F491411

General Info

Members Datasets Scaffolds Average Seq Length
1187 488 1169 87

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0358018|Ga0495598_0358018_68_376
Length 102
Sequence MRVQTDFTTRSITMNLIVWLVIGGVVGWLASIIMKRDAQQGVFLNIVVGVIGALLAGWFISPLVGIGTINSGLSIGSFLVSLLGAVVLLAIVNLFTRGRART

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2643221695 Lysobacter sp. Root494 Isolate Unclassified
6 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
7 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
8 2818991457 Xanthomonas translucens 569 Isolate Unclassified
9 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
10 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
11 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
12 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
13 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
14 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
15 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
16 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
17 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
42 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
45 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
152 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
153 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
154 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
155 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
156 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
157 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
158 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
159 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
160 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
161 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
162 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
163 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
178 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
179 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
180 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
181 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
182 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
184 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
188 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
189 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
191 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
192 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
194 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
195 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
266 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
271 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
272 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
284 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
285 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
286 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
287 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
288 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
289 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
290 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
291 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
294 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
297 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
298 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
300 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
309 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
310 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
311 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
312 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
313 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
314 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
315 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
316 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
317 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
318 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
319 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
322 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
323 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
324 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
325 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
328 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
329 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
330 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
331 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
332 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
333 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
334 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
335 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
336 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
337 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
338 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
339 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
340 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
341 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
342 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
343 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
344 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
345 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
346 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
347 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
348 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
349 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
350 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
351 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
352 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
353 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
354 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
355 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
356 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
357 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
358 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
359 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
360 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
361 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
362 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
363 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
364 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
365 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
369 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
370 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
371 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
383 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
397 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
398 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
406 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
407 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
408 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
421 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
422 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
423 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
424 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
425 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
426 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
427 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
428 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
429 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
432 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
452 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
453 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
454 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
455 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
456 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
457 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
458 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
459 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
460 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
461 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
462 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
463 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
464 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
465 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
466 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
467 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
468 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
486 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
487 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
488 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 3.03
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0
Rhizoplane 3.37
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2608932 2162886007 Bacteria 1441
2 ARcpr5oldR_c005890 3300000041 Bacteria 1051
3 JGI24736J21556_1000084 3300001904 Bacteria 15451
4 JGI24736J21556_1000245 3300001904 Bacteria 9885
5 JGI24741J21665_1000033 3300001915 Bacteria 33026
6 JGI24741J21665_1022120 3300001915 Bacteria 988
7 JGI24740J21852_10000308 3300001979 Bacteria 20760
8 JGI24740J21852_10010401 3300001979 Bacteria 3587
9 JGI24739J22299_10001399 3300001989 Bacteria 9074
10 JGI24739J22299_10058466 3300001989 Bacteria 1224
11 JGI24737J22298_10002067 3300001990 Bacteria 7176
12 JGI24735J21928_10002354 3300002067 Bacteria 6585
13 JGI24735J21928_10009527 3300002067 Bacteria 3116
14 JGI24735J21928_10106397 3300002067 Bacteria 806
15 JGI24748J21848_1017734 3300002074 Bacteria 853
16 JGI24738J21930_10000403 3300002075 Bacteria 12110
17 JGI24738J21930_10000553 3300002075 Bacteria 10685
18 JGI24749J21850_1000277 3300002076 Bacteria 7843
19 JGI24034J26672_10063209 3300002239 Bacteria 653
20 JGI24751J29686_10001694 3300002459 Bacteria 4537
21 JGI25150J39212_1000098 3300002774 Bacteria 50282
22 JGI25150J39212_1032474 3300002774 Bacteria 714
23 JGI25151J46595_10031054 3300003187 Bacteria 2091
24 JGI25153J46596_10000055 3300003215 Bacteria 135518
25 JGI25153J46596_10002938 3300003215 Bacteria 9651
26 JGI25153J46596_10065997 3300003215 Bacteria 959
27 rootH1_10016789 3300003316 Bacteria 1164
28 Ga0055526_1003146 3300003771 Bacteria 10691
29 Ga0055526_1103262 3300003771 Bacteria 520
30 Ga0055537_1001198 3300003773 Bacteria 10991
31 Ga0055537_1001216 3300003773 Bacteria 10852
32 Ga0055524_1000670 3300003775 Bacteria 24010
33 Ga0055536_1005408 3300003781 Bacteria 6256
34 Ga0055528_1024786 3300003790 Bacteria 1786
35 Ga0055530_10000224 3300003791 Bacteria 50209
36 Ga0055530_10010144 3300003791 Bacteria 3523
37 Ga0055530_10015555 3300003791 Bacteria 2475
38 Ga0055540_1001240 3300003792 Bacteria 15690
39 Ga0055531_10000094 3300003794 Bacteria 96266
40 Ga0055531_10003913 3300003794 Bacteria 9294
41 Ga0055531_10072924 3300003794 Bacteria 784
42 Ga0058692_1000081 3300003856 Bacteria 69376
43 JGI25405J52794_10000298 3300003911 Bacteria 6815
44 Ga0055543_1019776 3300004625 Bacteria 1244
45 Ga0058859_11186829 3300004798 Bacteria 1352
46 Ga0058859_11742863 3300004798 Bacteria 655
47 Ga0058859_11747837 3300004798 Bacteria 546
48 Ga0058859_11789015 3300004798 Bacteria 676
49 Ga0058859_11834298 3300004798 Bacteria 1781
50 Ga0058860_11386381 3300004801 Bacteria 694
51 Ga0058860_11409702 3300004801 Bacteria 1700
52 Ga0058860_12029252 3300004801 Bacteria 511
53 Ga0058860_12099451 3300004801 Bacteria 1459
54 Ga0058860_12203426 3300004801 Unclassified 1964
55 Ga0065165_1007915 3300005262 Bacteria 5099
56 Ga0065165_1023907 3300005262 Bacteria 2063
57 Ga0065165_1036540 3300005262 Bacteria 1498
58 Ga0065165_1055259 3300005262 Bacteria 1109
59 Ga0065704_10001806 3300005289 Bacteria 15273
60 Ga0065704_10078390 3300005289 Bacteria 4443
61 Ga0065704_10088093 3300005289 Bacteria 2968
62 Ga0065704_10115293 3300005289 Bacteria 1874
63 Ga0065704_10158200 3300005289 Bacteria 1374
64 Ga0065704_10196152 3300005289 Bacteria 1166
65 Ga0065704_10263838 3300005289 Bacteria 959
66 Ga0065712_10747402 3300005290 Bacteria 530
67 Ga0065715_10811313 3300005293 Bacteria 606
68 Ga0065707_10110051 3300005295 Bacteria 2446
69 Ga0065707_10129579 3300005295 Bacteria 1945
70 Ga0065707_10148430 3300005295 Bacteria 1686
71 Ga0065707_10182128 3300005295 Bacteria 1412
72 Ga0070658_10020553 3300005327 Bacteria 5292
73 Ga0070658_10181797 3300005327 Bacteria 1769
74 Ga0070658_10372339 3300005327 Bacteria 1224
75 Ga0070658_10469790 3300005327 Bacteria 1085
76 Ga0070676_10130746 3300005328 Bacteria 1587
77 Ga0070676_11259825 3300005328 Bacteria 564
78 Ga0070683_100526620 3300005329 Bacteria 1130
79 Ga0070683_100817410 3300005329 Bacteria 894
80 Ga0070683_100911697 3300005329 Bacteria 843
81 Ga0070683_101061898 3300005329 Bacteria 778
82 Ga0070683_102387100 3300005329 Bacteria 507
83 Ga0070690_100359067 3300005330 Bacteria 1059
84 Ga0070670_100003557 3300005331 Bacteria 12962
85 Ga0070670_100028217 3300005331 Bacteria 4831
86 Ga0070670_100073086 3300005331 Bacteria 2946
87 Ga0070670_100239903 3300005331 Bacteria 1578
88 Ga0070670_100286094 3300005331 Bacteria 1440
89 Ga0070670_100351750 3300005331 Bacteria 1294
90 Ga0070670_101468915 3300005331 Bacteria 626
91 Ga0070677_10054194 3300005333 Bacteria 1633
92 Ga0070677_10196083 3300005333 Bacteria 971
93 Ga0070677_10281992 3300005333 Bacteria 837
94 Ga0070677_10630391 3300005333 Bacteria 597
95 Ga0070677_10901815 3300005333 Bacteria 511
96 Ga0068869_100037537 3300005334 Bacteria 3445
97 Ga0068869_100073646 3300005334 Bacteria 2533
98 Ga0068869_100376476 3300005334 Bacteria 1163
99 Ga0068869_100991230 3300005334 Bacteria 731
100 Ga0068869_101530063 3300005334 Bacteria 593
101 Ga0070666_10001750 3300005335 Bacteria 13254
102 Ga0070680_100077391 3300005336 Bacteria 2740
103 Ga0070682_100031832 3300005337 Bacteria 3193
104 Ga0070682_100143279 3300005337 Bacteria 1631
105 Ga0070682_101349023 3300005337 Bacteria 608
106 Ga0068868_100220568 3300005338 Bacteria 1587
107 Ga0068868_100557510 3300005338 Bacteria 1010
108 Ga0068868_100833135 3300005338 Bacteria 834
109 Ga0068868_101079721 3300005338 Bacteria 738
110 Ga0070660_100170249 3300005339 Bacteria 1759
111 Ga0070660_100207702 3300005339 Bacteria 1589
112 Ga0070660_101165079 3300005339 Bacteria 653
113 Ga0070660_101522066 3300005339 Bacteria 569
114 Ga0070689_100008543 3300005340 Bacteria 7218
115 Ga0070689_100128753 3300005340 Bacteria 2028
116 Ga0070689_100173512 3300005340 Bacteria 1748
117 Ga0070689_100479309 3300005340 Unclassified 1063
118 Ga0070687_100250993 3300005343 Bacteria 1099
119 Ga0070661_100090999 3300005344 Bacteria 2259
120 Ga0070661_100109613 3300005344 Bacteria 2060
121 Ga0070661_100151526 3300005344 Bacteria 1753
122 Ga0070661_100240982 3300005344 Bacteria 1392
123 Ga0070661_101108681 3300005344 Bacteria 660
124 Ga0070692_10112290 3300005345 Bacteria 1509
125 Ga0070668_100000460 3300005347 Bacteria 26920
126 Ga0070668_100013970 3300005347 Bacteria 6003
127 Ga0070668_100075344 3300005347 Bacteria 2634
128 Ga0070668_100330696 3300005347 Bacteria 1285
129 Ga0070668_100481846 3300005347 Bacteria 1071
130 Ga0070668_100615799 3300005347 Bacteria 951
131 Ga0070668_100933638 3300005347 Bacteria 777
132 Ga0070668_101111384 3300005347 Bacteria 714
133 Ga0070668_101262289 3300005347 Bacteria 671
134 Ga0070668_101873102 3300005347 Unclassified 552
135 Ga0070669_100000059 3300005353 Bacteria 108504
136 Ga0070669_100004662 3300005353 Bacteria 9893
137 Ga0070669_100011016 3300005353 Bacteria 6417
138 Ga0070669_100068008 3300005353 Bacteria 2629
139 Ga0070669_100129070 3300005353 Bacteria 1937
140 Ga0070669_100481504 3300005353 Bacteria 1027
141 Ga0070669_101169273 3300005353 Bacteria 664
142 Ga0070669_101199073 3300005353 Bacteria 656
143 Ga0070675_100086771 3300005354 Bacteria 2616
144 Ga0070675_100370234 3300005354 Bacteria 1273
145 Ga0070675_100882501 3300005354 Bacteria 819
146 Ga0070675_101497214 3300005354 Unclassified 622
147 Ga0070675_102116517 3300005354 Bacteria 519
148 Ga0070671_100026426 3300005355 Bacteria 4770
149 Ga0070671_100246960 3300005355 Bacteria 1516
150 Ga0070671_101912747 3300005355 Bacteria 528
151 Ga0070674_100301647 3300005356 Bacteria 1277
152 Ga0070674_100826861 3300005356 Bacteria 802
153 Ga0070674_101361348 3300005356 Bacteria 634
154 Ga0070673_100552155 3300005364 Unclassified 1046
155 Ga0070673_100586025 3300005364 Bacteria 1016
156 Ga0070673_101267500 3300005364 Bacteria 692
157 Ga0070688_100000464 3300005365 Bacteria 20632
158 Ga0070688_100024154 3300005365 Bacteria 3582
159 Ga0070688_101082925 3300005365 Bacteria 640
160 Ga0070688_101352834 3300005365 Bacteria 576
161 Ga0070659_100039830 3300005366 Bacteria 3670
162 Ga0070659_100053840 3300005366 Bacteria 3168
163 Ga0070659_100094268 3300005366 Bacteria 2403
164 Ga0070659_100379626 3300005366 Bacteria 1190
165 Ga0070659_100814640 3300005366 Bacteria 812
166 Ga0070667_100000076 3300005367 Bacteria 120555
167 Ga0070667_100000286 3300005367 Bacteria 57006
