025917 Ga0207660_10005067 Ga0207660_1000506710 203
594 3300025917 Ga0207660_10016000 Ga0207660_100160002 203
595 3300025917 Ga0207660_10036732 Ga0207660_100367322 203
596 3300025917 Ga0207660_10062321 Ga0207660_100623212 203
597 3300025919 Ga0207657_10008206 Ga0207657_100082062 203
598 3300025919 Ga0207657_10084586 Ga0207657_100845864 203
599 3300025920 Ga0207649_10000835 Ga0207649_1000083512 203
600 3300025920 Ga0207649_10004317 Ga0207649_100043178 203
601 3300025920 Ga0207649_10048759 Ga0207649_100487592 203
602 3300025921 Ga0207652_10000017 Ga0207652_10000017158 203
603 3300025921 Ga0207652_10000726 Ga0207652_1000072624 203
604 3300025921 Ga0207652_10000759 Ga0207652_100007592 203
605 3300025921 Ga0207652_10021521 Ga0207652_100215213 203
606 3300025921 Ga0207652_10025885 Ga0207652_100258856 203
607 3300025932 Ga0207690_10001833 Ga0207690_100018335 203
608 3300025932 Ga0207690_10026773 Ga0207690_100267732 203
609 3300025932 Ga0207690_10084247 Ga0207690_100842472 203
610 3300025933 Ga0207706_10017778 Ga0207706_100177785 203
611 3300025939 Ga0207665_10018144 Ga0207665_100181442 203
612 3300025944 Ga0207661_10018367 Ga0207661_100183672 203
613 3300025944 Ga0207661_10027627 Ga0207661_100276273 203
614 3300025944 Ga0207661_10168236 Ga0207661_101682363 203
615 3300025945 Ga0207679_10014117 Ga0207679_100141174 203
616 3300025945 Ga0207679_10208455 Ga0207679_102084552 203
617 3300025949 Ga0207667_10000447 Ga0207667_1000044728 203
618 3300025949 Ga0207667_10000489 Ga0207667_1000048915 203
619 3300025949 Ga0207667_10055913 Ga0207667_100559134 203
620 3300025949 Ga0207667_10144688 Ga0207667_101446882 203
621 3300025949 Ga0207667_10174887 Ga0207667_101748872 203
622 3300025949 Ga0207667_10203544 Ga0207667_102035442 203
623 3300025981 Ga0207640_10006018 Ga0207640_100060182 203
624 3300025981 Ga0207640_10117635 Ga0207640_101176352 203
625 3300026041 Ga0207639_10012653 Ga0207639_100126535 203
626 3300026041 Ga0207639_10029105 Ga0207639_100291056 203
627 3300026067 Ga0207678_10122410 Ga0207678_101224102 203
628 3300026067 Ga0207678_10388867 Ga0207678_103888672 203
629 3300026067 Ga0207678_10393108 Ga0207678_103931082 203
630 3300026078 Ga0207702_10008032 Ga0207702_100080324 203
631 3300026078 Ga0207702_10025487 Ga0207702_100254872 203
632 3300026078 Ga0207702_10068668 Ga0207702_100686683 203
633 3300026078 Ga0207702_10199378 Ga0207702_101993782 203
634 3300026116 Ga0207674_10000341 Ga0207674_1000034112 203
635 3300026116 Ga0207674_10039137 Ga0207674_100391375 203
636 3300026116 Ga0207674_10087758 Ga0207674_100877582 203
637 3300026142 Ga0207698_10001385 Ga0207698_100013854 203
638 3300026142 Ga0207698_10002975 Ga0207698_1000297510 203
639 3300026142 Ga0207698_10118065 Ga0207698_101180653 203
640 3300037418 Ga0395900_0046132 Ga0395900_0046132_2317_2943 203
641 3300037466 Ga0395898_0115774 Ga0395898_0115774_1930_2556 203
642 3300037466 Ga0395898_0266007 Ga0395898_0266007_293_919 203
643 3300038443 Ga0395901_0030291 Ga0395901_0030291_440_1066 203
644 3300048922 Ga0496119_0012434 Ga0496119_0012434_3024_3656 203
645 3300048924 Ga0496121_0140587 Ga0496121_0140587_560_1183 203
646 3300048928 Ga0496125_0058999 Ga0496125_0058999_837_1460 203
647 3300048929 Ga0496126_0052739 Ga0496126_0052739_582_1205 203
648 3300049570 Ga0501033_0051275 Ga0501033_0051275_1900_2532 203
649 3300049570 Ga0501033_0123340 Ga0501033_0123340_306_932 203
650 3300049571 Ga0501034_0269958 Ga0501034_0269958_350_982 203
651 3300049572 Ga0501036_0268666 Ga0501036_0268666_43_669 203
652 3300049574 Ga0501038_0123922 Ga0501038_0123922_732_1364 203
653 3300049579 Ga0501043_0024778 Ga0501043_0024778_1144_1776 203
654 3300049580 Ga0501046_0086498 Ga0501046_0086498_486_1118 203
655 3300049581 Ga0501047_0269925 Ga0501047_0269925_527_1159 203
656 3300049585 Ga0501069_0160151 Ga0501069_0160151_323_949 203
657 3300049585 Ga0501069_0256958 Ga0501069_0256958_240_866 203
658 3300049586 Ga0501070_0000201 Ga0501070_0000201_1986_2612 203
659 3300049586 Ga0501070_0038943 Ga0501070_0038943_1152_1778 203
660 3300049586 Ga0501070_0059770 Ga0501070_0059770_2005_2631 203
661 3300049586 Ga0501070_0150774 Ga0501070_0150774_631_1257 203
662 3300049586 Ga0501070_0170066 Ga0501070_0170066_487_1113 203
663 3300049589 Ga0501073_0336638 Ga0501073_0336638_352_978 203
664 3300049590 Ga0501074_0035073 Ga0501074_0035073_799_1425 203
665 3300049590 Ga0501074_0067603 Ga0501074_0067603_1378_2004 203
666 3300049590 Ga0501074_0076002 Ga0501074_0076002_1023_1649 203
667 3300049741 Ga0501079_0367054 Ga0501079_0367054_319_945 203
668 3300049742 Ga0501080_0044729 Ga0501080_0044729_1036_1662 203
669 3300049742 Ga0501080_0062572 Ga0501080_0062572_265_891 203
670 3300049742 Ga0501080_0470294 Ga0501080_0470294_336_968 203
671 3300049822 Ga0501035_0013408 Ga0501035_0013408_4541_5167 203
