F491411
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1187 | 488 | 1169 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300046537|Ga0495598_0358018|Ga0495598_0358018_68_376 |
| Length | 102 |
| Sequence | MRVQTDFTTRSITMNLIVWLVIGGVVGWLASIIMKRDAQQGVFLNIVVGVIGALLAGWFISPLVGIGTINSGLSIGSFLVSLLGAVVLLAIVNLFTRGRART |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 5 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 6 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 7 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 8 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 9 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 10 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 11 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 12 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 13 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 14 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 15 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 16 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 17 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 42 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 45 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 49 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 95 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 110 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 111 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 126 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 127 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 128 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 129 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 130 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 131 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 132 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 133 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 152 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 153 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 154 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 155 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 156 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 157 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 158 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 159 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 160 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 161 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 162 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 163 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 164 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 180 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 181 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 184 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 187 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 188 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 189 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 191 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 271 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 272 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 273 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 274 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 275 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 276 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 279 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 282 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 283 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 284 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 285 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 286 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 287 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 288 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 289 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 291 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 300 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 303 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 306 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 307 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 308 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 309 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 310 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 311 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 312 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 313 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 322 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 323 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 324 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 325 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 326 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 327 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 328 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 329 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 330 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 331 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 332 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 333 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 334 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 335 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 336 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 337 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 338 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 339 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 340 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 341 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 342 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 343 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 344 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 345 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 346 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 347 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 348 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 349 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 350 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 351 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 352 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 353 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 354 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 355 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 356 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 357 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 358 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 359 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 360 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 361 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 362 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 385 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 389 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 390 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 391 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 392 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 393 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 394 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 395 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 396 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 397 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 398 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 401 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 402 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 403 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 404 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 405 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 406 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 407 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 408 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 421 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 422 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 423 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 427 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 428 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 429 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 430 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 432 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 433 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 437 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 451 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 452 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 453 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 456 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 457 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 458 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 462 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 463 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 464 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 466 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 467 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 468 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 486 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 487 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 488 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.45 |
| Metatranscriptomes | 3.03 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.68 |
| Nodule | 0 |
| Rhizoplane | 3.37 |
| Rhizosphere | 81.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2608932 | 2162886007 | Bacteria | 1441 |
| 2 | ARcpr5oldR_c005890 | 3300000041 | Bacteria | 1051 |
| 3 | JGI24736J21556_1000084 | 3300001904 | Bacteria | 15451 |
| 4 | JGI24736J21556_1000245 | 3300001904 | Bacteria | 9885 |
| 5 | JGI24741J21665_1000033 | 3300001915 | Bacteria | 33026 |
| 6 | JGI24741J21665_1022120 | 3300001915 | Bacteria | 988 |
| 7 | JGI24740J21852_10000308 | 3300001979 | Bacteria | 20760 |
| 8 | JGI24740J21852_10010401 | 3300001979 | Bacteria | 3587 |
| 9 | JGI24739J22299_10001399 | 3300001989 | Bacteria | 9074 |
| 10 | JGI24739J22299_10058466 | 3300001989 | Bacteria | 1224 |
| 11 | JGI24737J22298_10002067 | 3300001990 | Bacteria | 7176 |
| 12 | JGI24735J21928_10002354 | 3300002067 | Bacteria | 6585 |
| 13 | JGI24735J21928_10009527 | 3300002067 | Bacteria | 3116 |
| 14 | JGI24735J21928_10106397 | 3300002067 | Bacteria | 806 |
| 15 | JGI24748J21848_1017734 | 3300002074 | Bacteria | 853 |
| 16 | JGI24738J21930_10000403 | 3300002075 | Bacteria | 12110 |
| 17 | JGI24738J21930_10000553 | 3300002075 | Bacteria | 10685 |
| 18 | JGI24749J21850_1000277 | 3300002076 | Bacteria | 7843 |
| 19 | JGI24034J26672_10063209 | 3300002239 | Bacteria | 653 |
| 20 | JGI24751J29686_10001694 | 3300002459 | Bacteria | 4537 |
| 21 | JGI25150J39212_1000098 | 3300002774 | Bacteria | 50282 |
| 22 | JGI25150J39212_1032474 | 3300002774 | Bacteria | 714 |
| 23 | JGI25151J46595_10031054 | 3300003187 | Bacteria | 2091 |
| 24 | JGI25153J46596_10000055 | 3300003215 | Bacteria | 135518 |
| 25 | JGI25153J46596_10002938 | 3300003215 | Bacteria | 9651 |
| 26 | JGI25153J46596_10065997 | 3300003215 | Bacteria | 959 |
| 27 | rootH1_10016789 | 3300003316 | Bacteria | 1164 |
| 28 | Ga0055526_1003146 | 3300003771 | Bacteria | 10691 |
| 29 | Ga0055526_1103262 | 3300003771 | Bacteria | 520 |
| 30 | Ga0055537_1001198 | 3300003773 | Bacteria | 10991 |
| 31 | Ga0055537_1001216 | 3300003773 | Bacteria | 10852 |
| 32 | Ga0055524_1000670 | 3300003775 | Bacteria | 24010 |
| 33 | Ga0055536_1005408 | 3300003781 | Bacteria | 6256 |
| 34 | Ga0055528_1024786 | 3300003790 | Bacteria | 1786 |
| 35 | Ga0055530_10000224 | 3300003791 | Bacteria | 50209 |
| 36 | Ga0055530_10010144 | 3300003791 | Bacteria | 3523 |
| 37 | Ga0055530_10015555 | 3300003791 | Bacteria | 2475 |
| 38 | Ga0055540_1001240 | 3300003792 | Bacteria | 15690 |
| 39 | Ga0055531_10000094 | 3300003794 | Bacteria | 96266 |
| 40 | Ga0055531_10003913 | 3300003794 | Bacteria | 9294 |
| 41 | Ga0055531_10072924 | 3300003794 | Bacteria | 784 |
| 42 | Ga0058692_1000081 | 3300003856 | Bacteria | 69376 |
| 43 | JGI25405J52794_10000298 | 3300003911 | Bacteria | 6815 |
| 44 | Ga0055543_1019776 | 3300004625 | Bacteria | 1244 |
| 45 | Ga0058859_11186829 | 3300004798 | Bacteria | 1352 |
| 46 | Ga0058859_11742863 | 3300004798 | Bacteria | 655 |
| 47 | Ga0058859_11747837 | 3300004798 | Bacteria | 546 |
| 48 | Ga0058859_11789015 | 3300004798 | Bacteria | 676 |
| 49 | Ga0058859_11834298 | 3300004798 | Bacteria | 1781 |
| 50 | Ga0058860_11386381 | 3300004801 | Bacteria | 694 |
| 51 | Ga0058860_11409702 | 3300004801 | Bacteria | 1700 |
| 52 | Ga0058860_12029252 | 3300004801 | Bacteria | 511 |
| 53 | Ga0058860_12099451 | 3300004801 | Bacteria | 1459 |
| 54 | Ga0058860_12203426 | 3300004801 | Unclassified | 1964 |
| 55 | Ga0065165_1007915 | 3300005262 | Bacteria | 5099 |
| 56 | Ga0065165_1023907 | 3300005262 | Bacteria | 2063 |
| 57 | Ga0065165_1036540 | 3300005262 | Bacteria | 1498 |
| 58 | Ga0065165_1055259 | 3300005262 | Bacteria | 1109 |
| 59 | Ga0065704_10001806 | 3300005289 | Bacteria | 15273 |
| 60 | Ga0065704_10078390 | 3300005289 | Bacteria | 4443 |
| 61 | Ga0065704_10088093 | 3300005289 | Bacteria | 2968 |
| 62 | Ga0065704_10115293 | 3300005289 | Bacteria | 1874 |
| 63 | Ga0065704_10158200 | 3300005289 | Bacteria | 1374 |
| 64 | Ga0065704_10196152 | 3300005289 | Bacteria | 1166 |
| 65 | Ga0065704_10263838 | 3300005289 | Bacteria | 959 |
| 66 | Ga0065712_10747402 | 3300005290 | Bacteria | 530 |
| 67 | Ga0065715_10811313 | 3300005293 | Bacteria | 606 |
| 68 | Ga0065707_10110051 | 3300005295 | Bacteria | 2446 |
| 69 | Ga0065707_10129579 | 3300005295 | Bacteria | 1945 |
| 70 | Ga0065707_10148430 | 3300005295 | Bacteria | 1686 |
| 71 | Ga0065707_10182128 | 3300005295 | Bacteria | 1412 |
| 72 | Ga0070658_10020553 | 3300005327 | Bacteria | 5292 |
| 73 | Ga0070658_10181797 | 3300005327 | Bacteria | 1769 |
| 74 | Ga0070658_10372339 | 3300005327 | Bacteria | 1224 |
| 75 | Ga0070658_10469790 | 3300005327 | Bacteria | 1085 |
| 76 | Ga0070676_10130746 | 3300005328 | Bacteria | 1587 |
| 77 | Ga0070676_11259825 | 3300005328 | Bacteria | 564 |
| 78 | Ga0070683_100526620 | 3300005329 | Bacteria | 1130 |
| 79 | Ga0070683_100817410 | 3300005329 | Bacteria | 894 |
| 80 | Ga0070683_100911697 | 3300005329 | Bacteria | 843 |
| 81 | Ga0070683_101061898 | 3300005329 | Bacteria | 778 |
| 82 | Ga0070683_102387100 | 3300005329 | Bacteria | 507 |
| 83 | Ga0070690_100359067 | 3300005330 | Bacteria | 1059 |
| 84 | Ga0070670_100003557 | 3300005331 | Bacteria | 12962 |
| 85 | Ga0070670_100028217 | 3300005331 | Bacteria | 4831 |
| 86 | Ga0070670_100073086 | 3300005331 | Bacteria | 2946 |
| 87 | Ga0070670_100239903 | 3300005331 | Bacteria | 1578 |
| 88 | Ga0070670_100286094 | 3300005331 | Bacteria | 1440 |
| 89 | Ga0070670_100351750 | 3300005331 | Bacteria | 1294 |
| 90 | Ga0070670_101468915 | 3300005331 | Bacteria | 626 |
| 91 | Ga0070677_10054194 | 3300005333 | Bacteria | 1633 |
| 92 | Ga0070677_10196083 | 3300005333 | Bacteria | 971 |
| 93 | Ga0070677_10281992 | 3300005333 | Bacteria | 837 |
| 94 | Ga0070677_10630391 | 3300005333 | Bacteria | 597 |
| 95 | Ga0070677_10901815 | 3300005333 | Bacteria | 511 |
| 96 | Ga0068869_100037537 | 3300005334 | Bacteria | 3445 |
| 97 | Ga0068869_100073646 | 3300005334 | Bacteria | 2533 |
| 98 | Ga0068869_100376476 | 3300005334 | Bacteria | 1163 |