168 Ga0070667_100556960 3300005367 Bacteria 1054
169 Ga0070667_100804253 3300005367 Bacteria 873
170 Ga0070667_101023734 3300005367 Bacteria 771
171 Ga0070710_10222220 3300005437 Bacteria 1202
172 Ga0070701_10407954 3300005438 Bacteria 863
173 Ga0070705_101282588 3300005440 Bacteria 607
174 Ga0070700_100090960 3300005441 Bacteria 1991
175 Ga0070700_100136197 3300005441 Bacteria 1663
176 Ga0070700_100217322 3300005441 Bacteria 1352
177 Ga0070694_100597749 3300005444 Bacteria 888
178 Ga0070694_100613612 3300005444 Bacteria 877
179 Ga0070694_100790832 3300005444 Bacteria 777
180 Ga0070694_100864873 3300005444 Bacteria 745
181 Ga0070663_100139611 3300005455 Bacteria 1848
182 Ga0070663_100276632 3300005455 Bacteria 1336
183 Ga0070663_101073362 3300005455 Bacteria 703
184 Ga0070663_101867308 3300005455 Bacteria 539
185 Ga0070678_101473560 3300005456 Bacteria 637
186 Ga0070678_101515059 3300005456 Bacteria 628
187 Ga0070662_100002034 3300005457 Bacteria 12383
188 Ga0070662_100125479 3300005457 Bacteria 1972
189 Ga0070662_100428595 3300005457 Bacteria 1095
190 Ga0070662_100784756 3300005457 Bacteria 809
191 Ga0070681_10401588 3300005458 Bacteria 1282
192 Ga0070681_10651945 3300005458 Bacteria 968
193 Ga0070681_11224404 3300005458 Bacteria 673
194 Ga0068867_100137840 3300005459 Bacteria 1904
195 Ga0068867_101631799 3300005459 Bacteria 603
196 Ga0068867_102143574 3300005459 Bacteria 530
197 Ga0070685_10000247 3300005466 Bacteria 35364
198 Ga0070685_10170446 3300005466 Bacteria 1395
199 Ga0070685_10673582 3300005466 Bacteria 752
200 Ga0070706_100854974 3300005467 Bacteria 841
201 Ga0070706_101651486 3300005467 Bacteria 584
202 Ga0070706_101900657 3300005467 Bacteria 540
203 Ga0070707_100197763 3300005468 Bacteria 1960
204 Ga0070707_100668794 3300005468 Bacteria 1001
205 Ga0070707_101498227 3300005468 Unclassified 641
206 Ga0070698_100057955 3300005471 Bacteria 3918
207 Ga0070699_100488216 3300005518 Bacteria 1118
208 Ga0070679_100164449 3300005530 Bacteria 2193
209 Ga0070684_101061917 3300005535 Bacteria 761
210 Ga0070684_101343794 3300005535 Bacteria 673
211 Ga0070684_101685781 3300005535 Bacteria 598
212 Ga0070697_101122962 3300005536 Bacteria 700
213 Ga0068853_100681801 3300005539 Bacteria 979
214 Ga0068853_101549709 3300005539 Bacteria 642
215 Ga0068853_102430794 3300005539 Bacteria 507
216 Ga0070672_100003882 3300005543 Bacteria 9735
217 Ga0070672_100013080 3300005543 Bacteria 5849
218 Ga0070672_100428434 3300005543 Bacteria 1137
219 Ga0070672_100443636 3300005543 Bacteria 1117
220 Ga0070672_100585006 3300005543 Bacteria 971
221 Ga0070686_100036559 3300005544 Bacteria 3042
222 Ga0070686_100060268 3300005544 Bacteria 2448
223 Ga0070686_101446544 3300005544 Unclassified 578
224 Ga0070695_100659325 3300005545 Bacteria 827
225 Ga0070695_101106142 3300005545 Bacteria 649
226 Ga0070696_100016374 3300005546 Bacteria 4991
227 Ga0070696_100036845 3300005546 Bacteria 3374
228 Ga0070696_100277159 3300005546 Bacteria 1277
229 Ga0070696_100391765 3300005546 Bacteria 1085
230 Ga0070665_100000217 3300005548 Bacteria 97947
231 Ga0070665_100003281 3300005548 Bacteria 17362
232 Ga0070665_100004044 3300005548 Bacteria 15418
233 Ga0070665_100169050 3300005548 Bacteria 2188
234 Ga0070665_100420202 3300005548 Bacteria 1346
235 Ga0070665_100714477 3300005548 Bacteria 1015
236 Ga0070665_101025369 3300005548 Bacteria 837
237 Ga0070704_100604210 3300005549 Bacteria 964
238 Ga0070704_100858386 3300005549 Bacteria 814
239 Ga0070704_101036699 3300005549 Unclassified 743
240 Ga0070704_101057917 3300005549 Bacteria 736
241 Ga0070704_101298822 3300005549 Bacteria 666
242 Ga0068855_100003860 3300005563 Bacteria 18319
243 Ga0068855_100028542 3300005563 Bacteria 6675
244 Ga0068855_100233241 3300005563 Bacteria 2059
245 Ga0068855_101162278 3300005563 Bacteria 804
246 Ga0068855_101608813 3300005563 Bacteria 665
247 Ga0068855_102057311 3300005563 Bacteria 576
248 Ga0070664_100030751 3300005564 Bacteria 4481
249 Ga0070664_100145004 3300005564 Bacteria 2093
250 Ga0070664_100568299 3300005564 Bacteria 1050
251 Ga0070664_100757420 3300005564 Bacteria 907
252 Ga0070664_101386209 3300005564 Bacteria 664
253 Ga0068857_100049380 3300005577 Bacteria 3733
254 Ga0068857_100100906 3300005577 Bacteria 2589
255 Ga0068857_100121556 3300005577 Bacteria 2351
256 Ga0068857_100238588 3300005577 Bacteria 1664
257 Ga0068857_100297759 3300005577 Bacteria 1487
258 Ga0068857_100528141 3300005577 Bacteria 1110
259 Ga0068857_101021994 3300005577 Bacteria 796
260 Ga0068857_101072340 3300005577 Bacteria 777
261 Ga0068854_100003887 3300005578 Bacteria 9362
262 Ga0068854_100345797 3300005578 Bacteria 1216
263 Ga0068854_101131083 3300005578 Bacteria 699
264 Ga0068856_100006103 3300005614 Bacteria 11833
265 Ga0068856_100256786 3300005614 Bacteria 1763
266 Ga0068856_100726103 3300005614 Bacteria 1014
267 Ga0068856_101552463 3300005614 Bacteria 675
268 Ga0070702_100501202 3300005615 Bacteria 892
269 Ga0070702_100716159 3300005615 Unclassified 764
270 Ga0068852_100357541 3300005616 Bacteria 1427
271 Ga0068852_100703913 3300005616 Bacteria 1020
272 Ga0068852_100763496 3300005616 Bacteria 979
273 Ga0068852_101834674 3300005616 Bacteria 629
274 Ga0068859_100000937 3300005617 Bacteria 29957
275 Ga0068859_100158476 3300005617 Bacteria 2342
276 Ga0068859_100771262 3300005617 Bacteria 1050
277 Ga0068859_102191608 3300005617 Bacteria 610
278 Ga0068859_102502470 3300005617 Unclassified 568
279 Ga0068864_100101905 3300005618 Bacteria 2547
280 Ga0068864_100255330 3300005618 Bacteria 1629
281 Ga0068864_100552366 3300005618 Unclassified 1113
282 Ga0068864_100769951 3300005618 Bacteria 944
283 Ga0068864_101623756 3300005618 Bacteria 651
284 Ga0068866_10066946 3300005718 Bacteria 1884
285 Ga0068866_10444519 3300005718 Bacteria 846
286 Ga0068866_10779257 3300005718 Bacteria 663
287 Ga0068861_100001013 3300005719 Bacteria 17181
288 Ga0068861_100001319 3300005719 Bacteria 15563
289 Ga0068861_100030478 3300005719 Bacteria 3954
290 Ga0068861_100314475 3300005719 Bacteria 1362
291 Ga0068861_100749861 3300005719 Bacteria 912
292 Ga0068861_100805982 3300005719 Bacteria 882
293 Ga0068861_101034372 3300005719 Bacteria 786
294 Ga0068851_10066729 3300005834 Bacteria 1854
295 Ga0068851_10373581 3300005834 Bacteria 834
296 Ga0068851_10394696 3300005834 Bacteria 813
297 Ga0068870_10032554 3300005840 Bacteria 2652
298 Ga0068870_10105888 3300005840 Bacteria 1598
299 Ga0068863_100000168 3300005841 Bacteria 70935
300 Ga0068863_100007022 3300005841 Bacteria 11035
301 Ga0068863_100192390 3300005841 Bacteria 1961
302 Ga0068863_100263679 3300005841 Bacteria 1666
303 Ga0068863_100308978 3300005841 Bacteria 1534
304 Ga0068863_100739573 3300005841 Bacteria 979
305 Ga0068863_100847616 3300005841 Bacteria 913
306 Ga0068863_102696448 3300005841 Bacteria 506
307 Ga0068858_100002534 3300005842 Bacteria 18415
308 Ga0068858_100474219 3300005842 Unclassified 1207
309 Ga0068858_100764069 3300005842 Bacteria 942
310 Ga0068858_101020675 3300005842 Bacteria 811
311 Ga0068860_100000131 3300005843 Bacteria 121109
312 Ga0068860_100002475 3300005843 Bacteria 19382
313 Ga0068860_100025815 3300005843 Bacteria 5667
314 Ga0068860_100176437 3300005843 Bacteria 2065
315 Ga0068860_100310203 3300005843 Bacteria 1547
316 Ga0068860_100646094 3300005843 Bacteria 1066
317 Ga0068860_101715969 3300005843 Unclassified 650
318 Ga0068860_102688113 3300005843 Unclassified 516
319 Ga0068862_100006832 3300005844 Bacteria 9460
320 Ga0068862_100021336 3300005844 Bacteria 5411
321 Ga0068862_101185256 3300005844 Bacteria 762
322 Ga0068862_102710344 3300005844 Bacteria 507
323 Ga0075365_11127366 3300006038 Bacteria 552
324 Ga0075363_100097265 3300006048 Bacteria 1626
325 Ga0075432_10058225 3300006058 Bacteria 1372
326 Ga0075432_10398390 3300006058 Bacteria 594
327 Ga0075362_10000003 3300006177 Bacteria 171099
328 Ga0075369_10006096 3300006186 Bacteria 4546
329 Ga0075366_10000006 3300006195 Bacteria 106522
330 Ga0075366_10004410 3300006195 Bacteria 7553
331 Ga0075366_10009043 3300006195 Bacteria 5555
332 Ga0075366_10159049 3300006195 Bacteria 1369
333 Ga0075366_10404635 3300006195 Bacteria 840
334 Ga0075366_10844270 3300006195 Bacteria 570
335 Ga0075366_11077605 3300006195 Bacteria 502
336 Ga0097621_100012982 3300006237 Bacteria 6191
337 Ga0097621_100108950 3300006237 Bacteria 2339
338 Ga0097621_100443070 3300006237 Bacteria 1169
339 Ga0097621_100536177 3300006237 Bacteria 1064
340 Ga0075370_10000008 3300006353 Bacteria 97966
341 Ga0068871_100021925 3300006358 Bacteria 4919
342 Ga0068871_100081486 3300006358 Bacteria 2681
343 Ga0068871_100195049 3300006358 Bacteria 1746
344 Ga0068871_101648311 3300006358 Bacteria 608
345 Ga0075428_100024545 3300006844 Bacteria 6671
346 Ga0075428_100048029 3300006844 Bacteria 4686
347 Ga0075428_100363049 3300006844 Bacteria 1553
348 Ga0075428_100557585 3300006844 Bacteria 1225
349 Ga0075428_100970852 3300006844 Bacteria 900
350 Ga0075428_102091665 3300006844 Bacteria 586
351 Ga0075428_102220881 3300006844 Bacteria 566
352 Ga0075430_100028496 3300006846 Bacteria 4744
353 Ga0075430_100230052 3300006846 Bacteria 1537
354 Ga0075430_100267734 3300006846 Bacteria 1415
355 Ga0075430_100517176 3300006846 Bacteria 985
356 Ga0075430_100661347 3300006846 Bacteria 861
357 Ga0075431_100004046 3300006847 Bacteria 14286
358 Ga0075431_100009192 3300006847 Bacteria 9912
359 Ga0075431_100081587 3300006847 Bacteria 3339
360 Ga0075431_100325052 3300006847 Bacteria 1550
361 Ga0075431_100441752 3300006847 Bacteria 1298
362 Ga0075431_100515661 3300006847 Bacteria 1185
363 Ga0075431_100659061 3300006847 Bacteria 1027
364 Ga0075431_101525665 3300006847 Bacteria 626
365 Ga0075433_10001740 3300006852 Bacteria 16258
366 Ga0075433_10026664 3300006852 Bacteria 4896
367 Ga0075433_10120072 3300006852 Unclassified 2333
368 Ga0075433_11621746 3300006852 Unclassified 558
369 Ga0075433_11756301 3300006852 Bacteria 534
370 Ga0075434_100469506 3300006871 Bacteria 1279
371 Ga0075434_100631572 3300006871 Unclassified 1090
372 Ga0075429_100066252 3300006880 Bacteria 3144
373 Ga0075429_100282556 3300006880 Bacteria 1453
374 Ga0075429_100821512 3300006880 Bacteria 814
375 Ga0075429_101527745 3300006880 Bacteria 581
376 Ga0068865_100192080 3300006881 Bacteria 1580
377 Ga0068865_100776754 3300006881 Bacteria 825
378 Ga0068865_100790184 3300006881 Bacteria 818
379 Ga0068865_101295288 3300006881 Bacteria 648
380 Ga0068865_101624523 3300006881 Bacteria 581
381 Ga0097620_100000937 3300006931 Bacteria 29957
382 Ga0097620_100158469 3300006931 Bacteria 2342
383 Ga0097620_100771242 3300006931 Bacteria 1050
384 Ga0097620_102191919 3300006931 Bacteria 610
385 Ga0097620_102501853 3300006931 Unclassified 568
386 Ga0075435_100704095 3300007076 Bacteria 878
387 Ga0075435_101134671 3300007076 Bacteria 683
388 Ga0075435_101329195 3300007076 Bacteria 630
389 Ga0075435_102013855 3300007076 Unclassified 507
390 Ga0105251_10000008 3300009011 Bacteria 213669
391 Ga0105251_10000862 3300009011 Bacteria 27182
392 Ga0105240_10031828 3300009093 Bacteria 6834
393 Ga0105240_10105419 3300009093 Bacteria 3422
394 Ga0105240_10487802 3300009093 Bacteria 1372
395 Ga0105240_10964699 3300009093 Bacteria 914
396 Ga0105240_11380651 3300009093 Bacteria 741
397 Ga0105240_12176803 3300009093 Bacteria 575
398 Ga0111539_10043567 3300009094 Bacteria 5379
399 Ga0111539_10060790 3300009094 Bacteria 4477
400 Ga0111539_10173166 3300009094 Bacteria 2521
401 Ga0111539_10226322 3300009094 Bacteria 2178
402 Ga0111539_10285154 3300009094 Bacteria 1922
403 Ga0111539_10344112 3300009094 Bacteria 1736
404 Ga0111539_11189430 3300009094 Bacteria 885
405 Ga0111539_12123566 3300009094 Bacteria 652
406 Ga0111539_12387773 3300009094 Bacteria 613
407 Ga0111539_13076893 3300009094 Bacteria 538
408 Ga0105247_10007739 3300009101 Bacteria 6576
409 Ga0105247_10058703 3300009101 Unclassified 2381
410 Ga0105247_10102551 3300009101 Bacteria 1831
411 Ga0114129_10091923 3300009147 Bacteria 4203
412 Ga0114129_10138853 3300009147 Bacteria 3333
413 Ga0114129_10823468 3300009147 Bacteria 1182
414 Ga0114129_11034319 3300009147 Bacteria 1032
415 Ga0114129_11274551 3300009147 Bacteria 912
416 Ga0105243_10061151 3300009148 Bacteria 3011
417 Ga0105243_10702909 3300009148 Bacteria 986
418 Ga0105243_11253727 3300009148 Bacteria 757
419 Ga0105243_12460235 3300009148 Bacteria 559
420 Ga0105241_10001628 3300009174 Bacteria 17126
421 Ga0105241_10144017 3300009174 Bacteria 1943
422 Ga0105241_10642196 3300009174 Bacteria 963
423 Ga0105242_11236447 3300009176 Bacteria 768
424 Ga0105242_11635349 3300009176 Bacteria 679
425 Ga0105242_12543832 3300009176 Bacteria 560
426 Ga0105248_10000014 3300009177 Bacteria 324729
427 Ga0105248_10016965 3300009177 Bacteria 8018
428 Ga0105248_10435177 3300009177 Bacteria 1477
429 Ga0105248_11747331 3300009177 Bacteria 705
430 Ga0105237_10016667 3300009545 Bacteria 7631
431 Ga0105237_10531086 3300009545 Bacteria 1183
432 Ga0105237_10543583 3300009545 Bacteria 1168
433 Ga0105238_10151678 3300009551 Bacteria 2292
434 Ga0105238_10273381 3300009551 Bacteria 1670
435 Ga0105238_11141734 3300009551 Bacteria 802
436 Ga0105249_10016789 3300009553 Bacteria 6495
437 Ga0105249_10026693 3300009553 Bacteria 5207
438 Ga0105249_10061210 3300009553 Bacteria 3454
439 Ga0105249_10571229 3300009553 Unclassified 1183
440 Ga0105249_10579820 3300009553 Bacteria 1175
441 Ga0105249_10773039 3300009553 Bacteria 1023
442 Ga0105249_11123273 3300009553 Bacteria 856
443 Ga0105148_100020 3300009978 Bacteria 23647
444 Ga0105239_10090913 3300010375 Bacteria 3368
445 Ga0105239_10117318 3300010375 Bacteria 2954
446 Ga0105239_10160219 3300010375 Bacteria 2513
447 Ga0105239_10676300 3300010375 Bacteria 1180
448 Ga0105239_10973580 3300010375 Bacteria 975
449 Ga0105239_13198513 3300010375 Bacteria 533
450 Ga0105239_13492167 3300010375 Bacteria 511
451 Ga0105246_10395339 3300011119 Bacteria 1146
452 Ga0105246_10482363 3300011119 Bacteria 1049
453 Ga0157317_1011268 3300012475 Bacteria 695
454 Ga0157318_1004150 3300012482 Bacteria 872
455 Ga0157337_1033049 3300012483 Bacteria 539
456 Ga0157325_1011370 3300012485 Bacteria 669
457 Ga0157343_1029663 3300012488 Bacteria 545
458 Ga0157329_1010315 3300012491 Bacteria 730
459 Ga0157323_1005241 3300012495 Bacteria 861
460 Ga0157345_1017245 3300012498 Bacteria 701
461 Ga0157313_1031199 3300012503 Bacteria 606
462 Ga0157324_1016458 3300012506 Bacteria 704
463 Ga0157324_1033534 3300012506 Bacteria 594
464 Ga0157327_1001313 3300012512 Bacteria 1534
465 Ga0157326_1056645 3300012513 Bacteria 589
466 Ga0157338_1016355 3300012515 Bacteria 819
467 Ga0157373_10064081 3300013100 Bacteria 2602
468 Ga0157373_10544698 3300013100 Bacteria 841
469 Ga0157371_10088817 3300013102 Bacteria 2189
470 Ga0157370_10022193 3300013104 Bacteria 6317
471 Ga0157370_10085421 3300013104 Bacteria 2964
472 Ga0157370_11406289 3300013104 Bacteria 628
473 Ga0157369_10038912 3300013105 Bacteria 5199
474 Ga0157369_10202691 3300013105 Bacteria 2082
475 Ga0157378_10062716 3300013297 Bacteria 3320
476 Ga0157378_10461754 3300013297 Bacteria 1262
477 Ga0163162_10007277 3300013306 Bacteria 10751
478 Ga0163162_10027802 3300013306 Bacteria 5595
479 Ga0163162_10079660 3300013306 Unclassified 3341
480 Ga0163162_10268689 3300013306 Bacteria 1837
481 Ga0163162_11257646 3300013306 Bacteria 840
482 Ga0163162_11570973 3300013306 Bacteria 750
483 Ga0157372_10106546 3300013307 Bacteria 3206
484 Ga0157372_10810324 3300013307 Bacteria 1088
485 Ga0157372_13042401 3300013307 Bacteria 536
486 Ga0157375_10100139 3300013308 Bacteria 2978
487 Ga0157375_11573925 3300013308 Bacteria 777
488 Ga0157375_12526301 3300013308 Bacteria 613
489 Ga0163163_10011107 3300014325 Bacteria 8150
490 Ga0163163_10093241 3300014325 Unclassified 3028
491 Ga0163163_10183020 3300014325 Bacteria 2143
492 Ga0157380_10000094 3300014326 Bacteria 48823
493 Ga0157380_10000231 3300014326 Bacteria 33437
494 Ga0157380_10006104 3300014326 Bacteria 8445
495 Ga0157380_10069618 3300014326 Bacteria 2840
496 Ga0157380_10410514 3300014326 Bacteria 1288
497 Ga0157380_10436687 3300014326 Unclassified 1253
498 Ga0157380_10482747 3300014326 Bacteria 1199
499 Ga0157380_10865218 3300014326 Bacteria 927
500 Ga0157380_11043423 3300014326 Bacteria 853
501 Ga0157380_13117482 3300014326 Bacteria 529
502 Ga0157377_11151462 3300014745 Bacteria 597
503 Ga0157379_10060743 3300014968 Bacteria 3379
504 Ga0157379_10148470 3300014968 Bacteria 2114
505 Ga0157379_12169131 3300014968 Bacteria 551
506 Ga0157376_10004537 3300014969 Bacteria 9669
507 Ga0157376_10128485 3300014969 Bacteria 2258
508 Ga0157376_10625195 3300014969 Bacteria 1074
509 Ga0157376_11404345 3300014969 Bacteria 730
510 Ga0157376_12456480 3300014969 Bacteria 561
511 Ga0182006_1111727 3300015261 Bacteria 958
512 Ga0182005_1005698 3300015265 Bacteria 3870
513 Ga0183363_1007 3300015690 Bacteria 315687
514 Ga0183361_10068 3300016635 Bacteria 3137
515 Ga0163161_10013470 3300017792 Bacteria 5692
516 Ga0163161_10295590 3300017792 Bacteria 1274
517 Ga0163161_11623367 3300017792 Bacteria 571
518 Ga0206356_11610434 3300020070 Bacteria 1269
519 Ga0206355_1457572 3300020076 Bacteria 669