672 3300049822 Ga0501035_0089749 Ga0501035_0089749_1779_2405 203
673 3300049822 Ga0501035_0197647 Ga0501035_0197647_351_977 203
674 3300049823 Ga0501044_0234726 Ga0501044_0234726_762_1388 203
675 3300049823 Ga0501044_0365919 Ga0501044_0365919_273_899 203
676 3300053131 Ga0500652_087960 Ga0500652_087960_373_990 203
677 3300053136 Ga0500559_0000058 Ga0500559_0000058_29807_30442 203
678 iso_pu_bacteria 2643221563 2643832543 203
679 iso_pu_bacteria 2643221608 2644053662 203
680 iso_pu_bacteria 2738541297 2738828428 203
681 iso_pu_bacteria 2738541357 2739152224 203
682 iso_pu_bacteria 2738543003 2739193755 203
683 iso_pu_bacteria 2738543026 2739320620 203
684 iso_pu_bacteria 2738543029 2739338472 203
685 iso_pu_bacteria 2857564685 2857569941 203
686 3300001915 JGI24741J21665_1011473 JGI24741J21665_10114732 204
687 3300005455 Ga0070663_100325147 Ga0070663_1003251472 204
688 3300005577 Ga0068857_100078994 Ga0068857_1000789942 204
689 3300005844 Ga0068862_100760762 Ga0068862_1007607622 204
690 3300009551 Ga0105238_10745431 Ga0105238_107454312 204
691 3300013100 Ga0157373_10347880 Ga0157373_103478802 204
692 3300026067 Ga0207678_10310626 Ga0207678_103106262 204
693 3300026078 Ga0207702_10146846 Ga0207702_101468462 204
694 3300026116 Ga0207674_10063158 Ga0207674_100631583 204
695 3300031250 Ga0265331_10124406 Ga0265331_101244063 204
696 3300047472 Ga0495686_0000661 Ga0495686_0000661_22354_23016 204
697 3300049570 Ga0501033_0000259 Ga0501033_0000259_710_1336 204
698 3300049586 Ga0501070_0045585 Ga0501070_0045585_2454_3080 204
699 3300049742 Ga0501080_0019509 Ga0501080_0019509_5479_6105 204
700 3300049822 Ga0501035_0003843 Ga0501035_0003843_733_1359 204
701 3300053122 Ga0500608_000056 Ga0500608_000056_47342_47968 204
702 3300053140 Ga0500573_0000021 Ga0500573_0000021_26614_27240 204
703 3300053156 Ga0500622_0038650 Ga0500622_0038650_525_1151 204
704 iso_pu_bacteria 2841911363 2841913616 204
705 iso_pu_bacteria 2841917233 2841919363 204
706 iso_pu_bacteria 8054302542 8054306659 204
707 3300003187 JGI25151J46595_10048568 JGI25151J46595_100485682 205
708 3300003771 Ga0055526_1003976 Ga0055526_10039765 205
709 3300003775 Ga0055524_1024025 Ga0055524_10240252 205
710 3300003775 Ga0055524_1070331 Ga0055524_10703311 205
711 3300003775 Ga0055524_1070420 Ga0055524_10704201 205
712 3300003781 Ga0055536_1041988 Ga0055536_10419882 205
713 3300003791 Ga0055530_10003264 Ga0055530_100032641 205
714 3300003794 Ga0055531_10025287 Ga0055531_100252872 205
715 3300003794 Ga0055531_10081551 Ga0055531_100815511 205
716 3300003794 Ga0055531_10087643 Ga0055531_100876431 205
717 3300004625 Ga0055543_1001100 Ga0055543_10011007 205
718 3300005262 Ga0065165_1000101 Ga0065165_100010124 205
719 3300005329 Ga0070683_100753444 Ga0070683_1007534442 205
720 3300010375 Ga0105239_11424530 Ga0105239_114245301 205
721 3300021377 Ga0213874_10204541 Ga0213874_102045411 205
722 3300025273 Ga0209673_1004973 Ga0209673_10049732 205
723 3300025291 Ga0209675_1005833 Ga0209675_10058332 205
724 3300025291 Ga0209675_1022564 Ga0209675_10225642 205
725 3300025292 Ga0209676_1000196 Ga0209676_100019697 205
726 3300025292 Ga0209676_1001467 Ga0209676_10014672 205
727 3300025292 Ga0209676_1002185 Ga0209676_100218511 205
728 3300025292 Ga0209676_1002212 Ga0209676_10022129 205
729 3300025292 Ga0209676_1008591 Ga0209676_10085916 205
730 3300025294 Ga0209025_1001945 Ga0209025_100194516 205
731 3300025295 Ga0209564_1022642 Ga0209564_10226423 205
732 3300025297 Ga0209758_1054420 Ga0209758_10544201 205
733 3300025297 Ga0209758_1066704 Ga0209758_10667042 205
734 3300025298 Ga0209050_1001542 Ga0209050_10015421 205
735 3300025298 Ga0209050_1008975 Ga0209050_10089754 205
736 3300025299 Ga0209256_1002799 Ga0209256_100279911 205
737 3300025299 Ga0209256_1004756 Ga0209256_10047562 205
738 3300025302 Ga0207426_1041846 Ga0207426_10418462 205
739 3300025303 Ga0209051_1032710 Ga0209051_10327103 205
740 3300025304 Ga0209257_1000065 Ga0209257_100006542 205
741 3300025304 Ga0209257_1000737 Ga0209257_100073711 205
742 3300025304 Ga0209257_1000846 Ga0209257_10008462 205
743 3300025304 Ga0209257_1056445 Ga0209257_10564452 205
744 3300042876 Ga0451577_0004095 Ga0451577_0004095_11227_11856 205
745 3300044712 Ga0453684_0320696 Ga0453684_0320696_583_1212 205
746 3300046507 Ga0495606_0009523 Ga0495606_0009523_6935_7558 205
747 3300047472 Ga0495686_0003752 Ga0495686_0003752_4958_5635 205
748 3300048914 Ga0496111_0191031 Ga0496111_0191031_502_1131 205
749 3300048919 Ga0496116_0170428 Ga0496116_0170428_488_1117 205
750 3300048928 Ga0496125_0001513 Ga0496125_0001513_16011_16640 205
751 3300049513 Ga0501290_001270 Ga0501290_001270_1820_2449 205
752 3300049523 Ga0501300_004769 Ga0501300_004769_512_1141 205
753 3300049580 Ga0501046_0560948 Ga0501046_0560948_70_690 205