| 99 | Ga0068869_100991230 | 3300005334 | Bacteria | 731 |
| 100 | Ga0068869_101530063 | 3300005334 | Bacteria | 593 |
| 101 | Ga0070666_10001750 | 3300005335 | Bacteria | 13254 |
| 102 | Ga0070680_100077391 | 3300005336 | Bacteria | 2740 |
| 103 | Ga0070682_100031832 | 3300005337 | Bacteria | 3193 |
| 104 | Ga0070682_100143279 | 3300005337 | Bacteria | 1631 |
| 105 | Ga0070682_101349023 | 3300005337 | Bacteria | 608 |
| 106 | Ga0068868_100220568 | 3300005338 | Bacteria | 1587 |
| 107 | Ga0068868_100557510 | 3300005338 | Bacteria | 1010 |
| 108 | Ga0068868_100833135 | 3300005338 | Bacteria | 834 |
| 109 | Ga0068868_101079721 | 3300005338 | Bacteria | 738 |
| 110 | Ga0070660_100170249 | 3300005339 | Bacteria | 1759 |
| 111 | Ga0070660_100207702 | 3300005339 | Bacteria | 1589 |
| 112 | Ga0070660_101165079 | 3300005339 | Bacteria | 653 |
| 113 | Ga0070660_101522066 | 3300005339 | Bacteria | 569 |
| 114 | Ga0070689_100008543 | 3300005340 | Bacteria | 7218 |
| 115 | Ga0070689_100128753 | 3300005340 | Bacteria | 2028 |
| 116 | Ga0070689_100173512 | 3300005340 | Bacteria | 1748 |
| 117 | Ga0070689_100479309 | 3300005340 | Unclassified | 1063 |
| 118 | Ga0070687_100250993 | 3300005343 | Bacteria | 1099 |
| 119 | Ga0070661_100090999 | 3300005344 | Bacteria | 2259 |
| 120 | Ga0070661_100109613 | 3300005344 | Bacteria | 2060 |
| 121 | Ga0070661_100151526 | 3300005344 | Bacteria | 1753 |
| 122 | Ga0070661_100240982 | 3300005344 | Bacteria | 1392 |
| 123 | Ga0070661_101108681 | 3300005344 | Bacteria | 660 |
| 124 | Ga0070692_10112290 | 3300005345 | Bacteria | 1509 |
| 125 | Ga0070668_100000460 | 3300005347 | Bacteria | 26920 |
| 126 | Ga0070668_100013970 | 3300005347 | Bacteria | 6003 |
| 127 | Ga0070668_100075344 | 3300005347 | Bacteria | 2634 |
| 128 | Ga0070668_100330696 | 3300005347 | Bacteria | 1285 |
| 129 | Ga0070668_100481846 | 3300005347 | Bacteria | 1071 |
| 130 | Ga0070668_100615799 | 3300005347 | Bacteria | 951 |
| 131 | Ga0070668_100933638 | 3300005347 | Bacteria | 777 |
| 132 | Ga0070668_101111384 | 3300005347 | Bacteria | 714 |
| 133 | Ga0070668_101262289 | 3300005347 | Bacteria | 671 |
| 134 | Ga0070668_101873102 | 3300005347 | Unclassified | 552 |
| 135 | Ga0070669_100000059 | 3300005353 | Bacteria | 108504 |
| 136 | Ga0070669_100004662 | 3300005353 | Bacteria | 9893 |
| 137 | Ga0070669_100011016 | 3300005353 | Bacteria | 6417 |
| 138 | Ga0070669_100068008 | 3300005353 | Bacteria | 2629 |
| 139 | Ga0070669_100129070 | 3300005353 | Bacteria | 1937 |
| 140 | Ga0070669_100481504 | 3300005353 | Bacteria | 1027 |
| 141 | Ga0070669_101169273 | 3300005353 | Bacteria | 664 |
| 142 | Ga0070669_101199073 | 3300005353 | Bacteria | 656 |
| 143 | Ga0070675_100086771 | 3300005354 | Bacteria | 2616 |
| 144 | Ga0070675_100370234 | 3300005354 | Bacteria | 1273 |
| 145 | Ga0070675_100882501 | 3300005354 | Bacteria | 819 |
| 146 | Ga0070675_101497214 | 3300005354 | Unclassified | 622 |
| 147 | Ga0070675_102116517 | 3300005354 | Bacteria | 519 |
| 148 | Ga0070671_100026426 | 3300005355 | Bacteria | 4770 |
| 149 | Ga0070671_100246960 | 3300005355 | Bacteria | 1516 |
| 150 | Ga0070671_101912747 | 3300005355 | Bacteria | 528 |
| 151 | Ga0070674_100301647 | 3300005356 | Bacteria | 1277 |
| 152 | Ga0070674_100826861 | 3300005356 | Bacteria | 802 |
| 153 | Ga0070674_101361348 | 3300005356 | Bacteria | 634 |
| 154 | Ga0070673_100552155 | 3300005364 | Unclassified | 1046 |
| 155 | Ga0070673_100586025 | 3300005364 | Bacteria | 1016 |
| 156 | Ga0070673_101267500 | 3300005364 | Bacteria | 692 |
| 157 | Ga0070688_100000464 | 3300005365 | Bacteria | 20632 |
| 158 | Ga0070688_100024154 | 3300005365 | Bacteria | 3582 |
| 159 | Ga0070688_101082925 | 3300005365 | Bacteria | 640 |
| 160 | Ga0070688_101352834 | 3300005365 | Bacteria | 576 |
| 161 | Ga0070659_100039830 | 3300005366 | Bacteria | 3670 |
| 162 | Ga0070659_100053840 | 3300005366 | Bacteria | 3168 |
| 163 | Ga0070659_100094268 | 3300005366 | Bacteria | 2403 |
| 164 | Ga0070659_100379626 | 3300005366 | Bacteria | 1190 |
| 165 | Ga0070659_100814640 | 3300005366 | Bacteria | 812 |
| 166 | Ga0070667_100000076 | 3300005367 | Bacteria | 120555 |
| 167 | Ga0070667_100000286 | 3300005367 | Bacteria | 57006 |
| 168 | Ga0070667_100556960 | 3300005367 | Bacteria | 1054 |
| 169 | Ga0070667_100804253 | 3300005367 | Bacteria | 873 |
| 170 | Ga0070667_101023734 | 3300005367 | Bacteria | 771 |
| 171 | Ga0070710_10222220 | 3300005437 | Bacteria | 1202 |
| 172 | Ga0070701_10407954 | 3300005438 | Bacteria | 863 |
| 173 | Ga0070705_101282588 | 3300005440 | Bacteria | 607 |
| 174 | Ga0070700_100090960 | 3300005441 | Bacteria | 1991 |
| 175 | Ga0070700_100136197 | 3300005441 | Bacteria | 1663 |
| 176 | Ga0070700_100217322 | 3300005441 | Bacteria | 1352 |
| 177 | Ga0070694_100597749 | 3300005444 | Bacteria | 888 |
| 178 | Ga0070694_100613612 | 3300005444 | Bacteria | 877 |
| 179 | Ga0070694_100790832 | 3300005444 | Bacteria | 777 |
| 180 | Ga0070694_100864873 | 3300005444 | Bacteria | 745 |
| 181 | Ga0070663_100139611 | 3300005455 | Bacteria | 1848 |
| 182 | Ga0070663_100276632 | 3300005455 | Bacteria | 1336 |
| 183 | Ga0070663_101073362 | 3300005455 | Bacteria | 703 |
| 184 | Ga0070663_101867308 | 3300005455 | Bacteria | 539 |
| 185 | Ga0070678_101473560 | 3300005456 | Bacteria | 637 |
| 186 | Ga0070678_101515059 | 3300005456 | Bacteria | 628 |
| 187 | Ga0070662_100002034 | 3300005457 | Bacteria | 12383 |
| 188 | Ga0070662_100125479 | 3300005457 | Bacteria | 1972 |
| 189 | Ga0070662_100428595 | 3300005457 | Bacteria | 1095 |
| 190 | Ga0070662_100784756 | 3300005457 | Bacteria | 809 |
| 191 | Ga0070681_10401588 | 3300005458 | Bacteria | 1282 |
| 192 | Ga0070681_10651945 | 3300005458 | Bacteria | 968 |
| 193 | Ga0070681_11224404 | 3300005458 | Bacteria | 673 |
| 194 | Ga0068867_100137840 | 3300005459 | Bacteria | 1904 |
| 195 | Ga0068867_101631799 | 3300005459 | Bacteria | 603 |
| 196 | Ga0068867_102143574 | 3300005459 | Bacteria | 530 |
| 197 | Ga0070685_10000247 | 3300005466 | Bacteria | 35364 |
| 198 | Ga0070685_10170446 | 3300005466 | Bacteria | 1395 |
| 199 | Ga0070685_10673582 | 3300005466 | Bacteria | 752 |
| 200 | Ga0070706_100854974 | 3300005467 | Bacteria | 841 |
| 201 | Ga0070706_101651486 | 3300005467 | Bacteria | 584 |
| 202 | Ga0070706_101900657 | 3300005467 | Bacteria | 540 |
| 203 | Ga0070707_100197763 | 3300005468 | Bacteria | 1960 |
| 204 | Ga0070707_100668794 | 3300005468 | Bacteria | 1001 |
| 205 | Ga0070707_101498227 | 3300005468 | Unclassified | 641 |
| 206 | Ga0070698_100057955 | 3300005471 | Bacteria | 3918 |
| 207 | Ga0070699_100488216 | 3300005518 | Bacteria | 1118 |
| 208 | Ga0070679_100164449 | 3300005530 | Bacteria | 2193 |
| 209 | Ga0070684_101061917 | 3300005535 | Bacteria | 761 |
| 210 | Ga0070684_101343794 | 3300005535 | Bacteria | 673 |
| 211 | Ga0070684_101685781 | 3300005535 | Bacteria | 598 |
| 212 | Ga0070697_101122962 | 3300005536 | Bacteria | 700 |
| 213 | Ga0068853_100681801 | 3300005539 | Bacteria | 979 |
| 214 | Ga0068853_101549709 | 3300005539 | Bacteria | 642 |
| 215 | Ga0068853_102430794 | 3300005539 | Bacteria | 507 |
| 216 | Ga0070672_100003882 | 3300005543 | Bacteria | 9735 |
| 217 | Ga0070672_100013080 | 3300005543 | Bacteria | 5849 |
| 218 | Ga0070672_100428434 | 3300005543 | Bacteria | 1137 |
| 219 | Ga0070672_100443636 | 3300005543 | Bacteria | 1117 |
| 220 | Ga0070672_100585006 | 3300005543 | Bacteria | 971 |
| 221 | Ga0070686_100036559 | 3300005544 | Bacteria | 3042 |
| 222 | Ga0070686_100060268 | 3300005544 | Bacteria | 2448 |
| 223 | Ga0070686_101446544 | 3300005544 | Unclassified | 578 |
| 224 | Ga0070695_100659325 | 3300005545 | Bacteria | 827 |
| 225 | Ga0070695_101106142 | 3300005545 | Bacteria | 649 |
| 226 | Ga0070696_100016374 | 3300005546 | Bacteria | 4991 |
| 227 | Ga0070696_100036845 | 3300005546 | Bacteria | 3374 |
| 228 | Ga0070696_100277159 | 3300005546 | Bacteria | 1277 |
| 229 | Ga0070696_100391765 | 3300005546 | Bacteria | 1085 |
| 230 | Ga0070665_100000217 | 3300005548 | Bacteria | 97947 |
| 231 | Ga0070665_100003281 | 3300005548 | Bacteria | 17362 |
| 232 | Ga0070665_100004044 | 3300005548 | Bacteria | 15418 |
| 233 | Ga0070665_100169050 | 3300005548 | Bacteria | 2188 |
| 234 | Ga0070665_100420202 | 3300005548 | Bacteria | 1346 |
| 235 | Ga0070665_100714477 | 3300005548 | Bacteria | 1015 |
| 236 | Ga0070665_101025369 | 3300005548 | Bacteria | 837 |
| 237 | Ga0070704_100604210 | 3300005549 | Bacteria | 964 |
| 238 | Ga0070704_100858386 | 3300005549 | Bacteria | 814 |
| 239 | Ga0070704_101036699 | 3300005549 | Unclassified | 743 |
| 240 | Ga0070704_101057917 | 3300005549 | Bacteria | 736 |
| 241 | Ga0070704_101298822 | 3300005549 | Bacteria | 666 |
| 242 | Ga0068855_100003860 | 3300005563 | Bacteria | 18319 |
| 243 | Ga0068855_100028542 | 3300005563 | Bacteria | 6675 |
| 244 | Ga0068855_100233241 | 3300005563 | Bacteria | 2059 |
| 245 | Ga0068855_101162278 | 3300005563 | Bacteria | 804 |
| 246 | Ga0068855_101608813 | 3300005563 | Bacteria | 665 |
| 247 | Ga0068855_102057311 | 3300005563 | Bacteria | 576 |
| 248 | Ga0070664_100030751 | 3300005564 | Bacteria | 4481 |
| 249 | Ga0070664_100145004 | 3300005564 | Bacteria | 2093 |
| 250 | Ga0070664_100568299 | 3300005564 | Bacteria | 1050 |
| 251 | Ga0070664_100757420 | 3300005564 | Bacteria | 907 |
| 252 | Ga0070664_101386209 | 3300005564 | Bacteria | 664 |
| 253 | Ga0068857_100049380 | 3300005577 | Bacteria | 3733 |
| 254 | Ga0068857_100100906 | 3300005577 | Bacteria | 2589 |
| 255 | Ga0068857_100121556 | 3300005577 | Bacteria | 2351 |
| 256 | Ga0068857_100238588 | 3300005577 | Bacteria | 1664 |
| 257 | Ga0068857_100297759 | 3300005577 | Bacteria | 1487 |
| 258 | Ga0068857_100528141 | 3300005577 | Bacteria | 1110 |
| 259 | Ga0068857_101021994 | 3300005577 | Bacteria | 796 |
| 260 | Ga0068857_101072340 | 3300005577 | Bacteria | 777 |
| 261 | Ga0068854_100003887 | 3300005578 | Bacteria | 9362 |
| 262 | Ga0068854_100345797 | 3300005578 | Bacteria | 1216 |
| 263 | Ga0068854_101131083 | 3300005578 | Bacteria | 699 |
| 264 | Ga0068856_100006103 | 3300005614 | Bacteria | 11833 |
| 265 | Ga0068856_100256786 | 3300005614 | Bacteria | 1763 |
| 266 | Ga0068856_100726103 | 3300005614 | Bacteria | 1014 |
| 267 | Ga0068856_101552463 | 3300005614 | Bacteria | 675 |
| 268 | Ga0070702_100501202 | 3300005615 | Bacteria | 892 |
| 269 | Ga0070702_100716159 | 3300005615 | Unclassified | 764 |
| 270 | Ga0068852_100357541 | 3300005616 | Bacteria | 1427 |
| 271 | Ga0068852_100703913 | 3300005616 | Bacteria | 1020 |
| 272 | Ga0068852_100763496 | 3300005616 | Bacteria | 979 |
| 273 | Ga0068852_101834674 | 3300005616 | Bacteria | 629 |
| 274 | Ga0068859_100000937 | 3300005617 | Bacteria | 29957 |
| 275 | Ga0068859_100158476 | 3300005617 | Bacteria | 2342 |
| 276 | Ga0068859_100771262 | 3300005617 | Bacteria | 1050 |
| 277 | Ga0068859_102191608 | 3300005617 | Bacteria | 610 |
| 278 | Ga0068859_102502470 | 3300005617 | Unclassified | 568 |
| 279 | Ga0068864_100101905 | 3300005618 | Bacteria | 2547 |
| 280 | Ga0068864_100255330 | 3300005618 | Bacteria | 1629 |
| 281 | Ga0068864_100552366 | 3300005618 | Unclassified | 1113 |
| 282 | Ga0068864_100769951 | 3300005618 | Bacteria | 944 |
| 283 | Ga0068864_101623756 | 3300005618 | Bacteria | 651 |
| 284 | Ga0068866_10066946 | 3300005718 | Bacteria | 1884 |
| 285 | Ga0068866_10444519 | 3300005718 | Bacteria | 846 |
| 286 | Ga0068866_10779257 | 3300005718 | Bacteria | 663 |
| 287 | Ga0068861_100001013 | 3300005719 | Bacteria | 17181 |
| 288 | Ga0068861_100001319 | 3300005719 | Bacteria | 15563 |
| 289 | Ga0068861_100030478 | 3300005719 | Bacteria | 3954 |
| 290 | Ga0068861_100314475 | 3300005719 | Bacteria | 1362 |
| 291 | Ga0068861_100749861 | 3300005719 | Bacteria | 912 |
| 292 | Ga0068861_100805982 | 3300005719 | Bacteria | 882 |
| 293 | Ga0068861_101034372 | 3300005719 | Bacteria | 786 |
| 294 | Ga0068851_10066729 | 3300005834 | Bacteria | 1854 |
| 295 | Ga0068851_10373581 | 3300005834 | Bacteria | 834 |
| 296 | Ga0068851_10394696 | 3300005834 | Bacteria | 813 |
| 297 | Ga0068870_10032554 | 3300005840 | Bacteria | 2652 |
| 298 | Ga0068870_10105888 | 3300005840 | Bacteria | 1598 |
| 299 | Ga0068863_100000168 | 3300005841 | Bacteria | 70935 |
| 300 | Ga0068863_100007022 | 3300005841 | Bacteria | 11035 |
| 301 | Ga0068863_100192390 | 3300005841 | Bacteria | 1961 |
| 302 | Ga0068863_100263679 | 3300005841 | Bacteria | 1666 |
| 303 | Ga0068863_100308978 | 3300005841 | Bacteria | 1534 |
| 304 | Ga0068863_100739573 | 3300005841 | Bacteria | 979 |
| 305 | Ga0068863_100847616 | 3300005841 | Bacteria | 913 |
| 306 | Ga0068863_102696448 | 3300005841 | Bacteria | 506 |
| 307 | Ga0068858_100002534 | 3300005842 | Bacteria | 18415 |
| 308 | Ga0068858_100474219 | 3300005842 | Unclassified | 1207 |
| 309 | Ga0068858_100764069 | 3300005842 | Bacteria | 942 |
| 310 | Ga0068858_101020675 | 3300005842 | Bacteria | 811 |
| 311 | Ga0068860_100000131 | 3300005843 | Bacteria | 121109 |
| 312 | Ga0068860_100002475 | 3300005843 | Bacteria | 19382 |
| 313 | Ga0068860_100025815 | 3300005843 | Bacteria | 5667 |
| 314 | Ga0068860_100176437 | 3300005843 | Bacteria | 2065 |
| 315 | Ga0068860_100310203 | 3300005843 | Bacteria | 1547 |
| 316 | Ga0068860_100646094 | 3300005843 | Bacteria | 1066 |
| 317 | Ga0068860_101715969 | 3300005843 | Unclassified | 650 |
| 318 | Ga0068860_102688113 | 3300005843 | Unclassified | 516 |
| 319 | Ga0068862_100006832 | 3300005844 | Bacteria | 9460 |
| 320 | Ga0068862_100021336 | 3300005844 | Bacteria | 5411 |
| 321 | Ga0068862_101185256 | 3300005844 | Bacteria | 762 |
| 322 | Ga0068862_102710344 | 3300005844 | Bacteria | 507 |
| 323 | Ga0075365_11127366 | 3300006038 | Bacteria | 552 |
| 324 | Ga0075363_100097265 | 3300006048 | Bacteria | 1626 |
| 325 | Ga0075432_10058225 | 3300006058 | Bacteria | 1372 |
| 326 | Ga0075432_10398390 | 3300006058 | Bacteria | 594 |
| 327 | Ga0075362_10000003 | 3300006177 | Bacteria | 171099 |
| 328 | Ga0075369_10006096 | 3300006186 | Bacteria | 4546 |
| 329 | Ga0075366_10000006 | 3300006195 | Bacteria | 106522 |
| 330 | Ga0075366_10004410 | 3300006195 | Bacteria | 7553 |
| 331 | Ga0075366_10009043 | 3300006195 | Bacteria | 5555 |
| 332 | Ga0075366_10159049 | 3300006195 | Bacteria | 1369 |
| 333 | Ga0075366_10404635 | 3300006195 | Bacteria | 840 |
| 334 | Ga0075366_10844270 | 3300006195 | Bacteria | 570 |
| 335 | Ga0075366_11077605 | 3300006195 | Bacteria | 502 |
| 336 | Ga0097621_100012982 | 3300006237 | Bacteria | 6191 |
| 337 | Ga0097621_100108950 | 3300006237 | Bacteria | 2339 |
| 338 | Ga0097621_100443070 | 3300006237 | Bacteria | 1169 |
| 339 | Ga0097621_100536177 | 3300006237 | Bacteria | 1064 |
| 340 | Ga0075370_10000008 | 3300006353 | Bacteria | 97966 |
| 341 | Ga0068871_100021925 | 3300006358 | Bacteria | 4919 |
| 342 | Ga0068871_100081486 | 3300006358 | Bacteria | 2681 |
| 343 | Ga0068871_100195049 | 3300006358 | Bacteria | 1746 |
| 344 | Ga0068871_101648311 | 3300006358 | Bacteria | 608 |
| 345 | Ga0075428_100024545 | 3300006844 | Bacteria | 6671 |
| 346 | Ga0075428_100048029 | 3300006844 | Bacteria | 4686 |
| 347 | Ga0075428_100363049 | 3300006844 | Bacteria | 1553 |
| 348 | Ga0075428_100557585 | 3300006844 | Bacteria | 1225 |
| 349 | Ga0075428_100970852 | 3300006844 | Bacteria | 900 |
| 350 | Ga0075428_102091665 | 3300006844 | Bacteria | 586 |
| 351 | Ga0075428_102220881 | 3300006844 | Bacteria | 566 |
| 352 | Ga0075430_100028496 | 3300006846 | Bacteria | 4744 |
| 353 | Ga0075430_100230052 | 3300006846 | Bacteria | 1537 |
| 354 | Ga0075430_100267734 | 3300006846 | Bacteria | 1415 |
| 355 | Ga0075430_100517176 | 3300006846 | Bacteria | 985 |