520 Ga0206352_10030070 3300020078 Bacteria 685
521 Ga0206350_10854057 3300020080 Bacteria 538
522 Ga0206353_10274352 3300020082 Bacteria 633
523 Ga0206353_11844162 3300020082 Bacteria 2022
524 Ga0213873_10000021 3300021358 Bacteria 113830
525 Ga0213876_10000050 3300021384 Bacteria 144836
526 Ga0213876_10195201 3300021384 Bacteria 1076
527 Ga0224712_10563422 3300022467 Bacteria 554
528 Ga0256744_123496 3300023309 Bacteria 590
529 Ga0209436_105263 3300025208 Bacteria 3005
530 Ga0209147_100422 3300025229 Bacteria 27834
531 Ga0207425_1000005 3300025245 Bacteria 900502
532 Ga0209129_1008702 3300025258 Bacteria 2785
533 Ga0209565_1000029 3300025263 Bacteria 340335
534 Ga0209565_1000052 3300025263 Bacteria 212056
535 Ga0209565_1018477 3300025263 Bacteria 1507
536 Ga0209673_1000889 3300025273 Bacteria 38489
537 Ga0209673_1066750 3300025273 Bacteria 873
538 Ga0209675_1015193 3300025291 Bacteria 2300
539 Ga0209676_1016986 3300025292 Bacteria 2596
540 Ga0209676_1018694 3300025292 Bacteria 2410
541 Ga0209025_1000128 3300025294 Bacteria 198859
542 Ga0209564_1005977 3300025295 Bacteria 6732
543 Ga0209758_1000002 3300025297 Bacteria 1400310
544 Ga0209758_1004078 3300025297 Bacteria 12557
545 Ga0209758_1042906 3300025297 Bacteria 1672
546 Ga0209050_1000001 3300025298 Bacteria 3563507
547 Ga0209050_1000071 3300025298 Bacteria 295478
548 Ga0209050_1000166 3300025298 Bacteria 152073
549 Ga0209050_1001430 3300025298 Bacteria 25721
550 Ga0209050_1007906 3300025298 Bacteria 5827
551 Ga0209050_1032398 3300025298 Bacteria 1608
552 Ga0209050_1053035 3300025298 Bacteria 1011
553 Ga0209050_1077000 3300025298 Bacteria 722
554 Ga0209256_1000008 3300025299 Bacteria 975723
555 Ga0207426_1011881 3300025302 Bacteria 3295
556 Ga0209051_1001966 3300025303 Bacteria 15798
557 Ga0209257_1000027 3300025304 Bacteria 703541
558 Ga0209257_1002317 3300025304 Bacteria 19252
559 Ga0209257_1005763 3300025304 Bacteria 8460
560 Ga0209257_1012431 3300025304 Bacteria 3936
561 Ga0209257_1032794 3300025304 Bacteria 1642
562 Ga0207656_10227708 3300025321 Bacteria 908
563 Ga0207713_1000170 3300025735 Bacteria 94864
564 Ga0207682_10363370 3300025893 Bacteria 682
565 Ga0207692_10192324 3300025898 Bacteria 1195
566 Ga0207642_10224158 3300025899 Bacteria 1052
567 Ga0207642_10577309 3300025899 Bacteria 697
568 Ga0207642_10723090 3300025899 Bacteria 629
569 Ga0207642_10991912 3300025899 Bacteria 541
570 Ga0207680_10012356 3300025903 Bacteria 4346
571 Ga0207680_10826258 3300025903 Unclassified 664
572 Ga0207647_10006880 3300025904 Bacteria 8244
573 Ga0207685_10395253 3300025905 Bacteria 707
574 Ga0207645_10111059 3300025907 Bacteria 1775
575 Ga0207645_10463322 3300025907 Bacteria 856
576 Ga0207643_10048516 3300025908 Bacteria 2405
577 Ga0207643_10220695 3300025908 Bacteria 1160
578 Ga0207643_10348096 3300025908 Bacteria 930
579 Ga0207643_11136689 3300025908 Bacteria 503
580 Ga0207705_10121191 3300025909 Bacteria 1941
581 Ga0207705_10214744 3300025909 Bacteria 1459
582 Ga0207705_11064686 3300025909 Bacteria 624
583 Ga0207684_10039770 3300025910 Bacteria 3987
584 Ga0207684_11421547 3300025910 Bacteria 567
585 Ga0207654_10016757 3300025911 Bacteria 3819
586 Ga0207654_10285572 3300025911 Bacteria 1117
587 Ga0207707_10350915 3300025912 Bacteria 1271
588 Ga0207695_10070089 3300025913 Bacteria 3586
589 Ga0207695_10126174 3300025913 Bacteria 2521
590 Ga0207695_11085915 3300025913 Bacteria 680
591 Ga0207671_10008759 3300025914 Bacteria 8522
592 Ga0207671_10107104 3300025914 Bacteria 2123
593 Ga0207671_10566191 3300025914 Bacteria 906
594 Ga0207660_10066673 3300025917 Bacteria 2605
595 Ga0207662_10187893 3300025918 Bacteria 1332
596 Ga0207662_10601706 3300025918 Bacteria 765
597 Ga0207657_10020932 3300025919 Bacteria 6171
598 Ga0207657_10267108 3300025919 Bacteria 1360
599 Ga0207649_10492398 3300025920 Bacteria 931
600 Ga0207649_10580142 3300025920 Bacteria 861
601 Ga0207646_10585954 3300025922 Bacteria 1002
602 Ga0207646_10875273 3300025922 Bacteria 798
603 Ga0207646_11222917 3300025922 Unclassified 658
604 Ga0207681_10010695 3300025923 Bacteria 5630
605 Ga0207681_10019692 3300025923 Bacteria 4268
606 Ga0207681_10036351 3300025923 Bacteria 3249
607 Ga0207681_10071528 3300025923 Bacteria 2420
608 Ga0207681_10081198 3300025923 Bacteria 2289
609 Ga0207681_10484851 3300025923 Bacteria 1010
610 Ga0207681_11871868 3300025923 Bacteria 500
611 Ga0207694_10058269 3300025924 Bacteria 3004
612 Ga0207694_10316876 3300025924 Bacteria 1286
613 Ga0207694_10795760 3300025924 Bacteria 799
614 Ga0207650_10000609 3300025925 Bacteria 28609
615 Ga0207650_10018590 3300025925 Bacteria 4878
616 Ga0207650_10127839 3300025925 Bacteria 1985
617 Ga0207650_10203994 3300025925 Bacteria 1585
618 Ga0207650_10734858 3300025925 Bacteria 835
619 Ga0207650_11049786 3300025925 Bacteria 693
620 Ga0207659_10070632 3300025926 Bacteria 2547
621 Ga0207659_11267932 3300025926 Bacteria 633
622 Ga0207644_10109784 3300025931 Bacteria 2084
623 Ga0207690_10200195 3300025932 Bacteria 1516
624 Ga0207690_10263195 3300025932 Bacteria 1337
625 Ga0207690_10472198 3300025932 Bacteria 1011
626 Ga0207690_10537175 3300025932 Bacteria 949
627 Ga0207690_10554120 3300025932 Bacteria 935
628 Ga0207706_10004192 3300025933 Bacteria 13574
629 Ga0207706_10005112 3300025933 Bacteria 12245
630 Ga0207706_10579662 3300025933 Bacteria 965
631 Ga0207706_10685804 3300025933 Bacteria 876
632 Ga0207706_11409165 3300025933 Bacteria 572
633 Ga0207709_10033646 3300025935 Bacteria 3012
634 Ga0207709_10098211 3300025935 Bacteria 1930
635 Ga0207709_10347470 3300025935 Bacteria 1118
636 Ga0207709_10623351 3300025935 Bacteria 856
637 Ga0207670_10392327 3300025936 Bacteria 1108
638 Ga0207670_10909281 3300025936 Bacteria 737
639 Ga0207669_10178645 3300025937 Bacteria 1519
640 Ga0207669_10627153 3300025937 Bacteria 877
641 Ga0207669_11251853 3300025937 Bacteria 629
642 Ga0207704_10763913 3300025938 Bacteria 805
643 Ga0207704_11088079 3300025938 Bacteria 679
644 Ga0207704_11397064 3300025938 Bacteria 600
645 Ga0207665_10653358 3300025939 Bacteria 824
646 Ga0207691_10017008 3300025940 Bacteria 6901
647 Ga0207691_10294334 3300025940 Bacteria 1396
648 Ga0207691_10678455 3300025940 Bacteria 870
649 Ga0207711_10527097 3300025941 Bacteria 1102
650 Ga0207711_11751188 3300025941 Bacteria 565
651 Ga0207689_10075163 3300025942 Bacteria 2777
652 Ga0207689_10281180 3300025942 Bacteria 1378
653 Ga0207689_10479198 3300025942 Bacteria 1042
654 Ga0207661_10945605 3300025944 Bacteria 794
655 Ga0207661_11032044 3300025944 Bacteria 757
656 Ga0207679_10413999 3300025945 Bacteria 1188
657 Ga0207679_10523520 3300025945 Bacteria 1061
658 Ga0207679_10805260 3300025945 Bacteria 857
659 Ga0207679_10963551 3300025945 Bacteria 781
660 Ga0207667_10005788 3300025949 Bacteria 15080
661 Ga0207667_10597412 3300025949 Bacteria 1113
662 Ga0207667_11472856 3300025949 Bacteria 652
663 Ga0207651_10856766 3300025960 Bacteria 808
664 Ga0207712_10212028 3300025961 Bacteria 1543
665 Ga0207712_10687640 3300025961 Bacteria 892
666 Ga0207712_10717224 3300025961 Bacteria 874
667 Ga0207712_11347131 3300025961 Bacteria 638
668 Ga0207712_11853353 3300025961 Unclassified 540
669 Ga0207668_10000430 3300025972 Bacteria 26480
670 Ga0207668_10025250 3300025972 Bacteria 3843
671 Ga0207668_10178791 3300025972 Bacteria 1671
672 Ga0207668_10292187 3300025972 Bacteria 1341
673 Ga0207668_11327794 3300025972 Bacteria 648
674 Ga0207668_11611722 3300025972 Bacteria 586
675 Ga0207668_11643110 3300025972 Unclassified 580
676 Ga0207668_11922032 3300025972 Bacteria 533
677 Ga0207668_12003485 3300025972 Bacteria 522
678 Ga0207640_10009603 3300025981 Bacteria 5423
679 Ga0207640_10099519 3300025981 Bacteria 2035
680 Ga0207640_11774739 3300025981 Bacteria 557
681 Ga0207658_10000243 3300025986 Bacteria 57023
682 Ga0207658_10001048 3300025986 Bacteria 22433
683 Ga0207677_10167615 3300026023 Bacteria 1714
684 Ga0207677_10757731 3300026023 Bacteria 866
685 Ga0207703_10071564 3300026035 Bacteria 2864
686 Ga0207703_10778785 3300026035 Bacteria 912
687 Ga0207703_10887307 3300026035 Bacteria 854
688 Ga0207703_11455888 3300026035 Unclassified 659
689 Ga0207703_11496307 3300026035 Bacteria 649
690 Ga0207703_12250445 3300026035 Bacteria 521
691 Ga0207639_10014460 3300026041 Bacteria 5553
692 Ga0207639_11226195 3300026041 Bacteria 704
693 Ga0207639_11575440 3300026041 Bacteria 616
694 Ga0207678_10000773 3300026067 Bacteria 29183
695 Ga0207678_10836914 3300026067 Bacteria 813
696 Ga0207708_10072421 3300026075 Bacteria 2640
697 Ga0207708_10073525 3300026075 Bacteria 2620
698 Ga0207708_10203973 3300026075 Unclassified 1578
699 Ga0207708_10741462 3300026075 Bacteria 842
700 Ga0207702_10012453 3300026078 Bacteria 7081
701 Ga0207702_10142870 3300026078 Bacteria 2168
702 Ga0207641_10000241 3300026088 Bacteria 71027
703 Ga0207641_10006798 3300026088 Bacteria 9584
704 Ga0207641_10684046 3300026088 Bacteria 1009
705 Ga0207641_11158621 3300026088 Bacteria 772
706 Ga0207641_11615309 3300026088 Bacteria 650
707 Ga0207648_10012302 3300026089 Bacteria 8012
708 Ga0207648_10438395 3300026089 Bacteria 1188
709 Ga0207676_10109232 3300026095 Bacteria 2311
710 Ga0207676_10118267 3300026095 Bacteria 2230
711 Ga0207676_10382461 3300026095 Bacteria 1311
712 Ga0207676_10935398 3300026095 Bacteria 852
713 Ga0207676_10959843 3300026095 Unclassified 841
714 Ga0207674_10005038 3300026116 Bacteria 15771
715 Ga0207674_10043654 3300026116 Bacteria 4622
716 Ga0207674_10151794 3300026116 Bacteria 2273
717 Ga0207674_10246151 3300026116 Bacteria 1735
718 Ga0207674_10354086 3300026116 Bacteria 1419
719 Ga0207674_10890504 3300026116 Bacteria 858
720 Ga0207674_11391114 3300026116 Bacteria 671
721 Ga0207675_100000471 3300026118 Bacteria 39106
722 Ga0207675_100000520 3300026118 Bacteria 37450
723 Ga0207675_100140913 3300026118 Bacteria 2290
724 Ga0207675_100403404 3300026118 Bacteria 1347
725 Ga0207675_100854669 3300026118 Bacteria 925
726 Ga0207675_102203382 3300026118 Bacteria 566
727 Ga0207675_102275401 3300026118 Bacteria 556
728 Ga0207683_11963639 3300026121 Bacteria 534
729 Ga0207698_10018892 3300026142 Bacteria 4707
730 Ga0207698_10071771 3300026142 Bacteria 2749
731 Ga0207698_11655560 3300026142 Bacteria 655
732 Ga0207698_11994847 3300026142 Bacteria 595
733 Ga0209371_1000235 3300027312 Bacteria 69492
734 Ga0209813_10269161 3300027866 Bacteria 653
735 Ga0207428_10026662 3300027907 Bacteria 4820
736 Ga0207428_10042112 3300027907 Bacteria 3694
737 Ga0207428_10093739 3300027907 Bacteria 2328
738 Ga0207428_10406134 3300027907 Bacteria 997
739 Ga0207428_10760017 3300027907 Bacteria 690
740 Ga0207428_11275043 3300027907 Bacteria 510
741 Ga0268266_10133236 3300028379 Bacteria 2224
742 Ga0268266_10433855 3300028379 Bacteria 1247
743 Ga0268266_10860980 3300028379 Bacteria 876
744 Ga0268266_10872419 3300028379 Bacteria 870
745 Ga0268266_10921217 3300028379 Bacteria 845
746 Ga0268265_10011098 3300028380 Bacteria 6087
747 Ga0268265_10011632 3300028380 Bacteria 5951
748 Ga0268265_10026242 3300028380 Bacteria 4143
749 Ga0268265_10320918 3300028380 Bacteria 1403
750 Ga0268265_10731128 3300028380 Unclassified 959
751 Ga0268265_10807366 3300028380 Bacteria 915
752 Ga0268265_11955963 3300028380 Bacteria 593
753 Ga0268265_12030754 3300028380 Bacteria 582
754 Ga0268264_10000204 3300028381 Bacteria 120959
755 Ga0268264_10001562 3300028381 Bacteria 21229
756 Ga0268264_10052641 3300028381 Bacteria 3395
757 Ga0268264_10263909 3300028381 Bacteria 1606
758 Ga0268264_10547266 3300028381 Bacteria 1135
759 Ga0307515_10496291 3300028794 Bacteria 832
760 Ga0268256_1000196 3300030500 Bacteria 69428
761 Ga0314311_1176710 3300030733 Bacteria 948
762 Ga0307513_10037481 3300031456 Bacteria 5396
763 Ga0307509_10097611 3300031507 Bacteria 2986
764 Ga0307408_100003838 3300031548 Bacteria 10223
765 Ga0307408_100451402 3300031548 Bacteria 1115
766 Ga0307408_100675059 3300031548 Bacteria 926
767 Ga0307408_101381152 3300031548 Bacteria 662
768 Ga0307408_102033639 3300031548 Bacteria 553
769 Ga0307516_10420231 3300031730 Bacteria 995
770 Ga0307405_10050959 3300031731 Bacteria 2566
771 Ga0307405_10353778 3300031731 Bacteria 1134
772 Ga0307405_10640780 3300031731 Bacteria 872
773 Ga0307405_11740176 3300031731 Bacteria 553
774 Ga0307413_10191989 3300031824 Bacteria 1467
775 Ga0307413_10204123 3300031824 Bacteria 1430
776 Ga0307413_11915542 3300031824 Bacteria 533
777 Ga0307410_10095015 3300031852 Bacteria 2124
778 Ga0307410_10181207 3300031852 Bacteria 1595
779 Ga0307410_10589664 3300031852 Bacteria 926
780 Ga0307406_10310916 3300031901 Bacteria 1215
781 Ga0307406_10502639 3300031901 Bacteria 983
782 Ga0307406_10607487 3300031901 Bacteria 902
783 Ga0307406_10622376 3300031901 Bacteria 893
784 Ga0307406_11185421 3300031901 Bacteria 663
785 Ga0307407_10215834 3300031903 Bacteria 1294
786 Ga0307407_10322962 3300031903 Bacteria 1084
787 Ga0307412_10000206 3300031911 Bacteria 40298
788 Ga0307412_10053739 3300031911 Bacteria 2671
789 Ga0307412_10160568 3300031911 Bacteria 1669
790 Ga0307412_10164020 3300031911 Bacteria 1654
791 Ga0307412_10333369 3300031911 Bacteria 1212
792 Ga0307412_10696297 3300031911 Bacteria 871
793 Ga0307412_11206085 3300031911 Unclassified 678
794 Ga0307412_11352440 3300031911 Bacteria 643
795 Ga0307412_11580058 3300031911 Bacteria 598
796 Ga0307412_11739551 3300031911 Bacteria 572
797 Ga0307412_12218936 3300031911 Bacteria 511
798 Ga0307409_100154737 3300031995 Bacteria 1996
799 Ga0307409_100276468 3300031995 Bacteria 1549
800 Ga0307409_100493890 3300031995 Bacteria 1190
801 Ga0307409_100868530 3300031995 Bacteria 914
802 Ga0307409_100969487 3300031995 Bacteria 867
803 Ga0307416_100120782 3300032002 Bacteria 2334
804 Ga0307416_100180129 3300032002 Bacteria 1979
805 Ga0307416_100241034 3300032002 Bacteria 1752
806 Ga0307416_100384873 3300032002 Bacteria 1434
807 Ga0307416_100864069 3300032002 Bacteria 1003
808 Ga0307416_101318337 3300032002 Bacteria 828
809 Ga0307416_101640047 3300032002 Bacteria 748
810 Ga0307416_102119016 3300032002 Bacteria 664
811 Ga0307416_102145746 3300032002 Bacteria 660
812 Ga0307414_10000090 3300032004 Bacteria 78448
813 Ga0307414_10001067 3300032004 Bacteria 14023
814 Ga0307414_10024139 3300032004 Bacteria 3871
815 Ga0307414_10032478 3300032004 Bacteria 3437
816 Ga0307414_10083257 3300032004 Bacteria 2349
817 Ga0307414_10314754 3300032004 Bacteria 1330
818 Ga0307411_10031870 3300032005 Bacteria 3250
819 Ga0307411_10066342 3300032005 Bacteria 2424
820 Ga0307411_10177756 3300032005 Bacteria 1612
821 Ga0307411_10475390 3300032005 Bacteria 1051
822 Ga0307411_11530548 3300032005 Bacteria 614
823 Ga0307411_12320456 3300032005 Bacteria 504
824 Ga0307415_100510698 3300032126 Bacteria 1053
825 Ga0307415_100655277 3300032126 Bacteria 942
826 Ga0307415_100660778 3300032126 Bacteria 938
827 Ga0307415_101189908 3300032126 Bacteria 718
828 Ga0373926_0230201 3300035083 Bacteria 716
829 Ga0373944_0213989 3300035089 Bacteria 701
830 Ga0373939_0109239 3300035114 Bacteria 961
831 Ga0373945_0140046 3300035116 Bacteria 975
832 Ga0373957_0267558 3300035120 Bacteria 721
833 Ga0373960_0205143 3300035121 Bacteria 699
834 Ga0373946_0420660 3300035171 Bacteria 677
835 Ga0373955_0972083 3300035172 Bacteria 523
836 Ga0373962_0236129 3300035242 Bacteria 630
837 Ga0373931_0023028 3300035691 Bacteria 3141
838 Ga0373935_1095128 3300035692 Bacteria 593
839 Ga0373935_1428122 3300035692 Bacteria 517
840 Ga0373927_0051355 3300035695 Bacteria 2666
841 Ga0373933_0549796 3300035724 Bacteria 757
842 Ga0373937_1295810 3300036401 Bacteria 676
843 Ga0316582_0523956 3300036647 Bacteria 817
844 Ga0373925_0361313 3300037068 Bacteria 1180
845 Ga0395901_1791740 3300038443 Bacteria 563
846 Ga0436365_0480912 3300039437 Bacteria 48758
847 Ga0436363_0048982 3300039450 Bacteria 535
848 Ga0436363_0493190 3300039450 Bacteria 842
849 Ga0436362_0553111 3300039453 Bacteria 45057
850 Ga0439436_0065284 3300041404 Bacteria 1016
851 Ga0439436_0170291 3300041404 Bacteria 617
852 Ga0439439_0010294 3300041406 Bacteria 2233
853 Ga0439461_0000394 3300041410 Bacteria 6254
854 Ga0439461_0023156 3300041410 Bacteria 1248
855 Ga0439466_0199721 3300041411 Bacteria 608
856 Ga0439465_0000283 3300041413 Bacteria 14258
857 Ga0439465_0001505 3300041413 Bacteria 7561
858 Ga0451789_0782680 3300041443 Bacteria 833
859 Ga0451791_1030079 3300041451 Bacteria 1013
860 Ga0451793_0033680 3300041452 Bacteria 1359
861 Ga0451793_0957128 3300041452 Bacteria 837
862 Ga0451800_0427065 3300041459 Bacteria 2389
863 Ga0451800_0504361 3300041459 Bacteria 655
864 Ga0451800_1486363 3300041459 Bacteria 1877
865 Ga0451802_0398890 3300041460 Bacteria 1405
866 Ga0451802_1054188 3300041460 Bacteria 778
867 Ga0451806_242067 3300041462 Bacteria 1906
868 Ga0451806_513296 3300041462 Bacteria 2422
869 Ga0451804_0395309 3300041463 Bacteria 2030
870 Ga0451804_1112201 3300041463 Bacteria 649
871 Ga0451807_0115728 3300041486 Bacteria 542
872 Ga0451807_0343639 3300041486 Bacteria 544
873 Ga0451807_0451373 3300041486 Bacteria 1196
874 Ga0451807_0556227 3300041486 Bacteria 1956
875 Ga0451807_1077379 3300041486 Bacteria 944
876 Ga0451807_2058733 3300041486 Bacteria 1705