754 3300049581 Ga0501047_0758572 Ga0501047_0758572_15_650 205
755 3300049762 Ga0501265_000506 Ga0501265_000506_429_1058 205
756 3300049772 Ga0501275_000287 Ga0501275_000287_963_1592 205
757 3300053131 Ga0500652_170828 Ga0500652_170828_102_734 205
758 3300053136 Ga0500559_0083446 Ga0500559_0083446_677_1354 205
759 3300053156 Ga0500622_0029876 Ga0500622_0029876_742_1365 205
760 iso_pu_bacteria 2508501128 2509146787 205
761 iso_pu_bacteria 2593339238 2595448798 205
762 iso_pu_bacteria 2593339239 2595450660 205
763 iso_pu_bacteria 2818991440 2819564346 205
764 iso_pu_bacteria 2842914999 2842915788 205
765 iso_pu_bacteria 2842918807 2842921018 205
766 iso_pu_bacteria 2884338543 2884338753 205
767 iso_pu_bacteria 2904463128 2904464989 205
768 iso_pu_bacteria 2919085039 2919086548 205
769 iso_pu_bacteria 2919404418 2919407422 205
770 iso_pu_bacteria 2953994433 2953996282 205
771 iso_pu_bacteria 8006926726 8006932033 205
772 3300003763 Ga0055529_1000076 Ga0055529_1000076114 206
773 3300003791 Ga0055530_10005644 Ga0055530_100056442 206
774 3300003794 Ga0055531_10001002 Ga0055531_1000100224 206
775 3300005355 Ga0070671_100270334 Ga0070671_1002703342 206
776 3300005367 Ga0070667_100805793 Ga0070667_1008057931 206
777 3300005539 Ga0068853_100070406 Ga0068853_1000704064 206
778 3300005543 Ga0070672_100064190 Ga0070672_1000641903 206
779 3300005618 Ga0068864_100244820 Ga0068864_1002448203 206
780 3300005718 Ga0068866_10197397 Ga0068866_101973972 206
781 3300005842 Ga0068858_100449226 Ga0068858_1004492262 206
782 3300006237 Ga0097621_100043182 Ga0097621_1000431824 206
783 3300006358 Ga0068871_100053473 Ga0068871_1000534734 206
784 3300006931 Ga0097620_101224099 Ga0097620_1012240992 206
785 3300009036 Ga0105244_10009858 Ga0105244_100098586 206
786 3300009092 Ga0105250_10000005 Ga0105250_10000005215 206
787 3300009177 Ga0105248_10394626 Ga0105248_103946262 206
788 3300009545 Ga0105237_10050473 Ga0105237_100504732 206
789 3300012512 Ga0157327_1013548 Ga0157327_10135482 206
790 3300013104 Ga0157370_10176959 Ga0157370_101769593 206
791 3300014326 Ga0157380_10481611 Ga0157380_104816112 206
792 3300014497 Ga0182008_10003366 Ga0182008_100033668 206
793 3300014968 Ga0157379_10000199 Ga0157379_1000019934 206
794 3300015261 Ga0182006_1000133 Ga0182006_100013382 206
795 3300015265 Ga0182005_1009656 Ga0182005_10096562 206
796 3300017792 Ga0163161_10005751 Ga0163161_100057514 206
797 3300025245 Ga0207425_1000950 Ga0207425_100095010 206
798 3300025292 Ga0209676_1000243 Ga0209676_10002432 206
799 3300025294 Ga0209025_1006637 Ga0209025_10066377 206
800 3300025295 Ga0209564_1000011 Ga0209564_1000011573 206
801 3300025297 Ga0209758_1001782 Ga0209758_100178214 206
802 3300025298 Ga0209050_1000244 Ga0209050_10002442 206
803 3300025304 Ga0209257_1000140 Ga0209257_1000140121 206
804 3300025711 Ga0207696_1000181 Ga0207696_100018144 206
805 3300025728 Ga0207655_1003240 Ga0207655_100324011 206
806 3300025931 Ga0207644_10067091 Ga0207644_100670914 206
807 3300025940 Ga0207691_10049529 Ga0207691_100495295 206
808 3300025941 Ga0207711_10025799 Ga0207711_100257993 206
809 3300026035 Ga0207703_10463520 Ga0207703_104635202 206
810 3300026041 Ga0207639_10080835 Ga0207639_100808351 206
811 3300031731 Ga0307405_10218475 Ga0307405_102184752 206
812 3300032126 Ga0307415_100031417 Ga0307415_1000314173 206
813 3300035114 Ga0373939_0135111 Ga0373939_0135111_190_819 206
814 3300041404 Ga0439436_0000004 Ga0439436_0000004_85487_86113 206
815 3300041406 Ga0439439_0027845 Ga0439439_0027845_729_1361 206
816 3300041410 Ga0439461_0000338 Ga0439461_0000338_762_1394 206
817 3300041413 Ga0439465_0001362 Ga0439465_0001362_731_1363 206
818 3300041413 Ga0439465_0012861 Ga0439465_0012861_527_1153 206
819 3300041997 Ga0439431_0006417 Ga0439431_0006417_1803_2435 206
820 3300042002 Ga0439442_002014 Ga0439442_002014_824_1456 206
821 3300042004 Ga0439445_0000584 Ga0439445_0000584_6563_7195 206
822 3300042006 Ga0439432_001838 Ga0439432_001838_7080_7712 206
823 3300042015 Ga0439462_0001500 Ga0439462_0001500_1123_1755 206
824 3300042435 Ga0439434_0000210 Ga0439434_0000210_11892_12524 206
825 3300044658 Ga0466972_0087501 Ga0466972_0087501_400_1020 206
826 3300044735 Ga0466968_0032371 Ga0466968_0032371_867_1499 206
827 3300046452 Ga0495617_000018 Ga0495617_000018_104442_105071 206
828 3300046460 Ga0495638_0025571 Ga0495638_0025571_608_1237 206
829 3300046471 Ga0495650_0000067 Ga0495650_0000067_188253_188882 206
830 3300046471 Ga0495650_0000170 Ga0495650_0000170_74775_75404 206
831 3300046471 Ga0495650_0000932 Ga0495650_0000932_32477_33106 206
832 3300046474 Ga0495605_0000107 Ga0495605_0000107_92459_93088 206
833 3300046492 Ga0495585_0002320 Ga0495585_0002320_791_1420 206
834 3300046501 Ga0495607_0066061 Ga0495607_0066061_1096_1725 206