| 356 | Ga0075430_100661347 | 3300006846 | Bacteria | 861 |
| 357 | Ga0075431_100004046 | 3300006847 | Bacteria | 14286 |
| 358 | Ga0075431_100009192 | 3300006847 | Bacteria | 9912 |
| 359 | Ga0075431_100081587 | 3300006847 | Bacteria | 3339 |
| 360 | Ga0075431_100325052 | 3300006847 | Bacteria | 1550 |
| 361 | Ga0075431_100441752 | 3300006847 | Bacteria | 1298 |
| 362 | Ga0075431_100515661 | 3300006847 | Bacteria | 1185 |
| 363 | Ga0075431_100659061 | 3300006847 | Bacteria | 1027 |
| 364 | Ga0075431_101525665 | 3300006847 | Bacteria | 626 |
| 365 | Ga0075433_10001740 | 3300006852 | Bacteria | 16258 |
| 366 | Ga0075433_10026664 | 3300006852 | Bacteria | 4896 |
| 367 | Ga0075433_10120072 | 3300006852 | Unclassified | 2333 |
| 368 | Ga0075433_11621746 | 3300006852 | Unclassified | 558 |
| 369 | Ga0075433_11756301 | 3300006852 | Bacteria | 534 |
| 370 | Ga0075434_100469506 | 3300006871 | Bacteria | 1279 |
| 371 | Ga0075434_100631572 | 3300006871 | Unclassified | 1090 |
| 372 | Ga0075429_100066252 | 3300006880 | Bacteria | 3144 |
| 373 | Ga0075429_100282556 | 3300006880 | Bacteria | 1453 |
| 374 | Ga0075429_100821512 | 3300006880 | Bacteria | 814 |
| 375 | Ga0075429_101527745 | 3300006880 | Bacteria | 581 |
| 376 | Ga0068865_100192080 | 3300006881 | Bacteria | 1580 |
| 377 | Ga0068865_100776754 | 3300006881 | Bacteria | 825 |
| 378 | Ga0068865_100790184 | 3300006881 | Bacteria | 818 |
| 379 | Ga0068865_101295288 | 3300006881 | Bacteria | 648 |
| 380 | Ga0068865_101624523 | 3300006881 | Bacteria | 581 |
| 381 | Ga0097620_100000937 | 3300006931 | Bacteria | 29957 |
| 382 | Ga0097620_100158469 | 3300006931 | Bacteria | 2342 |
| 383 | Ga0097620_100771242 | 3300006931 | Bacteria | 1050 |
| 384 | Ga0097620_102191919 | 3300006931 | Bacteria | 610 |
| 385 | Ga0097620_102501853 | 3300006931 | Unclassified | 568 |
| 386 | Ga0075435_100704095 | 3300007076 | Bacteria | 878 |
| 387 | Ga0075435_101134671 | 3300007076 | Bacteria | 683 |
| 388 | Ga0075435_101329195 | 3300007076 | Bacteria | 630 |
| 389 | Ga0075435_102013855 | 3300007076 | Unclassified | 507 |
| 390 | Ga0105251_10000008 | 3300009011 | Bacteria | 213669 |
| 391 | Ga0105251_10000862 | 3300009011 | Bacteria | 27182 |
| 392 | Ga0105240_10031828 | 3300009093 | Bacteria | 6834 |
| 393 | Ga0105240_10105419 | 3300009093 | Bacteria | 3422 |
| 394 | Ga0105240_10487802 | 3300009093 | Bacteria | 1372 |
| 395 | Ga0105240_10964699 | 3300009093 | Bacteria | 914 |
| 396 | Ga0105240_11380651 | 3300009093 | Bacteria | 741 |
| 397 | Ga0105240_12176803 | 3300009093 | Bacteria | 575 |
| 398 | Ga0111539_10043567 | 3300009094 | Bacteria | 5379 |
| 399 | Ga0111539_10060790 | 3300009094 | Bacteria | 4477 |
| 400 | Ga0111539_10173166 | 3300009094 | Bacteria | 2521 |
| 401 | Ga0111539_10226322 | 3300009094 | Bacteria | 2178 |
| 402 | Ga0111539_10285154 | 3300009094 | Bacteria | 1922 |
| 403 | Ga0111539_10344112 | 3300009094 | Bacteria | 1736 |
| 404 | Ga0111539_11189430 | 3300009094 | Bacteria | 885 |
| 405 | Ga0111539_12123566 | 3300009094 | Bacteria | 652 |
| 406 | Ga0111539_12387773 | 3300009094 | Bacteria | 613 |
| 407 | Ga0111539_13076893 | 3300009094 | Bacteria | 538 |
| 408 | Ga0105247_10007739 | 3300009101 | Bacteria | 6576 |
| 409 | Ga0105247_10058703 | 3300009101 | Unclassified | 2381 |
| 410 | Ga0105247_10102551 | 3300009101 | Bacteria | 1831 |
| 411 | Ga0114129_10091923 | 3300009147 | Bacteria | 4203 |
| 412 | Ga0114129_10138853 | 3300009147 | Bacteria | 3333 |
| 413 | Ga0114129_10823468 | 3300009147 | Bacteria | 1182 |
| 414 | Ga0114129_11034319 | 3300009147 | Bacteria | 1032 |
| 415 | Ga0114129_11274551 | 3300009147 | Bacteria | 912 |
| 416 | Ga0105243_10061151 | 3300009148 | Bacteria | 3011 |
| 417 | Ga0105243_10702909 | 3300009148 | Bacteria | 986 |
| 418 | Ga0105243_11253727 | 3300009148 | Bacteria | 757 |
| 419 | Ga0105243_12460235 | 3300009148 | Bacteria | 559 |
| 420 | Ga0105241_10001628 | 3300009174 | Bacteria | 17126 |
| 421 | Ga0105241_10144017 | 3300009174 | Bacteria | 1943 |
| 422 | Ga0105241_10642196 | 3300009174 | Bacteria | 963 |
| 423 | Ga0105242_11236447 | 3300009176 | Bacteria | 768 |
| 424 | Ga0105242_11635349 | 3300009176 | Bacteria | 679 |
| 425 | Ga0105242_12543832 | 3300009176 | Bacteria | 560 |
| 426 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 427 | Ga0105248_10016965 | 3300009177 | Bacteria | 8018 |
| 428 | Ga0105248_10435177 | 3300009177 | Bacteria | 1477 |
| 429 | Ga0105248_11747331 | 3300009177 | Bacteria | 705 |
| 430 | Ga0105237_10016667 | 3300009545 | Bacteria | 7631 |
| 431 | Ga0105237_10531086 | 3300009545 | Bacteria | 1183 |
| 432 | Ga0105237_10543583 | 3300009545 | Bacteria | 1168 |
| 433 | Ga0105238_10151678 | 3300009551 | Bacteria | 2292 |
| 434 | Ga0105238_10273381 | 3300009551 | Bacteria | 1670 |
| 435 | Ga0105238_11141734 | 3300009551 | Bacteria | 802 |
| 436 | Ga0105249_10016789 | 3300009553 | Bacteria | 6495 |
| 437 | Ga0105249_10026693 | 3300009553 | Bacteria | 5207 |
| 438 | Ga0105249_10061210 | 3300009553 | Bacteria | 3454 |
| 439 | Ga0105249_10571229 | 3300009553 | Unclassified | 1183 |
| 440 | Ga0105249_10579820 | 3300009553 | Bacteria | 1175 |
| 441 | Ga0105249_10773039 | 3300009553 | Bacteria | 1023 |
| 442 | Ga0105249_11123273 | 3300009553 | Bacteria | 856 |
| 443 | Ga0105148_100020 | 3300009978 | Bacteria | 23647 |
| 444 | Ga0105239_10090913 | 3300010375 | Bacteria | 3368 |
| 445 | Ga0105239_10117318 | 3300010375 | Bacteria | 2954 |
| 446 | Ga0105239_10160219 | 3300010375 | Bacteria | 2513 |
| 447 | Ga0105239_10676300 | 3300010375 | Bacteria | 1180 |
| 448 | Ga0105239_10973580 | 3300010375 | Bacteria | 975 |
| 449 | Ga0105239_13198513 | 3300010375 | Bacteria | 533 |
| 450 | Ga0105239_13492167 | 3300010375 | Bacteria | 511 |
| 451 | Ga0105246_10395339 | 3300011119 | Bacteria | 1146 |
| 452 | Ga0105246_10482363 | 3300011119 | Bacteria | 1049 |
| 453 | Ga0157317_1011268 | 3300012475 | Bacteria | 695 |
| 454 | Ga0157318_1004150 | 3300012482 | Bacteria | 872 |
| 455 | Ga0157337_1033049 | 3300012483 | Bacteria | 539 |
| 456 | Ga0157325_1011370 | 3300012485 | Bacteria | 669 |
| 457 | Ga0157343_1029663 | 3300012488 | Bacteria | 545 |
| 458 | Ga0157329_1010315 | 3300012491 | Bacteria | 730 |
| 459 | Ga0157323_1005241 | 3300012495 | Bacteria | 861 |
| 460 | Ga0157345_1017245 | 3300012498 | Bacteria | 701 |
| 461 | Ga0157313_1031199 | 3300012503 | Bacteria | 606 |
| 462 | Ga0157324_1016458 | 3300012506 | Bacteria | 704 |
| 463 | Ga0157324_1033534 | 3300012506 | Bacteria | 594 |
| 464 | Ga0157327_1001313 | 3300012512 | Bacteria | 1534 |
| 465 | Ga0157326_1056645 | 3300012513 | Bacteria | 589 |
| 466 | Ga0157338_1016355 | 3300012515 | Bacteria | 819 |
| 467 | Ga0157373_10064081 | 3300013100 | Bacteria | 2602 |
| 468 | Ga0157373_10544698 | 3300013100 | Bacteria | 841 |
| 469 | Ga0157371_10088817 | 3300013102 | Bacteria | 2189 |
| 470 | Ga0157370_10022193 | 3300013104 | Bacteria | 6317 |
| 471 | Ga0157370_10085421 | 3300013104 | Bacteria | 2964 |
| 472 | Ga0157370_11406289 | 3300013104 | Bacteria | 628 |
| 473 | Ga0157369_10038912 | 3300013105 | Bacteria | 5199 |
| 474 | Ga0157369_10202691 | 3300013105 | Bacteria | 2082 |
| 475 | Ga0157378_10062716 | 3300013297 | Bacteria | 3320 |
| 476 | Ga0157378_10461754 | 3300013297 | Bacteria | 1262 |
| 477 | Ga0163162_10007277 | 3300013306 | Bacteria | 10751 |
| 478 | Ga0163162_10027802 | 3300013306 | Bacteria | 5595 |
| 479 | Ga0163162_10079660 | 3300013306 | Unclassified | 3341 |
| 480 | Ga0163162_10268689 | 3300013306 | Bacteria | 1837 |
| 481 | Ga0163162_11257646 | 3300013306 | Bacteria | 840 |
| 482 | Ga0163162_11570973 | 3300013306 | Bacteria | 750 |
| 483 | Ga0157372_10106546 | 3300013307 | Bacteria | 3206 |
| 484 | Ga0157372_10810324 | 3300013307 | Bacteria | 1088 |
| 485 | Ga0157372_13042401 | 3300013307 | Bacteria | 536 |
| 486 | Ga0157375_10100139 | 3300013308 | Bacteria | 2978 |
| 487 | Ga0157375_11573925 | 3300013308 | Bacteria | 777 |
| 488 | Ga0157375_12526301 | 3300013308 | Bacteria | 613 |
| 489 | Ga0163163_10011107 | 3300014325 | Bacteria | 8150 |
| 490 | Ga0163163_10093241 | 3300014325 | Unclassified | 3028 |
| 491 | Ga0163163_10183020 | 3300014325 | Bacteria | 2143 |
| 492 | Ga0157380_10000094 | 3300014326 | Bacteria | 48823 |
| 493 | Ga0157380_10000231 | 3300014326 | Bacteria | 33437 |
| 494 | Ga0157380_10006104 | 3300014326 | Bacteria | 8445 |
| 495 | Ga0157380_10069618 | 3300014326 | Bacteria | 2840 |
| 496 | Ga0157380_10410514 | 3300014326 | Bacteria | 1288 |
| 497 | Ga0157380_10436687 | 3300014326 | Unclassified | 1253 |
| 498 | Ga0157380_10482747 | 3300014326 | Bacteria | 1199 |
| 499 | Ga0157380_10865218 | 3300014326 | Bacteria | 927 |
| 500 | Ga0157380_11043423 | 3300014326 | Bacteria | 853 |
| 501 | Ga0157380_13117482 | 3300014326 | Bacteria | 529 |
| 502 | Ga0157377_11151462 | 3300014745 | Bacteria | 597 |
| 503 | Ga0157379_10060743 | 3300014968 | Bacteria | 3379 |
| 504 | Ga0157379_10148470 | 3300014968 | Bacteria | 2114 |
| 505 | Ga0157379_12169131 | 3300014968 | Bacteria | 551 |
| 506 | Ga0157376_10004537 | 3300014969 | Bacteria | 9669 |
| 507 | Ga0157376_10128485 | 3300014969 | Bacteria | 2258 |
| 508 | Ga0157376_10625195 | 3300014969 | Bacteria | 1074 |
| 509 | Ga0157376_11404345 | 3300014969 | Bacteria | 730 |
| 510 | Ga0157376_12456480 | 3300014969 | Bacteria | 561 |
| 511 | Ga0182006_1111727 | 3300015261 | Bacteria | 958 |
| 512 | Ga0182005_1005698 | 3300015265 | Bacteria | 3870 |
| 513 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 514 | Ga0183361_10068 | 3300016635 | Bacteria | 3137 |
| 515 | Ga0163161_10013470 | 3300017792 | Bacteria | 5692 |
| 516 | Ga0163161_10295590 | 3300017792 | Bacteria | 1274 |
| 517 | Ga0163161_11623367 | 3300017792 | Bacteria | 571 |
| 518 | Ga0206356_11610434 | 3300020070 | Bacteria | 1269 |
| 519 | Ga0206355_1457572 | 3300020076 | Bacteria | 669 |
| 520 | Ga0206352_10030070 | 3300020078 | Bacteria | 685 |
| 521 | Ga0206350_10854057 | 3300020080 | Bacteria | 538 |
| 522 | Ga0206353_10274352 | 3300020082 | Bacteria | 633 |
| 523 | Ga0206353_11844162 | 3300020082 | Bacteria | 2022 |
| 524 | Ga0213873_10000021 | 3300021358 | Bacteria | 113830 |
| 525 | Ga0213876_10000050 | 3300021384 | Bacteria | 144836 |
| 526 | Ga0213876_10195201 | 3300021384 | Bacteria | 1076 |
| 527 | Ga0224712_10563422 | 3300022467 | Bacteria | 554 |
| 528 | Ga0256744_123496 | 3300023309 | Bacteria | 590 |
| 529 | Ga0209436_105263 | 3300025208 | Bacteria | 3005 |
| 530 | Ga0209147_100422 | 3300025229 | Bacteria | 27834 |
| 531 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 532 | Ga0209129_1008702 | 3300025258 | Bacteria | 2785 |
| 533 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 534 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 535 | Ga0209565_1018477 | 3300025263 | Bacteria | 1507 |
| 536 | Ga0209673_1000889 | 3300025273 | Bacteria | 38489 |
| 537 | Ga0209673_1066750 | 3300025273 | Bacteria | 873 |
| 538 | Ga0209675_1015193 | 3300025291 | Bacteria | 2300 |
| 539 | Ga0209676_1016986 | 3300025292 | Bacteria | 2596 |
| 540 | Ga0209676_1018694 | 3300025292 | Bacteria | 2410 |
| 541 | Ga0209025_1000128 | 3300025294 | Bacteria | 198859 |
| 542 | Ga0209564_1005977 | 3300025295 | Bacteria | 6732 |
| 543 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 544 | Ga0209758_1004078 | 3300025297 | Bacteria | 12557 |
| 545 | Ga0209758_1042906 | 3300025297 | Bacteria | 1672 |
| 546 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 547 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 548 | Ga0209050_1000166 | 3300025298 | Bacteria | 152073 |
| 549 | Ga0209050_1001430 | 3300025298 | Bacteria | 25721 |
| 550 | Ga0209050_1007906 | 3300025298 | Bacteria | 5827 |
| 551 | Ga0209050_1032398 | 3300025298 | Bacteria | 1608 |
| 552 | Ga0209050_1053035 | 3300025298 | Bacteria | 1011 |
| 553 | Ga0209050_1077000 | 3300025298 | Bacteria | 722 |
| 554 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 555 | Ga0207426_1011881 | 3300025302 | Bacteria | 3295 |
| 556 | Ga0209051_1001966 | 3300025303 | Bacteria | 15798 |
| 557 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 558 | Ga0209257_1002317 | 3300025304 | Bacteria | 19252 |
| 559 | Ga0209257_1005763 | 3300025304 | Bacteria | 8460 |
| 560 | Ga0209257_1012431 | 3300025304 | Bacteria | 3936 |
| 561 | Ga0209257_1032794 | 3300025304 | Bacteria | 1642 |
| 562 | Ga0207656_10227708 | 3300025321 | Bacteria | 908 |
| 563 | Ga0207713_1000170 | 3300025735 | Bacteria | 94864 |
| 564 | Ga0207682_10363370 | 3300025893 | Bacteria | 682 |
| 565 | Ga0207692_10192324 | 3300025898 | Bacteria | 1195 |
| 566 | Ga0207642_10224158 | 3300025899 | Bacteria | 1052 |
| 567 | Ga0207642_10577309 | 3300025899 | Bacteria | 697 |
| 568 | Ga0207642_10723090 | 3300025899 | Bacteria | 629 |
| 569 | Ga0207642_10991912 | 3300025899 | Bacteria | 541 |
| 570 | Ga0207680_10012356 | 3300025903 | Bacteria | 4346 |
| 571 | Ga0207680_10826258 | 3300025903 | Unclassified | 664 |
| 572 | Ga0207647_10006880 | 3300025904 | Bacteria | 8244 |
| 573 | Ga0207685_10395253 | 3300025905 | Bacteria | 707 |
| 574 | Ga0207645_10111059 | 3300025907 | Bacteria | 1775 |
| 575 | Ga0207645_10463322 | 3300025907 | Bacteria | 856 |
| 576 | Ga0207643_10048516 | 3300025908 | Bacteria | 2405 |
| 577 | Ga0207643_10220695 | 3300025908 | Bacteria | 1160 |
| 578 | Ga0207643_10348096 | 3300025908 | Bacteria | 930 |
| 579 | Ga0207643_11136689 | 3300025908 | Bacteria | 503 |
| 580 | Ga0207705_10121191 | 3300025909 | Bacteria | 1941 |
| 581 | Ga0207705_10214744 | 3300025909 | Bacteria | 1459 |
| 582 | Ga0207705_11064686 | 3300025909 | Bacteria | 624 |
| 583 | Ga0207684_10039770 | 3300025910 | Bacteria | 3987 |
| 584 | Ga0207684_11421547 | 3300025910 | Bacteria | 567 |
| 585 | Ga0207654_10016757 | 3300025911 | Bacteria | 3819 |
| 586 | Ga0207654_10285572 | 3300025911 | Bacteria | 1117 |
| 587 | Ga0207707_10350915 | 3300025912 | Bacteria | 1271 |
| 588 | Ga0207695_10070089 | 3300025913 | Bacteria | 3586 |
| 589 | Ga0207695_10126174 | 3300025913 | Bacteria | 2521 |
| 590 | Ga0207695_11085915 | 3300025913 | Bacteria | 680 |
| 591 | Ga0207671_10008759 | 3300025914 | Bacteria | 8522 |
| 592 | Ga0207671_10107104 | 3300025914 | Bacteria | 2123 |
| 593 | Ga0207671_10566191 | 3300025914 | Bacteria | 906 |
| 594 | Ga0207660_10066673 | 3300025917 | Bacteria | 2605 |
| 595 | Ga0207662_10187893 | 3300025918 | Bacteria | 1332 |
| 596 | Ga0207662_10601706 | 3300025918 | Bacteria | 765 |
| 597 | Ga0207657_10020932 | 3300025919 | Bacteria | 6171 |
| 598 | Ga0207657_10267108 | 3300025919 | Bacteria | 1360 |
| 599 | Ga0207649_10492398 | 3300025920 | Bacteria | 931 |
| 600 | Ga0207649_10580142 | 3300025920 | Bacteria | 861 |
| 601 | Ga0207646_10585954 | 3300025922 | Bacteria | 1002 |
| 602 | Ga0207646_10875273 | 3300025922 | Bacteria | 798 |
| 603 | Ga0207646_11222917 | 3300025922 | Unclassified | 658 |
| 604 | Ga0207681_10010695 | 3300025923 | Bacteria | 5630 |
| 605 | Ga0207681_10019692 | 3300025923 | Bacteria | 4268 |
| 606 | Ga0207681_10036351 | 3300025923 | Bacteria | 3249 |
| 607 | Ga0207681_10071528 | 3300025923 | Bacteria | 2420 |
| 608 | Ga0207681_10081198 | 3300025923 | Bacteria | 2289 |
| 609 | Ga0207681_10484851 | 3300025923 | Bacteria | 1010 |
| 610 | Ga0207681_11871868 | 3300025923 | Bacteria | 500 |
| 611 | Ga0207694_10058269 | 3300025924 | Bacteria | 3004 |
| 612 | Ga0207694_10316876 | 3300025924 | Bacteria | 1286 |
| 613 | Ga0207694_10795760 | 3300025924 | Bacteria | 799 |
| 614 | Ga0207650_10000609 | 3300025925 | Bacteria | 28609 |
| 615 | Ga0207650_10018590 | 3300025925 | Bacteria | 4878 |