877 Ga0451833_1248443 3300041491 Bacteria 2359
878 Ga0451837_0561980 3300041494 Bacteria 1723
879 Ga0451845_0079559 3300041501 Bacteria 618
880 Ga0451849_0025924 3300041505 Bacteria 651
881 Ga0451851_0206228 3300041507 Bacteria 519
882 Ga0451853_1265896 3300041512 Bacteria 974
883 Ga0451853_2186315 3300041512 Bacteria 556
884 Ga0451853_2340752 3300041512 Bacteria 1516
885 Ga0439431_0000388 3300041997 Bacteria 9272
886 Ga0439433_0082408 3300041999 Bacteria 784
887 Ga0439442_000975 3300042002 Bacteria 5778
888 Ga0439442_009486 3300042002 Bacteria 1969
889 Ga0439443_080578 3300042003 Bacteria 605
890 Ga0439445_0006131 3300042004 Bacteria 2756
891 Ga0439445_0010370 3300042004 Bacteria 2203
892 Ga0439445_0236798 3300042004 Bacteria 544
893 Ga0439432_000054 3300042006 Bacteria 34641
894 Ga0439432_042859 3300042006 Bacteria 1430
895 Ga0439452_021914 3300042010 Bacteria 1658
896 Ga0439455_0145411 3300042012 Bacteria 673
897 Ga0439457_139090 3300042014 Bacteria 580
898 Ga0439462_0000462 3300042015 Bacteria 7979
899 Ga0439462_0004275 3300042015 Bacteria 3475
900 Ga0450890_054408 3300042127 Bacteria 616
901 Ga0450895_017865 3300042132 Bacteria 644
902 Ga0450896_013094 3300042133 Bacteria 1178
903 Ga0450889_004060 3300042144 Bacteria 1444
904 Ga0450906_047077 3300042145 Bacteria 761
905 Ga0450907_010656 3300042146 Bacteria 1525
906 Ga0439446_0023557 3300042156 Bacteria 1752
907 Ga0439446_0378379 3300042156 Bacteria 508
908 Ga0439434_0000569 3300042435 Bacteria 10645
909 Ga0439435_0219865 3300042436 Bacteria 632
910 Ga0439459_0094784 3300042438 Bacteria 723
911 Ga0439464_0171838 3300042439 Bacteria 684
912 Ga0439460_0094061 3300042461 Bacteria 956
913 Ga0451577_1011431 3300042876 Bacteria 746
914 Ga0451577_1076966 3300042876 Bacteria 720
915 Ga0466969_0008980 3300044656 Bacteria 5297
916 Ga0466966_0001607 3300044684 Bacteria 14542
917 Ga0466961_0055107 3300044693 Bacteria 2535
918 Ga0466961_0103542 3300044693 Bacteria 1792
919 Ga0466963_0052452 3300044694 Bacteria 2706
920 Ga0466964_0002394 3300044706 Bacteria 6661
921 Ga0466971_0000284 3300044719 Bacteria 19435
922 Ga0466971_0013113 3300044719 Bacteria 3634
923 Ga0466970_0000838 3300044765 Bacteria 14795
924 Ga0466970_0335562 3300044765 Bacteria 856
925 Ga0466957_0015872 3300044842 Bacteria 4401
926 Ga0466959_0006859 3300045049 Bacteria 7941
927 Ga0451576_0176225 3300045051 Bacteria 2232
928 Ga0466958_0062450 3300045836 Bacteria 2271
929 Ga0466958_0091687 3300045836 Bacteria 1881
930 Ga0466967_0030518 3300045976 Bacteria 4525
931 Ga0495627_050209 3300046453 Bacteria 1257
932 Ga0495638_0000774 3300046460 Bacteria 33793
933 Ga0495638_0090851 3300046460 Bacteria 1840
934 Ga0495650_0001552 3300046471 Bacteria 21682
935 Ga0495580_0686345 3300046472 Bacteria 671
936 Ga0495610_0131516 3300046512 Bacteria 1086
937 Ga0495616_0000022 3300046513 Bacteria 149720
938 Ga0495643_0141295 3300046522 Bacteria 1200
939 Ga0495654_0133690 3300046530 Bacteria 1111
940 Ga0495654_0378745 3300046530 Bacteria 565
941 Ga0495586_0413754 3300046535 Bacteria 776
942 Ga0495598_0185764 3300046537 Bacteria 744
943 Ga0495598_0358018 3300046537 Bacteria 563
944 Ga0495597_0240213 3300046542 Bacteria 714
945 Ga0495633_0316071 3300046558 Bacteria 709
946 Ga0495668_0000031 3300046616 Bacteria 256576
947 Ga0495668_0037509 3300046616 Bacteria 2711
948 Ga0495668_0162838 3300046616 Bacteria 1222
949 Ga0495668_0267227 3300046616 Bacteria 936
950 Ga0495668_0553833 3300046616 Bacteria 635
951 Ga0495634_0643887 3300046642 Bacteria 613
952 Ga0495611_0237212 3300046648 Bacteria 847
953 Ga0495625_0000083 3300046660 Bacteria 152144
954 Ga0495625_0000115 3300046660 Bacteria 122861
955 Ga0495625_0155072 3300046660 Bacteria 1537
956 Ga0495625_0222491 3300046660 Bacteria 1236
957 Ga0495670_0000047 3300046691 Bacteria 65608
958 Ga0495670_0371003 3300046691 Bacteria 771
959 Ga0495670_0709782 3300046691 Bacteria 548
960 Ga0495649_0298965 3300046694 Bacteria 820
961 Ga0495636_0527102 3300047318 Bacteria 573
962 Ga0495681_0033786 3300047470 Bacteria 2556
963 Ga0495686_0001048 3300047472 Bacteria 33188
964 Ga0495686_0001884 3300047472 Bacteria 20970
965 Ga0495686_0447359 3300047472 Bacteria 687
966 Ga0495686_0520613 3300047472 Bacteria 624
967 Ga0495626_0130762 3300048091 Bacteria 1072
968 Ga0496102_0231762 3300048905 Unclassified 1741
969 Ga0496102_1467062 3300048905 Bacteria 601
970 Ga0496104_0199331 3300048907 Bacteria 1914
971 Ga0496104_0225962 3300048907 Bacteria 1784
972 Ga0496104_0457463 3300048907 Bacteria 1188
973 Ga0496106_1548224 3300048909 Unclassified 509
974 Ga0496108_0001104 3300048911 Bacteria 21095
975 Ga0496108_0261640 3300048911 Bacteria 1506
976 Ga0496110_0007418 3300048913 Bacteria 8757
977 Ga0496110_0047911 3300048913 Bacteria 3744
978 Ga0496111_0040721 3300048914 Bacteria 3333
979 Ga0496111_0087688 3300048914 Bacteria 2278
980 Ga0496111_0134502 3300048914 Bacteria 1831
981 Ga0496111_0262321 3300048914 Bacteria 1282
982 Ga0496112_0055039 3300048915 Bacteria 3910
983 Ga0496113_0040728 3300048916 Bacteria 3425
984 Ga0496113_0371607 3300048916 Bacteria 1148
985 Ga0496113_1309919 3300048916 Bacteria 563
986 Ga0496114_1496123 3300048917 Bacteria 563
987 Ga0496115_0000333 3300048918 Bacteria 40158
988 Ga0496116_0122931 3300048919 Bacteria 1497
989 Ga0496117_0002512 3300048920 Bacteria 22989
990 Ga0496117_0027156 3300048920 Bacteria 4466
991 Ga0496118_0032030 3300048921 Bacteria 4342
992 Ga0496118_0118063 3300048921 Bacteria 1738
993 Ga0496118_0148557 3300048921 Bacteria 1471
994 Ga0496118_0188008 3300048921 Bacteria 1239
995 Ga0496118_0340787 3300048921 Bacteria 803
996 Ga0496119_0004541 3300048922 Bacteria 13758
997 Ga0496119_0216175 3300048922 Bacteria 983
998 Ga0496120_0001660 3300048923 Bacteria 25701
999 Ga0496120_0091448 3300048923 Bacteria 1624
1000 Ga0496120_0110315 3300048923 Bacteria 1438
1001 Ga0496121_0003542 3300048924 Bacteria 22106
1002 Ga0496121_0183126 3300048924 Bacteria 1509
1003 Ga0496122_0000361 3300048925 Bacteria 97861
1004 Ga0496122_0033601 3300048925 Bacteria 4215
1005 Ga0496122_0096833 3300048925 Bacteria 1988
1006 Ga0496122_0344323 3300048925 Bacteria 781
1007 Ga0496123_0002053 3300048926 Bacteria 25986
1008 Ga0496123_0008346 3300048926 Bacteria 9530
1009 Ga0496123_0054939 3300048926 Bacteria 2617
1010 Ga0496123_0119750 3300048926 Bacteria 1484
1011 Ga0496123_0158908 3300048926 Bacteria 1208
1012 Ga0496123_0215755 3300048926 Bacteria 971
1013 Ga0496123_0281226 3300048926 Bacteria 804
1014 Ga0496124_0000116 3300048927 Bacteria 164788
1015 Ga0496124_0002453 3300048927 Bacteria 24263
1016 Ga0496124_0021657 3300048927 Bacteria 5920
1017 Ga0496124_0239946 3300048927 Bacteria 1348
1018 Ga0496124_0633391 3300048927 Bacteria 689
1019 Ga0496125_0009457 3300048928 Bacteria 10008
1020 Ga0496125_0011195 3300048928 Bacteria 8990
1021 Ga0496125_0034476 3300048928 Bacteria 4461
1022 Ga0496125_0135923 3300048928 Bacteria 1720
1023 Ga0496125_0340902 3300048928 Bacteria 899
1024 Ga0496125_0430948 3300048928 Bacteria 761
1025 Ga0496126_0033359 3300048929 Bacteria 4844
1026 Ga0496126_0054433 3300048929 Bacteria 3624
1027 Ga0496126_0248981 3300048929 Bacteria 1481
1028 Ga0496126_0293834 3300048929 Bacteria 1343
1029 Ga0496126_0542085 3300048929 Bacteria 924
1030 Ga0496126_1021124 3300048929 Bacteria 619
1031 Ga0501290_000535 3300049513 Bacteria 5827
1032 Ga0501299_131159 3300049522 Bacteria 614
1033 Ga0501300_000775 3300049523 Bacteria 4832
1034 Ga0501300_055668 3300049523 Bacteria 618
1035 Ga0501335_004083 3300049551 Bacteria 1262
1036 Ga0501034_0052605 3300049571 Bacteria 4102
1037 Ga0501036_0814721 3300049572 Bacteria 768
1038 Ga0501037_0965925 3300049573 Bacteria 556
1039 Ga0501039_0396712 3300049575 Bacteria 1084
1040 Ga0501039_0575172 3300049575 Bacteria 884
1041 Ga0501043_0362780 3300049579 Bacteria 1099
1042 Ga0501047_0460255 3300049581 Bacteria 1101
1043 Ga0501047_1042898 3300049581 Bacteria 631
1044 Ga0501048_1133089 3300049582 Bacteria 563
1045 Ga0501069_0005700 3300049585 Bacteria 6486
1046 Ga0501070_0034219 3300049586 Bacteria 4249
1047 Ga0501071_0762292 3300049587 Bacteria 746
1048 Ga0501076_0901884 3300049592 Bacteria 729
1049 Ga0501206_054051 3300049653 Bacteria 645
1050 Ga0501208_058782 3300049655 Bacteria 749
1051 Ga0501211_000604 3300049658 Bacteria 3585
1052 Ga0501223_000008 3300049663 Bacteria 117828
1053 Ga0501235_012074 3300049669 Bacteria 1898
1054 Ga0501236_005683 3300049670 Bacteria 1513
1055 Ga0501246_011106 3300049676 Bacteria 831
1056 Ga0501256_001336 3300049685 Bacteria 1797
1057 Ga0501261_069797 3300049690 Bacteria 614
1058 Ga0501225_0002035 3300049705 Bacteria 6291
1059 Ga0501225_0005303 3300049705 Bacteria 3789
1060 Ga0501225_0052085 3300049705 Bacteria 1141
1061 Ga0501083_0022042 3300049744 Bacteria 4422
1062 Ga0501264_007196 3300049761 Bacteria 1034
1063 Ga0501275_000288 3300049772 Bacteria 5719
1064 Ga0501275_090043 3300049772 Bacteria 509
1065 Ga0501035_0460876 3300049822 Bacteria 1051
1066 Ga0501035_0998479 3300049822 Bacteria 658
1067 Ga0501044_0224010 3300049823 Bacteria 1830
1068 Ga0501044_1374425 3300049823 Bacteria 572
1069 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
1070 nmdc:mga03n38_1530_c1 3300050490 Bacteria 6691
1071 nmdc:mga0yw44_1049937_c1 3300050492 Bacteria 551
1072 nmdc:mga0k408_229344_c1 3300050493 Bacteria 1109
1073 nmdc:mga0k408_35281_c1 3300050493 Bacteria 2868
1074 nmdc:mga0k408_554573_c1 3300050493 Bacteria 679
1075 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
1076 nmdc:mga07m45_20_c1 3300050496 Bacteria 126269
1077 nmdc:mga07m45_401758_c1 3300050496 Bacteria 795
1078 nmdc:mga05p37_114129_c1 3300050507 Bacteria 3321
1079 nmdc:mga05p37_152982_c1 3300050507 Bacteria 2820
1080 nmdc:mga05p37_1966634_c1 3300050507 Bacteria 555
1081 nmdc:mga05p37_214267_c1 3300050507 Bacteria 2327
1082 nmdc:mga05p37_418677_c1 3300050507 Bacteria 1559
1083 nmdc:mga05p37_520230_c1 3300050507 Bacteria 1361
1084 nmdc:mga09592_1220239_c1 3300050508 Bacteria 621
1085 nmdc:mga09592_131176_c1 3300050508 Bacteria 2156
1086 nmdc:mga09592_183494_c1 3300050508 Bacteria 1810
1087 nmdc:mga09592_300173_c1 3300050508 Bacteria 1393
1088 nmdc:mga09592_49001_c1 3300050508 Bacteria 3562
1089 nmdc:mga09592_55952_c1 3300050508 Bacteria 3333
1090 nmdc:mga0qj67_116770_c1 3300050509 Bacteria 2156
1091 nmdc:mga0qj67_222894_c1 3300050509 Bacteria 1531
1092 nmdc:mga0qj67_274763_c1 3300050509 Bacteria 1366
1093 nmdc:mga0qj67_30550_c1 3300050509 Bacteria 4196
1094 nmdc:mga0qj67_58178_c1 3300050509 Bacteria 3064
1095 nmdc:mga0qj67_601297_c1 3300050509 Bacteria 880
1096 nmdc:mga06r32_1278980_c1 3300050510 Bacteria 678
1097 nmdc:mga06r32_19835_c1 3300050510 Bacteria 6178
1098 nmdc:mga06r32_317791_c1 3300050510 Bacteria 1543
1099 nmdc:mga06r32_337_c1 3300050510 Bacteria 39051
1100 nmdc:mga06r32_404430_c1 3300050510 Bacteria 1347
1101 nmdc:mga06r32_436025_c1 3300050510 Bacteria 1291
1102 nmdc:mga06r32_45225_c1 3300050510 Bacteria 4196
1103 nmdc:mga06r32_497681_c1 3300050510 Bacteria 1196
1104 nmdc:mga08y16_143511_c1 3300050511 Bacteria 2482
1105 nmdc:mga08y16_153661_c1 3300050511 Bacteria 2392
1106 nmdc:mga08y16_192656_c1 3300050511 Bacteria 2114
1107 nmdc:mga08y16_278848_c1 3300050511 Bacteria 1724
1108 nmdc:mga08y16_402669_c2 3300050511 Unclassified 506
1109 nmdc:mga08y16_465818_c1 3300050511 Bacteria 1287
1110 nmdc:mga08y16_589470_c1 3300050511 Bacteria 1121
1111 nmdc:mga08y16_61630_c1 3300050511 Bacteria 3917
1112 nmdc:mga08y16_877419_c1 3300050511 Bacteria 885
1113 nmdc:mga08y16_981615_c1 3300050511 Bacteria 826
1114 nmdc:mga0n895_191741_c1 3300050512 Bacteria 2075
1115 nmdc:mga0n895_39742_c1 3300050512 Bacteria 4567
1116 nmdc:mga0rr50_1496350_c1 3300050513 Bacteria 571
1117 nmdc:mga0rr50_210770_c1 3300050513 Unclassified 1600
1118 nmdc:mga0rr50_531604_c1 3300050513 Bacteria 1001
1119 nmdc:mga0a205_1176468_c1 3300050515 Bacteria 614
1120 nmdc:mga0a205_1207496_c1 3300050515 Bacteria 604
1121 nmdc:mga0a205_14992_c1 3300050515 Bacteria 7234
1122 nmdc:mga0sz30_2719_c1 3300050516 Bacteria 4757
1123 Ga0495612_0182441 3300053078 Bacteria 922
1124 Ga0500643_000475 3300053087 Bacteria 29406
1125 Ga0500643_001338 3300053087 Bacteria 14380
1126 Ga0500643_002080 3300053087 Bacteria 10653
1127 Ga0500646_0126025 3300053090 Bacteria 828
1128 Ga0500583_0541334 3300053092 Bacteria 542
1129 Ga0500566_0008244 3300053094 Bacteria 6166
1130 Ga0500566_0383088 3300053094 Bacteria 635
1131 Ga0500650_0501876 3300053098 Bacteria 516
1132 Ga0500562_122410 3300053108 Bacteria 709
1133 Ga0500562_225602 3300053108 Bacteria 506
1134 Ga0500592_005468 3300053116 Bacteria 2024
1135 Ga0500592_012998 3300053116 Bacteria 1333
1136 Ga0500652_174553 3300053131 Bacteria 883
1137 Ga0500658_0123970 3300053134 Bacteria 1147
1138 Ga0500568_0013638 3300053139 Bacteria 3697
1139 Ga0500568_0034532 3300053139 Bacteria 2069
1140 Ga0500604_0002288 3300053151 Bacteria 5243
1141 Ga0500616_0111302 3300053153 Bacteria 1322
1142 Ga0500627_0000003 3300053158 Bacteria 178186
1143 Ga0500627_0121223 3300053158 Bacteria 1180
1144 Ga0500570_202968 3300053724 Bacteria 598
1145 Ga0501084_1142384 3300054114 Bacteria 654
1146 Ga0500661_001498 3300055283 Bacteria 4384
1147 Ga0590071_005027 3300059421 Bacteria 3190
1148 Ga0590071_172255 3300059421 Bacteria 566
1149 Ga0590074_021120 3300059423 Bacteria 1121
1150 Ga0587084_031580 3300059477 Bacteria 855
1151 Ga0587093_093274 3300059478 Unclassified 535
1152 Ga0587077_199839 3300059493 Bacteria 552
1153 Ga0587082_057045 3300059504 Bacteria 760
1154 Ga0587085_033063 3300059506 Bacteria 861
1155 Ga0587090_036077 3300059510 Bacteria 849
1156 Ga0587091_018621 3300059511 Bacteria 1184
1157 Ga0587098_019198 3300059604 Bacteria 854
1158 Ga0587129_015400 3300059608 Unclassified 637
1159 Ga0587101_109295 3300059623 Bacteria 559
1160 Ga0587101_139287 3300059623 Bacteria 517
1161 Ga0587109_051344 3300059624 Bacteria 846
1162 Ga0587117_042859 3300059627 Bacteria 727
1163 Ga0587128_014085 3300059630 Bacteria 1139
1164 Ga0587062_027045 3300059639 Bacteria 855
1165 Ga0587108_011948 3300059653 Bacteria 746
1166 Ga0587111_0049805 3300060346 Bacteria 921
1167 Ga0501082_0481586 3300060353 Bacteria 1085
1168 Ga0466962_0002691 3300061719 Bacteria 8462
1169 Ga0466962_0007169 3300061719 Bacteria 5339

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0008980 Ga0466969_0008980_2987_3307 63
2 3300044684 Ga0466966_0001607 Ga0466966_0001607_7637_7957 63
3 3300044693 Ga0466961_0055107 Ga0466961_0055107_140_460 63
4 3300044706 Ga0466964_0002394 Ga0466964_0002394_5391_5711 63
5 3300044719 Ga0466971_0000284 Ga0466971_0000284_11054_11374 63
6 3300044765 Ga0466970_0000838 Ga0466970_0000838_10064_10384 63
7 3300044842 Ga0466957_0015872 Ga0466957_0015872_2763_3083 63
8 3300045049 Ga0466959_0006859 Ga0466959_0006859_2857_3177 63
9 3300045836 Ga0466958_0062450 Ga0466958_0062450_562_882 63
10 3300061719 Ga0466962_0002691 Ga0466962_0002691_8050_8370 63
11 3300035116 Ga0373945_0140046 Ga0373945_0140046_181_501 64
12 3300035120 Ga0373957_0267558 Ga0373957_0267558_317_637 64
13 3300035172 Ga0373955_0972083 Ga0373955_0972083_145_465 64
14 3300035692 Ga0373935_1095128 Ga0373935_1095128_195_515 64
15 3300035724 Ga0373933_0549796 Ga0373933_0549796_370_690 64
16 3300036401 Ga0373937_1295810 Ga0373937_1295810_110_430 64
17 3300042156 Ga0439446_0378379 Ga0439446_0378379_133_450 64
18 3300046642 Ga0495634_0643887 Ga0495634_0643887_70_390 64
19 3300012495 Ga0157323_1005241 Ga0157323_10052412 66
20 3300025922 Ga0207646_10875273 Ga0207646_108752731 66
21 3300005367 Ga0070667_101023734 Ga0070667_1010237342 67
22 3300009553 Ga0105249_10026693 Ga0105249_100266936 67
23 3300014745 Ga0157377_11151462 Ga0157377_111514622 67
24 3300004798 Ga0058859_11186829 Ga0058859_111868292 68
25 3300004801 Ga0058860_12203426 Ga0058860_122034262 68
26 3300005347 Ga0070668_101873102 Ga0070668_1018731022 68
27 3300005354 Ga0070675_101497214 Ga0070675_1014972141 68
28 3300005544 Ga0070686_101446544 Ga0070686_1014465441 68
29 3300009553 Ga0105249_10571229 Ga0105249_105712292 68
30 3300014325 Ga0163163_10093241 Ga0163163_100932412 68
31 3300014326 Ga0157380_10436687 Ga0157380_104366871 68
32 3300025298 Ga0209050_1001430 Ga0209050_100143015 68
33 3300025961 Ga0207712_10717224 Ga0207712_107172242 68
34 3300027907 Ga0207428_10406134 Ga0207428_104061342 68
35 3300006844 Ga0075428_100970852 Ga0075428_1009708522 69
36 3300041501 Ga0451845_0079559 Ga0451845_0079559_145_429 71
37 3300053098 Ga0500650_0501876 Ga0500650_0501876_177_461 71
38 3300009094 Ga0111539_10285154 Ga0111539_102851544 72
39 3300009147 Ga0114129_11034319 Ga0114129_110343193 72
40 3300009176 Ga0105242_12543832 Ga0105242_125438321 72
41 3300010375 Ga0105239_13198513 Ga0105239_131985131 72
42 3300013100 Ga0157373_10544698 Ga0157373_105446981 72
43 3300013308 Ga0157375_11573925 Ga0157375_115739251 72
44 3300032002 Ga0307416_101640047 Ga0307416_1016400472 72
45 3300032126 Ga0307415_100660778 Ga0307415_1006607782 72
46 3300042144 Ga0450889_004060 Ga0450889_004060_1144_1404 72
47 3300050508 nmdc:mga09592_55952_c1 nmdc:mga09592_55952_c1_1234_1494 72