835 3300046507 Ga0495606_0000118 Ga0495606_0000118_74245_74874 206
836 3300046512 Ga0495610_0000012 Ga0495610_0000012_293580_294209 206
837 3300046512 Ga0495610_0000261 Ga0495610_0000261_840_1466 206
838 3300046512 Ga0495610_0002368 Ga0495610_0002368_6250_6879 206
839 3300046520 Ga0495637_0000342 Ga0495637_0000342_34341_34970 206
840 3300046524 Ga0495648_0012310 Ga0495648_0012310_3726_4355 206
841 3300046530 Ga0495654_0000011 Ga0495654_0000011_245877_246506 206
842 3300046558 Ga0495633_0013550 Ga0495633_0013550_2862_3491 206
843 3300046616 Ga0495668_0000137 Ga0495668_0000137_36156_36785 206
844 3300046616 Ga0495668_0000983 Ga0495668_0000983_1610_2239 206
845 3300046660 Ga0495625_0017582 Ga0495625_0017582_1198_1827 206
846 3300046660 Ga0495625_0110131 Ga0495625_0110131_835_1464 206
847 3300046665 Ga0495661_0108212 Ga0495661_0108212_180_809 206
848 3300046691 Ga0495670_0011181 Ga0495670_0011181_673_1299 206
849 3300046692 Ga0495671_0000006 Ga0495671_0000006_201274_201903 206
850 3300046810 Ga0495660_0004327 Ga0495660_0004327_7139_7768 206
851 3300047446 Ga0495679_004248 Ga0495679_004248_2734_3363 206
852 3300047469 Ga0495673_0000050 Ga0495673_0000050_76656_77285 206
853 3300047472 Ga0495686_0022911 Ga0495686_0022911_2410_3039 206
854 3300047472 Ga0495686_0066613 Ga0495686_0066613_1217_1846 206
855 3300048904 Ga0496101_0319910 Ga0496101_0319910_495_1127 206
856 3300048910 Ga0496107_0172724 Ga0496107_0172724_98_730 206
857 3300048911 Ga0496108_0056207 Ga0496108_0056207_982_1614 206
858 3300048912 Ga0496109_0118637 Ga0496109_0118637_1710_2342 206
859 3300048913 Ga0496110_0112716 Ga0496110_0112716_133_765 206
860 3300048914 Ga0496111_0094542 Ga0496111_0094542_825_1457 206
861 3300048917 Ga0496114_0007473 Ga0496114_0007473_1750_2382 206
862 3300048919 Ga0496116_0027637 Ga0496116_0027637_855_1484 206
863 3300048922 Ga0496119_0036466 Ga0496119_0036466_1587_2213 206
864 3300048923 Ga0496120_0213239 Ga0496120_0213239_160_786 206
865 3300053125 Ga0500618_000476 Ga0500618_000476_3712_4341 206
866 3300053134 Ga0500658_0005690 Ga0500658_0005690_2870_3499 206
867 3300053730 Ga0500645_038014 Ga0500645_038014_504_1133 206
868 iso_pu_bacteria 2643221733 2644727597 206
869 iso_pu_bacteria 2718218334 2721025408 206
870 iso_pu_bacteria 2734482264 2735834615 206
871 iso_pu_bacteria 2738543009 2739226073 206
872 3300001979 JGI24740J21852_10008770 JGI24740J21852_100087705 207
873 3300005539 Ga0068853_100545339 Ga0068853_1005453391 207
874 3300005616 Ga0068852_100036629 Ga0068852_1000366293 207
875 3300009093 Ga0105240_10008765 Ga0105240_1000876515 207
876 3300009093 Ga0105240_10463790 Ga0105240_104637901 207
877 3300009177 Ga0105248_11363830 Ga0105248_113638302 207
878 3300009551 Ga0105238_10000109 Ga0105238_100001096 207
879 3300010375 Ga0105239_10011676 Ga0105239_100116767 207
880 3300013306 Ga0163162_10000324 Ga0163162_1000032426 207
881 3300017792 Ga0163161_10198269 Ga0163161_101982692 207
882 3300025304 Ga0209257_1000155 Ga0209257_1000155154 207
883 3300025913 Ga0207695_10023535 Ga0207695_100235359 207
884 3300025914 Ga0207671_10004748 Ga0207671_100047487 207
885 3300026041 Ga0207639_10444592 Ga0207639_104445921 207
886 3300038705 Ga0237819_00145 Ga0237819_00145_25252_25881 207
887 3300039145 Ga0237816_03427 Ga0237816_03427_437_1066 207
888 3300046460 Ga0495638_0001219 Ga0495638_0001219_22329_22958 207
889 3300046513 Ga0495616_0000001 Ga0495616_0000001_421005_421640 207
890 3300046519 Ga0495632_0000196 Ga0495632_0000196_59526_60155 207
891 3300046616 Ga0495668_0001476 Ga0495668_0001476_993_1622 207
892 3300046648 Ga0495611_0035087 Ga0495611_0035087_1343_1975 207
893 3300046660 Ga0495625_0009860 Ga0495625_0009860_6945_7574 207
894 3300046810 Ga0495660_0000669 Ga0495660_0000669_126_755 207
895 3300047469 Ga0495673_0000004 Ga0495673_0000004_1352912_1353541 207
896 3300048089 Ga0495614_0028898 Ga0495614_0028898_558_1217 207
897 3300048905 Ga0496102_0000315 Ga0496102_0000315_20903_21532 207
898 3300048905 Ga0496102_0614110 Ga0496102_0614110_228_857 207
899 3300048906 Ga0496103_0001484 Ga0496103_0001484_820_1449 207
900 3300048919 Ga0496116_0008944 Ga0496116_0008944_518_1147 207
901 3300048920 Ga0496117_0000484 Ga0496117_0000484_44089_44718 207
902 3300048920 Ga0496117_0016813 Ga0496117_0016813_899_1531 207
903 3300048921 Ga0496118_0000486 Ga0496118_0000486_20964_21593 207
904 3300048921 Ga0496118_0063391 Ga0496118_0063391_1328_1960 207
905 3300048921 Ga0496118_0101584 Ga0496118_0101584_118_750 207
906 3300048924 Ga0496121_0000515 Ga0496121_0000515_71813_72445 207
907 3300048924 Ga0496121_0000770 Ga0496121_0000770_570_1199 207
908 3300048924 Ga0496121_0023471 Ga0496121_0023471_4620_5252 207
909 3300048924 Ga0496121_0050373 Ga0496121_0050373_925_1554 207