| 616 | Ga0207650_10127839 | 3300025925 | Bacteria | 1985 |
| 617 | Ga0207650_10203994 | 3300025925 | Bacteria | 1585 |
| 618 | Ga0207650_10734858 | 3300025925 | Bacteria | 835 |
| 619 | Ga0207650_11049786 | 3300025925 | Bacteria | 693 |
| 620 | Ga0207659_10070632 | 3300025926 | Bacteria | 2547 |
| 621 | Ga0207659_11267932 | 3300025926 | Bacteria | 633 |
| 622 | Ga0207644_10109784 | 3300025931 | Bacteria | 2084 |
| 623 | Ga0207690_10200195 | 3300025932 | Bacteria | 1516 |
| 624 | Ga0207690_10263195 | 3300025932 | Bacteria | 1337 |
| 625 | Ga0207690_10472198 | 3300025932 | Bacteria | 1011 |
| 626 | Ga0207690_10537175 | 3300025932 | Bacteria | 949 |
| 627 | Ga0207690_10554120 | 3300025932 | Bacteria | 935 |
| 628 | Ga0207706_10004192 | 3300025933 | Bacteria | 13574 |
| 629 | Ga0207706_10005112 | 3300025933 | Bacteria | 12245 |
| 630 | Ga0207706_10579662 | 3300025933 | Bacteria | 965 |
| 631 | Ga0207706_10685804 | 3300025933 | Bacteria | 876 |
| 632 | Ga0207706_11409165 | 3300025933 | Bacteria | 572 |
| 633 | Ga0207709_10033646 | 3300025935 | Bacteria | 3012 |
| 634 | Ga0207709_10098211 | 3300025935 | Bacteria | 1930 |
| 635 | Ga0207709_10347470 | 3300025935 | Bacteria | 1118 |
| 636 | Ga0207709_10623351 | 3300025935 | Bacteria | 856 |
| 637 | Ga0207670_10392327 | 3300025936 | Bacteria | 1108 |
| 638 | Ga0207670_10909281 | 3300025936 | Bacteria | 737 |
| 639 | Ga0207669_10178645 | 3300025937 | Bacteria | 1519 |
| 640 | Ga0207669_10627153 | 3300025937 | Bacteria | 877 |
| 641 | Ga0207669_11251853 | 3300025937 | Bacteria | 629 |
| 642 | Ga0207704_10763913 | 3300025938 | Bacteria | 805 |
| 643 | Ga0207704_11088079 | 3300025938 | Bacteria | 679 |
| 644 | Ga0207704_11397064 | 3300025938 | Bacteria | 600 |
| 645 | Ga0207665_10653358 | 3300025939 | Bacteria | 824 |
| 646 | Ga0207691_10017008 | 3300025940 | Bacteria | 6901 |
| 647 | Ga0207691_10294334 | 3300025940 | Bacteria | 1396 |
| 648 | Ga0207691_10678455 | 3300025940 | Bacteria | 870 |
| 649 | Ga0207711_10527097 | 3300025941 | Bacteria | 1102 |
| 650 | Ga0207711_11751188 | 3300025941 | Bacteria | 565 |
| 651 | Ga0207689_10075163 | 3300025942 | Bacteria | 2777 |
| 652 | Ga0207689_10281180 | 3300025942 | Bacteria | 1378 |
| 653 | Ga0207689_10479198 | 3300025942 | Bacteria | 1042 |
| 654 | Ga0207661_10945605 | 3300025944 | Bacteria | 794 |
| 655 | Ga0207661_11032044 | 3300025944 | Bacteria | 757 |
| 656 | Ga0207679_10413999 | 3300025945 | Bacteria | 1188 |
| 657 | Ga0207679_10523520 | 3300025945 | Bacteria | 1061 |
| 658 | Ga0207679_10805260 | 3300025945 | Bacteria | 857 |
| 659 | Ga0207679_10963551 | 3300025945 | Bacteria | 781 |
| 660 | Ga0207667_10005788 | 3300025949 | Bacteria | 15080 |
| 661 | Ga0207667_10597412 | 3300025949 | Bacteria | 1113 |
| 662 | Ga0207667_11472856 | 3300025949 | Bacteria | 652 |
| 663 | Ga0207651_10856766 | 3300025960 | Bacteria | 808 |
| 664 | Ga0207712_10212028 | 3300025961 | Bacteria | 1543 |
| 665 | Ga0207712_10687640 | 3300025961 | Bacteria | 892 |
| 666 | Ga0207712_10717224 | 3300025961 | Bacteria | 874 |
| 667 | Ga0207712_11347131 | 3300025961 | Bacteria | 638 |
| 668 | Ga0207712_11853353 | 3300025961 | Unclassified | 540 |
| 669 | Ga0207668_10000430 | 3300025972 | Bacteria | 26480 |
| 670 | Ga0207668_10025250 | 3300025972 | Bacteria | 3843 |
| 671 | Ga0207668_10178791 | 3300025972 | Bacteria | 1671 |
| 672 | Ga0207668_10292187 | 3300025972 | Bacteria | 1341 |
| 673 | Ga0207668_11327794 | 3300025972 | Bacteria | 648 |
| 674 | Ga0207668_11611722 | 3300025972 | Bacteria | 586 |
| 675 | Ga0207668_11643110 | 3300025972 | Unclassified | 580 |
| 676 | Ga0207668_11922032 | 3300025972 | Bacteria | 533 |
| 677 | Ga0207668_12003485 | 3300025972 | Bacteria | 522 |
| 678 | Ga0207640_10009603 | 3300025981 | Bacteria | 5423 |
| 679 | Ga0207640_10099519 | 3300025981 | Bacteria | 2035 |
| 680 | Ga0207640_11774739 | 3300025981 | Bacteria | 557 |
| 681 | Ga0207658_10000243 | 3300025986 | Bacteria | 57023 |
| 682 | Ga0207658_10001048 | 3300025986 | Bacteria | 22433 |
| 683 | Ga0207677_10167615 | 3300026023 | Bacteria | 1714 |
| 684 | Ga0207677_10757731 | 3300026023 | Bacteria | 866 |
| 685 | Ga0207703_10071564 | 3300026035 | Bacteria | 2864 |
| 686 | Ga0207703_10778785 | 3300026035 | Bacteria | 912 |
| 687 | Ga0207703_10887307 | 3300026035 | Bacteria | 854 |
| 688 | Ga0207703_11455888 | 3300026035 | Unclassified | 659 |
| 689 | Ga0207703_11496307 | 3300026035 | Bacteria | 649 |
| 690 | Ga0207703_12250445 | 3300026035 | Bacteria | 521 |
| 691 | Ga0207639_10014460 | 3300026041 | Bacteria | 5553 |
| 692 | Ga0207639_11226195 | 3300026041 | Bacteria | 704 |
| 693 | Ga0207639_11575440 | 3300026041 | Bacteria | 616 |
| 694 | Ga0207678_10000773 | 3300026067 | Bacteria | 29183 |
| 695 | Ga0207678_10836914 | 3300026067 | Bacteria | 813 |
| 696 | Ga0207708_10072421 | 3300026075 | Bacteria | 2640 |
| 697 | Ga0207708_10073525 | 3300026075 | Bacteria | 2620 |
| 698 | Ga0207708_10203973 | 3300026075 | Unclassified | 1578 |
| 699 | Ga0207708_10741462 | 3300026075 | Bacteria | 842 |
| 700 | Ga0207702_10012453 | 3300026078 | Bacteria | 7081 |
| 701 | Ga0207702_10142870 | 3300026078 | Bacteria | 2168 |
| 702 | Ga0207641_10000241 | 3300026088 | Bacteria | 71027 |
| 703 | Ga0207641_10006798 | 3300026088 | Bacteria | 9584 |
| 704 | Ga0207641_10684046 | 3300026088 | Bacteria | 1009 |
| 705 | Ga0207641_11158621 | 3300026088 | Bacteria | 772 |
| 706 | Ga0207641_11615309 | 3300026088 | Bacteria | 650 |
| 707 | Ga0207648_10012302 | 3300026089 | Bacteria | 8012 |
| 708 | Ga0207648_10438395 | 3300026089 | Bacteria | 1188 |
| 709 | Ga0207676_10109232 | 3300026095 | Bacteria | 2311 |
| 710 | Ga0207676_10118267 | 3300026095 | Bacteria | 2230 |
| 711 | Ga0207676_10382461 | 3300026095 | Bacteria | 1311 |
| 712 | Ga0207676_10935398 | 3300026095 | Bacteria | 852 |
| 713 | Ga0207676_10959843 | 3300026095 | Unclassified | 841 |
| 714 | Ga0207674_10005038 | 3300026116 | Bacteria | 15771 |
| 715 | Ga0207674_10043654 | 3300026116 | Bacteria | 4622 |
| 716 | Ga0207674_10151794 | 3300026116 | Bacteria | 2273 |
| 717 | Ga0207674_10246151 | 3300026116 | Bacteria | 1735 |
| 718 | Ga0207674_10354086 | 3300026116 | Bacteria | 1419 |
| 719 | Ga0207674_10890504 | 3300026116 | Bacteria | 858 |
| 720 | Ga0207674_11391114 | 3300026116 | Bacteria | 671 |
| 721 | Ga0207675_100000471 | 3300026118 | Bacteria | 39106 |
| 722 | Ga0207675_100000520 | 3300026118 | Bacteria | 37450 |
| 723 | Ga0207675_100140913 | 3300026118 | Bacteria | 2290 |
| 724 | Ga0207675_100403404 | 3300026118 | Bacteria | 1347 |
| 725 | Ga0207675_100854669 | 3300026118 | Bacteria | 925 |
| 726 | Ga0207675_102203382 | 3300026118 | Bacteria | 566 |
| 727 | Ga0207675_102275401 | 3300026118 | Bacteria | 556 |
| 728 | Ga0207683_11963639 | 3300026121 | Bacteria | 534 |
| 729 | Ga0207698_10018892 | 3300026142 | Bacteria | 4707 |
| 730 | Ga0207698_10071771 | 3300026142 | Bacteria | 2749 |
| 731 | Ga0207698_11655560 | 3300026142 | Bacteria | 655 |
| 732 | Ga0207698_11994847 | 3300026142 | Bacteria | 595 |
| 733 | Ga0209371_1000235 | 3300027312 | Bacteria | 69492 |
| 734 | Ga0209813_10269161 | 3300027866 | Bacteria | 653 |
| 735 | Ga0207428_10026662 | 3300027907 | Bacteria | 4820 |
| 736 | Ga0207428_10042112 | 3300027907 | Bacteria | 3694 |
| 737 | Ga0207428_10093739 | 3300027907 | Bacteria | 2328 |
| 738 | Ga0207428_10406134 | 3300027907 | Bacteria | 997 |
| 739 | Ga0207428_10760017 | 3300027907 | Bacteria | 690 |
| 740 | Ga0207428_11275043 | 3300027907 | Bacteria | 510 |
| 741 | Ga0268266_10133236 | 3300028379 | Bacteria | 2224 |
| 742 | Ga0268266_10433855 | 3300028379 | Bacteria | 1247 |
| 743 | Ga0268266_10860980 | 3300028379 | Bacteria | 876 |
| 744 | Ga0268266_10872419 | 3300028379 | Bacteria | 870 |
| 745 | Ga0268266_10921217 | 3300028379 | Bacteria | 845 |
| 746 | Ga0268265_10011098 | 3300028380 | Bacteria | 6087 |
| 747 | Ga0268265_10011632 | 3300028380 | Bacteria | 5951 |
| 748 | Ga0268265_10026242 | 3300028380 | Bacteria | 4143 |
| 749 | Ga0268265_10320918 | 3300028380 | Bacteria | 1403 |
| 750 | Ga0268265_10731128 | 3300028380 | Unclassified | 959 |
| 751 | Ga0268265_10807366 | 3300028380 | Bacteria | 915 |
| 752 | Ga0268265_11955963 | 3300028380 | Bacteria | 593 |
| 753 | Ga0268265_12030754 | 3300028380 | Bacteria | 582 |
| 754 | Ga0268264_10000204 | 3300028381 | Bacteria | 120959 |
| 755 | Ga0268264_10001562 | 3300028381 | Bacteria | 21229 |
| 756 | Ga0268264_10052641 | 3300028381 | Bacteria | 3395 |
| 757 | Ga0268264_10263909 | 3300028381 | Bacteria | 1606 |
| 758 | Ga0268264_10547266 | 3300028381 | Bacteria | 1135 |
| 759 | Ga0307515_10496291 | 3300028794 | Bacteria | 832 |
| 760 | Ga0268256_1000196 | 3300030500 | Bacteria | 69428 |
| 761 | Ga0314311_1176710 | 3300030733 | Bacteria | 948 |
| 762 | Ga0307513_10037481 | 3300031456 | Bacteria | 5396 |
| 763 | Ga0307509_10097611 | 3300031507 | Bacteria | 2986 |
| 764 | Ga0307408_100003838 | 3300031548 | Bacteria | 10223 |
| 765 | Ga0307408_100451402 | 3300031548 | Bacteria | 1115 |
| 766 | Ga0307408_100675059 | 3300031548 | Bacteria | 926 |
| 767 | Ga0307408_101381152 | 3300031548 | Bacteria | 662 |
| 768 | Ga0307408_102033639 | 3300031548 | Bacteria | 553 |
| 769 | Ga0307516_10420231 | 3300031730 | Bacteria | 995 |
| 770 | Ga0307405_10050959 | 3300031731 | Bacteria | 2566 |
| 771 | Ga0307405_10353778 | 3300031731 | Bacteria | 1134 |
| 772 | Ga0307405_10640780 | 3300031731 | Bacteria | 872 |
| 773 | Ga0307405_11740176 | 3300031731 | Bacteria | 553 |
| 774 | Ga0307413_10191989 | 3300031824 | Bacteria | 1467 |
| 775 | Ga0307413_10204123 | 3300031824 | Bacteria | 1430 |
| 776 | Ga0307413_11915542 | 3300031824 | Bacteria | 533 |
| 777 | Ga0307410_10095015 | 3300031852 | Bacteria | 2124 |
| 778 | Ga0307410_10181207 | 3300031852 | Bacteria | 1595 |
| 779 | Ga0307410_10589664 | 3300031852 | Bacteria | 926 |
| 780 | Ga0307406_10310916 | 3300031901 | Bacteria | 1215 |
| 781 | Ga0307406_10502639 | 3300031901 | Bacteria | 983 |
| 782 | Ga0307406_10607487 | 3300031901 | Bacteria | 902 |
| 783 | Ga0307406_10622376 | 3300031901 | Bacteria | 893 |
| 784 | Ga0307406_11185421 | 3300031901 | Bacteria | 663 |
| 785 | Ga0307407_10215834 | 3300031903 | Bacteria | 1294 |
| 786 | Ga0307407_10322962 | 3300031903 | Bacteria | 1084 |
| 787 | Ga0307412_10000206 | 3300031911 | Bacteria | 40298 |
| 788 | Ga0307412_10053739 | 3300031911 | Bacteria | 2671 |
| 789 | Ga0307412_10160568 | 3300031911 | Bacteria | 1669 |
| 790 | Ga0307412_10164020 | 3300031911 | Bacteria | 1654 |
| 791 | Ga0307412_10333369 | 3300031911 | Bacteria | 1212 |
| 792 | Ga0307412_10696297 | 3300031911 | Bacteria | 871 |
| 793 | Ga0307412_11206085 | 3300031911 | Unclassified | 678 |
| 794 | Ga0307412_11352440 | 3300031911 | Bacteria | 643 |
| 795 | Ga0307412_11580058 | 3300031911 | Bacteria | 598 |
| 796 | Ga0307412_11739551 | 3300031911 | Bacteria | 572 |
| 797 | Ga0307412_12218936 | 3300031911 | Bacteria | 511 |
| 798 | Ga0307409_100154737 | 3300031995 | Bacteria | 1996 |
| 799 | Ga0307409_100276468 | 3300031995 | Bacteria | 1549 |
| 800 | Ga0307409_100493890 | 3300031995 | Bacteria | 1190 |
| 801 | Ga0307409_100868530 | 3300031995 | Bacteria | 914 |
| 802 | Ga0307409_100969487 | 3300031995 | Bacteria | 867 |
| 803 | Ga0307416_100120782 | 3300032002 | Bacteria | 2334 |
| 804 | Ga0307416_100180129 | 3300032002 | Bacteria | 1979 |
| 805 | Ga0307416_100241034 | 3300032002 | Bacteria | 1752 |
| 806 | Ga0307416_100384873 | 3300032002 | Bacteria | 1434 |
| 807 | Ga0307416_100864069 | 3300032002 | Bacteria | 1003 |
| 808 | Ga0307416_101318337 | 3300032002 | Bacteria | 828 |
| 809 | Ga0307416_101640047 | 3300032002 | Bacteria | 748 |
| 810 | Ga0307416_102119016 | 3300032002 | Bacteria | 664 |
| 811 | Ga0307416_102145746 | 3300032002 | Bacteria | 660 |
| 812 | Ga0307414_10000090 | 3300032004 | Bacteria | 78448 |
| 813 | Ga0307414_10001067 | 3300032004 | Bacteria | 14023 |
| 814 | Ga0307414_10024139 | 3300032004 | Bacteria | 3871 |
| 815 | Ga0307414_10032478 | 3300032004 | Bacteria | 3437 |
| 816 | Ga0307414_10083257 | 3300032004 | Bacteria | 2349 |
| 817 | Ga0307414_10314754 | 3300032004 | Bacteria | 1330 |
| 818 | Ga0307411_10031870 | 3300032005 | Bacteria | 3250 |
| 819 | Ga0307411_10066342 | 3300032005 | Bacteria | 2424 |
| 820 | Ga0307411_10177756 | 3300032005 | Bacteria | 1612 |
| 821 | Ga0307411_10475390 | 3300032005 | Bacteria | 1051 |
| 822 | Ga0307411_11530548 | 3300032005 | Bacteria | 614 |
| 823 | Ga0307411_12320456 | 3300032005 | Bacteria | 504 |
| 824 | Ga0307415_100510698 | 3300032126 | Bacteria | 1053 |
| 825 | Ga0307415_100655277 | 3300032126 | Bacteria | 942 |
| 826 | Ga0307415_100660778 | 3300032126 | Bacteria | 938 |
| 827 | Ga0307415_101189908 | 3300032126 | Bacteria | 718 |
| 828 | Ga0373926_0230201 | 3300035083 | Bacteria | 716 |
| 829 | Ga0373944_0213989 | 3300035089 | Bacteria | 701 |
| 830 | Ga0373939_0109239 | 3300035114 | Bacteria | 961 |
| 831 | Ga0373945_0140046 | 3300035116 | Bacteria | 975 |
| 832 | Ga0373957_0267558 | 3300035120 | Bacteria | 721 |
| 833 | Ga0373960_0205143 | 3300035121 | Bacteria | 699 |
| 834 | Ga0373946_0420660 | 3300035171 | Bacteria | 677 |
| 835 | Ga0373955_0972083 | 3300035172 | Bacteria | 523 |
| 836 | Ga0373962_0236129 | 3300035242 | Bacteria | 630 |
| 837 | Ga0373931_0023028 | 3300035691 | Bacteria | 3141 |
| 838 | Ga0373935_1095128 | 3300035692 | Bacteria | 593 |
| 839 | Ga0373935_1428122 | 3300035692 | Bacteria | 517 |
| 840 | Ga0373927_0051355 | 3300035695 | Bacteria | 2666 |
| 841 | Ga0373933_0549796 | 3300035724 | Bacteria | 757 |
| 842 | Ga0373937_1295810 | 3300036401 | Bacteria | 676 |
| 843 | Ga0316582_0523956 | 3300036647 | Bacteria | 817 |
| 844 | Ga0373925_0361313 | 3300037068 | Bacteria | 1180 |
| 845 | Ga0395901_1791740 | 3300038443 | Bacteria | 563 |
| 846 | Ga0436365_0480912 | 3300039437 | Bacteria | 48758 |
| 847 | Ga0436363_0048982 | 3300039450 | Bacteria | 535 |
| 848 | Ga0436363_0493190 | 3300039450 | Bacteria | 842 |
| 849 | Ga0436362_0553111 | 3300039453 | Bacteria | 45057 |
| 850 | Ga0439436_0065284 | 3300041404 | Bacteria | 1016 |
| 851 | Ga0439436_0170291 | 3300041404 | Bacteria | 617 |
| 852 | Ga0439439_0010294 | 3300041406 | Bacteria | 2233 |
| 853 | Ga0439461_0000394 | 3300041410 | Bacteria | 6254 |
| 854 | Ga0439461_0023156 | 3300041410 | Bacteria | 1248 |
| 855 | Ga0439466_0199721 | 3300041411 | Bacteria | 608 |
| 856 | Ga0439465_0000283 | 3300041413 | Bacteria | 14258 |
| 857 | Ga0439465_0001505 | 3300041413 | Bacteria | 7561 |
| 858 | Ga0451789_0782680 | 3300041443 | Bacteria | 833 |
| 859 | Ga0451791_1030079 | 3300041451 | Bacteria | 1013 |
| 860 | Ga0451793_0033680 | 3300041452 | Bacteria | 1359 |
| 861 | Ga0451793_0957128 | 3300041452 | Bacteria | 837 |
| 862 | Ga0451800_0427065 | 3300041459 | Bacteria | 2389 |
| 863 | Ga0451800_0504361 | 3300041459 | Bacteria | 655 |
| 864 | Ga0451800_1486363 | 3300041459 | Bacteria | 1877 |
| 865 | Ga0451802_0398890 | 3300041460 | Bacteria | 1405 |
| 866 | Ga0451802_1054188 | 3300041460 | Bacteria | 778 |
| 867 | Ga0451806_242067 | 3300041462 | Bacteria | 1906 |
| 868 | Ga0451806_513296 | 3300041462 | Bacteria | 2422 |
| 869 | Ga0451804_0395309 | 3300041463 | Bacteria | 2030 |
| 870 | Ga0451804_1112201 | 3300041463 | Bacteria | 649 |
| 871 | Ga0451807_0115728 | 3300041486 | Bacteria | 542 |
| 872 | Ga0451807_0343639 | 3300041486 | Bacteria | 544 |
| 873 | Ga0451807_0451373 | 3300041486 | Bacteria | 1196 |
| 874 | Ga0451807_0556227 | 3300041486 | Bacteria | 1956 |
| 875 | Ga0451807_1077379 | 3300041486 | Bacteria | 944 |
| 876 | Ga0451807_2058733 | 3300041486 | Bacteria | 1705 |
| 877 | Ga0451833_1248443 | 3300041491 | Bacteria | 2359 |