48 3300050511 nmdc:mga08y16_981615_c1 nmdc:mga08y16_981615_c1_243_503 72
49 3300009147 Ga0114129_10138853 Ga0114129_101388533 73
50 3300005338 Ga0068868_100557510 Ga0068868_1005575102 74
51 3300005340 Ga0070689_100479309 Ga0070689_1004793092 74
52 3300005549 Ga0070704_101036699 Ga0070704_1010366991 74
53 3300005617 Ga0068859_102502470 Ga0068859_1025024701 74
54 3300005843 Ga0068860_101715969 Ga0068860_1017159692 74
55 3300006931 Ga0097620_102501853 Ga0097620_1025018531 74
56 3300009101 Ga0105247_10058703 Ga0105247_100587033 74
57 3300028380 Ga0268265_10731128 Ga0268265_107311281 74
58 3300048909 Ga0496106_1548224 Ga0496106_1548224_177_446 74
59 3300050511 nmdc:mga08y16_192656_c1 nmdc:mga08y16_192656_c1_852_1121 74
60 3300005618 Ga0068864_100552366 Ga0068864_1005523662 75
61 3300013307 Ga0157372_13042401 Ga0157372_130424011 75
62 3300026095 Ga0207676_10959843 Ga0207676_109598431 75
63 3300009094 Ga0111539_13076893 Ga0111539_130768931 76
64 3300031456 Ga0307513_10037481 Ga0307513_100374813 76
65 3300053724 Ga0500570_202968 Ga0500570_202968_184_453 76
66 3300006852 Ga0075433_11621746 Ga0075433_116217461 77
67 3300031911 Ga0307412_12218936 Ga0307412_122189361 77
68 3300009011 Ga0105251_10000862 Ga0105251_100008627 78
69 3300009101 Ga0105247_10007739 Ga0105247_100077393 78
70 3300009177 Ga0105248_10000014 Ga0105248_10000014214 78
71 3300013306 Ga0163162_10007277 Ga0163162_100072773 78
72 3300014326 Ga0157380_10865218 Ga0157380_108652182 78
73 3300014968 Ga0157379_10060743 Ga0157379_100607432 78
74 3300046691 Ga0495670_0371003 Ga0495670_0371003_427_681 78
75 3300048907 Ga0496104_0199331 Ga0496104_0199331_269_523 78
76 3300048914 Ga0496111_0087688 Ga0496111_0087688_346_600 78
77 3300048921 Ga0496118_0118063 Ga0496118_0118063_451_705 78
78 3300053087 Ga0500643_000475 Ga0500643_000475_14729_14983 78
79 iso_pu_bacteria 2775507255 2778125807 78
80 iso_pu_bacteria 2818991438 2819552460 79
81 iso_pu_bacteria 2818991457 2819661834 79
82 iso_pu_bacteria 2852684882 2852688499 79
83 iso_pu_bacteria 2881101125 2881102749 79
84 iso_pu_bacteria 2919130084 2919133867 79
85 iso_pu_bacteria 2929195423 2929199844 79
86 iso_pu_bacteria 8021622325 8021622967 79
87 iso_pu_bacteria 8021626552 8021629099 79
88 iso_pu_bacteria 8021648035 8021651210 79
89 iso_pu_bacteria 2571042365 2572255450 80
90 iso_pu_bacteria 2599185359 2600228469 80
91 iso_pu_bacteria 2643221622 2644127533 80
92 iso_pu_bacteria 2643221695 2644527954 80
93 iso_pu_bacteria 2818991466 2819715261 80
94 iso_pu_bacteria 2879163058 2879163177 80
95 iso_pu_bacteria 2928526807 2928527999 80
96 iso_pu_bacteria 2928968154 2928971498 80
97 3300005615 Ga0070702_100716159 Ga0070702_1007161591 81
98 3300021384 Ga0213876_10195201 Ga0213876_101952011 81
99 3300041451 Ga0451791_1030079 Ga0451791_1030079_303_566 81
100 3300046472 Ga0495580_0686345 Ga0495580_0686345_56_319 81
101 3300049579 Ga0501043_0362780 Ga0501043_0362780_169_441 81
102 3300049581 Ga0501047_1042898 Ga0501047_1042898_26_298 81
103 3300049822 Ga0501035_0460876 Ga0501035_0460876_30_302 81
104 3300049822 Ga0501035_0998479 Ga0501035_0998479_298_570 81
105 3300049823 Ga0501044_0224010 Ga0501044_0224010_554_826 81
106 3300001904 JGI24736J21556_1000245 JGI24736J21556_10002457 82
107 3300001915 JGI24741J21665_1000033 JGI24741J21665_100003329 82
108 3300001979 JGI24740J21852_10000308 JGI24740J21852_1000030815 82
109 3300001989 JGI24739J22299_10001399 JGI24739J22299_100013994 82
110 3300001990 JGI24737J22298_10002067 JGI24737J22298_100020677 82
111 3300002067 JGI24735J21928_10002354 JGI24735J21928_100023545 82
112 3300002074 JGI24748J21848_1017734 JGI24748J21848_10177341 82
113 3300002075 JGI24738J21930_10000553 JGI24738J21930_100005537 82
114 3300002239 JGI24034J26672_10063209 JGI24034J26672_100632092 82
115 3300005289 Ga0065704_10001806 Ga0065704_100018068 82
116 3300005289 Ga0065704_10088093 Ga0065704_100880933 82
117 3300005289 Ga0065704_10263838 Ga0065704_102638381 82
118 3300005295 Ga0065707_10148430 Ga0065707_101484303 82
119 3300005327 Ga0070658_10181797 Ga0070658_101817973 82
120 3300005328 Ga0070676_11259825 Ga0070676_112598251 82
121 3300005329 Ga0070683_101061898 Ga0070683_1010618982 82
122 3300005331 Ga0070670_100028217 Ga0070670_1000282173 82
123 3300005331 Ga0070670_100239903 Ga0070670_1002399033 82
124 3300005335 Ga0070666_10001750 Ga0070666_1000175010 82
125 3300005339 Ga0070660_101522066 Ga0070660_1015220661 82
126 3300005344 Ga0070661_100109613 Ga0070661_1001096134 82
127 3300005347 Ga0070668_100000460 Ga0070668_10000046011 82
128 3300005347 Ga0070668_100013970 Ga0070668_1000139704 82
129 3300005347 Ga0070668_100481846 Ga0070668_1004818462 82
130 3300005347 Ga0070668_101111384 Ga0070668_1011113842 82
131 3300005347 Ga0070668_101262289 Ga0070668_1012622892 82
132 3300005353 Ga0070669_100004662 Ga0070669_1000046628 82
133 3300005353 Ga0070669_100068008 Ga0070669_1000680083 82
134 3300005353 Ga0070669_100481504 Ga0070669_1004815042 82
135 3300005355 Ga0070671_100026426 Ga0070671_1000264266 82
136 3300005366 Ga0070659_100039830 Ga0070659_1000398306 82
137 3300005366 Ga0070659_100053840 Ga0070659_1000538403 82
138 3300005367 Ga0070667_100000286 Ga0070667_10000028620 82
139 3300005440 Ga0070705_101282588 Ga0070705_1012825881 82
140 3300005444 Ga0070694_100864873 Ga0070694_1008648732 82
141 3300005455 Ga0070663_100139611 Ga0070663_1001396114 82
142 3300005467 Ga0070706_100854974 Ga0070706_1008549741 82
143 3300005467 Ga0070706_101651486 Ga0070706_1016514861 82
144 3300005468 Ga0070707_100197763 Ga0070707_1001977632 82
145 3300005471 Ga0070698_100057955 Ga0070698_1000579552 82
146 3300005545 Ga0070695_101106142 Ga0070695_1011061421 82
147 3300005546 Ga0070696_100016374 Ga0070696_1000163741 82
148 3300005548 Ga0070665_100003281 Ga0070665_10000328118 82
149 3300005548 Ga0070665_101025369 Ga0070665_1010253692 82
150 3300005549 Ga0070704_101298822 Ga0070704_1012988222 82
151 3300005563 Ga0068855_100028542 Ga0068855_1000285424 82
152 3300005563 Ga0068855_101608813 Ga0068855_1016088131 82
153 3300005564 Ga0070664_100030751 Ga0070664_1000307515 82
154 3300005577 Ga0068857_100121556 Ga0068857_1001215564 82
155 3300005614 Ga0068856_100006103 Ga0068856_1000061031 82
156 3300005618 Ga0068864_100101905 Ga0068864_1001019053 82
157 3300005841 Ga0068863_100000168 Ga0068863_10000016836 82
158 3300005843 Ga0068860_100025815 Ga0068860_1000258157 82
159 3300005843 Ga0068860_100176437 Ga0068860_1001764371 82
160 3300006844 Ga0075428_102220881 Ga0075428_1022208811 82
161 3300006847 Ga0075431_100009192 Ga0075431_1000091925 82
162 3300006880 Ga0075429_100821512 Ga0075429_1008215122 82
163 3300006880 Ga0075429_101527745 Ga0075429_1015277452 82
164 3300009093 Ga0105240_10105419 Ga0105240_101054193 82
165 3300009094 Ga0111539_10226322 Ga0111539_102263221 82
166 3300009174 Ga0105241_10001628 Ga0105241_1000162815 82
167 3300009545 Ga0105237_10016667 Ga0105237_100166674 82
168 3300009551 Ga0105238_10273381 Ga0105238_102733813 82
169 3300009553 Ga0105249_10061210 Ga0105249_100612105 82
170 3300009553 Ga0105249_11123273 Ga0105249_111232732 82
171 3300009978 Ga0105148_100020 Ga0105148_10002011 82
172 3300010375 Ga0105239_10090913 Ga0105239_100909136 82
173 3300010375 Ga0105239_10117318 Ga0105239_101173183 82
174 3300010375 Ga0105239_10160219 Ga0105239_101602192 82
175 3300013100 Ga0157373_10064081 Ga0157373_100640814 82
176 3300013102 Ga0157371_10088817 Ga0157371_100888172 82
177 3300013104 Ga0157370_10085421 Ga0157370_100854214 82
178 3300013105 Ga0157369_10038912 Ga0157369_100389124 82
179 3300013307 Ga0157372_10106546 Ga0157372_101065463 82
180 3300014326 Ga0157380_10069618 Ga0157380_100696182 82
181 3300014326 Ga0157380_10410514 Ga0157380_104105142 82
182 3300017792 Ga0163161_10013470 Ga0163161_100134704 82
183 3300020070 Ga0206356_11610434 Ga0206356_116104343 82
184 3300020076 Ga0206355_1457572 Ga0206355_14575722 82
185 3300020078 Ga0206352_10030070 Ga0206352_100300702 82
186 3300020082 Ga0206353_11844162 Ga0206353_118441624 82
187 3300022467 Ga0224712_10563422 Ga0224712_105634221 82
188 3300025229 Ga0209147_100422 Ga0209147_10042214 82
189 3300025321 Ga0207656_10227708 Ga0207656_102277082 82
190 3300025903 Ga0207680_10012356 Ga0207680_100123563 82
191 3300025904 Ga0207647_10006880 Ga0207647_100068808 82
192 3300025907 Ga0207645_10463322 Ga0207645_104633222 82
193 3300025909 Ga0207705_10214744 Ga0207705_102147443 82
194 3300025910 Ga0207684_11421547 Ga0207684_114215471 82
195 3300025911 Ga0207654_10016757 Ga0207654_100167574 82
196 3300025913 Ga0207695_10070089 Ga0207695_100700894 82
197 3300025914 Ga0207671_10107104 Ga0207671_101071043 82
198 3300025919 Ga0207657_10020932 Ga0207657_100209325 82
199 3300025920 Ga0207649_10492398 Ga0207649_104923982 82
200 3300025923 Ga0207681_10019692 Ga0207681_100196923 82
201 3300025923 Ga0207681_10036351 Ga0207681_100363513 82
202 3300025923 Ga0207681_10071528 Ga0207681_100715282 82
203 3300025924 Ga0207694_10058269 Ga0207694_100582692 82
204 3300025925 Ga0207650_10018590 Ga0207650_100185903 82
205 3300025925 Ga0207650_10203994 Ga0207650_102039942 82
206 3300025931 Ga0207644_10109784 Ga0207644_101097842 82
207 3300025932 Ga0207690_10200195 Ga0207690_102001953 82
208 3300025932 Ga0207690_10537175 Ga0207690_105371752 82
209 3300025933 Ga0207706_10005112 Ga0207706_100051124 82
210 3300025945 Ga0207679_10413999 Ga0207679_104139992 82
211 3300025949 Ga0207667_10597412 Ga0207667_105974123 82
212 3300025949 Ga0207667_11472856 Ga0207667_114728562 82
213 3300025961 Ga0207712_10212028 Ga0207712_102120283 82
214 3300025972 Ga0207668_10000430 Ga0207668_1000043017 82
215 3300025972 Ga0207668_10292187 Ga0207668_102921873 82
216 3300025972 Ga0207668_11611722 Ga0207668_116117222 82
217 3300025972 Ga0207668_11643110 Ga0207668_116431101 82
218 3300025972 Ga0207668_11922032 Ga0207668_119220321 82
219 3300025981 Ga0207640_10099519 Ga0207640_100995192 82
220 3300025986 Ga0207658_10000243 Ga0207658_1000024350 82
221 3300026041 Ga0207639_10014460 Ga0207639_100144606 82
222 3300026067 Ga0207678_10000773 Ga0207678_1000077310 82
223 3300026078 Ga0207702_10012453 Ga0207702_100124531 82
224 3300026088 Ga0207641_10000241 Ga0207641_1000024141 82
225 3300026095 Ga0207676_10118267 Ga0207676_101182673 82
226 3300026116 Ga0207674_10005038 Ga0207674_100050389 82
227 3300026142 Ga0207698_10018892 Ga0207698_100188924 82
228 3300028379 Ga0268266_10133236 Ga0268266_101332363 82
229 3300028379 Ga0268266_10921217 Ga0268266_109212172 82
230 3300028380 Ga0268265_10026242 Ga0268265_100262424 82
231 3300028381 Ga0268264_10052641 Ga0268264_100526414 82
232 3300031548 Ga0307408_100003838 Ga0307408_1000038382 82
233 3300031548 Ga0307408_101381152 Ga0307408_1013811522 82
234 3300031731 Ga0307405_10050959 Ga0307405_100509591 82
235 3300031731 Ga0307405_10640780 Ga0307405_106407801 82
236 3300031824 Ga0307413_10191989 Ga0307413_101919894 82
237 3300031852 Ga0307410_10095015 Ga0307410_100950153 82
238 3300031901 Ga0307406_10607487 Ga0307406_106074873 82
239 3300031903 Ga0307407_10215834 Ga0307407_102158343 82
240 3300031911 Ga0307412_10164020 Ga0307412_101640201 82
241 3300031911 Ga0307412_10333369 Ga0307412_103333693 82
242 3300031911 Ga0307412_10696297 Ga0307412_106962972 82
243 3300031995 Ga0307409_100276468 Ga0307409_1002764682 82
244 3300032002 Ga0307416_100180129 Ga0307416_1001801294 82
245 3300032002 Ga0307416_102119016 Ga0307416_1021190162 82
246 3300032004 Ga0307414_10032478 Ga0307414_100324784 82
247 3300032005 Ga0307411_10066342 Ga0307411_100663422 82
248 3300032005 Ga0307411_10475390 Ga0307411_104753902 82
249 3300032126 Ga0307415_100655277 Ga0307415_1006552772 82
250 3300042127 Ga0450890_054408 Ga0450890_054408_109_369 82
251 3300046471 Ga0495650_0001552 Ga0495650_0001552_6539_6793 82
252 3300046513 Ga0495616_0000022 Ga0495616_0000022_114567_114821 82
253 3300046616 Ga0495668_0267227 Ga0495668_0267227_666_920 82
254 3300046648 Ga0495611_0237212 Ga0495611_0237212_125_379 82
255 3300046691 Ga0495670_0709782 Ga0495670_0709782_186_440 82
256 3300048907 Ga0496104_0457463 Ga0496104_0457463_100_354 82
257 3300048911 Ga0496108_0001104 Ga0496108_0001104_7795_8049 82
258 3300048911 Ga0496108_0261640 Ga0496108_0261640_719_973 82
259 3300048913 Ga0496110_0007418 Ga0496110_0007418_8282_8536 82
260 3300048913 Ga0496110_0047911 Ga0496110_0047911_38_292 82
261 3300048914 Ga0496111_0040721 Ga0496111_0040721_2956_3210 82
262 3300048914 Ga0496111_0134502 Ga0496111_0134502_903_1157 82
263 3300048916 Ga0496113_0040728 Ga0496113_0040728_1061_1315 82
264 3300048916 Ga0496113_1309919 Ga0496113_1309919_299_553 82
265 3300048919 Ga0496116_0122931 Ga0496116_0122931_354_608 82
266 3300048921 Ga0496118_0148557 Ga0496118_0148557_1142_1396 82
267 3300048924 Ga0496121_0003542 Ga0496121_0003542_16309_16563 82
268 3300048925 Ga0496122_0033601 Ga0496122_0033601_63_317 82
269 3300048926 Ga0496123_0054939 Ga0496123_0054939_1236_1490 82
270 3300048926 Ga0496123_0281226 Ga0496123_0281226_119_373 82
271 3300048927 Ga0496124_0239946 Ga0496124_0239946_454_708 82
272 3300048928 Ga0496125_0009457 Ga0496125_0009457_8371_8625 82
273 3300048928 Ga0496125_0011195 Ga0496125_0011195_953_1207 82
274 3300048928 Ga0496125_0034476 Ga0496125_0034476_974_1228 82
275 3300048928 Ga0496125_0135923 Ga0496125_0135923_798_1055 82
276 3300048929 Ga0496126_0293834 Ga0496126_0293834_98_352 82
277 3300048929 Ga0496126_0542085 Ga0496126_0542085_93_347 82
278 3300049523 Ga0501300_055668 Ga0501300_055668_288_542 82
279 3300049551 Ga0501335_004083 Ga0501335_004083_225_479 82
280 3300049571 Ga0501034_0052605 Ga0501034_0052605_731_1009 82
281 3300049581 Ga0501047_0460255 Ga0501047_0460255_804_1082 82
282 3300049585 Ga0501069_0005700 Ga0501069_0005700_1816_2094 82
283 3300049586 Ga0501070_0034219 Ga0501070_0034219_3106_3384 82
284 3300049587 Ga0501071_0762292 Ga0501071_0762292_410_688 82
285 3300049653 Ga0501206_054051 Ga0501206_054051_108_362 82
286 3300049658 Ga0501211_000604 Ga0501211_000604_222_476 82
287 3300049663 Ga0501223_000008 Ga0501223_000008_17085_17339 82
288 3300049669 Ga0501235_012074 Ga0501235_012074_870_1124 82
289 3300049670 Ga0501236_005683 Ga0501236_005683_532_786 82
290 3300049676 Ga0501246_011106 Ga0501246_011106_13_267 82
291 3300049685 Ga0501256_001336 Ga0501256_001336_890_1144 82
292 3300049705 Ga0501225_0002035 Ga0501225_0002035_1966_2220 82
293 3300049705 Ga0501225_0005303 Ga0501225_0005303_453_707 82
294 3300049705 Ga0501225_0052085 Ga0501225_0052085_50_304 82
295 3300049761 Ga0501264_007196 Ga0501264_007196_605_859 82
296 3300050507 nmdc:mga05p37_152982_c1 nmdc:mga05p37_152982_c1_153_407 82
297 3300050508 nmdc:mga09592_1220239_c1 nmdc:mga09592_1220239_c1_28_282 82
298 3300050510 nmdc:mga06r32_19835_c1 nmdc:mga06r32_19835_c1_33_287 82
299 3300050511 nmdc:mga08y16_402669_c2 nmdc:mga08y16_402669_c2_96_362 82
300 3300053087 Ga0500643_002080 Ga0500643_002080_6278_6532 82
301 3300053151 Ga0500604_0002288 Ga0500604_0002288_3277_3531 82
302 3300055283 Ga0500661_001498 Ga0500661_001498_2521_2775 82
303 2162886007 SwRhRL2b_contig_2608932 SwRhRL2b_0237.00000510 83
304 3300000041 ARcpr5oldR_c005890 ARcpr5oldR_0058902 83
305 3300001904 JGI24736J21556_1000084 JGI24736J21556_100008410 83
306 3300001915 JGI24741J21665_1022120 JGI24741J21665_10221201 83
307 3300001979 JGI24740J21852_10010401 JGI24740J21852_100104013 83
308 3300001989 JGI24739J22299_10058466 JGI24739J22299_100584662 83
309 3300002067 JGI24735J21928_10009527 JGI24735J21928_100095273 83
310 3300002067 JGI24735J21928_10106397 JGI24735J21928_101063972 83
311 3300002075 JGI24738J21930_10000403 JGI24738J21930_1000040312 83
312 3300002076 JGI24749J21850_1000277 JGI24749J21850_10002775 83
313 3300002459 JGI24751J29686_10001694 JGI24751J29686_100016944 83
314 3300002774 JGI25150J39212_1000098 JGI25150J39212_100009811 83
315 3300002774 JGI25150J39212_1032474 JGI25150J39212_10324741 83
316 3300003187 JGI25151J46595_10031054 JGI25151J46595_100310541 83
317 3300003215 JGI25153J46596_10000055 JGI25153J46596_10000055125 83
318 3300003215 JGI25153J46596_10002938 JGI25153J46596_100029389 83
319 3300003215 JGI25153J46596_10065997 JGI25153J46596_100659972 83
320 3300003316 rootH1_10016789 rootH1_100167892 83
321 3300003771 Ga0055526_1003146 Ga0055526_10031461 83
322 3300003771 Ga0055526_1103262 Ga0055526_11032621 83
323 3300003773 Ga0055537_1001198 Ga0055537_10011989 83
324 3300003773 Ga0055537_1001216 Ga0055537_10012164 83
325 3300003775 Ga0055524_1000670 Ga0055524_100067018 83
326 3300003781 Ga0055536_1005408 Ga0055536_10054085 83
327 3300003790 Ga0055528_1024786 Ga0055528_10247864 83
328 3300003791 Ga0055530_10000224 Ga0055530_100002245 83
329 3300003791 Ga0055530_10010144 Ga0055530_100101444 83
330 3300003791 Ga0055530_10015555 Ga0055530_100155551 83
331 3300003792 Ga0055540_1001240 Ga0055540_100124012 83
332 3300003794 Ga0055531_10000094 Ga0055531_1000009447 83
333 3300003794 Ga0055531_10003913 Ga0055531_100039134 83
334 3300003794 Ga0055531_10072924 Ga0055531_100729241 83
335 3300003856 Ga0058692_1000081 Ga0058692_100008150 83
336 3300003911 JGI25405J52794_10000298 JGI25405J52794_100002982 83
337 3300004625 Ga0055543_1019776 Ga0055543_10197762 83