910 3300048928 Ga0496125_0078631 Ga0496125_0078631_851_1480 207
911 3300048928 Ga0496125_0079049 Ga0496125_0079049_1228_1857 207
912 3300048929 Ga0496126_0007075 Ga0496126_0007075_3494_4126 207
913 3300048929 Ga0496126_0048208 Ga0496126_0048208_1049_1678 207
914 3300049580 Ga0501046_0328112 Ga0501046_0328112_85_717 207
915 3300049742 Ga0501080_0111958 Ga0501080_0111958_612_1244 207
916 3300049822 Ga0501035_0426974 Ga0501035_0426974_305_937 207
917 3300049823 Ga0501044_0035800 Ga0501044_0035800_3788_4420 207
918 iso_pu_bacteria 2808606401 2809061852 207
919 iso_pu_bacteria 2808606404 2809077816 207
920 iso_pu_bacteria 2808606405 2809082476 207
921 iso_pu_bacteria 2880518877 2880519965 207
922 3300002075 JGI24738J21930_10000448 JGI24738J21930_100004486 208
923 3300003479 Ga0006556J51387_1032851 Ga0006556J51387_10328512 208
924 3300003565 Ga0006560J51390_1037325 Ga0006560J51390_10373251 208
925 3300003567 Ga0006554J51385_1031149 Ga0006554J51385_10311492 208
926 3300003575 Ga0007409J51694_1008758 Ga0007409J51694_10087583 208
927 3300003578 Ga0006562J51391_1044196 Ga0006562J51391_10441962 208
928 3300005262 Ga0065165_1000386 Ga0065165_100038627 208
929 3300005289 Ga0065704_10393488 Ga0065704_103934881 208
930 3300005353 Ga0070669_100065888 Ga0070669_1000658882 208
931 3300005355 Ga0070671_100118023 Ga0070671_1001180233 208
932 3300005459 Ga0068867_100496952 Ga0068867_1004969522 208
933 3300005544 Ga0070686_100321305 Ga0070686_1003213052 208
934 3300005548 Ga0070665_100217358 Ga0070665_1002173583 208
935 3300006186 Ga0075369_10202324 Ga0075369_102023242 208
936 3300009176 Ga0105242_10198237 Ga0105242_101982372 208
937 3300009551 Ga0105238_10285677 Ga0105238_102856773 208
938 3300010375 Ga0105239_10501147 Ga0105239_105011472 208
939 3300013104 Ga0157370_10004006 Ga0157370_100040067 208
940 3300013308 Ga0157375_10005255 Ga0157375_1000525511 208
941 3300015265 Ga0182005_1000027 Ga0182005_100002755 208
942 3300025226 Ga0209674_101868 Ga0209674_1018685 208
943 3300025233 Ga0209437_102902 Ga0209437_1029022 208
944 3300025254 Ga0209148_1001455 Ga0209148_10014558 208
945 3300025258 Ga0209129_1000647 Ga0209129_100064710 208
946 3300025297 Ga0209758_1019590 Ga0209758_10195903 208
947 3300025302 Ga0207426_1018654 Ga0207426_10186542 208
948 3300025303 Ga0209051_1017203 Ga0209051_10172032 208
949 3300025304 Ga0209257_1045513 Ga0209257_10455132 208
950 3300025924 Ga0207694_10335999 Ga0207694_103359992 208
951 3300025927 Ga0207687_10698688 Ga0207687_106986881 208
952 3300025932 Ga0207690_10104732 Ga0207690_101047321 208
953 3300025934 Ga0207686_10149641 Ga0207686_101496412 208
954 3300025940 Ga0207691_10202201 Ga0207691_102022012 208
955 3300026089 Ga0207648_10651237 Ga0207648_106512372 208
956 3300026142 Ga0207698_10322420 Ga0207698_103224202 208
957 3300028379 Ga0268266_10177480 Ga0268266_101774802 208
958 3300031911 Ga0307412_10000575 Ga0307412_100005752 208
959 3300037312 Ga0395899_0000086 Ga0395899_0000086_147752_148387 208
960 3300037418 Ga0395900_0749780 Ga0395900_0749780_245_880 208
961 3300037471 Ga0395905_0199330 Ga0395905_0199330_982_1617 208
962 3300038443 Ga0395901_0000263 Ga0395901_0000263_121_756 208
963 3300041501 Ga0451845_0500926 Ga0451845_0500926_397_1035 208
964 3300044735 Ga0466968_0018240 Ga0466968_0018240_1422_2057 208
965 3300044842 Ga0466957_0065217 Ga0466957_0065217_1533_2168 208
966 3300046457 Ga0495590_0001652 Ga0495590_0001652_7927_8571 208
967 3300046473 Ga0495582_0040520 Ga0495582_0040520_1161_1805 208
968 3300046491 Ga0495584_0000002 Ga0495584_0000002_419100_419735 208
969 3300046492 Ga0495585_0000003 Ga0495585_0000003_72665_73300 208
970 3300046492 Ga0495585_0096768 Ga0495585_0096768_23_658 208
971 3300046499 Ga0495594_0078129 Ga0495594_0078129_418_1062 208
972 3300046499 Ga0495594_0089973 Ga0495594_0089973_168_803 208
973 3300046501 Ga0495607_0018714 Ga0495607_0018714_2892_3527 208
974 3300046506 Ga0495583_0022480 Ga0495583_0022480_1757_2392 208
975 3300046507 Ga0495606_0303889 Ga0495606_0303889_82_717 208
976 3300046512 Ga0495610_0000303 Ga0495610_0000303_917_1561 208
977 3300046513 Ga0495616_0000228 Ga0495616_0000228_44830_45465 208
978 3300046515 Ga0495620_0027255 Ga0495620_0027255_183_818 208
979 3300046517 Ga0495630_0095365 Ga0495630_0095365_774_1418 208
980 3300046517 Ga0495630_0371981 Ga0495630_0371981_442_1077 208
981 3300046522 Ga0495643_0000341 Ga0495643_0000341_55984_56628 208
982 3300046524 Ga0495648_0000171 Ga0495648_0000171_72920_73555 208
983 3300046524 Ga0495648_0192516 Ga0495648_0192516_350_994 208
984 3300046526 Ga0495666_0007754 Ga0495666_0007754_747_1391 208
985 3300046526 Ga0495666_0012710 Ga0495666_0012710_2926_3561 208
986 3300046526 Ga0495666_0271178 Ga0495666_0271178_66_701 208
987 3300046528 Ga0495642_0008640 Ga0495642_0008640_3224_3859 208