| 878 | Ga0451837_0561980 | 3300041494 | Bacteria | 1723 |
| 879 | Ga0451845_0079559 | 3300041501 | Bacteria | 618 |
| 880 | Ga0451849_0025924 | 3300041505 | Bacteria | 651 |
| 881 | Ga0451851_0206228 | 3300041507 | Bacteria | 519 |
| 882 | Ga0451853_1265896 | 3300041512 | Bacteria | 974 |
| 883 | Ga0451853_2186315 | 3300041512 | Bacteria | 556 |
| 884 | Ga0451853_2340752 | 3300041512 | Bacteria | 1516 |
| 885 | Ga0439431_0000388 | 3300041997 | Bacteria | 9272 |
| 886 | Ga0439433_0082408 | 3300041999 | Bacteria | 784 |
| 887 | Ga0439442_000975 | 3300042002 | Bacteria | 5778 |
| 888 | Ga0439442_009486 | 3300042002 | Bacteria | 1969 |
| 889 | Ga0439443_080578 | 3300042003 | Bacteria | 605 |
| 890 | Ga0439445_0006131 | 3300042004 | Bacteria | 2756 |
| 891 | Ga0439445_0010370 | 3300042004 | Bacteria | 2203 |
| 892 | Ga0439445_0236798 | 3300042004 | Bacteria | 544 |
| 893 | Ga0439432_000054 | 3300042006 | Bacteria | 34641 |
| 894 | Ga0439432_042859 | 3300042006 | Bacteria | 1430 |
| 895 | Ga0439452_021914 | 3300042010 | Bacteria | 1658 |
| 896 | Ga0439455_0145411 | 3300042012 | Bacteria | 673 |
| 897 | Ga0439457_139090 | 3300042014 | Bacteria | 580 |
| 898 | Ga0439462_0000462 | 3300042015 | Bacteria | 7979 |
| 899 | Ga0439462_0004275 | 3300042015 | Bacteria | 3475 |
| 900 | Ga0450890_054408 | 3300042127 | Bacteria | 616 |
| 901 | Ga0450895_017865 | 3300042132 | Bacteria | 644 |
| 902 | Ga0450896_013094 | 3300042133 | Bacteria | 1178 |
| 903 | Ga0450889_004060 | 3300042144 | Bacteria | 1444 |
| 904 | Ga0450906_047077 | 3300042145 | Bacteria | 761 |
| 905 | Ga0450907_010656 | 3300042146 | Bacteria | 1525 |
| 906 | Ga0439446_0023557 | 3300042156 | Bacteria | 1752 |
| 907 | Ga0439446_0378379 | 3300042156 | Bacteria | 508 |
| 908 | Ga0439434_0000569 | 3300042435 | Bacteria | 10645 |
| 909 | Ga0439435_0219865 | 3300042436 | Bacteria | 632 |
| 910 | Ga0439459_0094784 | 3300042438 | Bacteria | 723 |
| 911 | Ga0439464_0171838 | 3300042439 | Bacteria | 684 |
| 912 | Ga0439460_0094061 | 3300042461 | Bacteria | 956 |
| 913 | Ga0451577_1011431 | 3300042876 | Bacteria | 746 |
| 914 | Ga0451577_1076966 | 3300042876 | Bacteria | 720 |
| 915 | Ga0466969_0008980 | 3300044656 | Bacteria | 5297 |
| 916 | Ga0466966_0001607 | 3300044684 | Bacteria | 14542 |
| 917 | Ga0466961_0055107 | 3300044693 | Bacteria | 2535 |
| 918 | Ga0466961_0103542 | 3300044693 | Bacteria | 1792 |
| 919 | Ga0466963_0052452 | 3300044694 | Bacteria | 2706 |
| 920 | Ga0466964_0002394 | 3300044706 | Bacteria | 6661 |
| 921 | Ga0466971_0000284 | 3300044719 | Bacteria | 19435 |
| 922 | Ga0466971_0013113 | 3300044719 | Bacteria | 3634 |
| 923 | Ga0466970_0000838 | 3300044765 | Bacteria | 14795 |
| 924 | Ga0466970_0335562 | 3300044765 | Bacteria | 856 |
| 925 | Ga0466957_0015872 | 3300044842 | Bacteria | 4401 |
| 926 | Ga0466959_0006859 | 3300045049 | Bacteria | 7941 |
| 927 | Ga0451576_0176225 | 3300045051 | Bacteria | 2232 |
| 928 | Ga0466958_0062450 | 3300045836 | Bacteria | 2271 |
| 929 | Ga0466958_0091687 | 3300045836 | Bacteria | 1881 |
| 930 | Ga0466967_0030518 | 3300045976 | Bacteria | 4525 |
| 931 | Ga0495627_050209 | 3300046453 | Bacteria | 1257 |
| 932 | Ga0495638_0000774 | 3300046460 | Bacteria | 33793 |
| 933 | Ga0495638_0090851 | 3300046460 | Bacteria | 1840 |
| 934 | Ga0495650_0001552 | 3300046471 | Bacteria | 21682 |
| 935 | Ga0495580_0686345 | 3300046472 | Bacteria | 671 |
| 936 | Ga0495610_0131516 | 3300046512 | Bacteria | 1086 |
| 937 | Ga0495616_0000022 | 3300046513 | Bacteria | 149720 |
| 938 | Ga0495643_0141295 | 3300046522 | Bacteria | 1200 |
| 939 | Ga0495654_0133690 | 3300046530 | Bacteria | 1111 |
| 940 | Ga0495654_0378745 | 3300046530 | Bacteria | 565 |
| 941 | Ga0495586_0413754 | 3300046535 | Bacteria | 776 |
| 942 | Ga0495598_0185764 | 3300046537 | Bacteria | 744 |
| 943 | Ga0495598_0358018 | 3300046537 | Bacteria | 563 |
| 944 | Ga0495597_0240213 | 3300046542 | Bacteria | 714 |
| 945 | Ga0495633_0316071 | 3300046558 | Bacteria | 709 |
| 946 | Ga0495668_0000031 | 3300046616 | Bacteria | 256576 |
| 947 | Ga0495668_0037509 | 3300046616 | Bacteria | 2711 |
| 948 | Ga0495668_0162838 | 3300046616 | Bacteria | 1222 |
| 949 | Ga0495668_0267227 | 3300046616 | Bacteria | 936 |
| 950 | Ga0495668_0553833 | 3300046616 | Bacteria | 635 |
| 951 | Ga0495634_0643887 | 3300046642 | Bacteria | 613 |
| 952 | Ga0495611_0237212 | 3300046648 | Bacteria | 847 |
| 953 | Ga0495625_0000083 | 3300046660 | Bacteria | 152144 |
| 954 | Ga0495625_0000115 | 3300046660 | Bacteria | 122861 |
| 955 | Ga0495625_0155072 | 3300046660 | Bacteria | 1537 |
| 956 | Ga0495625_0222491 | 3300046660 | Bacteria | 1236 |
| 957 | Ga0495670_0000047 | 3300046691 | Bacteria | 65608 |
| 958 | Ga0495670_0371003 | 3300046691 | Bacteria | 771 |
| 959 | Ga0495670_0709782 | 3300046691 | Bacteria | 548 |
| 960 | Ga0495649_0298965 | 3300046694 | Bacteria | 820 |
| 961 | Ga0495636_0527102 | 3300047318 | Bacteria | 573 |
| 962 | Ga0495681_0033786 | 3300047470 | Bacteria | 2556 |
| 963 | Ga0495686_0001048 | 3300047472 | Bacteria | 33188 |
| 964 | Ga0495686_0001884 | 3300047472 | Bacteria | 20970 |
| 965 | Ga0495686_0447359 | 3300047472 | Bacteria | 687 |
| 966 | Ga0495686_0520613 | 3300047472 | Bacteria | 624 |
| 967 | Ga0495626_0130762 | 3300048091 | Bacteria | 1072 |
| 968 | Ga0496102_0231762 | 3300048905 | Unclassified | 1741 |
| 969 | Ga0496102_1467062 | 3300048905 | Bacteria | 601 |
| 970 | Ga0496104_0199331 | 3300048907 | Bacteria | 1914 |
| 971 | Ga0496104_0225962 | 3300048907 | Bacteria | 1784 |
| 972 | Ga0496104_0457463 | 3300048907 | Bacteria | 1188 |
| 973 | Ga0496106_1548224 | 3300048909 | Unclassified | 509 |
| 974 | Ga0496108_0001104 | 3300048911 | Bacteria | 21095 |
| 975 | Ga0496108_0261640 | 3300048911 | Bacteria | 1506 |
| 976 | Ga0496110_0007418 | 3300048913 | Bacteria | 8757 |
| 977 | Ga0496110_0047911 | 3300048913 | Bacteria | 3744 |
| 978 | Ga0496111_0040721 | 3300048914 | Bacteria | 3333 |
| 979 | Ga0496111_0087688 | 3300048914 | Bacteria | 2278 |
| 980 | Ga0496111_0134502 | 3300048914 | Bacteria | 1831 |
| 981 | Ga0496111_0262321 | 3300048914 | Bacteria | 1282 |
| 982 | Ga0496112_0055039 | 3300048915 | Bacteria | 3910 |
| 983 | Ga0496113_0040728 | 3300048916 | Bacteria | 3425 |
| 984 | Ga0496113_0371607 | 3300048916 | Bacteria | 1148 |
| 985 | Ga0496113_1309919 | 3300048916 | Bacteria | 563 |
| 986 | Ga0496114_1496123 | 3300048917 | Bacteria | 563 |
| 987 | Ga0496115_0000333 | 3300048918 | Bacteria | 40158 |
| 988 | Ga0496116_0122931 | 3300048919 | Bacteria | 1497 |
| 989 | Ga0496117_0002512 | 3300048920 | Bacteria | 22989 |
| 990 | Ga0496117_0027156 | 3300048920 | Bacteria | 4466 |
| 991 | Ga0496118_0032030 | 3300048921 | Bacteria | 4342 |
| 992 | Ga0496118_0118063 | 3300048921 | Bacteria | 1738 |
| 993 | Ga0496118_0148557 | 3300048921 | Bacteria | 1471 |
| 994 | Ga0496118_0188008 | 3300048921 | Bacteria | 1239 |
| 995 | Ga0496118_0340787 | 3300048921 | Bacteria | 803 |
| 996 | Ga0496119_0004541 | 3300048922 | Bacteria | 13758 |
| 997 | Ga0496119_0216175 | 3300048922 | Bacteria | 983 |
| 998 | Ga0496120_0001660 | 3300048923 | Bacteria | 25701 |
| 999 | Ga0496120_0091448 | 3300048923 | Bacteria | 1624 |
| 1000 | Ga0496120_0110315 | 3300048923 | Bacteria | 1438 |
| 1001 | Ga0496121_0003542 | 3300048924 | Bacteria | 22106 |
| 1002 | Ga0496121_0183126 | 3300048924 | Bacteria | 1509 |
| 1003 | Ga0496122_0000361 | 3300048925 | Bacteria | 97861 |
| 1004 | Ga0496122_0033601 | 3300048925 | Bacteria | 4215 |
| 1005 | Ga0496122_0096833 | 3300048925 | Bacteria | 1988 |
| 1006 | Ga0496122_0344323 | 3300048925 | Bacteria | 781 |
| 1007 | Ga0496123_0002053 | 3300048926 | Bacteria | 25986 |
| 1008 | Ga0496123_0008346 | 3300048926 | Bacteria | 9530 |
| 1009 | Ga0496123_0054939 | 3300048926 | Bacteria | 2617 |
| 1010 | Ga0496123_0119750 | 3300048926 | Bacteria | 1484 |
| 1011 | Ga0496123_0158908 | 3300048926 | Bacteria | 1208 |
| 1012 | Ga0496123_0215755 | 3300048926 | Bacteria | 971 |
| 1013 | Ga0496123_0281226 | 3300048926 | Bacteria | 804 |
| 1014 | Ga0496124_0000116 | 3300048927 | Bacteria | 164788 |
| 1015 | Ga0496124_0002453 | 3300048927 | Bacteria | 24263 |
| 1016 | Ga0496124_0021657 | 3300048927 | Bacteria | 5920 |
| 1017 | Ga0496124_0239946 | 3300048927 | Bacteria | 1348 |
| 1018 | Ga0496124_0633391 | 3300048927 | Bacteria | 689 |
| 1019 | Ga0496125_0009457 | 3300048928 | Bacteria | 10008 |
| 1020 | Ga0496125_0011195 | 3300048928 | Bacteria | 8990 |
| 1021 | Ga0496125_0034476 | 3300048928 | Bacteria | 4461 |
| 1022 | Ga0496125_0135923 | 3300048928 | Bacteria | 1720 |
| 1023 | Ga0496125_0340902 | 3300048928 | Bacteria | 899 |
| 1024 | Ga0496125_0430948 | 3300048928 | Bacteria | 761 |
| 1025 | Ga0496126_0033359 | 3300048929 | Bacteria | 4844 |
| 1026 | Ga0496126_0054433 | 3300048929 | Bacteria | 3624 |
| 1027 | Ga0496126_0248981 | 3300048929 | Bacteria | 1481 |
| 1028 | Ga0496126_0293834 | 3300048929 | Bacteria | 1343 |
| 1029 | Ga0496126_0542085 | 3300048929 | Bacteria | 924 |
| 1030 | Ga0496126_1021124 | 3300048929 | Bacteria | 619 |
| 1031 | Ga0501290_000535 | 3300049513 | Bacteria | 5827 |
| 1032 | Ga0501299_131159 | 3300049522 | Bacteria | 614 |
| 1033 | Ga0501300_000775 | 3300049523 | Bacteria | 4832 |
| 1034 | Ga0501300_055668 | 3300049523 | Bacteria | 618 |
| 1035 | Ga0501335_004083 | 3300049551 | Bacteria | 1262 |
| 1036 | Ga0501034_0052605 | 3300049571 | Bacteria | 4102 |
| 1037 | Ga0501036_0814721 | 3300049572 | Bacteria | 768 |
| 1038 | Ga0501037_0965925 | 3300049573 | Bacteria | 556 |
| 1039 | Ga0501039_0396712 | 3300049575 | Bacteria | 1084 |
| 1040 | Ga0501039_0575172 | 3300049575 | Bacteria | 884 |
| 1041 | Ga0501043_0362780 | 3300049579 | Bacteria | 1099 |
| 1042 | Ga0501047_0460255 | 3300049581 | Bacteria | 1101 |
| 1043 | Ga0501047_1042898 | 3300049581 | Bacteria | 631 |
| 1044 | Ga0501048_1133089 | 3300049582 | Bacteria | 563 |
| 1045 | Ga0501069_0005700 | 3300049585 | Bacteria | 6486 |
| 1046 | Ga0501070_0034219 | 3300049586 | Bacteria | 4249 |
| 1047 | Ga0501071_0762292 | 3300049587 | Bacteria | 746 |
| 1048 | Ga0501076_0901884 | 3300049592 | Bacteria | 729 |
| 1049 | Ga0501206_054051 | 3300049653 | Bacteria | 645 |
| 1050 | Ga0501208_058782 | 3300049655 | Bacteria | 749 |
| 1051 | Ga0501211_000604 | 3300049658 | Bacteria | 3585 |
| 1052 | Ga0501223_000008 | 3300049663 | Bacteria | 117828 |
| 1053 | Ga0501235_012074 | 3300049669 | Bacteria | 1898 |
| 1054 | Ga0501236_005683 | 3300049670 | Bacteria | 1513 |
| 1055 | Ga0501246_011106 | 3300049676 | Bacteria | 831 |
| 1056 | Ga0501256_001336 | 3300049685 | Bacteria | 1797 |
| 1057 | Ga0501261_069797 | 3300049690 | Bacteria | 614 |
| 1058 | Ga0501225_0002035 | 3300049705 | Bacteria | 6291 |
| 1059 | Ga0501225_0005303 | 3300049705 | Bacteria | 3789 |
| 1060 | Ga0501225_0052085 | 3300049705 | Bacteria | 1141 |
| 1061 | Ga0501083_0022042 | 3300049744 | Bacteria | 4422 |
| 1062 | Ga0501264_007196 | 3300049761 | Bacteria | 1034 |
| 1063 | Ga0501275_000288 | 3300049772 | Bacteria | 5719 |
| 1064 | Ga0501275_090043 | 3300049772 | Bacteria | 509 |
| 1065 | Ga0501035_0460876 | 3300049822 | Bacteria | 1051 |
| 1066 | Ga0501035_0998479 | 3300049822 | Bacteria | 658 |
| 1067 | Ga0501044_0224010 | 3300049823 | Bacteria | 1830 |
| 1068 | Ga0501044_1374425 | 3300049823 | Bacteria | 572 |
| 1069 | nmdc:mga03683_13_c1 | 3300050489 | Bacteria | 110533 |
| 1070 | nmdc:mga03n38_1530_c1 | 3300050490 | Bacteria | 6691 |
| 1071 | nmdc:mga0yw44_1049937_c1 | 3300050492 | Bacteria | 551 |
| 1072 | nmdc:mga0k408_229344_c1 | 3300050493 | Bacteria | 1109 |
| 1073 | nmdc:mga0k408_35281_c1 | 3300050493 | Bacteria | 2868 |
| 1074 | nmdc:mga0k408_554573_c1 | 3300050493 | Bacteria | 679 |
| 1075 | nmdc:mga0k408_8_c1 | 3300050493 | Bacteria | 161211 |
| 1076 | nmdc:mga07m45_20_c1 | 3300050496 | Bacteria | 126269 |
| 1077 | nmdc:mga07m45_401758_c1 | 3300050496 | Bacteria | 795 |
| 1078 | nmdc:mga05p37_114129_c1 | 3300050507 | Bacteria | 3321 |
| 1079 | nmdc:mga05p37_152982_c1 | 3300050507 | Bacteria | 2820 |
| 1080 | nmdc:mga05p37_1966634_c1 | 3300050507 | Bacteria | 555 |
| 1081 | nmdc:mga05p37_214267_c1 | 3300050507 | Bacteria | 2327 |
| 1082 | nmdc:mga05p37_418677_c1 | 3300050507 | Bacteria | 1559 |
| 1083 | nmdc:mga05p37_520230_c1 | 3300050507 | Bacteria | 1361 |
| 1084 | nmdc:mga09592_1220239_c1 | 3300050508 | Bacteria | 621 |
| 1085 | nmdc:mga09592_131176_c1 | 3300050508 | Bacteria | 2156 |
| 1086 | nmdc:mga09592_183494_c1 | 3300050508 | Bacteria | 1810 |
| 1087 | nmdc:mga09592_300173_c1 | 3300050508 | Bacteria | 1393 |
| 1088 | nmdc:mga09592_49001_c1 | 3300050508 | Bacteria | 3562 |
| 1089 | nmdc:mga09592_55952_c1 | 3300050508 | Bacteria | 3333 |
| 1090 | nmdc:mga0qj67_116770_c1 | 3300050509 | Bacteria | 2156 |
| 1091 | nmdc:mga0qj67_222894_c1 | 3300050509 | Bacteria | 1531 |
| 1092 | nmdc:mga0qj67_274763_c1 | 3300050509 | Bacteria | 1366 |
| 1093 | nmdc:mga0qj67_30550_c1 | 3300050509 | Bacteria | 4196 |
| 1094 | nmdc:mga0qj67_58178_c1 | 3300050509 | Bacteria | 3064 |
| 1095 | nmdc:mga0qj67_601297_c1 | 3300050509 | Bacteria | 880 |
| 1096 | nmdc:mga06r32_1278980_c1 | 3300050510 | Bacteria | 678 |
| 1097 | nmdc:mga06r32_19835_c1 | 3300050510 | Bacteria | 6178 |
| 1098 | nmdc:mga06r32_317791_c1 | 3300050510 | Bacteria | 1543 |
| 1099 | nmdc:mga06r32_337_c1 | 3300050510 | Bacteria | 39051 |
| 1100 | nmdc:mga06r32_404430_c1 | 3300050510 | Bacteria | 1347 |
| 1101 | nmdc:mga06r32_436025_c1 | 3300050510 | Bacteria | 1291 |
| 1102 | nmdc:mga06r32_45225_c1 | 3300050510 | Bacteria | 4196 |
| 1103 | nmdc:mga06r32_497681_c1 | 3300050510 | Bacteria | 1196 |
| 1104 | nmdc:mga08y16_143511_c1 | 3300050511 | Bacteria | 2482 |
| 1105 | nmdc:mga08y16_153661_c1 | 3300050511 | Bacteria | 2392 |
| 1106 | nmdc:mga08y16_192656_c1 | 3300050511 | Bacteria | 2114 |
| 1107 | nmdc:mga08y16_278848_c1 | 3300050511 | Bacteria | 1724 |
| 1108 | nmdc:mga08y16_402669_c2 | 3300050511 | Unclassified | 506 |
| 1109 | nmdc:mga08y16_465818_c1 | 3300050511 | Bacteria | 1287 |
| 1110 | nmdc:mga08y16_589470_c1 | 3300050511 | Bacteria | 1121 |
| 1111 | nmdc:mga08y16_61630_c1 | 3300050511 | Bacteria | 3917 |
| 1112 | nmdc:mga08y16_877419_c1 | 3300050511 | Bacteria | 885 |
| 1113 | nmdc:mga08y16_981615_c1 | 3300050511 | Bacteria | 826 |
| 1114 | nmdc:mga0n895_191741_c1 | 3300050512 | Bacteria | 2075 |
| 1115 | nmdc:mga0n895_39742_c1 | 3300050512 | Bacteria | 4567 |
| 1116 | nmdc:mga0rr50_1496350_c1 | 3300050513 | Bacteria | 571 |
| 1117 | nmdc:mga0rr50_210770_c1 | 3300050513 | Unclassified | 1600 |
| 1118 | nmdc:mga0rr50_531604_c1 | 3300050513 | Bacteria | 1001 |
| 1119 | nmdc:mga0a205_1176468_c1 | 3300050515 | Bacteria | 614 |
| 1120 | nmdc:mga0a205_1207496_c1 | 3300050515 | Bacteria | 604 |
| 1121 | nmdc:mga0a205_14992_c1 | 3300050515 | Bacteria | 7234 |
| 1122 | nmdc:mga0sz30_2719_c1 | 3300050516 | Bacteria | 4757 |
| 1123 | Ga0495612_0182441 | 3300053078 | Bacteria | 922 |
| 1124 | Ga0500643_000475 | 3300053087 | Bacteria | 29406 |
| 1125 | Ga0500643_001338 | 3300053087 | Bacteria | 14380 |
| 1126 | Ga0500643_002080 | 3300053087 | Bacteria | 10653 |
| 1127 | Ga0500646_0126025 | 3300053090 | Bacteria | 828 |
| 1128 | Ga0500583_0541334 | 3300053092 | Bacteria | 542 |
| 1129 | Ga0500566_0008244 | 3300053094 | Bacteria | 6166 |
| 1130 | Ga0500566_0383088 | 3300053094 | Bacteria | 635 |
| 1131 | Ga0500650_0501876 | 3300053098 | Bacteria | 516 |
| 1132 | Ga0500562_122410 | 3300053108 | Bacteria | 709 |
| 1133 | Ga0500562_225602 | 3300053108 | Bacteria | 506 |
| 1134 | Ga0500592_005468 | 3300053116 | Bacteria | 2024 |
| 1135 | Ga0500592_012998 | 3300053116 | Bacteria | 1333 |