338 3300004798 Ga0058859_11742863 Ga0058859_117428631 83
339 3300004798 Ga0058859_11747837 Ga0058859_117478371 83
340 3300004798 Ga0058859_11789015 Ga0058859_117890152 83
341 3300004798 Ga0058859_11834298 Ga0058859_118342981 83
342 3300004801 Ga0058860_11386381 Ga0058860_113863811 83
343 3300004801 Ga0058860_11409702 Ga0058860_114097022 83
344 3300004801 Ga0058860_12029252 Ga0058860_120292521 83
345 3300004801 Ga0058860_12099451 Ga0058860_120994512 83
346 3300005262 Ga0065165_1007915 Ga0065165_10079151 83
347 3300005262 Ga0065165_1023907 Ga0065165_10239073 83
348 3300005262 Ga0065165_1036540 Ga0065165_10365403 83
349 3300005262 Ga0065165_1055259 Ga0065165_10552591 83
350 3300005289 Ga0065704_10078390 Ga0065704_100783902 83
351 3300005289 Ga0065704_10115293 Ga0065704_101152933 83
352 3300005289 Ga0065704_10158200 Ga0065704_101582003 83
353 3300005289 Ga0065704_10196152 Ga0065704_101961522 83
354 3300005290 Ga0065712_10747402 Ga0065712_107474021 83
355 3300005293 Ga0065715_10811313 Ga0065715_108113131 83
356 3300005295 Ga0065707_10110051 Ga0065707_101100513 83
357 3300005295 Ga0065707_10129579 Ga0065707_101295792 83
358 3300005295 Ga0065707_10182128 Ga0065707_101821282 83
359 3300005327 Ga0070658_10020553 Ga0070658_100205532 83
360 3300005327 Ga0070658_10372339 Ga0070658_103723392 83
361 3300005327 Ga0070658_10469790 Ga0070658_104697901 83
362 3300005328 Ga0070676_10130746 Ga0070676_101307463 83
363 3300005329 Ga0070683_100526620 Ga0070683_1005266202 83
364 3300005329 Ga0070683_100817410 Ga0070683_1008174101 83
365 3300005329 Ga0070683_100911697 Ga0070683_1009116972 83
366 3300005329 Ga0070683_102387100 Ga0070683_1023871001 83
367 3300005330 Ga0070690_100359067 Ga0070690_1003590672 83
368 3300005331 Ga0070670_100003557 Ga0070670_10000355710 83
369 3300005331 Ga0070670_100073086 Ga0070670_1000730864 83
370 3300005331 Ga0070670_100286094 Ga0070670_1002860941 83
371 3300005331 Ga0070670_100351750 Ga0070670_1003517502 83
372 3300005331 Ga0070670_101468915 Ga0070670_1014689152 83
373 3300005333 Ga0070677_10054194 Ga0070677_100541941 83
374 3300005333 Ga0070677_10196083 Ga0070677_101960831 83
375 3300005333 Ga0070677_10281992 Ga0070677_102819922 83
376 3300005333 Ga0070677_10630391 Ga0070677_106303911 83
377 3300005333 Ga0070677_10901815 Ga0070677_109018151 83
378 3300005334 Ga0068869_100037537 Ga0068869_1000375374 83
379 3300005334 Ga0068869_100073646 Ga0068869_1000736462 83
380 3300005334 Ga0068869_100376476 Ga0068869_1003764762 83
381 3300005334 Ga0068869_100991230 Ga0068869_1009912302 83
382 3300005334 Ga0068869_101530063 Ga0068869_1015300632 83
383 3300005336 Ga0070680_100077391 Ga0070680_1000773915 83
384 3300005337 Ga0070682_100031832 Ga0070682_1000318324 83
385 3300005337 Ga0070682_100143279 Ga0070682_1001432792 83
386 3300005337 Ga0070682_101349023 Ga0070682_1013490231 83
387 3300005338 Ga0068868_100220568 Ga0068868_1002205681 83
388 3300005338 Ga0068868_100833135 Ga0068868_1008331351 83
389 3300005338 Ga0068868_101079721 Ga0068868_1010797212 83
390 3300005339 Ga0070660_100170249 Ga0070660_1001702491 83
391 3300005339 Ga0070660_100207702 Ga0070660_1002077022 83
392 3300005339 Ga0070660_101165079 Ga0070660_1011650792 83
393 3300005340 Ga0070689_100008543 Ga0070689_1000085431 83
394 3300005340 Ga0070689_100128753 Ga0070689_1001287533 83
395 3300005340 Ga0070689_100173512 Ga0070689_1001735122 83
396 3300005343 Ga0070687_100250993 Ga0070687_1002509931 83
397 3300005344 Ga0070661_100090999 Ga0070661_1000909992 83
398 3300005344 Ga0070661_100151526 Ga0070661_1001515261 83
399 3300005344 Ga0070661_100240982 Ga0070661_1002409822 83
400 3300005344 Ga0070661_101108681 Ga0070661_1011086811 83
401 3300005345 Ga0070692_10112290 Ga0070692_101122902 83
402 3300005347 Ga0070668_100075344 Ga0070668_1000753443 83
403 3300005347 Ga0070668_100330696 Ga0070668_1003306961 83
404 3300005347 Ga0070668_100615799 Ga0070668_1006157991 83
405 3300005347 Ga0070668_100933638 Ga0070668_1009336382 83
406 3300005353 Ga0070669_100000059 Ga0070669_10000005965 83
407 3300005353 Ga0070669_100011016 Ga0070669_1000110165 83
408 3300005353 Ga0070669_100129070 Ga0070669_1001290702 83
409 3300005353 Ga0070669_101169273 Ga0070669_1011692732 83
410 3300005353 Ga0070669_101199073 Ga0070669_1011990731 83
411 3300005354 Ga0070675_100086771 Ga0070675_1000867712 83
412 3300005354 Ga0070675_100370234 Ga0070675_1003702342 83
413 3300005354 Ga0070675_100882501 Ga0070675_1008825012 83
414 3300005354 Ga0070675_102116517 Ga0070675_1021165171 83
415 3300005355 Ga0070671_100246960 Ga0070671_1002469603 83
416 3300005355 Ga0070671_101912747 Ga0070671_1019127472 83
417 3300005356 Ga0070674_100301647 Ga0070674_1003016472 83
418 3300005356 Ga0070674_100826861 Ga0070674_1008268612 83
419 3300005356 Ga0070674_101361348 Ga0070674_1013613481 83
420 3300005364 Ga0070673_100552155 Ga0070673_1005521552 83
421 3300005364 Ga0070673_100586025 Ga0070673_1005860251 83
422 3300005364 Ga0070673_101267500 Ga0070673_1012675002 83
423 3300005365 Ga0070688_100000464 Ga0070688_10000046412 83
424 3300005365 Ga0070688_100024154 Ga0070688_1000241545 83
425 3300005365 Ga0070688_101082925 Ga0070688_1010829251 83
426 3300005365 Ga0070688_101352834 Ga0070688_1013528341 83
427 3300005366 Ga0070659_100094268 Ga0070659_1000942682 83
428 3300005366 Ga0070659_100379626 Ga0070659_1003796262 83
429 3300005366 Ga0070659_100814640 Ga0070659_1008146402 83
430 3300005367 Ga0070667_100000076 Ga0070667_10000007615 83
431 3300005367 Ga0070667_100556960 Ga0070667_1005569601 83
432 3300005367 Ga0070667_100804253 Ga0070667_1008042531 83
433 3300005437 Ga0070710_10222220 Ga0070710_102222202 83
434 3300005438 Ga0070701_10407954 Ga0070701_104079542 83
435 3300005441 Ga0070700_100090960 Ga0070700_1000909603 83
436 3300005441 Ga0070700_100136197 Ga0070700_1001361971 83
437 3300005441 Ga0070700_100217322 Ga0070700_1002173222 83
438 3300005444 Ga0070694_100597749 Ga0070694_1005977492 83
439 3300005444 Ga0070694_100613612 Ga0070694_1006136121 83
440 3300005444 Ga0070694_100790832 Ga0070694_1007908322 83
441 3300005455 Ga0070663_100276632 Ga0070663_1002766322 83
442 3300005455 Ga0070663_101073362 Ga0070663_1010733622 83
443 3300005455 Ga0070663_101867308 Ga0070663_1018673081 83
444 3300005456 Ga0070678_101473560 Ga0070678_1014735601 83
445 3300005456 Ga0070678_101515059 Ga0070678_1015150591 83
446 3300005457 Ga0070662_100002034 Ga0070662_1000020345 83
447 3300005457 Ga0070662_100125479 Ga0070662_1001254792 83
448 3300005457 Ga0070662_100428595 Ga0070662_1004285952 83
449 3300005457 Ga0070662_100784756 Ga0070662_1007847562 83
450 3300005458 Ga0070681_10401588 Ga0070681_104015882 83
451 3300005458 Ga0070681_10651945 Ga0070681_106519451 83
452 3300005458 Ga0070681_11224404 Ga0070681_112244041 83
453 3300005459 Ga0068867_100137840 Ga0068867_1001378402 83
454 3300005459 Ga0068867_101631799 Ga0068867_1016317992 83
455 3300005459 Ga0068867_102143574 Ga0068867_1021435741 83
456 3300005466 Ga0070685_10000247 Ga0070685_1000024717 83
457 3300005466 Ga0070685_10170446 Ga0070685_101704462 83
458 3300005466 Ga0070685_10673582 Ga0070685_106735822 83
459 3300005467 Ga0070706_101900657 Ga0070706_1019006572 83
460 3300005468 Ga0070707_100668794 Ga0070707_1006687942 83
461 3300005468 Ga0070707_101498227 Ga0070707_1014982271 83
462 3300005518 Ga0070699_100488216 Ga0070699_1004882162 83
463 3300005530 Ga0070679_100164449 Ga0070679_1001644493 83
464 3300005535 Ga0070684_101061917 Ga0070684_1010619172 83
465 3300005535 Ga0070684_101343794 Ga0070684_1013437941 83
466 3300005535 Ga0070684_101685781 Ga0070684_1016857812 83
467 3300005536 Ga0070697_101122962 Ga0070697_1011229622 83
468 3300005539 Ga0068853_100681801 Ga0068853_1006818012 83
469 3300005539 Ga0068853_101549709 Ga0068853_1015497092 83
470 3300005539 Ga0068853_102430794 Ga0068853_1024307942 83
471 3300005543 Ga0070672_100003882 Ga0070672_1000038823 83
472 3300005543 Ga0070672_100013080 Ga0070672_1000130802 83
473 3300005543 Ga0070672_100428434 Ga0070672_1004284342 83
474 3300005543 Ga0070672_100443636 Ga0070672_1004436362 83
475 3300005543 Ga0070672_100585006 Ga0070672_1005850062 83
476 3300005544 Ga0070686_100036559 Ga0070686_1000365596 83
477 3300005544 Ga0070686_100060268 Ga0070686_1000602683 83
478 3300005545 Ga0070695_100659325 Ga0070695_1006593252 83
479 3300005546 Ga0070696_100036845 Ga0070696_1000368453 83
480 3300005546 Ga0070696_100277159 Ga0070696_1002771591 83
481 3300005546 Ga0070696_100391765 Ga0070696_1003917652 83
482 3300005548 Ga0070665_100000217 Ga0070665_10000021750 83
483 3300005548 Ga0070665_100004044 Ga0070665_1000040442 83
484 3300005548 Ga0070665_100169050 Ga0070665_1001690503 83
485 3300005548 Ga0070665_100420202 Ga0070665_1004202023 83
486 3300005548 Ga0070665_100714477 Ga0070665_1007144772 83
487 3300005549 Ga0070704_100604210 Ga0070704_1006042102 83
488 3300005549 Ga0070704_100858386 Ga0070704_1008583861 83
489 3300005549 Ga0070704_101057917 Ga0070704_1010579171 83
490 3300005563 Ga0068855_100003860 Ga0068855_10000386018 83
491 3300005563 Ga0068855_100233241 Ga0068855_1002332411 83
492 3300005563 Ga0068855_101162278 Ga0068855_1011622782 83
493 3300005563 Ga0068855_102057311 Ga0068855_1020573112 83
494 3300005564 Ga0070664_100145004 Ga0070664_1001450042 83
495 3300005564 Ga0070664_100568299 Ga0070664_1005682993 83
496 3300005564 Ga0070664_100757420 Ga0070664_1007574202 83
497 3300005564 Ga0070664_101386209 Ga0070664_1013862092 83
498 3300005577 Ga0068857_100049380 Ga0068857_1000493802 83
499 3300005577 Ga0068857_100100906 Ga0068857_1001009062 83
500 3300005577 Ga0068857_100238588 Ga0068857_1002385882 83
501 3300005577 Ga0068857_100297759 Ga0068857_1002977593 83
502 3300005577 Ga0068857_100528141 Ga0068857_1005281412 83
503 3300005577 Ga0068857_101021994 Ga0068857_1010219942 83
504 3300005577 Ga0068857_101072340 Ga0068857_1010723402 83
505 3300005578 Ga0068854_100003887 Ga0068854_10000388710 83
506 3300005578 Ga0068854_100345797 Ga0068854_1003457972 83
507 3300005578 Ga0068854_101131083 Ga0068854_1011310832 83
508 3300005614 Ga0068856_100256786 Ga0068856_1002567863 83
509 3300005614 Ga0068856_100726103 Ga0068856_1007261032 83
510 3300005614 Ga0068856_101552463 Ga0068856_1015524631 83
511 3300005615 Ga0070702_100501202 Ga0070702_1005012022 83
512 3300005616 Ga0068852_100357541 Ga0068852_1003575412 83
513 3300005616 Ga0068852_100703913 Ga0068852_1007039132 83
514 3300005616 Ga0068852_100763496 Ga0068852_1007634962 83
515 3300005616 Ga0068852_101834674 Ga0068852_1018346741 83
516 3300005617 Ga0068859_100000937 Ga0068859_10000093722 83
517 3300005617 Ga0068859_100158476 Ga0068859_1001584763 83
518 3300005617 Ga0068859_100771262 Ga0068859_1007712622 83
519 3300005617 Ga0068859_102191608 Ga0068859_1021916081 83
520 3300005618 Ga0068864_100255330 Ga0068864_1002553303 83
521 3300005618 Ga0068864_100769951 Ga0068864_1007699511 83
522 3300005618 Ga0068864_101623756 Ga0068864_1016237561 83
523 3300005718 Ga0068866_10066946 Ga0068866_100669463 83
524 3300005718 Ga0068866_10444519 Ga0068866_104445191 83
525 3300005718 Ga0068866_10779257 Ga0068866_107792572 83
526 3300005719 Ga0068861_100001013 Ga0068861_1000010135 83
527 3300005719 Ga0068861_100001319 Ga0068861_1000013195 83
528 3300005719 Ga0068861_100030478 Ga0068861_1000304781 83
529 3300005719 Ga0068861_100314475 Ga0068861_1003144752 83
530 3300005719 Ga0068861_100749861 Ga0068861_1007498612 83
531 3300005719 Ga0068861_100805982 Ga0068861_1008059821 83
532 3300005719 Ga0068861_101034372 Ga0068861_1010343722 83
533 3300005834 Ga0068851_10066729 Ga0068851_100667292 83
534 3300005834 Ga0068851_10373581 Ga0068851_103735811 83
535 3300005834 Ga0068851_10394696 Ga0068851_103946961 83
536 3300005840 Ga0068870_10032554 Ga0068870_100325544 83
537 3300005840 Ga0068870_10105888 Ga0068870_101058881 83
538 3300005841 Ga0068863_100007022 Ga0068863_1000070229 83
539 3300005841 Ga0068863_100192390 Ga0068863_1001923904 83
540 3300005841 Ga0068863_100263679 Ga0068863_1002636792 83
541 3300005841 Ga0068863_100308978 Ga0068863_1003089783 83
542 3300005841 Ga0068863_100739573 Ga0068863_1007395732 83
543 3300005841 Ga0068863_100847616 Ga0068863_1008476162 83
544 3300005841 Ga0068863_102696448 Ga0068863_1026964482 83
545 3300005842 Ga0068858_100002534 Ga0068858_10000253423 83
546 3300005842 Ga0068858_100474219 Ga0068858_1004742192 83
547 3300005842 Ga0068858_100764069 Ga0068858_1007640692 83
548 3300005842 Ga0068858_101020675 Ga0068858_1010206752 83
549 3300005843 Ga0068860_100000131 Ga0068860_10000013191 83
550 3300005843 Ga0068860_100002475 Ga0068860_10000247515 83
551 3300005843 Ga0068860_100310203 Ga0068860_1003102033 83
552 3300005843 Ga0068860_100646094 Ga0068860_1006460942 83
553 3300005843 Ga0068860_102688113 Ga0068860_1026881132 83
554 3300005844 Ga0068862_100006832 Ga0068862_1000068325 83
555 3300005844 Ga0068862_100021336 Ga0068862_1000213368 83
556 3300005844 Ga0068862_101185256 Ga0068862_1011852562 83
557 3300005844 Ga0068862_102710344 Ga0068862_1027103441 83
558 3300006038 Ga0075365_11127366 Ga0075365_111273662 83
559 3300006048 Ga0075363_100097265 Ga0075363_1000972654 83
560 3300006058 Ga0075432_10058225 Ga0075432_100582252 83
561 3300006058 Ga0075432_10398390 Ga0075432_103983901 83
562 3300006177 Ga0075362_10000003 Ga0075362_10000003131 83
563 3300006186 Ga0075369_10006096 Ga0075369_100060965 83
564 3300006195 Ga0075366_10000006 Ga0075366_1000000641 83
565 3300006195 Ga0075366_10004410 Ga0075366_100044107 83
566 3300006195 Ga0075366_10009043 Ga0075366_100090436 83
567 3300006195 Ga0075366_10159049 Ga0075366_101590491 83
568 3300006195 Ga0075366_10404635 Ga0075366_104046352 83
569 3300006195 Ga0075366_10844270 Ga0075366_108442701 83
570 3300006195 Ga0075366_11077605 Ga0075366_110776051 83
571 3300006237 Ga0097621_100012982 Ga0097621_1000129828 83
572 3300006237 Ga0097621_100108950 Ga0097621_1001089502 83
573 3300006237 Ga0097621_100443070 Ga0097621_1004430703 83
574 3300006237 Ga0097621_100536177 Ga0097621_1005361772 83
575 3300006353 Ga0075370_10000008 Ga0075370_1000000852 83
576 3300006358 Ga0068871_100021925 Ga0068871_1000219259 83
577 3300006358 Ga0068871_100081486 Ga0068871_1000814863 83
578 3300006358 Ga0068871_100195049 Ga0068871_1001950492 83
579 3300006358 Ga0068871_101648311 Ga0068871_1016483111 83
580 3300006844 Ga0075428_100024545 Ga0075428_1000245456 83
581 3300006844 Ga0075428_100048029 Ga0075428_1000480293 83
582 3300006844 Ga0075428_100363049 Ga0075428_1003630492 83
583 3300006844 Ga0075428_100557585 Ga0075428_1005575852 83
584 3300006844 Ga0075428_102091665 Ga0075428_1020916651 83
585 3300006846 Ga0075430_100028496 Ga0075430_1000284965 83
586 3300006846 Ga0075430_100230052 Ga0075430_1002300522 83
587 3300006846 Ga0075430_100267734 Ga0075430_1002677343 83
588 3300006846 Ga0075430_100517176 Ga0075430_1005171762 83
589 3300006846 Ga0075430_100661347 Ga0075430_1006613472 83
590 3300006847 Ga0075431_100004046 Ga0075431_1000040465 83
591 3300006847 Ga0075431_100081587 Ga0075431_1000815872 83
592 3300006847 Ga0075431_100325052 Ga0075431_1003250523 83
593 3300006847 Ga0075431_100441752 Ga0075431_1004417522 83
594 3300006847 Ga0075431_100515661 Ga0075431_1005156612 83
595 3300006847 Ga0075431_100659061 Ga0075431_1006590612 83
596 3300006847 Ga0075431_101525665 Ga0075431_1015256652 83
597 3300006852 Ga0075433_10001740 Ga0075433_100017403 83
598 3300006852 Ga0075433_10026664 Ga0075433_100266644 83
599 3300006852 Ga0075433_10120072 Ga0075433_101200723 83
600 3300006852 Ga0075433_11756301 Ga0075433_117563012 83
601 3300006871 Ga0075434_100469506 Ga0075434_1004695062 83
602 3300006871 Ga0075434_100631572 Ga0075434_1006315721 83
603 3300006880 Ga0075429_100066252 Ga0075429_1000662522 83
604 3300006880 Ga0075429_100282556 Ga0075429_1002825562 83
605 3300006881 Ga0068865_100192080 Ga0068865_1001920802 83
606 3300006881 Ga0068865_100776754 Ga0068865_1007767541 83
607 3300006881 Ga0068865_100790184 Ga0068865_1007901842 83
608 3300006881 Ga0068865_101295288 Ga0068865_1012952882 83
609 3300006881 Ga0068865_101624523 Ga0068865_1016245232 83
610 3300006931 Ga0097620_100000937 Ga0097620_10000093715 83
611 3300006931 Ga0097620_100158469 Ga0097620_1001584693 83
612 3300006931 Ga0097620_100771242 Ga0097620_1007712422 83
613 3300006931 Ga0097620_102191919 Ga0097620_1021919192 83
614 3300007076 Ga0075435_100704095 Ga0075435_1007040951 83
615 3300007076 Ga0075435_101134671 Ga0075435_1011346711 83
616 3300007076 Ga0075435_101329195 Ga0075435_1013291952 83
617 3300007076 Ga0075435_102013855 Ga0075435_1020138551 83
618 3300009011 Ga0105251_10000008 Ga0105251_1000000880 83
619 3300009093 Ga0105240_10031828 Ga0105240_100318284 83
620 3300009093 Ga0105240_10487802 Ga0105240_104878022 83
621 3300009093 Ga0105240_10964699 Ga0105240_109646991 83
622 3300009093 Ga0105240_11380651 Ga0105240_113806512 83
623 3300009093 Ga0105240_12176803 Ga0105240_121768032 83
624 3300009094 Ga0111539_10043567 Ga0111539_100435674 83
625 3300009094 Ga0111539_10060790 Ga0111539_100607905 83
626 3300009094 Ga0111539_10173166 Ga0111539_101731662 83
627 3300009094 Ga0111539_10344112 Ga0111539_103441122 83
628 3300009094 Ga0111539_11189430 Ga0111539_111894302 83