988 3300046528 Ga0495642_0134275 Ga0495642_0134275_397_1032 208
989 3300046529 Ga0495652_0139886 Ga0495652_0139886_491_1135 208
990 3300046529 Ga0495652_0141168 Ga0495652_0141168_540_1175 208
991 3300046531 Ga0495665_0000780 Ga0495665_0000780_845_1480 208
992 3300046531 Ga0495665_0005867 Ga0495665_0005867_3940_4584 208
993 3300046535 Ga0495586_0019616 Ga0495586_0019616_1746_2381 208
994 3300046535 Ga0495586_0148621 Ga0495586_0148621_256_900 208
995 3300046536 Ga0495587_0067776 Ga0495587_0067776_1180_1824 208
996 3300046536 Ga0495587_0085335 Ga0495587_0085335_328_963 208
997 3300046536 Ga0495587_0110097 Ga0495587_0110097_775_1410 208
998 3300046557 Ga0495622_0021124 Ga0495622_0021124_2243_2878 208
999 3300046558 Ga0495633_0005961 Ga0495633_0005961_5761_6396 208
1000 3300046558 Ga0495633_0067299 Ga0495633_0067299_352_1014 208
1001 3300046616 Ga0495668_0095350 Ga0495668_0095350_102_764 208
1002 3300046616 Ga0495668_0193207 Ga0495668_0193207_49_711 208
1003 3300046642 Ga0495634_0031183 Ga0495634_0031183_2062_2706 208
1004 3300046660 Ga0495625_0075451 Ga0495625_0075451_804_1439 208
1005 3300046665 Ga0495661_0087338 Ga0495661_0087338_895_1530 208
1006 3300046674 Ga0495588_0034196 Ga0495588_0034196_921_1556 208
1007 3300046674 Ga0495588_0083805 Ga0495588_0083805_119_781 208
1008 3300046674 Ga0495588_0117530 Ga0495588_0117530_405_1040 208
1009 3300046679 Ga0495623_0016435 Ga0495623_0016435_2924_3559 208
1010 3300046689 Ga0495613_0167018 Ga0495613_0167018_10_645 208
1011 3300046690 Ga0495624_0005352 Ga0495624_0005352_7884_8546 208
1012 3300046692 Ga0495671_0055817 Ga0495671_0055817_897_1559 208
1013 3300046692 Ga0495671_0126603 Ga0495671_0126603_499_1134 208
1014 3300046809 Ga0495600_0037890 Ga0495600_0037890_1448_2083 208
1015 3300046809 Ga0495600_0073845 Ga0495600_0073845_792_1436 208
1016 3300047315 Ga0495581_0039471 Ga0495581_0039471_1245_1880 208
1017 3300047315 Ga0495581_0059343 Ga0495581_0059343_467_1129 208
1018 3300047315 Ga0495581_0113646 Ga0495581_0113646_256_918 208
1019 3300047317 Ga0495604_0077424 Ga0495604_0077424_821_1465 208
1020 3300047320 Ga0495672_0054754 Ga0495672_0054754_1453_2082 208
1021 3300047321 Ga0495676_0162272 Ga0495676_0162272_753_1388 208
1022 3300047322 Ga0495680_0225456 Ga0495680_0225456_609_1253 208
1023 3300047444 Ga0495675_0042443 Ga0495675_0042443_1375_2019 208
1024 3300047444 Ga0495675_0310952 Ga0495675_0310952_24_659 208
1025 3300047472 Ga0495686_0000028 Ga0495686_0000028_79678_80313 208
1026 3300047673 Ga0495593_0023745 Ga0495593_0023745_1767_2429 208
1027 3300048088 Ga0495602_0033930 Ga0495602_0033930_3643_4287 208
1028 3300048088 Ga0495602_0087077 Ga0495602_0087077_1155_1790 208
1029 3300048090 Ga0495615_0000440 Ga0495615_0000440_4713_5354 208
1030 3300048917 Ga0496114_0652438 Ga0496114_0652438_246_881 208
1031 3300048918 Ga0496115_0007853 Ga0496115_0007853_6393_7022 208
1032 3300048918 Ga0496115_0445070 Ga0496115_0445070_245_880 208
1033 3300048919 Ga0496116_0222156 Ga0496116_0222156_302_940 208
1034 3300048921 Ga0496118_0001019 Ga0496118_0001019_15428_16063 208
1035 3300048921 Ga0496118_0153253 Ga0496118_0153253_766_1401 208
1036 3300048925 Ga0496122_0013233 Ga0496122_0013233_712_1353 208
1037 3300048926 Ga0496123_0001685 Ga0496123_0001685_28304_28945 208
1038 3300048927 Ga0496124_0028088 Ga0496124_0028088_3213_3848 208
1039 3300048927 Ga0496124_0343835 Ga0496124_0343835_195_827 208
1040 3300049459 Ga0495678_000288 Ga0495678_000288_791_1426 208
1041 3300049571 Ga0501034_0195238 Ga0501034_0195238_628_1260 208
1042 3300049582 Ga0501048_0605371 Ga0501048_0605371_121_759 208
1043 3300049823 Ga0501044_0001901 Ga0501044_0001901_22727_23365 208
1044 3300050516 nmdc:mga0sz30_33831_c2 nmdc:mga0sz30_33831_c2_73_708 208
1045 3300053139 Ga0500568_0045537 Ga0500568_0045537_869_1501 208
1046 3300053156 Ga0500622_0007115 Ga0500622_0007115_748_1380 208
1047 2162886007 SwRhRL2b_contig_3207873 SwRhRL2b_0996.00002580 209
1048 3300005327 Ga0070658_10000464 Ga0070658_1000046433 209
1049 3300005335 Ga0070666_10000012 Ga0070666_10000012101 209
1050 3300005337 Ga0070682_100812522 Ga0070682_1008125221 209
1051 3300005367 Ga0070667_100029599 Ga0070667_1000295993 209
1052 3300005539 Ga0068853_100342344 Ga0068853_1003423441 209
1053 3300005578 Ga0068854_100417520 Ga0068854_1004175202 209
1054 3300005843 Ga0068860_100230707 Ga0068860_1002307073 209
1055 3300005937 Ga0081455_10000120 Ga0081455_1000012025 209
1056 3300006353 Ga0075370_10226356 Ga0075370_102263562 209
1057 3300009101 Ga0105247_10000719 Ga0105247_1000071919 209
1058 3300009177 Ga0105248_10711288 Ga0105248_107112882 209
1059 3300009177 Ga0105248_11055962 Ga0105248_110559622 209
1060 3300009551 Ga0105238_10707001 Ga0105238_107070012 209
1061 3300010375 Ga0105239_10214394 Ga0105239_102143943 209