| 1136 | Ga0500652_174553 | 3300053131 | Bacteria | 883 |
| 1137 | Ga0500658_0123970 | 3300053134 | Bacteria | 1147 |
| 1138 | Ga0500568_0013638 | 3300053139 | Bacteria | 3697 |
| 1139 | Ga0500568_0034532 | 3300053139 | Bacteria | 2069 |
| 1140 | Ga0500604_0002288 | 3300053151 | Bacteria | 5243 |
| 1141 | Ga0500616_0111302 | 3300053153 | Bacteria | 1322 |
| 1142 | Ga0500627_0000003 | 3300053158 | Bacteria | 178186 |
| 1143 | Ga0500627_0121223 | 3300053158 | Bacteria | 1180 |
| 1144 | Ga0500570_202968 | 3300053724 | Bacteria | 598 |
| 1145 | Ga0501084_1142384 | 3300054114 | Bacteria | 654 |
| 1146 | Ga0500661_001498 | 3300055283 | Bacteria | 4384 |
| 1147 | Ga0590071_005027 | 3300059421 | Bacteria | 3190 |
| 1148 | Ga0590071_172255 | 3300059421 | Bacteria | 566 |
| 1149 | Ga0590074_021120 | 3300059423 | Bacteria | 1121 |
| 1150 | Ga0587084_031580 | 3300059477 | Bacteria | 855 |
| 1151 | Ga0587093_093274 | 3300059478 | Unclassified | 535 |
| 1152 | Ga0587077_199839 | 3300059493 | Bacteria | 552 |
| 1153 | Ga0587082_057045 | 3300059504 | Bacteria | 760 |
| 1154 | Ga0587085_033063 | 3300059506 | Bacteria | 861 |
| 1155 | Ga0587090_036077 | 3300059510 | Bacteria | 849 |
| 1156 | Ga0587091_018621 | 3300059511 | Bacteria | 1184 |
| 1157 | Ga0587098_019198 | 3300059604 | Bacteria | 854 |
| 1158 | Ga0587129_015400 | 3300059608 | Unclassified | 637 |
| 1159 | Ga0587101_109295 | 3300059623 | Bacteria | 559 |
| 1160 | Ga0587101_139287 | 3300059623 | Bacteria | 517 |
| 1161 | Ga0587109_051344 | 3300059624 | Bacteria | 846 |
| 1162 | Ga0587117_042859 | 3300059627 | Bacteria | 727 |
| 1163 | Ga0587128_014085 | 3300059630 | Bacteria | 1139 |
| 1164 | Ga0587062_027045 | 3300059639 | Bacteria | 855 |
| 1165 | Ga0587108_011948 | 3300059653 | Bacteria | 746 |
| 1166 | Ga0587111_0049805 | 3300060346 | Bacteria | 921 |
| 1167 | Ga0501082_0481586 | 3300060353 | Bacteria | 1085 |
| 1168 | Ga0466962_0002691 | 3300061719 | Bacteria | 8462 |
| 1169 | Ga0466962_0007169 | 3300061719 | Bacteria | 5339 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044656 | Ga0466969_0008980 | Ga0466969_0008980_2987_3307 | 63 |
| 2 | 3300044684 | Ga0466966_0001607 | Ga0466966_0001607_7637_7957 | 63 |
| 3 | 3300044693 | Ga0466961_0055107 | Ga0466961_0055107_140_460 | 63 |
| 4 | 3300044706 | Ga0466964_0002394 | Ga0466964_0002394_5391_5711 | 63 |
| 5 | 3300044719 | Ga0466971_0000284 | Ga0466971_0000284_11054_11374 | 63 |
| 6 | 3300044765 | Ga0466970_0000838 | Ga0466970_0000838_10064_10384 | 63 |
| 7 | 3300044842 | Ga0466957_0015872 | Ga0466957_0015872_2763_3083 | 63 |
| 8 | 3300045049 | Ga0466959_0006859 | Ga0466959_0006859_2857_3177 | 63 |
| 9 | 3300045836 | Ga0466958_0062450 | Ga0466958_0062450_562_882 | 63 |
| 10 | 3300061719 | Ga0466962_0002691 | Ga0466962_0002691_8050_8370 | 63 |
| 11 | 3300035116 | Ga0373945_0140046 | Ga0373945_0140046_181_501 | 64 |
| 12 | 3300035120 | Ga0373957_0267558 | Ga0373957_0267558_317_637 | 64 |
| 13 | 3300035172 | Ga0373955_0972083 | Ga0373955_0972083_145_465 | 64 |
| 14 | 3300035692 | Ga0373935_1095128 | Ga0373935_1095128_195_515 | 64 |
| 15 | 3300035724 | Ga0373933_0549796 | Ga0373933_0549796_370_690 | 64 |
| 16 | 3300036401 | Ga0373937_1295810 | Ga0373937_1295810_110_430 | 64 |
| 17 | 3300042156 | Ga0439446_0378379 | Ga0439446_0378379_133_450 | 64 |
| 18 | 3300046642 | Ga0495634_0643887 | Ga0495634_0643887_70_390 | 64 |
| 19 | 3300012495 | Ga0157323_1005241 | Ga0157323_10052412 | 66 |
| 20 | 3300025922 | Ga0207646_10875273 | Ga0207646_108752731 | 66 |
| 21 | 3300005367 | Ga0070667_101023734 | Ga0070667_1010237342 | 67 |
| 22 | 3300009553 | Ga0105249_10026693 | Ga0105249_100266936 | 67 |
| 23 | 3300014745 | Ga0157377_11151462 | Ga0157377_111514622 | 67 |
| 24 | 3300004798 | Ga0058859_11186829 | Ga0058859_111868292 | 68 |
| 25 | 3300004801 | Ga0058860_12203426 | Ga0058860_122034262 | 68 |
| 26 | 3300005347 | Ga0070668_101873102 | Ga0070668_1018731022 | 68 |
| 27 | 3300005354 | Ga0070675_101497214 | Ga0070675_1014972141 | 68 |
| 28 | 3300005544 | Ga0070686_101446544 | Ga0070686_1014465441 | 68 |
| 29 | 3300009553 | Ga0105249_10571229 | Ga0105249_105712292 | 68 |
| 30 | 3300014325 | Ga0163163_10093241 | Ga0163163_100932412 | 68 |
| 31 | 3300014326 | Ga0157380_10436687 | Ga0157380_104366871 | 68 |
| 32 | 3300025298 | Ga0209050_1001430 | Ga0209050_100143015 | 68 |
| 33 | 3300025961 | Ga0207712_10717224 | Ga0207712_107172242 | 68 |
| 34 | 3300027907 | Ga0207428_10406134 | Ga0207428_104061342 | 68 |
| 35 | 3300006844 | Ga0075428_100970852 | Ga0075428_1009708522 | 69 |
| 36 | 3300041501 | Ga0451845_0079559 | Ga0451845_0079559_145_429 | 71 |
| 37 | 3300053098 | Ga0500650_0501876 | Ga0500650_0501876_177_461 | 71 |
| 38 | 3300009094 | Ga0111539_10285154 | Ga0111539_102851544 | 72 |
| 39 | 3300009147 | Ga0114129_11034319 | Ga0114129_110343193 | 72 |
| 40 | 3300009176 | Ga0105242_12543832 | Ga0105242_125438321 | 72 |
| 41 | 3300010375 | Ga0105239_13198513 | Ga0105239_131985131 | 72 |
| 42 | 3300013100 | Ga0157373_10544698 | Ga0157373_105446981 | 72 |
| 43 | 3300013308 | Ga0157375_11573925 | Ga0157375_115739251 | 72 |
| 44 | 3300032002 | Ga0307416_101640047 | Ga0307416_1016400472 | 72 |
| 45 | 3300032126 | Ga0307415_100660778 | Ga0307415_1006607782 | 72 |
| 46 | 3300042144 | Ga0450889_004060 | Ga0450889_004060_1144_1404 | 72 |
| 47 | 3300050508 | nmdc:mga09592_55952_c1 | nmdc:mga09592_55952_c1_1234_1494 | 72 |
| 48 | 3300050511 | nmdc:mga08y16_981615_c1 | nmdc:mga08y16_981615_c1_243_503 | 72 |
| 49 | 3300009147 | Ga0114129_10138853 | Ga0114129_101388533 | 73 |
| 50 | 3300005338 | Ga0068868_100557510 | Ga0068868_1005575102 | 74 |
| 51 | 3300005340 | Ga0070689_100479309 | Ga0070689_1004793092 | 74 |
| 52 | 3300005549 | Ga0070704_101036699 | Ga0070704_1010366991 | 74 |
| 53 | 3300005617 | Ga0068859_102502470 | Ga0068859_1025024701 | 74 |
| 54 | 3300005843 | Ga0068860_101715969 | Ga0068860_1017159692 | 74 |
| 55 | 3300006931 | Ga0097620_102501853 | Ga0097620_1025018531 | 74 |
| 56 | 3300009101 | Ga0105247_10058703 | Ga0105247_100587033 | 74 |
| 57 | 3300028380 | Ga0268265_10731128 | Ga0268265_107311281 | 74 |
| 58 | 3300048909 | Ga0496106_1548224 | Ga0496106_1548224_177_446 | 74 |
| 59 | 3300050511 | nmdc:mga08y16_192656_c1 | nmdc:mga08y16_192656_c1_852_1121 | 74 |
| 60 | 3300005618 | Ga0068864_100552366 | Ga0068864_1005523662 | 75 |
| 61 | 3300013307 | Ga0157372_13042401 | Ga0157372_130424011 | 75 |
| 62 | 3300026095 | Ga0207676_10959843 | Ga0207676_109598431 | 75 |
| 63 | 3300009094 | Ga0111539_13076893 | Ga0111539_130768931 | 76 |
| 64 | 3300031456 | Ga0307513_10037481 | Ga0307513_100374813 | 76 |
| 65 | 3300053724 | Ga0500570_202968 | Ga0500570_202968_184_453 | 76 |
| 66 | 3300006852 | Ga0075433_11621746 | Ga0075433_116217461 | 77 |
| 67 | 3300031911 | Ga0307412_12218936 | Ga0307412_122189361 | 77 |
| 68 | 3300009011 | Ga0105251_10000862 | Ga0105251_100008627 | 78 |
| 69 | 3300009101 | Ga0105247_10007739 | Ga0105247_100077393 | 78 |
| 70 | 3300009177 | Ga0105248_10000014 | Ga0105248_10000014214 | 78 |
| 71 | 3300013306 | Ga0163162_10007277 | Ga0163162_100072773 | 78 |
| 72 | 3300014326 | Ga0157380_10865218 | Ga0157380_108652182 | 78 |
| 73 | 3300014968 | Ga0157379_10060743 | Ga0157379_100607432 | 78 |
| 74 | 3300046691 | Ga0495670_0371003 | Ga0495670_0371003_427_681 | 78 |
| 75 | 3300048907 | Ga0496104_0199331 | Ga0496104_0199331_269_523 | 78 |
| 76 | 3300048914 | Ga0496111_0087688 | Ga0496111_0087688_346_600 | 78 |
| 77 | 3300048921 | Ga0496118_0118063 | Ga0496118_0118063_451_705 | 78 |
| 78 | 3300053087 | Ga0500643_000475 | Ga0500643_000475_14729_14983 | 78 |
| 79 | iso_pu_bacteria | 2775507255 | 2778125807 | 78 |
| 80 | iso_pu_bacteria | 2818991438 | 2819552460 | 79 |
| 81 | iso_pu_bacteria | 2818991457 | 2819661834 | 79 |
| 82 | iso_pu_bacteria | 2852684882 | 2852688499 | 79 |
| 83 | iso_pu_bacteria | 2881101125 | 2881102749 | 79 |
| 84 | iso_pu_bacteria | 2919130084 | 2919133867 | 79 |
| 85 | iso_pu_bacteria | 2929195423 | 2929199844 | 79 |
| 86 | iso_pu_bacteria | 8021622325 | 8021622967 | 79 |
| 87 | iso_pu_bacteria | 8021626552 | 8021629099 | 79 |
| 88 | iso_pu_bacteria | 8021648035 | 8021651210 | 79 |
| 89 | iso_pu_bacteria | 2571042365 | 2572255450 | 80 |
| 90 | iso_pu_bacteria | 2599185359 | 2600228469 | 80 |
| 91 | iso_pu_bacteria | 2643221622 | 2644127533 | 80 |
| 92 | iso_pu_bacteria | 2643221695 | 2644527954 | 80 |
| 93 | iso_pu_bacteria | 2818991466 | 2819715261 | 80 |
| 94 | iso_pu_bacteria | 2879163058 | 2879163177 | 80 |
| 95 | iso_pu_bacteria | 2928526807 | 2928527999 | 80 |
| 96 | iso_pu_bacteria | 2928968154 | 2928971498 | 80 |
| 97 | 3300005615 | Ga0070702_100716159 | Ga0070702_1007161591 | 81 |
| 98 | 3300021384 | Ga0213876_10195201 | Ga0213876_101952011 | 81 |
| 99 | 3300041451 | Ga0451791_1030079 | Ga0451791_1030079_303_566 | 81 |
| 100 | 3300046472 | Ga0495580_0686345 | Ga0495580_0686345_56_319 | 81 |
| 101 | 3300049579 | Ga0501043_0362780 | Ga0501043_0362780_169_441 | 81 |
| 102 | 3300049581 | Ga0501047_1042898 | Ga0501047_1042898_26_298 | 81 |
| 103 | 3300049822 | Ga0501035_0460876 | Ga0501035_0460876_30_302 | 81 |
| 104 | 3300049822 | Ga0501035_0998479 | Ga0501035_0998479_298_570 | 81 |
| 105 | 3300049823 | Ga0501044_0224010 | Ga0501044_0224010_554_826 | 81 |
| 106 | 3300001904 | JGI24736J21556_1000245 | JGI24736J21556_10002457 | 82 |
| 107 | 3300001915 | JGI24741J21665_1000033 | JGI24741J21665_100003329 | 82 |
| 108 | 3300001979 | JGI24740J21852_10000308 | JGI24740J21852_1000030815 | 82 |
| 109 | 3300001989 | JGI24739J22299_10001399 | JGI24739J22299_100013994 | 82 |
| 110 | 3300001990 | JGI24737J22298_10002067 | JGI24737J22298_100020677 | 82 |
| 111 | 3300002067 | JGI24735J21928_10002354 | JGI24735J21928_100023545 | 82 |
| 112 | 3300002074 | JGI24748J21848_1017734 | JGI24748J21848_10177341 | 82 |
| 113 | 3300002075 | JGI24738J21930_10000553 | JGI24738J21930_100005537 | 82 |
| 114 | 3300002239 | JGI24034J26672_10063209 | JGI24034J26672_100632092 | 82 |
| 115 | 3300005289 | Ga0065704_10001806 | Ga0065704_100018068 | 82 |
| 116 | 3300005289 | Ga0065704_10088093 | Ga0065704_100880933 | 82 |
| 117 | 3300005289 | Ga0065704_10263838 | Ga0065704_102638381 | 82 |
| 118 | 3300005295 | Ga0065707_10148430 | Ga0065707_101484303 | 82 |
| 119 | 3300005327 | Ga0070658_10181797 | Ga0070658_101817973 | 82 |
| 120 | 3300005328 | Ga0070676_11259825 | Ga0070676_112598251 | 82 |
| 121 | 3300005329 | Ga0070683_101061898 | Ga0070683_1010618982 | 82 |
| 122 | 3300005331 | Ga0070670_100028217 | Ga0070670_1000282173 | 82 |
| 123 | 3300005331 | Ga0070670_100239903 | Ga0070670_1002399033 | 82 |
| 124 | 3300005335 | Ga0070666_10001750 | Ga0070666_1000175010 | 82 |
| 125 | 3300005339 | Ga0070660_101522066 | Ga0070660_1015220661 | 82 |
| 126 | 3300005344 | Ga0070661_100109613 | Ga0070661_1001096134 | 82 |
| 127 | 3300005347 | Ga0070668_100000460 | Ga0070668_10000046011 | 82 |
| 128 | 3300005347 | Ga0070668_100013970 | Ga0070668_1000139704 | 82 |
| 129 | 3300005347 | Ga0070668_100481846 | Ga0070668_1004818462 | 82 |
| 130 | 3300005347 | Ga0070668_101111384 | Ga0070668_1011113842 | 82 |
| 131 | 3300005347 | Ga0070668_101262289 | Ga0070668_1012622892 | 82 |
| 132 | 3300005353 | Ga0070669_100004662 | Ga0070669_1000046628 | 82 |
| 133 | 3300005353 | Ga0070669_100068008 | Ga0070669_1000680083 | 82 |
| 134 | 3300005353 | Ga0070669_100481504 | Ga0070669_1004815042 | 82 |
| 135 | 3300005355 | Ga0070671_100026426 | Ga0070671_1000264266 | 82 |
| 136 | 3300005366 | Ga0070659_100039830 | Ga0070659_1000398306 | 82 |
| 137 | 3300005366 | Ga0070659_100053840 | Ga0070659_1000538403 | 82 |
| 138 | 3300005367 | Ga0070667_100000286 | Ga0070667_10000028620 | 82 |
| 139 | 3300005440 | Ga0070705_101282588 | Ga0070705_1012825881 | 82 |
| 140 | 3300005444 | Ga0070694_100864873 | Ga0070694_1008648732 | 82 |
| 141 | 3300005455 | Ga0070663_100139611 | Ga0070663_1001396114 | 82 |
| 142 | 3300005467 | Ga0070706_100854974 | Ga0070706_1008549741 | 82 |
| 143 | 3300005467 | Ga0070706_101651486 | Ga0070706_1016514861 | 82 |
| 144 | 3300005468 | Ga0070707_100197763 | Ga0070707_1001977632 | 82 |
| 145 | 3300005471 | Ga0070698_100057955 | Ga0070698_1000579552 | 82 |
| 146 | 3300005545 | Ga0070695_101106142 | Ga0070695_1011061421 | 82 |
| 147 | 3300005546 | Ga0070696_100016374 | Ga0070696_1000163741 | 82 |
| 148 | 3300005548 | Ga0070665_100003281 | Ga0070665_10000328118 | 82 |
| 149 | 3300005548 | Ga0070665_101025369 | Ga0070665_1010253692 | 82 |
| 150 | 3300005549 | Ga0070704_101298822 | Ga0070704_1012988222 | 82 |
| 151 | 3300005563 | Ga0068855_100028542 | Ga0068855_1000285424 | 82 |
| 152 | 3300005563 | Ga0068855_101608813 | Ga0068855_1016088131 | 82 |
| 153 | 3300005564 | Ga0070664_100030751 | Ga0070664_1000307515 | 82 |
| 154 | 3300005577 | Ga0068857_100121556 | Ga0068857_1001215564 | 82 |
| 155 | 3300005614 | Ga0068856_100006103 | Ga0068856_1000061031 | 82 |
| 156 | 3300005618 | Ga0068864_100101905 | Ga0068864_1001019053 | 82 |
| 157 | 3300005841 | Ga0068863_100000168 | Ga0068863_10000016836 | 82 |
| 158 | 3300005843 | Ga0068860_100025815 | Ga0068860_1000258157 | 82 |
| 159 | 3300005843 | Ga0068860_100176437 | Ga0068860_1001764371 | 82 |
| 160 | 3300006844 | Ga0075428_102220881 | Ga0075428_1022208811 | 82 |
| 161 | 3300006847 | Ga0075431_100009192 | Ga0075431_1000091925 | 82 |
| 162 | 3300006880 | Ga0075429_100821512 | Ga0075429_1008215122 | 82 |
| 163 | 3300006880 | Ga0075429_101527745 | Ga0075429_1015277452 | 82 |
| 164 | 3300009093 | Ga0105240_10105419 | Ga0105240_101054193 | 82 |
| 165 | 3300009094 | Ga0111539_10226322 | Ga0111539_102263221 | 82 |
| 166 | 3300009174 | Ga0105241_10001628 | Ga0105241_1000162815 | 82 |
| 167 | 3300009545 | Ga0105237_10016667 | Ga0105237_100166674 | 82 |
| 168 | 3300009551 | Ga0105238_10273381 | Ga0105238_102733813 | 82 |
| 169 | 3300009553 | Ga0105249_10061210 | Ga0105249_100612105 | 82 |
| 170 | 3300009553 | Ga0105249_11123273 | Ga0105249_111232732 | 82 |
| 171 | 3300009978 | Ga0105148_100020 | Ga0105148_10002011 | 82 |
| 172 | 3300010375 | Ga0105239_10090913 | Ga0105239_100909136 | 82 |
| 173 | 3300010375 | Ga0105239_10117318 | Ga0105239_101173183 | 82 |
| 174 | 3300010375 | Ga0105239_10160219 | Ga0105239_101602192 | 82 |
| 175 | 3300013100 | Ga0157373_10064081 | Ga0157373_100640814 | 82 |
| 176 | 3300013102 | Ga0157371_10088817 | Ga0157371_100888172 | 82 |
| 177 | 3300013104 | Ga0157370_10085421 | Ga0157370_100854214 | 82 |
| 178 | 3300013105 | Ga0157369_10038912 | Ga0157369_100389124 | 82 |
| 179 | 3300013307 | Ga0157372_10106546 | Ga0157372_101065463 | 82 |
| 180 | 3300014326 | Ga0157380_10069618 | Ga0157380_100696182 | 82 |
| 181 | 3300014326 | Ga0157380_10410514 | Ga0157380_104105142 | 82 |
| 182 | 3300017792 | Ga0163161_10013470 | Ga0163161_100134704 | 82 |
| 183 | 3300020070 | Ga0206356_11610434 | Ga0206356_116104343 | 82 |
| 184 | 3300020076 | Ga0206355_1457572 | Ga0206355_14575722 | 82 |
| 185 | 3300020078 | Ga0206352_10030070 | Ga0206352_100300702 | 82 |
| 186 | 3300020082 | Ga0206353_11844162 | Ga0206353_118441624 | 82 |
| 187 | 3300022467 | Ga0224712_10563422 | Ga0224712_105634221 | 82 |
| 188 | 3300025229 | Ga0209147_100422 | Ga0209147_10042214 | 82 |
| 189 | 3300025321 | Ga0207656_10227708 | Ga0207656_102277082 | 82 |
| 190 | 3300025903 | Ga0207680_10012356 | Ga0207680_100123563 | 82 |
| 191 | 3300025904 | Ga0207647_10006880 | Ga0207647_100068808 | 82 |
| 192 | 3300025907 | Ga0207645_10463322 | Ga0207645_104633222 | 82 |
| 193 | 3300025909 | Ga0207705_10214744 | Ga0207705_102147443 | 82 |
| 194 | 3300025910 | Ga0207684_11421547 | Ga0207684_114215471 | 82 |