629 3300009094 Ga0111539_12123566 Ga0111539_121235661 83
630 3300009094 Ga0111539_12387773 Ga0111539_123877731 83
631 3300009101 Ga0105247_10102551 Ga0105247_101025512 83
632 3300009147 Ga0114129_10091923 Ga0114129_100919233 83
633 3300009147 Ga0114129_10823468 Ga0114129_108234683 83
634 3300009147 Ga0114129_11274551 Ga0114129_112745512 83
635 3300009148 Ga0105243_10061151 Ga0105243_100611513 83
636 3300009148 Ga0105243_10702909 Ga0105243_107029092 83
637 3300009148 Ga0105243_11253727 Ga0105243_112537272 83
638 3300009148 Ga0105243_12460235 Ga0105243_124602352 83
639 3300009174 Ga0105241_10144017 Ga0105241_101440173 83
640 3300009174 Ga0105241_10642196 Ga0105241_106421962 83
641 3300009176 Ga0105242_11236447 Ga0105242_112364472 83
642 3300009176 Ga0105242_11635349 Ga0105242_116353491 83
643 3300009177 Ga0105248_10016965 Ga0105248_100169658 83
644 3300009177 Ga0105248_10435177 Ga0105248_104351773 83
645 3300009177 Ga0105248_11747331 Ga0105248_117473311 83
646 3300009545 Ga0105237_10531086 Ga0105237_105310861 83
647 3300009545 Ga0105237_10543583 Ga0105237_105435832 83
648 3300009551 Ga0105238_10151678 Ga0105238_101516782 83
649 3300009551 Ga0105238_11141734 Ga0105238_111417342 83
650 3300009553 Ga0105249_10016789 Ga0105249_100167896 83
651 3300009553 Ga0105249_10579820 Ga0105249_105798202 83
652 3300009553 Ga0105249_10773039 Ga0105249_107730392 83
653 3300010375 Ga0105239_10676300 Ga0105239_106763002 83
654 3300010375 Ga0105239_10973580 Ga0105239_109735802 83
655 3300010375 Ga0105239_13492167 Ga0105239_134921671 83
656 3300011119 Ga0105246_10395339 Ga0105246_103953392 83
657 3300011119 Ga0105246_10482363 Ga0105246_104823632 83
658 3300012475 Ga0157317_1011268 Ga0157317_10112681 83
659 3300012482 Ga0157318_1004150 Ga0157318_10041502 83
660 3300012483 Ga0157337_1033049 Ga0157337_10330491 83
661 3300012485 Ga0157325_1011370 Ga0157325_10113702 83
662 3300012488 Ga0157343_1029663 Ga0157343_10296632 83
663 3300012491 Ga0157329_1010315 Ga0157329_10103152 83
664 3300012498 Ga0157345_1017245 Ga0157345_10172451 83
665 3300012503 Ga0157313_1031199 Ga0157313_10311991 83
666 3300012506 Ga0157324_1016458 Ga0157324_10164581 83
667 3300012506 Ga0157324_1033534 Ga0157324_10335342 83
668 3300012512 Ga0157327_1001313 Ga0157327_10013134 83
669 3300012513 Ga0157326_1056645 Ga0157326_10566452 83
670 3300012515 Ga0157338_1016355 Ga0157338_10163552 83
671 3300013104 Ga0157370_10022193 Ga0157370_100221932 83
672 3300013104 Ga0157370_11406289 Ga0157370_114062891 83
673 3300013105 Ga0157369_10202691 Ga0157369_102026912 83
674 3300013297 Ga0157378_10062716 Ga0157378_100627164 83
675 3300013297 Ga0157378_10461754 Ga0157378_104617542 83
676 3300013306 Ga0163162_10027802 Ga0163162_100278026 83
677 3300013306 Ga0163162_10079660 Ga0163162_100796603 83
678 3300013306 Ga0163162_10268689 Ga0163162_102686893 83
679 3300013306 Ga0163162_11257646 Ga0163162_112576462 83
680 3300013306 Ga0163162_11570973 Ga0163162_115709732 83
681 3300013307 Ga0157372_10810324 Ga0157372_108103242 83
682 3300013308 Ga0157375_10100139 Ga0157375_101001393 83
683 3300013308 Ga0157375_12526301 Ga0157375_125263012 83
684 3300014325 Ga0163163_10011107 Ga0163163_100111072 83
685 3300014325 Ga0163163_10183020 Ga0163163_101830202 83
686 3300014326 Ga0157380_10000094 Ga0157380_100000949 83
687 3300014326 Ga0157380_10000231 Ga0157380_1000023130 83
688 3300014326 Ga0157380_10006104 Ga0157380_100061044 83
689 3300014326 Ga0157380_10482747 Ga0157380_104827472 83
690 3300014326 Ga0157380_11043423 Ga0157380_110434232 83
691 3300014326 Ga0157380_13117482 Ga0157380_131174822 83
692 3300014968 Ga0157379_10148470 Ga0157379_101484703 83
693 3300014968 Ga0157379_12169131 Ga0157379_121691312 83
694 3300014969 Ga0157376_10004537 Ga0157376_100045378 83
695 3300014969 Ga0157376_10128485 Ga0157376_101284852 83
696 3300014969 Ga0157376_10625195 Ga0157376_106251952 83
697 3300014969 Ga0157376_11404345 Ga0157376_114043451 83
698 3300014969 Ga0157376_12456480 Ga0157376_124564802 83
699 3300015261 Ga0182006_1111727 Ga0182006_11117272 83
700 3300015265 Ga0182005_1005698 Ga0182005_10056982 83
701 3300015690 Ga0183363_1007 Ga0183363_100729 83
702 3300016635 Ga0183361_10068 Ga0183361_100685 83
703 3300017792 Ga0163161_10295590 Ga0163161_102955902 83
704 3300017792 Ga0163161_11623367 Ga0163161_116233671 83
705 3300020080 Ga0206350_10854057 Ga0206350_108540571 83
706 3300020082 Ga0206353_10274352 Ga0206353_102743522 83
707 3300021358 Ga0213873_10000021 Ga0213873_1000002190 83
708 3300021384 Ga0213876_10000050 Ga0213876_1000005033 83
709 3300023309 Ga0256744_123496 Ga0256744_1234961 83
710 3300025208 Ga0209436_105263 Ga0209436_1052634 83
711 3300025245 Ga0207425_1000005 Ga0207425_1000005576 83
712 3300025258 Ga0209129_1008702 Ga0209129_10087024 83
713 3300025263 Ga0209565_1000029 Ga0209565_1000029310 83
714 3300025263 Ga0209565_1000052 Ga0209565_100005228 83
715 3300025263 Ga0209565_1018477 Ga0209565_10184772 83
716 3300025273 Ga0209673_1000889 Ga0209673_100088923 83
717 3300025273 Ga0209673_1066750 Ga0209673_10667501 83
718 3300025291 Ga0209675_1015193 Ga0209675_10151932 83
719 3300025292 Ga0209676_1016986 Ga0209676_10169864 83
720 3300025292 Ga0209676_1018694 Ga0209676_10186942 83
721 3300025294 Ga0209025_1000128 Ga0209025_10001286 83
722 3300025295 Ga0209564_1005977 Ga0209564_10059772 83
723 3300025297 Ga0209758_1000002 Ga0209758_1000002768 83
724 3300025297 Ga0209758_1004078 Ga0209758_10040789 83
725 3300025297 Ga0209758_1042906 Ga0209758_10429062 83
726 3300025298 Ga0209050_1000001 Ga0209050_1000001753 83
727 3300025298 Ga0209050_1000071 Ga0209050_1000071225 83
728 3300025298 Ga0209050_1000166 Ga0209050_100016684 83
729 3300025298 Ga0209050_1007906 Ga0209050_10079065 83
730 3300025298 Ga0209050_1032398 Ga0209050_10323983 83
731 3300025298 Ga0209050_1053035 Ga0209050_10530352 83
732 3300025298 Ga0209050_1077000 Ga0209050_10770001 83
733 3300025299 Ga0209256_1000008 Ga0209256_1000008918 83
734 3300025302 Ga0207426_1011881 Ga0207426_10118813 83
735 3300025303 Ga0209051_1001966 Ga0209051_10019666 83
736 3300025304 Ga0209257_1000027 Ga0209257_100002778 83
737 3300025304 Ga0209257_1002317 Ga0209257_10023172 83
738 3300025304 Ga0209257_1005763 Ga0209257_10057638 83
739 3300025304 Ga0209257_1012431 Ga0209257_10124314 83
740 3300025304 Ga0209257_1032794 Ga0209257_10327943 83
741 3300025735 Ga0207713_1000170 Ga0207713_100017051 83
742 3300025893 Ga0207682_10363370 Ga0207682_103633701 83
743 3300025898 Ga0207692_10192324 Ga0207692_101923242 83
744 3300025899 Ga0207642_10224158 Ga0207642_102241583 83
745 3300025899 Ga0207642_10577309 Ga0207642_105773092 83
746 3300025899 Ga0207642_10723090 Ga0207642_107230901 83
747 3300025899 Ga0207642_10991912 Ga0207642_109919122 83
748 3300025903 Ga0207680_10826258 Ga0207680_108262581 83
749 3300025905 Ga0207685_10395253 Ga0207685_103952532 83
750 3300025907 Ga0207645_10111059 Ga0207645_101110593 83
751 3300025908 Ga0207643_10048516 Ga0207643_100485164 83
752 3300025908 Ga0207643_10220695 Ga0207643_102206952 83
753 3300025908 Ga0207643_10348096 Ga0207643_103480962 83
754 3300025908 Ga0207643_11136689 Ga0207643_111366891 83
755 3300025909 Ga0207705_10121191 Ga0207705_101211912 83
756 3300025909 Ga0207705_11064686 Ga0207705_110646862 83
757 3300025910 Ga0207684_10039770 Ga0207684_100397701 83
758 3300025911 Ga0207654_10285572 Ga0207654_102855721 83
759 3300025912 Ga0207707_10350915 Ga0207707_103509153 83
760 3300025913 Ga0207695_10126174 Ga0207695_101261742 83
761 3300025913 Ga0207695_11085915 Ga0207695_110859152 83
762 3300025914 Ga0207671_10008759 Ga0207671_100087597 83
763 3300025914 Ga0207671_10566191 Ga0207671_105661912 83
764 3300025917 Ga0207660_10066673 Ga0207660_100666735 83
765 3300025918 Ga0207662_10187893 Ga0207662_101878932 83
766 3300025918 Ga0207662_10601706 Ga0207662_106017061 83
767 3300025919 Ga0207657_10267108 Ga0207657_102671082 83
768 3300025920 Ga0207649_10580142 Ga0207649_105801422 83
769 3300025922 Ga0207646_10585954 Ga0207646_105859542 83
770 3300025922 Ga0207646_11222917 Ga0207646_112229172 83
771 3300025923 Ga0207681_10010695 Ga0207681_100106957 83
772 3300025923 Ga0207681_10081198 Ga0207681_100811982 83
773 3300025923 Ga0207681_10484851 Ga0207681_104848513 83
774 3300025923 Ga0207681_11871868 Ga0207681_118718681 83
775 3300025924 Ga0207694_10316876 Ga0207694_103168763 83
776 3300025924 Ga0207694_10795760 Ga0207694_107957602 83
777 3300025925 Ga0207650_10000609 Ga0207650_1000060922 83
778 3300025925 Ga0207650_10127839 Ga0207650_101278394 83
779 3300025925 Ga0207650_10734858 Ga0207650_107348581 83
780 3300025925 Ga0207650_11049786 Ga0207650_110497862 83
781 3300025926 Ga0207659_10070632 Ga0207659_100706324 83
782 3300025926 Ga0207659_11267932 Ga0207659_112679321 83
783 3300025932 Ga0207690_10263195 Ga0207690_102631952 83
784 3300025932 Ga0207690_10472198 Ga0207690_104721982 83
785 3300025932 Ga0207690_10554120 Ga0207690_105541201 83
786 3300025933 Ga0207706_10004192 Ga0207706_1000419210 83
787 3300025933 Ga0207706_10579662 Ga0207706_105796622 83
788 3300025933 Ga0207706_10685804 Ga0207706_106858042 83
789 3300025933 Ga0207706_11409165 Ga0207706_114091652 83
790 3300025935 Ga0207709_10033646 Ga0207709_100336464 83
791 3300025935 Ga0207709_10098211 Ga0207709_100982111 83
792 3300025935 Ga0207709_10347470 Ga0207709_103474702 83
793 3300025935 Ga0207709_10623351 Ga0207709_106233511 83
794 3300025936 Ga0207670_10392327 Ga0207670_103923272 83
795 3300025936 Ga0207670_10909281 Ga0207670_109092811 83
796 3300025937 Ga0207669_10178645 Ga0207669_101786452 83
797 3300025937 Ga0207669_10627153 Ga0207669_106271531 83
798 3300025937 Ga0207669_11251853 Ga0207669_112518532 83
799 3300025938 Ga0207704_10763913 Ga0207704_107639132 83
800 3300025938 Ga0207704_11088079 Ga0207704_110880792 83
801 3300025938 Ga0207704_11397064 Ga0207704_113970641 83
802 3300025939 Ga0207665_10653358 Ga0207665_106533581 83
803 3300025940 Ga0207691_10017008 Ga0207691_100170089 83
804 3300025940 Ga0207691_10294334 Ga0207691_102943343 83
805 3300025940 Ga0207691_10678455 Ga0207691_106784552 83
806 3300025941 Ga0207711_10527097 Ga0207711_105270971 83
807 3300025941 Ga0207711_11751188 Ga0207711_117511881 83
808 3300025942 Ga0207689_10075163 Ga0207689_100751633 83
809 3300025942 Ga0207689_10281180 Ga0207689_102811803 83
810 3300025942 Ga0207689_10479198 Ga0207689_104791982 83
811 3300025944 Ga0207661_10945605 Ga0207661_109456051 83
812 3300025944 Ga0207661_11032044 Ga0207661_110320441 83
813 3300025945 Ga0207679_10523520 Ga0207679_105235201 83
814 3300025945 Ga0207679_10805260 Ga0207679_108052602 83
815 3300025945 Ga0207679_10963551 Ga0207679_109635512 83
816 3300025949 Ga0207667_10005788 Ga0207667_100057882 83
817 3300025960 Ga0207651_10856766 Ga0207651_108567661 83
818 3300025961 Ga0207712_10687640 Ga0207712_106876401 83
819 3300025961 Ga0207712_11347131 Ga0207712_113471312 83
820 3300025961 Ga0207712_11853353 Ga0207712_118533532 83
821 3300025972 Ga0207668_10025250 Ga0207668_100252505 83
822 3300025972 Ga0207668_10178791 Ga0207668_101787912 83
823 3300025972 Ga0207668_11327794 Ga0207668_113277942 83
824 3300025972 Ga0207668_12003485 Ga0207668_120034851 83
825 3300025981 Ga0207640_10009603 Ga0207640_100096034 83
826 3300025981 Ga0207640_11774739 Ga0207640_117747391 83
827 3300025986 Ga0207658_10001048 Ga0207658_100010482 83
828 3300026023 Ga0207677_10167615 Ga0207677_101676151 83
829 3300026023 Ga0207677_10757731 Ga0207677_107577311 83
830 3300026035 Ga0207703_10071564 Ga0207703_100715641 83
831 3300026035 Ga0207703_10778785 Ga0207703_107787851 83
832 3300026035 Ga0207703_10887307 Ga0207703_108873071 83
833 3300026035 Ga0207703_11455888 Ga0207703_114558881 83
834 3300026035 Ga0207703_11496307 Ga0207703_114963072 83
835 3300026035 Ga0207703_12250445 Ga0207703_122504452 83
836 3300026041 Ga0207639_11226195 Ga0207639_112261951 83
837 3300026041 Ga0207639_11575440 Ga0207639_115754402 83
838 3300026067 Ga0207678_10836914 Ga0207678_108369141 83
839 3300026075 Ga0207708_10072421 Ga0207708_100724212 83
840 3300026075 Ga0207708_10073525 Ga0207708_100735252 83
841 3300026075 Ga0207708_10203973 Ga0207708_102039731 83
842 3300026075 Ga0207708_10741462 Ga0207708_107414622 83
843 3300026078 Ga0207702_10142870 Ga0207702_101428702 83
844 3300026088 Ga0207641_10006798 Ga0207641_100067985 83
845 3300026088 Ga0207641_10684046 Ga0207641_106840461 83
846 3300026088 Ga0207641_11158621 Ga0207641_111586211 83
847 3300026088 Ga0207641_11615309 Ga0207641_116153092 83
848 3300026089 Ga0207648_10012302 Ga0207648_100123028 83
849 3300026089 Ga0207648_10438395 Ga0207648_104383952 83
850 3300026095 Ga0207676_10109232 Ga0207676_101092322 83
851 3300026095 Ga0207676_10382461 Ga0207676_103824612 83
852 3300026095 Ga0207676_10935398 Ga0207676_109353982 83
853 3300026116 Ga0207674_10043654 Ga0207674_100436547 83
854 3300026116 Ga0207674_10151794 Ga0207674_101517944 83
855 3300026116 Ga0207674_10246151 Ga0207674_102461512 83
856 3300026116 Ga0207674_10354086 Ga0207674_103540862 83
857 3300026116 Ga0207674_10890504 Ga0207674_108905042 83
858 3300026116 Ga0207674_11391114 Ga0207674_113911141 83
859 3300026118 Ga0207675_100000471 Ga0207675_10000047139 83
860 3300026118 Ga0207675_100000520 Ga0207675_10000052030 83
861 3300026118 Ga0207675_100140913 Ga0207675_1001409132 83
862 3300026118 Ga0207675_100403404 Ga0207675_1004034042 83
863 3300026118 Ga0207675_100854669 Ga0207675_1008546692 83
864 3300026118 Ga0207675_102203382 Ga0207675_1022033821 83
865 3300026118 Ga0207675_102275401 Ga0207675_1022754011 83
866 3300026121 Ga0207683_11963639 Ga0207683_119636392 83
867 3300026142 Ga0207698_10071771 Ga0207698_100717714 83
868 3300026142 Ga0207698_11655560 Ga0207698_116555601 83
869 3300026142 Ga0207698_11994847 Ga0207698_119948471 83
870 3300027312 Ga0209371_1000235 Ga0209371_100023550 83
871 3300027866 Ga0209813_10269161 Ga0209813_102691611 83
872 3300027907 Ga0207428_10026662 Ga0207428_100266627 83
873 3300027907 Ga0207428_10042112 Ga0207428_100421124 83
874 3300027907 Ga0207428_10093739 Ga0207428_100937394 83
875 3300027907 Ga0207428_10760017 Ga0207428_107600171 83
876 3300027907 Ga0207428_11275043 Ga0207428_112750431 83
877 3300028379 Ga0268266_10433855 Ga0268266_104338552 83
878 3300028379 Ga0268266_10860980 Ga0268266_108609802 83
879 3300028379 Ga0268266_10872419 Ga0268266_108724192 83
880 3300028380 Ga0268265_10011098 Ga0268265_100110984 83
881 3300028380 Ga0268265_10011632 Ga0268265_100116323 83
882 3300028380 Ga0268265_10320918 Ga0268265_103209182 83
883 3300028380 Ga0268265_10807366 Ga0268265_108073662 83
884 3300028380 Ga0268265_11955963 Ga0268265_119559631 83
885 3300028380 Ga0268265_12030754 Ga0268265_120307541 83
886 3300028381 Ga0268264_10000204 Ga0268264_1000020488 83
887 3300028381 Ga0268264_10001562 Ga0268264_1000156210 83
888 3300028381 Ga0268264_10263909 Ga0268264_102639093 83
889 3300028381 Ga0268264_10547266 Ga0268264_105472662 83
890 3300028794 Ga0307515_10496291 Ga0307515_104962912 83
891 3300030500 Ga0268256_1000196 Ga0268256_100019613 83
892 3300030733 Ga0314311_1176710 Ga0314311_11767102 83
893 3300031507 Ga0307509_10097611 Ga0307509_100976114 83
894 3300031548 Ga0307408_100451402 Ga0307408_1004514023 83
895 3300031548 Ga0307408_100675059 Ga0307408_1006750593 83
896 3300031548 Ga0307408_102033639 Ga0307408_1020336391 83
897 3300031730 Ga0307516_10420231 Ga0307516_104202312 83
898 3300031731 Ga0307405_10353778 Ga0307405_103537782 83
899 3300031731 Ga0307405_11740176 Ga0307405_117401762 83
900 3300031824 Ga0307413_10204123 Ga0307413_102041233 83
901 3300031824 Ga0307413_11915542 Ga0307413_119155421 83
902 3300031852 Ga0307410_10181207 Ga0307410_101812072 83
903 3300031852 Ga0307410_10589664 Ga0307410_105896642 83
904 3300031901 Ga0307406_10310916 Ga0307406_103109163 83
905 3300031901 Ga0307406_10502639 Ga0307406_105026391 83
906 3300031901 Ga0307406_10622376 Ga0307406_106223762 83
907 3300031901 Ga0307406_11185421 Ga0307406_111854212 83
908 3300031903 Ga0307407_10322962 Ga0307407_103229623 83
909 3300031911 Ga0307412_10000206 Ga0307412_100002065 83
910 3300031911 Ga0307412_10053739 Ga0307412_100537392 83
911 3300031911 Ga0307412_10160568 Ga0307412_101605682 83
912 3300031911 Ga0307412_11206085 Ga0307412_112060852 83
913 3300031911 Ga0307412_11352440 Ga0307412_113524401 83
914 3300031911 Ga0307412_11580058 Ga0307412_115800581 83
915 3300031911 Ga0307412_11739551 Ga0307412_117395512 83
916 3300031995 Ga0307409_100154737 Ga0307409_1001547374 83
917 3300031995 Ga0307409_100493890 Ga0307409_1004938902 83
918 3300031995 Ga0307409_100868530 Ga0307409_1008685302 83
919 3300031995 Ga0307409_100969487 Ga0307409_1009694871 83
920 3300032002 Ga0307416_100120782 Ga0307416_1001207822 83
921 3300032002 Ga0307416_100241034 Ga0307416_1002410343 83
922 3300032002 Ga0307416_100384873 Ga0307416_1003848732 83
923 3300032002 Ga0307416_100864069 Ga0307416_1008640692 83
924 3300032002 Ga0307416_101318337 Ga0307416_1013183372 83
925 3300032002 Ga0307416_102145746 Ga0307416_1021457462 83
926 3300032004 Ga0307414_10000090 Ga0307414_1000009059 83
927 3300032004 Ga0307414_10001067 Ga0307414_100010674 83