1062 3300013104 Ga0157370_10064244 Ga0157370_100642444 209
1063 3300013308 Ga0157375_10216357 Ga0157375_102163572 209
1064 3300014497 Ga0182008_10045595 Ga0182008_100455952 209
1065 3300015261 Ga0182006_1000041 Ga0182006_100004198 209
1066 3300015262 Ga0182007_10004669 Ga0182007_100046694 209
1067 3300017792 Ga0163161_10007960 Ga0163161_100079602 209
1068 3300025900 Ga0207710_10003656 Ga0207710_100036565 209
1069 3300025900 Ga0207710_10144941 Ga0207710_101449412 209
1070 3300025901 Ga0207688_10345180 Ga0207688_103451802 209
1071 3300025903 Ga0207680_10000013 Ga0207680_10000013101 209
1072 3300025909 Ga0207705_10004077 Ga0207705_1000407710 209
1073 3300025920 Ga0207649_10198589 Ga0207649_101985892 209
1074 3300025924 Ga0207694_10000122 Ga0207694_1000012256 209
1075 3300025949 Ga0207667_10497627 Ga0207667_104976272 209
1076 3300025986 Ga0207658_10191811 Ga0207658_101918112 209
1077 3300028379 Ga0268266_10000021 Ga0268266_10000021104 209
1078 3300028380 Ga0268265_10216500 Ga0268265_102165002 209
1079 3300028381 Ga0268264_10249649 Ga0268264_102496492 209
1080 3300028556 Ga0265337_1003670 Ga0265337_10036705 209
1081 3300028558 Ga0265326_10003092 Ga0265326_100030922 209
1082 3300028563 Ga0265319_1000598 Ga0265319_10005982 209
1083 3300028573 Ga0265334_10000692 Ga0265334_100006927 209
1084 3300028577 Ga0265318_10005512 Ga0265318_100055127 209
1085 3300028653 Ga0265323_10000487 Ga0265323_100004879 209
1086 3300028666 Ga0265336_10001123 Ga0265336_100011239 209
1087 3300028794 Ga0307515_10327313 Ga0307515_103273132 209
1088 3300028800 Ga0265338_10000094 Ga0265338_10000094147 209
1089 3300029957 Ga0265324_10001770 Ga0265324_100017708 209
1090 3300031456 Ga0307513_10304043 Ga0307513_103040432 209
1091 3300031507 Ga0307509_10261629 Ga0307509_102616292 209
1092 3300033180 Ga0307510_10003060 Ga0307510_1000306012 209
1093 3300033180 Ga0307510_10155503 Ga0307510_101555033 209
1094 3300037418 Ga0395900_0097263 Ga0395900_0097263_507_1193 209
1095 3300041459 Ga0451800_0510821 Ga0451800_0510821_55_684 209
1096 3300046452 Ga0495617_000071 Ga0495617_000071_81466_82104 209
1097 3300046452 Ga0495617_000222 Ga0495617_000222_928_1566 209
1098 3300046457 Ga0495590_0046903 Ga0495590_0046903_522_1160 209
1099 3300046460 Ga0495638_0000041 Ga0495638_0000041_160631_161269 209
1100 3300046471 Ga0495650_0000920 Ga0495650_0000920_12458_13096 209
1101 3300046471 Ga0495650_0001241 Ga0495650_0001241_25745_26383 209
1102 3300046471 Ga0495650_0051957 Ga0495650_0051957_114_752 209
1103 3300046491 Ga0495584_0002229 Ga0495584_0002229_4522_5160 209
1104 3300046492 Ga0495585_0000008 Ga0495585_0000008_90972_91610 209
1105 3300046492 Ga0495585_0000303 Ga0495585_0000303_309_947 209
1106 3300046501 Ga0495607_0000141 Ga0495607_0000141_903_1541 209
1107 3300046506 Ga0495583_0006252 Ga0495583_0006252_5306_5944 209
1108 3300046507 Ga0495606_0000117 Ga0495606_0000117_51395_52033 209
1109 3300046507 Ga0495606_0001825 Ga0495606_0001825_24886_25524 209
1110 3300046507 Ga0495606_0040331 Ga0495606_0040331_1120_1758 209
1111 3300046513 Ga0495616_0000002 Ga0495616_0000002_48354_48992 209
1112 3300046513 Ga0495616_0001259 Ga0495616_0001259_2452_3090 209
1113 3300046515 Ga0495620_0000008 Ga0495620_0000008_62118_62756 209
1114 3300046515 Ga0495620_0022151 Ga0495620_0022151_1744_2382 209
1115 3300046518 Ga0495631_0000001 Ga0495631_0000001_117829_118467 209
1116 3300046518 Ga0495631_0000093 Ga0495631_0000093_1219_1857 209
1117 3300046519 Ga0495632_0001811 Ga0495632_0001811_6158_6796 209
1118 3300046519 Ga0495632_0007983 Ga0495632_0007983_113_751 209
1119 3300046519 Ga0495632_0085766 Ga0495632_0085766_551_1183 209
1120 3300046520 Ga0495637_0085954 Ga0495637_0085954_35_673 209
1121 3300046522 Ga0495643_0167060 Ga0495643_0167060_346_984 209
1122 3300046524 Ga0495648_0000063 Ga0495648_0000063_145701_146339 209
1123 3300046538 Ga0495609_0008465 Ga0495609_0008465_3860_4498 209
1124 3300046648 Ga0495611_0000002 Ga0495611_0000002_390886_391524 209
1125 3300046648 Ga0495611_0000097 Ga0495611_0000097_58623_59261 209
1126 3300046660 Ga0495625_0000002 Ga0495625_0000002_395371_396009 209
1127 3300046660 Ga0495625_0013228 Ga0495625_0013228_4824_5462 209
1128 3300046660 Ga0495625_0025312 Ga0495625_0025312_1001_1639 209
1129 3300046665 Ga0495661_0001175 Ga0495661_0001175_3415_4053 209
1130 3300046665 Ga0495661_0206495 Ga0495661_0206495_21_659 209
1131 3300046691 Ga0495670_0049212 Ga0495670_0049212_1420_2058 209
1132 3300046691 Ga0495670_0074370 Ga0495670_0074370_51_689 209
1133 3300046692 Ga0495671_0000598 Ga0495671_0000598_24964_25602 209
1134 3300046694 Ga0495649_0331677 Ga0495649_0331677_25_654 209
1135 3300046794 Ga0495589_0000111 Ga0495589_0000111_9897_10535 209
1136 3300046810 Ga0495660_0000760 Ga0495660_0000760_23516_24154 209