| 195 | 3300025911 | Ga0207654_10016757 | Ga0207654_100167574 | 82 |
| 196 | 3300025913 | Ga0207695_10070089 | Ga0207695_100700894 | 82 |
| 197 | 3300025914 | Ga0207671_10107104 | Ga0207671_101071043 | 82 |
| 198 | 3300025919 | Ga0207657_10020932 | Ga0207657_100209325 | 82 |
| 199 | 3300025920 | Ga0207649_10492398 | Ga0207649_104923982 | 82 |
| 200 | 3300025923 | Ga0207681_10019692 | Ga0207681_100196923 | 82 |
| 201 | 3300025923 | Ga0207681_10036351 | Ga0207681_100363513 | 82 |
| 202 | 3300025923 | Ga0207681_10071528 | Ga0207681_100715282 | 82 |
| 203 | 3300025924 | Ga0207694_10058269 | Ga0207694_100582692 | 82 |
| 204 | 3300025925 | Ga0207650_10018590 | Ga0207650_100185903 | 82 |
| 205 | 3300025925 | Ga0207650_10203994 | Ga0207650_102039942 | 82 |
| 206 | 3300025931 | Ga0207644_10109784 | Ga0207644_101097842 | 82 |
| 207 | 3300025932 | Ga0207690_10200195 | Ga0207690_102001953 | 82 |
| 208 | 3300025932 | Ga0207690_10537175 | Ga0207690_105371752 | 82 |
| 209 | 3300025933 | Ga0207706_10005112 | Ga0207706_100051124 | 82 |
| 210 | 3300025945 | Ga0207679_10413999 | Ga0207679_104139992 | 82 |
| 211 | 3300025949 | Ga0207667_10597412 | Ga0207667_105974123 | 82 |
| 212 | 3300025949 | Ga0207667_11472856 | Ga0207667_114728562 | 82 |
| 213 | 3300025961 | Ga0207712_10212028 | Ga0207712_102120283 | 82 |
| 214 | 3300025972 | Ga0207668_10000430 | Ga0207668_1000043017 | 82 |
| 215 | 3300025972 | Ga0207668_10292187 | Ga0207668_102921873 | 82 |
| 216 | 3300025972 | Ga0207668_11611722 | Ga0207668_116117222 | 82 |
| 217 | 3300025972 | Ga0207668_11643110 | Ga0207668_116431101 | 82 |
| 218 | 3300025972 | Ga0207668_11922032 | Ga0207668_119220321 | 82 |
| 219 | 3300025981 | Ga0207640_10099519 | Ga0207640_100995192 | 82 |
| 220 | 3300025986 | Ga0207658_10000243 | Ga0207658_1000024350 | 82 |
| 221 | 3300026041 | Ga0207639_10014460 | Ga0207639_100144606 | 82 |
| 222 | 3300026067 | Ga0207678_10000773 | Ga0207678_1000077310 | 82 |
| 223 | 3300026078 | Ga0207702_10012453 | Ga0207702_100124531 | 82 |
| 224 | 3300026088 | Ga0207641_10000241 | Ga0207641_1000024141 | 82 |
| 225 | 3300026095 | Ga0207676_10118267 | Ga0207676_101182673 | 82 |
| 226 | 3300026116 | Ga0207674_10005038 | Ga0207674_100050389 | 82 |
| 227 | 3300026142 | Ga0207698_10018892 | Ga0207698_100188924 | 82 |
| 228 | 3300028379 | Ga0268266_10133236 | Ga0268266_101332363 | 82 |
| 229 | 3300028379 | Ga0268266_10921217 | Ga0268266_109212172 | 82 |
| 230 | 3300028380 | Ga0268265_10026242 | Ga0268265_100262424 | 82 |
| 231 | 3300028381 | Ga0268264_10052641 | Ga0268264_100526414 | 82 |
| 232 | 3300031548 | Ga0307408_100003838 | Ga0307408_1000038382 | 82 |
| 233 | 3300031548 | Ga0307408_101381152 | Ga0307408_1013811522 | 82 |
| 234 | 3300031731 | Ga0307405_10050959 | Ga0307405_100509591 | 82 |
| 235 | 3300031731 | Ga0307405_10640780 | Ga0307405_106407801 | 82 |
| 236 | 3300031824 | Ga0307413_10191989 | Ga0307413_101919894 | 82 |
| 237 | 3300031852 | Ga0307410_10095015 | Ga0307410_100950153 | 82 |
| 238 | 3300031901 | Ga0307406_10607487 | Ga0307406_106074873 | 82 |
| 239 | 3300031903 | Ga0307407_10215834 | Ga0307407_102158343 | 82 |
| 240 | 3300031911 | Ga0307412_10164020 | Ga0307412_101640201 | 82 |
| 241 | 3300031911 | Ga0307412_10333369 | Ga0307412_103333693 | 82 |
| 242 | 3300031911 | Ga0307412_10696297 | Ga0307412_106962972 | 82 |
| 243 | 3300031995 | Ga0307409_100276468 | Ga0307409_1002764682 | 82 |
| 244 | 3300032002 | Ga0307416_100180129 | Ga0307416_1001801294 | 82 |
| 245 | 3300032002 | Ga0307416_102119016 | Ga0307416_1021190162 | 82 |
| 246 | 3300032004 | Ga0307414_10032478 | Ga0307414_100324784 | 82 |
| 247 | 3300032005 | Ga0307411_10066342 | Ga0307411_100663422 | 82 |
| 248 | 3300032005 | Ga0307411_10475390 | Ga0307411_104753902 | 82 |
| 249 | 3300032126 | Ga0307415_100655277 | Ga0307415_1006552772 | 82 |
| 250 | 3300042127 | Ga0450890_054408 | Ga0450890_054408_109_369 | 82 |
| 251 | 3300046471 | Ga0495650_0001552 | Ga0495650_0001552_6539_6793 | 82 |
| 252 | 3300046513 | Ga0495616_0000022 | Ga0495616_0000022_114567_114821 | 82 |
| 253 | 3300046616 | Ga0495668_0267227 | Ga0495668_0267227_666_920 | 82 |
| 254 | 3300046648 | Ga0495611_0237212 | Ga0495611_0237212_125_379 | 82 |
| 255 | 3300046691 | Ga0495670_0709782 | Ga0495670_0709782_186_440 | 82 |
| 256 | 3300048907 | Ga0496104_0457463 | Ga0496104_0457463_100_354 | 82 |
| 257 | 3300048911 | Ga0496108_0001104 | Ga0496108_0001104_7795_8049 | 82 |
| 258 | 3300048911 | Ga0496108_0261640 | Ga0496108_0261640_719_973 | 82 |
| 259 | 3300048913 | Ga0496110_0007418 | Ga0496110_0007418_8282_8536 | 82 |
| 260 | 3300048913 | Ga0496110_0047911 | Ga0496110_0047911_38_292 | 82 |
| 261 | 3300048914 | Ga0496111_0040721 | Ga0496111_0040721_2956_3210 | 82 |
| 262 | 3300048914 | Ga0496111_0134502 | Ga0496111_0134502_903_1157 | 82 |
| 263 | 3300048916 | Ga0496113_0040728 | Ga0496113_0040728_1061_1315 | 82 |
| 264 | 3300048916 | Ga0496113_1309919 | Ga0496113_1309919_299_553 | 82 |
| 265 | 3300048919 | Ga0496116_0122931 | Ga0496116_0122931_354_608 | 82 |
| 266 | 3300048921 | Ga0496118_0148557 | Ga0496118_0148557_1142_1396 | 82 |
| 267 | 3300048924 | Ga0496121_0003542 | Ga0496121_0003542_16309_16563 | 82 |
| 268 | 3300048925 | Ga0496122_0033601 | Ga0496122_0033601_63_317 | 82 |
| 269 | 3300048926 | Ga0496123_0054939 | Ga0496123_0054939_1236_1490 | 82 |
| 270 | 3300048926 | Ga0496123_0281226 | Ga0496123_0281226_119_373 | 82 |
| 271 | 3300048927 | Ga0496124_0239946 | Ga0496124_0239946_454_708 | 82 |
| 272 | 3300048928 | Ga0496125_0009457 | Ga0496125_0009457_8371_8625 | 82 |
| 273 | 3300048928 | Ga0496125_0011195 | Ga0496125_0011195_953_1207 | 82 |
| 274 | 3300048928 | Ga0496125_0034476 | Ga0496125_0034476_974_1228 | 82 |
| 275 | 3300048928 | Ga0496125_0135923 | Ga0496125_0135923_798_1055 | 82 |
| 276 | 3300048929 | Ga0496126_0293834 | Ga0496126_0293834_98_352 | 82 |
| 277 | 3300048929 | Ga0496126_0542085 | Ga0496126_0542085_93_347 | 82 |
| 278 | 3300049523 | Ga0501300_055668 | Ga0501300_055668_288_542 | 82 |
| 279 | 3300049551 | Ga0501335_004083 | Ga0501335_004083_225_479 | 82 |
| 280 | 3300049571 | Ga0501034_0052605 | Ga0501034_0052605_731_1009 | 82 |
| 281 | 3300049581 | Ga0501047_0460255 | Ga0501047_0460255_804_1082 | 82 |
| 282 | 3300049585 | Ga0501069_0005700 | Ga0501069_0005700_1816_2094 | 82 |
| 283 | 3300049586 | Ga0501070_0034219 | Ga0501070_0034219_3106_3384 | 82 |
| 284 | 3300049587 | Ga0501071_0762292 | Ga0501071_0762292_410_688 | 82 |
| 285 | 3300049653 | Ga0501206_054051 | Ga0501206_054051_108_362 | 82 |
| 286 | 3300049658 | Ga0501211_000604 | Ga0501211_000604_222_476 | 82 |
| 287 | 3300049663 | Ga0501223_000008 | Ga0501223_000008_17085_17339 | 82 |
| 288 | 3300049669 | Ga0501235_012074 | Ga0501235_012074_870_1124 | 82 |
| 289 | 3300049670 | Ga0501236_005683 | Ga0501236_005683_532_786 | 82 |
| 290 | 3300049676 | Ga0501246_011106 | Ga0501246_011106_13_267 | 82 |
| 291 | 3300049685 | Ga0501256_001336 | Ga0501256_001336_890_1144 | 82 |
| 292 | 3300049705 | Ga0501225_0002035 | Ga0501225_0002035_1966_2220 | 82 |
| 293 | 3300049705 | Ga0501225_0005303 | Ga0501225_0005303_453_707 | 82 |
| 294 | 3300049705 | Ga0501225_0052085 | Ga0501225_0052085_50_304 | 82 |
| 295 | 3300049761 | Ga0501264_007196 | Ga0501264_007196_605_859 | 82 |
| 296 | 3300050507 | nmdc:mga05p37_152982_c1 | nmdc:mga05p37_152982_c1_153_407 | 82 |
| 297 | 3300050508 | nmdc:mga09592_1220239_c1 | nmdc:mga09592_1220239_c1_28_282 | 82 |
| 298 | 3300050510 | nmdc:mga06r32_19835_c1 | nmdc:mga06r32_19835_c1_33_287 | 82 |
| 299 | 3300050511 | nmdc:mga08y16_402669_c2 | nmdc:mga08y16_402669_c2_96_362 | 82 |
| 300 | 3300053087 | Ga0500643_002080 | Ga0500643_002080_6278_6532 | 82 |
| 301 | 3300053151 | Ga0500604_0002288 | Ga0500604_0002288_3277_3531 | 82 |
| 302 | 3300055283 | Ga0500661_001498 | Ga0500661_001498_2521_2775 | 82 |
| 303 | 2162886007 | SwRhRL2b_contig_2608932 | SwRhRL2b_0237.00000510 | 83 |
| 304 | 3300000041 | ARcpr5oldR_c005890 | ARcpr5oldR_0058902 | 83 |
| 305 | 3300001904 | JGI24736J21556_1000084 | JGI24736J21556_100008410 | 83 |
| 306 | 3300001915 | JGI24741J21665_1022120 | JGI24741J21665_10221201 | 83 |
| 307 | 3300001979 | JGI24740J21852_10010401 | JGI24740J21852_100104013 | 83 |
| 308 | 3300001989 | JGI24739J22299_10058466 | JGI24739J22299_100584662 | 83 |
| 309 | 3300002067 | JGI24735J21928_10009527 | JGI24735J21928_100095273 | 83 |
| 310 | 3300002067 | JGI24735J21928_10106397 | JGI24735J21928_101063972 | 83 |
| 311 | 3300002075 | JGI24738J21930_10000403 | JGI24738J21930_1000040312 | 83 |
| 312 | 3300002076 | JGI24749J21850_1000277 | JGI24749J21850_10002775 | 83 |
| 313 | 3300002459 | JGI24751J29686_10001694 | JGI24751J29686_100016944 | 83 |
| 314 | 3300002774 | JGI25150J39212_1000098 | JGI25150J39212_100009811 | 83 |
| 315 | 3300002774 | JGI25150J39212_1032474 | JGI25150J39212_10324741 | 83 |
| 316 | 3300003187 | JGI25151J46595_10031054 | JGI25151J46595_100310541 | 83 |
| 317 | 3300003215 | JGI25153J46596_10000055 | JGI25153J46596_10000055125 | 83 |
| 318 | 3300003215 | JGI25153J46596_10002938 | JGI25153J46596_100029389 | 83 |
| 319 | 3300003215 | JGI25153J46596_10065997 | JGI25153J46596_100659972 | 83 |
| 320 | 3300003316 | rootH1_10016789 | rootH1_100167892 | 83 |
| 321 | 3300003771 | Ga0055526_1003146 | Ga0055526_10031461 | 83 |
| 322 | 3300003771 | Ga0055526_1103262 | Ga0055526_11032621 | 83 |
| 323 | 3300003773 | Ga0055537_1001198 | Ga0055537_10011989 | 83 |
| 324 | 3300003773 | Ga0055537_1001216 | Ga0055537_10012164 | 83 |
| 325 | 3300003775 | Ga0055524_1000670 | Ga0055524_100067018 | 83 |
| 326 | 3300003781 | Ga0055536_1005408 | Ga0055536_10054085 | 83 |
| 327 | 3300003790 | Ga0055528_1024786 | Ga0055528_10247864 | 83 |
| 328 | 3300003791 | Ga0055530_10000224 | Ga0055530_100002245 | 83 |
| 329 | 3300003791 | Ga0055530_10010144 | Ga0055530_100101444 | 83 |
| 330 | 3300003791 | Ga0055530_10015555 | Ga0055530_100155551 | 83 |
| 331 | 3300003792 | Ga0055540_1001240 | Ga0055540_100124012 | 83 |
| 332 | 3300003794 | Ga0055531_10000094 | Ga0055531_1000009447 | 83 |
| 333 | 3300003794 | Ga0055531_10003913 | Ga0055531_100039134 | 83 |
| 334 | 3300003794 | Ga0055531_10072924 | Ga0055531_100729241 | 83 |
| 335 | 3300003856 | Ga0058692_1000081 | Ga0058692_100008150 | 83 |
| 336 | 3300003911 | JGI25405J52794_10000298 | JGI25405J52794_100002982 | 83 |
| 337 | 3300004625 | Ga0055543_1019776 | Ga0055543_10197762 | 83 |
| 338 | 3300004798 | Ga0058859_11742863 | Ga0058859_117428631 | 83 |
| 339 | 3300004798 | Ga0058859_11747837 | Ga0058859_117478371 | 83 |
| 340 | 3300004798 | Ga0058859_11789015 | Ga0058859_117890152 | 83 |
| 341 | 3300004798 | Ga0058859_11834298 | Ga0058859_118342981 | 83 |
| 342 | 3300004801 | Ga0058860_11386381 | Ga0058860_113863811 | 83 |
| 343 | 3300004801 | Ga0058860_11409702 | Ga0058860_114097022 | 83 |
| 344 | 3300004801 | Ga0058860_12029252 | Ga0058860_120292521 | 83 |
| 345 | 3300004801 | Ga0058860_12099451 | Ga0058860_120994512 | 83 |
| 346 | 3300005262 | Ga0065165_1007915 | Ga0065165_10079151 | 83 |
| 347 | 3300005262 | Ga0065165_1023907 | Ga0065165_10239073 | 83 |
| 348 | 3300005262 | Ga0065165_1036540 | Ga0065165_10365403 | 83 |
| 349 | 3300005262 | Ga0065165_1055259 | Ga0065165_10552591 | 83 |
| 350 | 3300005289 | Ga0065704_10078390 | Ga0065704_100783902 | 83 |
| 351 | 3300005289 | Ga0065704_10115293 | Ga0065704_101152933 | 83 |
| 352 | 3300005289 | Ga0065704_10158200 | Ga0065704_101582003 | 83 |
| 353 | 3300005289 | Ga0065704_10196152 | Ga0065704_101961522 | 83 |
| 354 | 3300005290 | Ga0065712_10747402 | Ga0065712_107474021 | 83 |
| 355 | 3300005293 | Ga0065715_10811313 | Ga0065715_108113131 | 83 |
| 356 | 3300005295 | Ga0065707_10110051 | Ga0065707_101100513 | 83 |
| 357 | 3300005295 | Ga0065707_10129579 | Ga0065707_101295792 | 83 |
| 358 | 3300005295 | Ga0065707_10182128 | Ga0065707_101821282 | 83 |
| 359 | 3300005327 | Ga0070658_10020553 | Ga0070658_100205532 | 83 |
| 360 | 3300005327 | Ga0070658_10372339 | Ga0070658_103723392 | 83 |
| 361 | 3300005327 | Ga0070658_10469790 | Ga0070658_104697901 | 83 |
| 362 | 3300005328 | Ga0070676_10130746 | Ga0070676_101307463 | 83 |
| 363 | 3300005329 | Ga0070683_100526620 | Ga0070683_1005266202 | 83 |
| 364 | 3300005329 | Ga0070683_100817410 | Ga0070683_1008174101 | 83 |
| 365 | 3300005329 | Ga0070683_100911697 | Ga0070683_1009116972 | 83 |
| 366 | 3300005329 | Ga0070683_102387100 | Ga0070683_1023871001 | 83 |
| 367 | 3300005330 | Ga0070690_100359067 | Ga0070690_1003590672 | 83 |
| 368 | 3300005331 | Ga0070670_100003557 | Ga0070670_10000355710 | 83 |
| 369 | 3300005331 | Ga0070670_100073086 | Ga0070670_1000730864 | 83 |
| 370 | 3300005331 | Ga0070670_100286094 | Ga0070670_1002860941 | 83 |
| 371 | 3300005331 | Ga0070670_100351750 | Ga0070670_1003517502 | 83 |
| 372 | 3300005331 | Ga0070670_101468915 | Ga0070670_1014689152 | 83 |
| 373 | 3300005333 | Ga0070677_10054194 | Ga0070677_100541941 | 83 |
| 374 | 3300005333 | Ga0070677_10196083 | Ga0070677_101960831 | 83 |
| 375 | 3300005333 | Ga0070677_10281992 | Ga0070677_102819922 | 83 |
| 376 | 3300005333 | Ga0070677_10630391 | Ga0070677_106303911 | 83 |
| 377 | 3300005333 | Ga0070677_10901815 | Ga0070677_109018151 | 83 |
| 378 | 3300005334 | Ga0068869_100037537 | Ga0068869_1000375374 | 83 |
| 379 | 3300005334 | Ga0068869_100073646 | Ga0068869_1000736462 | 83 |
| 380 | 3300005334 | Ga0068869_100376476 | Ga0068869_1003764762 | 83 |
| 381 | 3300005334 | Ga0068869_100991230 | Ga0068869_1009912302 | 83 |
| 382 | 3300005334 | Ga0068869_101530063 | Ga0068869_1015300632 | 83 |
| 383 | 3300005336 | Ga0070680_100077391 | Ga0070680_1000773915 | 83 |
| 384 | 3300005337 | Ga0070682_100031832 | Ga0070682_1000318324 | 83 |
| 385 | 3300005337 | Ga0070682_100143279 | Ga0070682_1001432792 | 83 |
| 386 | 3300005337 | Ga0070682_101349023 | Ga0070682_1013490231 | 83 |
| 387 | 3300005338 | Ga0068868_100220568 | Ga0068868_1002205681 | 83 |
| 388 | 3300005338 | Ga0068868_100833135 | Ga0068868_1008331351 | 83 |
| 389 | 3300005338 | Ga0068868_101079721 | Ga0068868_1010797212 | 83 |
| 390 | 3300005339 | Ga0070660_100170249 | Ga0070660_1001702491 | 83 |
| 391 | 3300005339 | Ga0070660_100207702 | Ga0070660_1002077022 | 83 |
| 392 | 3300005339 | Ga0070660_101165079 | Ga0070660_1011650792 | 83 |
| 393 | 3300005340 | Ga0070689_100008543 | Ga0070689_1000085431 | 83 |
| 394 | 3300005340 | Ga0070689_100128753 | Ga0070689_1001287533 | 83 |
| 395 | 3300005340 | Ga0070689_100173512 | Ga0070689_1001735122 | 83 |
| 396 | 3300005343 | Ga0070687_100250993 | Ga0070687_1002509931 | 83 |
| 397 | 3300005344 | Ga0070661_100090999 | Ga0070661_1000909992 | 83 |
| 398 | 3300005344 | Ga0070661_100151526 | Ga0070661_1001515261 | 83 |
| 399 | 3300005344 | Ga0070661_100240982 | Ga0070661_1002409822 | 83 |
| 400 | 3300005344 | Ga0070661_101108681 | Ga0070661_1011086811 | 83 |
| 401 | 3300005345 | Ga0070692_10112290 | Ga0070692_101122902 | 83 |
| 402 | 3300005347 | Ga0070668_100075344 | Ga0070668_1000753443 | 83 |
| 403 | 3300005347 | Ga0070668_100330696 | Ga0070668_1003306961 | 83 |
| 404 | 3300005347 | Ga0070668_100615799 | Ga0070668_1006157991 | 83 |
| 405 | 3300005347 | Ga0070668_100933638 | Ga0070668_1009336382 | 83 |
| 406 | 3300005353 | Ga0070669_100000059 | Ga0070669_10000005965 | 83 |
| 407 | 3300005353 | Ga0070669_100011016 | Ga0070669_1000110165 | 83 |
| 408 | 3300005353 | Ga0070669_100129070 | Ga0070669_1001290702 | 83 |
| 409 | 3300005353 | Ga0070669_101169273 | Ga0070669_1011692732 | 83 |
| 410 | 3300005353 | Ga0070669_101199073 | Ga0070669_1011990731 | 83 |
| 411 | 3300005354 | Ga0070675_100086771 | Ga0070675_1000867712 | 83 |
| 412 | 3300005354 | Ga0070675_100370234 | Ga0070675_1003702342 | 83 |