928 3300032004 Ga0307414_10024139 Ga0307414_100241393 83
929 3300032004 Ga0307414_10083257 Ga0307414_100832573 83
930 3300032004 Ga0307414_10314754 Ga0307414_103147542 83
931 3300032005 Ga0307411_10031870 Ga0307411_100318702 83
932 3300032005 Ga0307411_10177756 Ga0307411_101777562 83
933 3300032005 Ga0307411_11530548 Ga0307411_115305482 83
934 3300032005 Ga0307411_12320456 Ga0307411_123204561 83
935 3300032126 Ga0307415_100510698 Ga0307415_1005106982 83
936 3300032126 Ga0307415_101189908 Ga0307415_1011899082 83
937 3300035083 Ga0373926_0230201 Ga0373926_0230201_38_307 83
938 3300035089 Ga0373944_0213989 Ga0373944_0213989_324_593 83
939 3300035114 Ga0373939_0109239 Ga0373939_0109239_573_842 83
940 3300035121 Ga0373960_0205143 Ga0373960_0205143_14_280 83
941 3300035171 Ga0373946_0420660 Ga0373946_0420660_245_514 83
942 3300035242 Ga0373962_0236129 Ga0373962_0236129_260_529 83
943 3300035691 Ga0373931_0023028 Ga0373931_0023028_1785_2054 83
944 3300035692 Ga0373935_1428122 Ga0373935_1428122_25_294 83
945 3300035695 Ga0373927_0051355 Ga0373927_0051355_1695_1964 83
946 3300036647 Ga0316582_0523956 Ga0316582_0523956_433_702 83
947 3300037068 Ga0373925_0361313 Ga0373925_0361313_781_1050 83
948 3300038443 Ga0395901_1791740 Ga0395901_1791740_35_301 83
949 3300039437 Ga0436365_0480912 Ga0436365_0480912_15214_15468 83
950 3300039450 Ga0436363_0048982 Ga0436363_0048982_126_395 83
951 3300039450 Ga0436363_0493190 Ga0436363_0493190_292_561 83
952 3300039453 Ga0436362_0553111 Ga0436362_0553111_33291_33545 83
953 3300041404 Ga0439436_0065284 Ga0439436_0065284_389_646 83
954 3300041404 Ga0439436_0170291 Ga0439436_0170291_271_528 83
955 3300041406 Ga0439439_0010294 Ga0439439_0010294_63_320 83
956 3300041410 Ga0439461_0000394 Ga0439461_0000394_503_760 83
957 3300041410 Ga0439461_0023156 Ga0439461_0023156_833_1090 83
958 3300041411 Ga0439466_0199721 Ga0439466_0199721_167_424 83
959 3300041413 Ga0439465_0000283 Ga0439465_0000283_1905_2162 83
960 3300041413 Ga0439465_0001505 Ga0439465_0001505_1592_1849 83
961 3300041443 Ga0451789_0782680 Ga0451789_0782680_102_368 83
962 3300041452 Ga0451793_0033680 Ga0451793_0033680_308_559 83
963 3300041452 Ga0451793_0957128 Ga0451793_0957128_278_547 83
964 3300041459 Ga0451800_0427065 Ga0451800_0427065_295_546 83
965 3300041459 Ga0451800_0504361 Ga0451800_0504361_298_564 83
966 3300041459 Ga0451800_1486363 Ga0451800_1486363_1261_1521 83
967 3300041460 Ga0451802_0398890 Ga0451802_0398890_492_752 83
968 3300041460 Ga0451802_1054188 Ga0451802_1054188_110_367 83
969 3300041462 Ga0451806_242067 Ga0451806_242067_1509_1760 83
970 3300041462 Ga0451806_513296 Ga0451806_513296_665_925 83
971 3300041463 Ga0451804_0395309 Ga0451804_0395309_1540_1791 83
972 3300041463 Ga0451804_1112201 Ga0451804_1112201_162_419 83
973 3300041486 Ga0451807_0115728 Ga0451807_0115728_44_304 83
974 3300041486 Ga0451807_0343639 Ga0451807_0343639_210_479 83
975 3300041486 Ga0451807_0451373 Ga0451807_0451373_299_571 83
976 3300041486 Ga0451807_0556227 Ga0451807_0556227_198_449 83
977 3300041486 Ga0451807_1077379 Ga0451807_1077379_371_640 83
978 3300041486 Ga0451807_2058733 Ga0451807_2058733_795_1064 83
979 3300041491 Ga0451833_1248443 Ga0451833_1248443_389_658 83
980 3300041494 Ga0451837_0561980 Ga0451837_0561980_131_400 83
981 3300041505 Ga0451849_0025924 Ga0451849_0025924_351_620 83
982 3300041507 Ga0451851_0206228 Ga0451851_0206228_21_290 83
983 3300041512 Ga0451853_1265896 Ga0451853_1265896_350_619 83
984 3300041512 Ga0451853_2186315 Ga0451853_2186315_69_332 83
985 3300041512 Ga0451853_2340752 Ga0451853_2340752_1113_1373 83
986 3300041997 Ga0439431_0000388 Ga0439431_0000388_4271_4528 83
987 3300041999 Ga0439433_0082408 Ga0439433_0082408_234_491 83
988 3300042002 Ga0439442_000975 Ga0439442_000975_4885_5142 83
989 3300042002 Ga0439442_009486 Ga0439442_009486_1652_1909 83
990 3300042003 Ga0439443_080578 Ga0439443_080578_14_283 83
991 3300042004 Ga0439445_0006131 Ga0439445_0006131_1036_1293 83
992 3300042004 Ga0439445_0010370 Ga0439445_0010370_537_794 83
993 3300042004 Ga0439445_0236798 Ga0439445_0236798_133_399 83
994 3300042006 Ga0439432_000054 Ga0439432_000054_14786_15043 83
995 3300042006 Ga0439432_042859 Ga0439432_042859_28_285 83
996 3300042010 Ga0439452_021914 Ga0439452_021914_640_897 83
997 3300042012 Ga0439455_0145411 Ga0439455_0145411_180_446 83
998 3300042014 Ga0439457_139090 Ga0439457_139090_149_406 83
999 3300042015 Ga0439462_0000462 Ga0439462_0000462_4993_5250 83
1000 3300042015 Ga0439462_0004275 Ga0439462_0004275_2809_3066 83
1001 3300042132 Ga0450895_017865 Ga0450895_017865_359_634 83
1002 3300042133 Ga0450896_013094 Ga0450896_013094_444_719 83
1003 3300042145 Ga0450906_047077 Ga0450906_047077_159_425 83
1004 3300042146 Ga0450907_010656 Ga0450907_010656_206_481 83
1005 3300042156 Ga0439446_0023557 Ga0439446_0023557_67_324 83
1006 3300042435 Ga0439434_0000569 Ga0439434_0000569_5504_5761 83
1007 3300042436 Ga0439435_0219865 Ga0439435_0219865_195_461 83
1008 3300042438 Ga0439459_0094784 Ga0439459_0094784_16_285 83
1009 3300042439 Ga0439464_0171838 Ga0439464_0171838_212_478 83
1010 3300042461 Ga0439460_0094061 Ga0439460_0094061_396_665 83
1011 3300042876 Ga0451577_1011431 Ga0451577_1011431_52_321 83
1012 3300042876 Ga0451577_1076966 Ga0451577_1076966_319_585 83
1013 3300044693 Ga0466961_0103542 Ga0466961_0103542_872_1129 83
1014 3300044694 Ga0466963_0052452 Ga0466963_0052452_1092_1349 83
1015 3300044719 Ga0466971_0013113 Ga0466971_0013113_2231_2488 83
1016 3300044765 Ga0466970_0335562 Ga0466970_0335562_136_393 83
1017 3300045051 Ga0451576_0176225 Ga0451576_0176225_938_1204 83
1018 3300045836 Ga0466958_0091687 Ga0466958_0091687_1612_1869 83
1019 3300045976 Ga0466967_0030518 Ga0466967_0030518_2995_3252 83
1020 3300046453 Ga0495627_050209 Ga0495627_050209_71_328 83
1021 3300046460 Ga0495638_0000774 Ga0495638_0000774_2327_2593 83
1022 3300046460 Ga0495638_0090851 Ga0495638_0090851_1215_1481 83
1023 3300046512 Ga0495610_0131516 Ga0495610_0131516_485_754 83
1024 3300046522 Ga0495643_0141295 Ga0495643_0141295_481_750 83
1025 3300046530 Ga0495654_0133690 Ga0495654_0133690_262_531 83
1026 3300046530 Ga0495654_0378745 Ga0495654_0378745_151_417 83
1027 3300046535 Ga0495586_0413754 Ga0495586_0413754_181_450 83
1028 3300046537 Ga0495598_0185764 Ga0495598_0185764_377_643 83
1029 3300046537 Ga0495598_0358018 Ga0495598_0358018_68_376 83
1030 3300046542 Ga0495597_0240213 Ga0495597_0240213_361_630 83
1031 3300046558 Ga0495633_0316071 Ga0495633_0316071_39_308 83
1032 3300046616 Ga0495668_0000031 Ga0495668_0000031_137523_137792 83
1033 3300046616 Ga0495668_0037509 Ga0495668_0037509_1004_1273 83
1034 3300046616 Ga0495668_0162838 Ga0495668_0162838_940_1209 83
1035 3300046616 Ga0495668_0553833 Ga0495668_0553833_142_411 83
1036 3300046660 Ga0495625_0000083 Ga0495625_0000083_147005_147274 83
1037 3300046660 Ga0495625_0000115 Ga0495625_0000115_106692_106961 83
1038 3300046660 Ga0495625_0155072 Ga0495625_0155072_649_915 83
1039 3300046660 Ga0495625_0222491 Ga0495625_0222491_37_306 83
1040 3300046691 Ga0495670_0000047 Ga0495670_0000047_51312_51569 83
1041 3300046694 Ga0495649_0298965 Ga0495649_0298965_486_743 83
1042 3300047318 Ga0495636_0527102 Ga0495636_0527102_11_277 83
1043 3300047470 Ga0495681_0033786 Ga0495681_0033786_153_410 83
1044 3300047472 Ga0495686_0001048 Ga0495686_0001048_11561_11818 83
1045 3300047472 Ga0495686_0001884 Ga0495686_0001884_10643_10912 83
1046 3300047472 Ga0495686_0447359 Ga0495686_0447359_308_577 83
1047 3300047472 Ga0495686_0520613 Ga0495686_0520613_341_598 83
1048 3300048091 Ga0495626_0130762 Ga0495626_0130762_192_458 83
1049 3300048905 Ga0496102_0231762 Ga0496102_0231762_28_285 83
1050 3300048905 Ga0496102_1467062 Ga0496102_1467062_79_339 83
1051 3300048907 Ga0496104_0225962 Ga0496104_0225962_86_355 83
1052 3300048914 Ga0496111_0262321 Ga0496111_0262321_873_1142 83
1053 3300048915 Ga0496112_0055039 Ga0496112_0055039_3490_3759 83
1054 3300048916 Ga0496113_0371607 Ga0496113_0371607_245_514 83
1055 3300048917 Ga0496114_1496123 Ga0496114_1496123_95_364 83
1056 3300048918 Ga0496115_0000333 Ga0496115_0000333_8859_9119 83
1057 3300048920 Ga0496117_0002512 Ga0496117_0002512_7370_7621 83
1058 3300048920 Ga0496117_0027156 Ga0496117_0027156_3239_3496 83
1059 3300048921 Ga0496118_0032030 Ga0496118_0032030_767_1018 83
1060 3300048921 Ga0496118_0188008 Ga0496118_0188008_250_516 83
1061 3300048921 Ga0496118_0340787 Ga0496118_0340787_189_440 83
1062 3300048922 Ga0496119_0004541 Ga0496119_0004541_3426_3677 83
1063 3300048922 Ga0496119_0216175 Ga0496119_0216175_659_916 83
1064 3300048923 Ga0496120_0001660 Ga0496120_0001660_15362_15613 83
1065 3300048923 Ga0496120_0091448 Ga0496120_0091448_517_774 83
1066 3300048923 Ga0496120_0110315 Ga0496120_0110315_921_1178 83
1067 3300048924 Ga0496121_0183126 Ga0496121_0183126_38_295 83
1068 3300048925 Ga0496122_0000361 Ga0496122_0000361_15558_15809 83
1069 3300048925 Ga0496122_0096833 Ga0496122_0096833_1463_1720 83
1070 3300048925 Ga0496122_0344323 Ga0496122_0344323_405_662 83
1071 3300048926 Ga0496123_0002053 Ga0496123_0002053_10114_10365 83
1072 3300048926 Ga0496123_0008346 Ga0496123_0008346_7922_8179 83
1073 3300048926 Ga0496123_0119750 Ga0496123_0119750_277_531 83
1074 3300048926 Ga0496123_0158908 Ga0496123_0158908_879_1136 83
1075 3300048926 Ga0496123_0215755 Ga0496123_0215755_355_612 83
1076 3300048927 Ga0496124_0000116 Ga0496124_0000116_131511_131768 83
1077 3300048927 Ga0496124_0002453 Ga0496124_0002453_13920_14171 83
1078 3300048927 Ga0496124_0021657 Ga0496124_0021657_11_268 83
1079 3300048927 Ga0496124_0633391 Ga0496124_0633391_69_326 83
1080 3300048928 Ga0496125_0340902 Ga0496125_0340902_303_560 83
1081 3300048928 Ga0496125_0430948 Ga0496125_0430948_400_657 83
1082 3300048929 Ga0496126_0033359 Ga0496126_0033359_1932_2189 83
1083 3300048929 Ga0496126_0054433 Ga0496126_0054433_1866_2135 83
1084 3300048929 Ga0496126_0248981 Ga0496126_0248981_729_980 83
1085 3300048929 Ga0496126_1021124 Ga0496126_1021124_176_445 83
1086 3300049513 Ga0501290_000535 Ga0501290_000535_4419_4685 83
1087 3300049522 Ga0501299_131159 Ga0501299_131159_193_459 83
1088 3300049523 Ga0501300_000775 Ga0501300_000775_1701_1967 83
1089 3300049572 Ga0501036_0814721 Ga0501036_0814721_215_484 83
1090 3300049573 Ga0501037_0965925 Ga0501037_0965925_51_323 83
1091 3300049575 Ga0501039_0396712 Ga0501039_0396712_589_861 83
1092 3300049575 Ga0501039_0575172 Ga0501039_0575172_184_453 83
1093 3300049582 Ga0501048_1133089 Ga0501048_1133089_121_387 83
1094 3300049592 Ga0501076_0901884 Ga0501076_0901884_276_545 83
1095 3300049655 Ga0501208_058782 Ga0501208_058782_446_712 83
1096 3300049690 Ga0501261_069797 Ga0501261_069797_122_388 83
1097 3300049744 Ga0501083_0022042 Ga0501083_0022042_722_991 83
1098 3300049772 Ga0501275_000288 Ga0501275_000288_63_329 83
1099 3300049772 Ga0501275_090043 Ga0501275_090043_242_496 83
1100 3300049823 Ga0501044_1374425 Ga0501044_1374425_105_374 83
1101 3300050489 nmdc:mga03683_13_c1 nmdc:mga03683_13_c1_77870_78139 83
1102 3300050490 nmdc:mga03n38_1530_c1 nmdc:mga03n38_1530_c1_891_1160 83
1103 3300050492 nmdc:mga0yw44_1049937_c1 nmdc:mga0yw44_1049937_c1_13_273 83
1104 3300050493 nmdc:mga0k408_229344_c1 nmdc:mga0k408_229344_c1_636_905 83
1105 3300050493 nmdc:mga0k408_35281_c1 nmdc:mga0k408_35281_c1_641_910 83
1106 3300050493 nmdc:mga0k408_554573_c1 nmdc:mga0k408_554573_c1_182_451 83
1107 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_88203_88472 83
1108 3300050496 nmdc:mga07m45_20_c1 nmdc:mga07m45_20_c1_46206_46475 83
1109 3300050496 nmdc:mga07m45_401758_c1 nmdc:mga07m45_401758_c1_452_721 83
1110 3300050507 nmdc:mga05p37_114129_c1 nmdc:mga05p37_114129_c1_930_1196 83
1111 3300050507 nmdc:mga05p37_1966634_c1 nmdc:mga05p37_1966634_c1_221_487 83
1112 3300050507 nmdc:mga05p37_214267_c1 nmdc:mga05p37_214267_c1_326_592 83
1113 3300050507 nmdc:mga05p37_418677_c1 nmdc:mga05p37_418677_c1_150_416 83
1114 3300050507 nmdc:mga05p37_520230_c1 nmdc:mga05p37_520230_c1_63_329 83
1115 3300050508 nmdc:mga09592_131176_c1 nmdc:mga09592_131176_c1_862_1128 83
1116 3300050508 nmdc:mga09592_183494_c1 nmdc:mga09592_183494_c1_1396_1662 83
1117 3300050508 nmdc:mga09592_300173_c1 nmdc:mga09592_300173_c1_308_574 83
1118 3300050508 nmdc:mga09592_49001_c1 nmdc:mga09592_49001_c1_1561_1827 83
1119 3300050509 nmdc:mga0qj67_116770_c1 nmdc:mga0qj67_116770_c1_1189_1455 83
1120 3300050509 nmdc:mga0qj67_222894_c1 nmdc:mga0qj67_222894_c1_325_591 83
1121 3300050509 nmdc:mga0qj67_274763_c1 nmdc:mga0qj67_274763_c1_212_481 83
1122 3300050509 nmdc:mga0qj67_30550_c1 nmdc:mga0qj67_30550_c1_1073_1339 83
1123 3300050509 nmdc:mga0qj67_58178_c1 nmdc:mga0qj67_58178_c1_2472_2738 83
1124 3300050509 nmdc:mga0qj67_601297_c1 nmdc:mga0qj67_601297_c1_547_813 83
1125 3300050510 nmdc:mga06r32_1278980_c1 nmdc:mga06r32_1278980_c1_101_367 83
1126 3300050510 nmdc:mga06r32_317791_c1 nmdc:mga06r32_317791_c1_966_1232 83
1127 3300050510 nmdc:mga06r32_337_c1 nmdc:mga06r32_337_c1_24243_24509 83
1128 3300050510 nmdc:mga06r32_404430_c1 nmdc:mga06r32_404430_c1_517_783 83
1129 3300050510 nmdc:mga06r32_436025_c1 nmdc:mga06r32_436025_c1_26_295 83
1130 3300050510 nmdc:mga06r32_45225_c1 nmdc:mga06r32_45225_c1_2858_3124 83
1131 3300050510 nmdc:mga06r32_497681_c1 nmdc:mga06r32_497681_c1_642_908 83
1132 3300050511 nmdc:mga08y16_143511_c1 nmdc:mga08y16_143511_c1_1974_2240 83
1133 3300050511 nmdc:mga08y16_153661_c1 nmdc:mga08y16_153661_c1_623_889 83
1134 3300050511 nmdc:mga08y16_278848_c1 nmdc:mga08y16_278848_c1_47_316 83
1135 3300050511 nmdc:mga08y16_465818_c1 nmdc:mga08y16_465818_c1_124_390 83
1136 3300050511 nmdc:mga08y16_589470_c1 nmdc:mga08y16_589470_c1_816_1082 83
1137 3300050511 nmdc:mga08y16_61630_c1 nmdc:mga08y16_61630_c1_1459_1725 83
1138 3300050511 nmdc:mga08y16_877419_c1 nmdc:mga08y16_877419_c1_296_565 83
1139 3300050512 nmdc:mga0n895_191741_c1 nmdc:mga0n895_191741_c1_100_369 83
1140 3300050512 nmdc:mga0n895_39742_c1 nmdc:mga0n895_39742_c1_3790_4059 83
1141 3300050513 nmdc:mga0rr50_1496350_c1 nmdc:mga0rr50_1496350_c1_179_448 83
1142 3300050513 nmdc:mga0rr50_210770_c1 nmdc:mga0rr50_210770_c1_1303_1572 83
1143 3300050513 nmdc:mga0rr50_531604_c1 nmdc:mga0rr50_531604_c1_13_282 83
1144 3300050515 nmdc:mga0a205_1176468_c1 nmdc:mga0a205_1176468_c1_120_386 83
1145 3300050515 nmdc:mga0a205_1207496_c1 nmdc:mga0a205_1207496_c1_297_566 83
1146 3300050515 nmdc:mga0a205_14992_c1 nmdc:mga0a205_14992_c1_3101_3370 83
1147 3300050516 nmdc:mga0sz30_2719_c1 nmdc:mga0sz30_2719_c1_1163_1432 83
1148 3300053078 Ga0495612_0182441 Ga0495612_0182441_223_480 83
1149 3300053087 Ga0500643_001338 Ga0500643_001338_144_401 83
1150 3300053090 Ga0500646_0126025 Ga0500646_0126025_512_781 83
1151 3300053092 Ga0500583_0541334 Ga0500583_0541334_225_491 83
1152 3300053094 Ga0500566_0008244 Ga0500566_0008244_1421_1693 83
1153 3300053094 Ga0500566_0383088 Ga0500566_0383088_358_618 83
1154 3300053108 Ga0500562_122410 Ga0500562_122410_424_681 83
1155 3300053108 Ga0500562_225602 Ga0500562_225602_159_428 83
1156 3300053116 Ga0500592_005468 Ga0500592_005468_1583_1852 83
1157 3300053116 Ga0500592_012998 Ga0500592_012998_516_785 83
1158 3300053131 Ga0500652_174553 Ga0500652_174553_557_814 83
1159 3300053134 Ga0500658_0123970 Ga0500658_0123970_476_733 83
1160 3300053139 Ga0500568_0013638 Ga0500568_0013638_526_795 83
1161 3300053139 Ga0500568_0034532 Ga0500568_0034532_513_770 83
1162 3300053153 Ga0500616_0111302 Ga0500616_0111302_27_284 83
1163 3300053158 Ga0500627_0000003 Ga0500627_0000003_80233_80502 83
1164 3300053158 Ga0500627_0121223 Ga0500627_0121223_590_859 83
1165 3300054114 Ga0501084_1142384 Ga0501084_1142384_373_642 83
1166 3300059421 Ga0590071_005027 Ga0590071_005027_1040_1309 83
1167 3300059421 Ga0590071_172255 Ga0590071_172255_70_336 83
1168 3300059423 Ga0590074_021120 Ga0590074_021120_112_381 83
1169 3300059477 Ga0587084_031580 Ga0587084_031580_20_292 83
1170 3300059478 Ga0587093_093274 Ga0587093_093274_214_483 83
1171 3300059493 Ga0587077_199839 Ga0587077_199839_21_293 83
1172 3300059504 Ga0587082_057045 Ga0587082_057045_18_290 83
1173 3300059506 Ga0587085_033063 Ga0587085_033063_573_845 83
1174 3300059510 Ga0587090_036077 Ga0587090_036077_561_833 83
1175 3300059511 Ga0587091_018621 Ga0587091_018621_21_293 83
1176 3300059604 Ga0587098_019198 Ga0587098_019198_18_290 83
1177 3300059608 Ga0587129_015400 Ga0587129_015400_324_593 83
1178 3300059623 Ga0587101_109295 Ga0587101_109295_271_543 83
1179 3300059623 Ga0587101_139287 Ga0587101_139287_67_336 83
1180 3300059624 Ga0587109_051344 Ga0587109_051344_558_830 83
1181 3300059627 Ga0587117_042859 Ga0587117_042859_142_411 83
1182 3300059630 Ga0587128_014085 Ga0587128_014085_489_758 83
1183 3300059639 Ga0587062_027045 Ga0587062_027045_568_840 83
1184 3300059653 Ga0587108_011948 Ga0587108_011948_13_285 83
1185 3300060346 Ga0587111_0049805 Ga0587111_0049805_213_482 83
1186 3300060353 Ga0501082_0481586 Ga0501082_0481586_547_816 83
1187 3300061719 Ga0466962_0007169 Ga0466962_0007169_3598_3855 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

46

97

0.95

Feature Viewer

pLDDT pTM Quality
68.97 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map