1137 3300047323 Ga0495683_0000468 Ga0495683_0000468_30139_30777 209
1138 3300047446 Ga0495679_000003 Ga0495679_000003_404394_405032 209
1139 3300047469 Ga0495673_0000062 Ga0495673_0000062_159511_160149 209
1140 3300047469 Ga0495673_0000283 Ga0495673_0000283_418_1056 209
1141 3300047469 Ga0495673_0082015 Ga0495673_0082015_568_1293 209
1142 3300047470 Ga0495681_0054898 Ga0495681_0054898_432_1070 209
1143 3300047472 Ga0495686_0000068 Ga0495686_0000068_68083_68721 209
1144 3300047472 Ga0495686_0007171 Ga0495686_0007171_2980_3618 209
1145 3300048911 Ga0496108_0727153 Ga0496108_0727153_99_728 209
1146 3300048913 Ga0496110_0971428 Ga0496110_0971428_61_690 209
1147 3300048917 Ga0496114_0371498 Ga0496114_0371498_534_1175 209
1148 3300048924 Ga0496121_0001028 Ga0496121_0001028_699_1337 209
1149 3300048927 Ga0496124_0344211 Ga0496124_0344211_367_996 209
1150 3300049459 Ga0495678_000019 Ga0495678_000019_122234_122872 209
1151 3300049460 Ga0495682_0004816 Ga0495682_0004816_4895_5533 209
1152 3300049569 Ga0501032_0048794 Ga0501032_0048794_722_1360 209
1153 3300049571 Ga0501034_0013222 Ga0501034_0013222_3402_4040 209
1154 3300049572 Ga0501036_0044409 Ga0501036_0044409_894_1532 209
1155 3300049573 Ga0501037_0015430 Ga0501037_0015430_4178_4816 209
1156 3300049574 Ga0501038_0011847 Ga0501038_0011847_3261_3899 209
1157 3300049581 Ga0501047_0025460 Ga0501047_0025460_4098_4736 209
1158 3300049585 Ga0501069_0167538 Ga0501069_0167538_88_753 209
1159 3300049586 Ga0501070_0041143 Ga0501070_0041143_82_747 209
1160 3300049586 Ga0501070_0092416 Ga0501070_0092416_495_1133 209
1161 3300049742 Ga0501080_0015803 Ga0501080_0015803_466_1104 209
1162 3300049822 Ga0501035_0009828 Ga0501035_0009828_7258_7896 209
1163 3300049823 Ga0501044_0015720 Ga0501044_0015720_3789_4427 209
1164 3300049823 Ga0501044_0043685 Ga0501044_0043685_1002_1667 209
1165 3300050496 nmdc:mga07m45_285943_c1 nmdc:mga07m45_285943_c1_163_855 209
1166 3300053087 Ga0500643_000054 Ga0500643_000054_100499_101137 209
1167 3300053092 Ga0500583_0295266 Ga0500583_0295266_52_681 209
1168 3300053096 Ga0500641_0074051 Ga0500641_0074051_476_1105 209
1169 3300053096 Ga0500641_0111080 Ga0500641_0111080_460_1092 209
1170 3300053103 Ga0500555_001223 Ga0500555_001223_748_1386 209
1171 3300053130 Ga0500642_0188971 Ga0500642_0188971_319_948 209
1172 3300053139 Ga0500568_0112641 Ga0500568_0112641_230_859 209
1173 3300053153 Ga0500616_0000011 Ga0500616_0000011_70556_71185 209
1174 3300053153 Ga0500616_0005790 Ga0500616_0005790_6981_7610 209
1175 3300053156 Ga0500622_0108173 Ga0500622_0108173_415_1047 209
1176 iso_pu_bacteria 2848297114 2848297692 209
1177 2162886007 SwRhRL2b_contig_1446302 SwRhRL2b_0021.00007070 211
1178 3300005289 Ga0065704_10023675 Ga0065704_100236752 211
1179 3300005295 Ga0065707_10044585 Ga0065707_100445852 211
1180 3300009978 Ga0105148_100086 Ga0105148_1000862 211
1181 3300009982 Ga0105147_111069 Ga0105147_1110691 211
1182 3300014326 Ga0157380_10436269 Ga0157380_104362692 211
1183 3300049574 Ga0501038_0214165 Ga0501038_0214165_225_872 211
1184 3300049579 Ga0501043_0146151 Ga0501043_0146151_1187_1834 211
1185 3300049580 Ga0501046_0276152 Ga0501046_0276152_320_967 211
1186 3300049586 Ga0501070_0112254 Ga0501070_0112254_1271_1918 211
1187 3300049823 Ga0501044_0129050 Ga0501044_0129050_648_1295 211
1188 3300053088 Ga0500644_0072872 Ga0500644_0072872_164_802 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

7

201

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.9387 28 208
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9236 79 115
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.923 33 205
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.9192 28 208
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.9116 33 205
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9416 27 209 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9223 27 209 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9052 33 211 1.20.120.80
1fftH00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8733 25 208 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8676 33 211 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A2M9TGN6-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9812 61 208 GO:0004129
GO:0005886
GO:0009486
GO:0019646
GO:0020037
AF-A0A212ID19-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9713 41 208 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A3Q9CPG2-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 0.9697 41 208 GO:0004129
GO:0005886
GO:0019646
AF-A0A127QXW6-F1-model_v4 deleted 0.9693 33 211
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9692 65 208 GO:0004129
GO:0005886
GO:0009486
GO:0019646

Feature Viewer

pLDDT pTM Quality
73.44 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map