| 413 | 3300005354 | Ga0070675_100882501 | Ga0070675_1008825012 | 83 |
| 414 | 3300005354 | Ga0070675_102116517 | Ga0070675_1021165171 | 83 |
| 415 | 3300005355 | Ga0070671_100246960 | Ga0070671_1002469603 | 83 |
| 416 | 3300005355 | Ga0070671_101912747 | Ga0070671_1019127472 | 83 |
| 417 | 3300005356 | Ga0070674_100301647 | Ga0070674_1003016472 | 83 |
| 418 | 3300005356 | Ga0070674_100826861 | Ga0070674_1008268612 | 83 |
| 419 | 3300005356 | Ga0070674_101361348 | Ga0070674_1013613481 | 83 |
| 420 | 3300005364 | Ga0070673_100552155 | Ga0070673_1005521552 | 83 |
| 421 | 3300005364 | Ga0070673_100586025 | Ga0070673_1005860251 | 83 |
| 422 | 3300005364 | Ga0070673_101267500 | Ga0070673_1012675002 | 83 |
| 423 | 3300005365 | Ga0070688_100000464 | Ga0070688_10000046412 | 83 |
| 424 | 3300005365 | Ga0070688_100024154 | Ga0070688_1000241545 | 83 |
| 425 | 3300005365 | Ga0070688_101082925 | Ga0070688_1010829251 | 83 |
| 426 | 3300005365 | Ga0070688_101352834 | Ga0070688_1013528341 | 83 |
| 427 | 3300005366 | Ga0070659_100094268 | Ga0070659_1000942682 | 83 |
| 428 | 3300005366 | Ga0070659_100379626 | Ga0070659_1003796262 | 83 |
| 429 | 3300005366 | Ga0070659_100814640 | Ga0070659_1008146402 | 83 |
| 430 | 3300005367 | Ga0070667_100000076 | Ga0070667_10000007615 | 83 |
| 431 | 3300005367 | Ga0070667_100556960 | Ga0070667_1005569601 | 83 |
| 432 | 3300005367 | Ga0070667_100804253 | Ga0070667_1008042531 | 83 |
| 433 | 3300005437 | Ga0070710_10222220 | Ga0070710_102222202 | 83 |
| 434 | 3300005438 | Ga0070701_10407954 | Ga0070701_104079542 | 83 |
| 435 | 3300005441 | Ga0070700_100090960 | Ga0070700_1000909603 | 83 |
| 436 | 3300005441 | Ga0070700_100136197 | Ga0070700_1001361971 | 83 |
| 437 | 3300005441 | Ga0070700_100217322 | Ga0070700_1002173222 | 83 |
| 438 | 3300005444 | Ga0070694_100597749 | Ga0070694_1005977492 | 83 |
| 439 | 3300005444 | Ga0070694_100613612 | Ga0070694_1006136121 | 83 |
| 440 | 3300005444 | Ga0070694_100790832 | Ga0070694_1007908322 | 83 |
| 441 | 3300005455 | Ga0070663_100276632 | Ga0070663_1002766322 | 83 |
| 442 | 3300005455 | Ga0070663_101073362 | Ga0070663_1010733622 | 83 |
| 443 | 3300005455 | Ga0070663_101867308 | Ga0070663_1018673081 | 83 |
| 444 | 3300005456 | Ga0070678_101473560 | Ga0070678_1014735601 | 83 |
| 445 | 3300005456 | Ga0070678_101515059 | Ga0070678_1015150591 | 83 |
| 446 | 3300005457 | Ga0070662_100002034 | Ga0070662_1000020345 | 83 |
| 447 | 3300005457 | Ga0070662_100125479 | Ga0070662_1001254792 | 83 |
| 448 | 3300005457 | Ga0070662_100428595 | Ga0070662_1004285952 | 83 |
| 449 | 3300005457 | Ga0070662_100784756 | Ga0070662_1007847562 | 83 |
| 450 | 3300005458 | Ga0070681_10401588 | Ga0070681_104015882 | 83 |
| 451 | 3300005458 | Ga0070681_10651945 | Ga0070681_106519451 | 83 |
| 452 | 3300005458 | Ga0070681_11224404 | Ga0070681_112244041 | 83 |
| 453 | 3300005459 | Ga0068867_100137840 | Ga0068867_1001378402 | 83 |
| 454 | 3300005459 | Ga0068867_101631799 | Ga0068867_1016317992 | 83 |
| 455 | 3300005459 | Ga0068867_102143574 | Ga0068867_1021435741 | 83 |
| 456 | 3300005466 | Ga0070685_10000247 | Ga0070685_1000024717 | 83 |
| 457 | 3300005466 | Ga0070685_10170446 | Ga0070685_101704462 | 83 |
| 458 | 3300005466 | Ga0070685_10673582 | Ga0070685_106735822 | 83 |
| 459 | 3300005467 | Ga0070706_101900657 | Ga0070706_1019006572 | 83 |
| 460 | 3300005468 | Ga0070707_100668794 | Ga0070707_1006687942 | 83 |
| 461 | 3300005468 | Ga0070707_101498227 | Ga0070707_1014982271 | 83 |
| 462 | 3300005518 | Ga0070699_100488216 | Ga0070699_1004882162 | 83 |
| 463 | 3300005530 | Ga0070679_100164449 | Ga0070679_1001644493 | 83 |
| 464 | 3300005535 | Ga0070684_101061917 | Ga0070684_1010619172 | 83 |
| 465 | 3300005535 | Ga0070684_101343794 | Ga0070684_1013437941 | 83 |
| 466 | 3300005535 | Ga0070684_101685781 | Ga0070684_1016857812 | 83 |
| 467 | 3300005536 | Ga0070697_101122962 | Ga0070697_1011229622 | 83 |
| 468 | 3300005539 | Ga0068853_100681801 | Ga0068853_1006818012 | 83 |
| 469 | 3300005539 | Ga0068853_101549709 | Ga0068853_1015497092 | 83 |
| 470 | 3300005539 | Ga0068853_102430794 | Ga0068853_1024307942 | 83 |
| 471 | 3300005543 | Ga0070672_100003882 | Ga0070672_1000038823 | 83 |
| 472 | 3300005543 | Ga0070672_100013080 | Ga0070672_1000130802 | 83 |
| 473 | 3300005543 | Ga0070672_100428434 | Ga0070672_1004284342 | 83 |
| 474 | 3300005543 | Ga0070672_100443636 | Ga0070672_1004436362 | 83 |
| 475 | 3300005543 | Ga0070672_100585006 | Ga0070672_1005850062 | 83 |
| 476 | 3300005544 | Ga0070686_100036559 | Ga0070686_1000365596 | 83 |
| 477 | 3300005544 | Ga0070686_100060268 | Ga0070686_1000602683 | 83 |
| 478 | 3300005545 | Ga0070695_100659325 | Ga0070695_1006593252 | 83 |
| 479 | 3300005546 | Ga0070696_100036845 | Ga0070696_1000368453 | 83 |
| 480 | 3300005546 | Ga0070696_100277159 | Ga0070696_1002771591 | 83 |
| 481 | 3300005546 | Ga0070696_100391765 | Ga0070696_1003917652 | 83 |
| 482 | 3300005548 | Ga0070665_100000217 | Ga0070665_10000021750 | 83 |
| 483 | 3300005548 | Ga0070665_100004044 | Ga0070665_1000040442 | 83 |
| 484 | 3300005548 | Ga0070665_100169050 | Ga0070665_1001690503 | 83 |
| 485 | 3300005548 | Ga0070665_100420202 | Ga0070665_1004202023 | 83 |
| 486 | 3300005548 | Ga0070665_100714477 | Ga0070665_1007144772 | 83 |
| 487 | 3300005549 | Ga0070704_100604210 | Ga0070704_1006042102 | 83 |
| 488 | 3300005549 | Ga0070704_100858386 | Ga0070704_1008583861 | 83 |
| 489 | 3300005549 | Ga0070704_101057917 | Ga0070704_1010579171 | 83 |
| 490 | 3300005563 | Ga0068855_100003860 | Ga0068855_10000386018 | 83 |
| 491 | 3300005563 | Ga0068855_100233241 | Ga0068855_1002332411 | 83 |
| 492 | 3300005563 | Ga0068855_101162278 | Ga0068855_1011622782 | 83 |
| 493 | 3300005563 | Ga0068855_102057311 | Ga0068855_1020573112 | 83 |
| 494 | 3300005564 | Ga0070664_100145004 | Ga0070664_1001450042 | 83 |
| 495 | 3300005564 | Ga0070664_100568299 | Ga0070664_1005682993 | 83 |
| 496 | 3300005564 | Ga0070664_100757420 | Ga0070664_1007574202 | 83 |
| 497 | 3300005564 | Ga0070664_101386209 | Ga0070664_1013862092 | 83 |
| 498 | 3300005577 | Ga0068857_100049380 | Ga0068857_1000493802 | 83 |
| 499 | 3300005577 | Ga0068857_100100906 | Ga0068857_1001009062 | 83 |
| 500 | 3300005577 | Ga0068857_100238588 | Ga0068857_1002385882 | 83 |
| 501 | 3300005577 | Ga0068857_100297759 | Ga0068857_1002977593 | 83 |
| 502 | 3300005577 | Ga0068857_100528141 | Ga0068857_1005281412 | 83 |
| 503 | 3300005577 | Ga0068857_101021994 | Ga0068857_1010219942 | 83 |
| 504 | 3300005577 | Ga0068857_101072340 | Ga0068857_1010723402 | 83 |
| 505 | 3300005578 | Ga0068854_100003887 | Ga0068854_10000388710 | 83 |
| 506 | 3300005578 | Ga0068854_100345797 | Ga0068854_1003457972 | 83 |
| 507 | 3300005578 | Ga0068854_101131083 | Ga0068854_1011310832 | 83 |
| 508 | 3300005614 | Ga0068856_100256786 | Ga0068856_1002567863 | 83 |
| 509 | 3300005614 | Ga0068856_100726103 | Ga0068856_1007261032 | 83 |
| 510 | 3300005614 | Ga0068856_101552463 | Ga0068856_1015524631 | 83 |
| 511 | 3300005615 | Ga0070702_100501202 | Ga0070702_1005012022 | 83 |
| 512 | 3300005616 | Ga0068852_100357541 | Ga0068852_1003575412 | 83 |
| 513 | 3300005616 | Ga0068852_100703913 | Ga0068852_1007039132 | 83 |
| 514 | 3300005616 | Ga0068852_100763496 | Ga0068852_1007634962 | 83 |
| 515 | 3300005616 | Ga0068852_101834674 | Ga0068852_1018346741 | 83 |
| 516 | 3300005617 | Ga0068859_100000937 | Ga0068859_10000093722 | 83 |
| 517 | 3300005617 | Ga0068859_100158476 | Ga0068859_1001584763 | 83 |
| 518 | 3300005617 | Ga0068859_100771262 | Ga0068859_1007712622 | 83 |
| 519 | 3300005617 | Ga0068859_102191608 | Ga0068859_1021916081 | 83 |
| 520 | 3300005618 | Ga0068864_100255330 | Ga0068864_1002553303 | 83 |
| 521 | 3300005618 | Ga0068864_100769951 | Ga0068864_1007699511 | 83 |
| 522 | 3300005618 | Ga0068864_101623756 | Ga0068864_1016237561 | 83 |
| 523 | 3300005718 | Ga0068866_10066946 | Ga0068866_100669463 | 83 |
| 524 | 3300005718 | Ga0068866_10444519 | Ga0068866_104445191 | 83 |
| 525 | 3300005718 | Ga0068866_10779257 | Ga0068866_107792572 | 83 |
| 526 | 3300005719 | Ga0068861_100001013 | Ga0068861_1000010135 | 83 |
| 527 | 3300005719 | Ga0068861_100001319 | Ga0068861_1000013195 | 83 |
| 528 | 3300005719 | Ga0068861_100030478 | Ga0068861_1000304781 | 83 |
| 529 | 3300005719 | Ga0068861_100314475 | Ga0068861_1003144752 | 83 |
| 530 | 3300005719 | Ga0068861_100749861 | Ga0068861_1007498612 | 83 |
| 531 | 3300005719 | Ga0068861_100805982 | Ga0068861_1008059821 | 83 |
| 532 | 3300005719 | Ga0068861_101034372 | Ga0068861_1010343722 | 83 |
| 533 | 3300005834 | Ga0068851_10066729 | Ga0068851_100667292 | 83 |
| 534 | 3300005834 | Ga0068851_10373581 | Ga0068851_103735811 | 83 |
| 535 | 3300005834 | Ga0068851_10394696 | Ga0068851_103946961 | 83 |
| 536 | 3300005840 | Ga0068870_10032554 | Ga0068870_100325544 | 83 |
| 537 | 3300005840 | Ga0068870_10105888 | Ga0068870_101058881 | 83 |
| 538 | 3300005841 | Ga0068863_100007022 | Ga0068863_1000070229 | 83 |
| 539 | 3300005841 | Ga0068863_100192390 | Ga0068863_1001923904 | 83 |
| 540 | 3300005841 | Ga0068863_100263679 | Ga0068863_1002636792 | 83 |
| 541 | 3300005841 | Ga0068863_100308978 | Ga0068863_1003089783 | 83 |
| 542 | 3300005841 | Ga0068863_100739573 | Ga0068863_1007395732 | 83 |
| 543 | 3300005841 | Ga0068863_100847616 | Ga0068863_1008476162 | 83 |
| 544 | 3300005841 | Ga0068863_102696448 | Ga0068863_1026964482 | 83 |
| 545 | 3300005842 | Ga0068858_100002534 | Ga0068858_10000253423 | 83 |
| 546 | 3300005842 | Ga0068858_100474219 | Ga0068858_1004742192 | 83 |
| 547 | 3300005842 | Ga0068858_100764069 | Ga0068858_1007640692 | 83 |
| 548 | 3300005842 | Ga0068858_101020675 | Ga0068858_1010206752 | 83 |
| 549 | 3300005843 | Ga0068860_100000131 | Ga0068860_10000013191 | 83 |
| 550 | 3300005843 | Ga0068860_100002475 | Ga0068860_10000247515 | 83 |
| 551 | 3300005843 | Ga0068860_100310203 | Ga0068860_1003102033 | 83 |
| 552 | 3300005843 | Ga0068860_100646094 | Ga0068860_1006460942 | 83 |
| 553 | 3300005843 | Ga0068860_102688113 | Ga0068860_1026881132 | 83 |
| 554 | 3300005844 | Ga0068862_100006832 | Ga0068862_1000068325 | 83 |
| 555 | 3300005844 | Ga0068862_100021336 | Ga0068862_1000213368 | 83 |
| 556 | 3300005844 | Ga0068862_101185256 | Ga0068862_1011852562 | 83 |
| 557 | 3300005844 | Ga0068862_102710344 | Ga0068862_1027103441 | 83 |
| 558 | 3300006038 | Ga0075365_11127366 | Ga0075365_111273662 | 83 |
| 559 | 3300006048 | Ga0075363_100097265 | Ga0075363_1000972654 | 83 |
| 560 | 3300006058 | Ga0075432_10058225 | Ga0075432_100582252 | 83 |
| 561 | 3300006058 | Ga0075432_10398390 | Ga0075432_103983901 | 83 |
| 562 | 3300006177 | Ga0075362_10000003 | Ga0075362_10000003131 | 83 |
| 563 | 3300006186 | Ga0075369_10006096 | Ga0075369_100060965 | 83 |
| 564 | 3300006195 | Ga0075366_10000006 | Ga0075366_1000000641 | 83 |
| 565 | 3300006195 | Ga0075366_10004410 | Ga0075366_100044107 | 83 |
| 566 | 3300006195 | Ga0075366_10009043 | Ga0075366_100090436 | 83 |
| 567 | 3300006195 | Ga0075366_10159049 | Ga0075366_101590491 | 83 |
| 568 | 3300006195 | Ga0075366_10404635 | Ga0075366_104046352 | 83 |
| 569 | 3300006195 | Ga0075366_10844270 | Ga0075366_108442701 | 83 |
| 570 | 3300006195 | Ga0075366_11077605 | Ga0075366_110776051 | 83 |
| 571 | 3300006237 | Ga0097621_100012982 | Ga0097621_1000129828 | 83 |
| 572 | 3300006237 | Ga0097621_100108950 | Ga0097621_1001089502 | 83 |
| 573 | 3300006237 | Ga0097621_100443070 | Ga0097621_1004430703 | 83 |
| 574 | 3300006237 | Ga0097621_100536177 | Ga0097621_1005361772 | 83 |
| 575 | 3300006353 | Ga0075370_10000008 | Ga0075370_1000000852 | 83 |
| 576 | 3300006358 | Ga0068871_100021925 | Ga0068871_1000219259 | 83 |
| 577 | 3300006358 | Ga0068871_100081486 | Ga0068871_1000814863 | 83 |
| 578 | 3300006358 | Ga0068871_100195049 | Ga0068871_1001950492 | 83 |
| 579 | 3300006358 | Ga0068871_101648311 | Ga0068871_1016483111 | 83 |
| 580 | 3300006844 | Ga0075428_100024545 | Ga0075428_1000245456 | 83 |
| 581 | 3300006844 | Ga0075428_100048029 | Ga0075428_1000480293 | 83 |
| 582 | 3300006844 | Ga0075428_100363049 | Ga0075428_1003630492 | 83 |
| 583 | 3300006844 | Ga0075428_100557585 | Ga0075428_1005575852 | 83 |
| 584 | 3300006844 | Ga0075428_102091665 | Ga0075428_1020916651 | 83 |
| 585 | 3300006846 | Ga0075430_100028496 | Ga0075430_1000284965 | 83 |
| 586 | 3300006846 | Ga0075430_100230052 | Ga0075430_1002300522 | 83 |
| 587 | 3300006846 | Ga0075430_100267734 | Ga0075430_1002677343 | 83 |
| 588 | 3300006846 | Ga0075430_100517176 | Ga0075430_1005171762 | 83 |
| 589 | 3300006846 | Ga0075430_100661347 | Ga0075430_1006613472 | 83 |
| 590 | 3300006847 | Ga0075431_100004046 | Ga0075431_1000040465 | 83 |
| 591 | 3300006847 | Ga0075431_100081587 | Ga0075431_1000815872 | 83 |
| 592 | 3300006847 | Ga0075431_100325052 | Ga0075431_1003250523 | 83 |
| 593 | 3300006847 | Ga0075431_100441752 | Ga0075431_1004417522 | 83 |
| 594 | 3300006847 | Ga0075431_100515661 | Ga0075431_1005156612 | 83 |
| 595 | 3300006847 | Ga0075431_100659061 | Ga0075431_1006590612 | 83 |
| 596 | 3300006847 | Ga0075431_101525665 | Ga0075431_1015256652 | 83 |
| 597 | 3300006852 | Ga0075433_10001740 | Ga0075433_100017403 | 83 |
| 598 | 3300006852 | Ga0075433_10026664 | Ga0075433_100266644 | 83 |
| 599 | 3300006852 | Ga0075433_10120072 | Ga0075433_101200723 | 83 |
| 600 | 3300006852 | Ga0075433_11756301 | Ga0075433_117563012 | 83 |
| 601 | 3300006871 | Ga0075434_100469506 | Ga0075434_1004695062 | 83 |
| 602 | 3300006871 | Ga0075434_100631572 | Ga0075434_1006315721 | 83 |
| 603 | 3300006880 | Ga0075429_100066252 | Ga0075429_1000662522 | 83 |
| 604 | 3300006880 | Ga0075429_100282556 | Ga0075429_1002825562 | 83 |
| 605 | 3300006881 | Ga0068865_100192080 | Ga0068865_1001920802 | 83 |
| 606 | 3300006881 | Ga0068865_100776754 | Ga0068865_1007767541 | 83 |
| 607 | 3300006881 | Ga0068865_100790184 | Ga0068865_1007901842 | 83 |
| 608 | 3300006881 | Ga0068865_101295288 | Ga0068865_1012952882 | 83 |
| 609 | 3300006881 | Ga0068865_101624523 | Ga0068865_1016245232 | 83 |
| 610 | 3300006931 | Ga0097620_100000937 | Ga0097620_10000093715 | 83 |
| 611 | 3300006931 | Ga0097620_100158469 | Ga0097620_1001584693 | 83 |
| 612 | 3300006931 | Ga0097620_100771242 | Ga0097620_1007712422 | 83 |
| 613 | 3300006931 | Ga0097620_102191919 | Ga0097620_1021919192 | 83 |
| 614 | 3300007076 | Ga0075435_100704095 | Ga0075435_1007040951 | 83 |
| 615 | 3300007076 | Ga0075435_101134671 | Ga0075435_1011346711 | 83 |
| 616 | 3300007076 | Ga0075435_101329195 | Ga0075435_1013291952 | 83 |
| 617 | 3300007076 | Ga0075435_102013855 | Ga0075435_1020138551 | 83 |
| 618 | 3300009011 | Ga0105251_10000008 | Ga0105251_1000000880 | 83 |
| 619 | 3300009093 | Ga0105240_10031828 | Ga0105240_100318284 | 83 |
| 620 | 3300009093 | Ga0105240_10487802 | Ga0105240_104878022 | 83 |
| 621 | 3300009093 | Ga0105240_10964699 | Ga0105240_109646991 | 83 |
| 622 | 3300009093 | Ga0105240_11380651 | Ga0105240_113806512 | 83 |
| 623 | 3300009093 | Ga0105240_12176803 | Ga0105240_121768032 | 83 |
| 624 | 3300009094 | Ga0111539_10043567 | Ga0111539_100435674 | 83 |
| 625 | 3300009094 | Ga0111539_10060790 | Ga0111539_100607905 | 83 |
| 626 | 3300009094 | Ga0111539_10173166 | Ga0111539_101731662 | 83 |
| 627 | 3300009094 | Ga0111539_10344112 | Ga0111539_103441122 | 83 |
| 628 | 3300009094 | Ga0111539_11189430 | Ga0111539_111894302 | 83 |
| 629 | 3300009094 | Ga0111539_12123566 | Ga0111539_121235661 | 83 |
| 630 | 3300009094 | Ga0111539_12387773 | Ga0111539_123877731 | 83 |
| 631 | 3300009101 | Ga0105247_10102551 | Ga0105247_101025512 | 83 |
| 632 | 3300009147 | Ga0114129_10091923 | Ga0114129_100919233 | 83 |
| 633 | 3300009147 | Ga0114129_10823468 | Ga0114129_108234683 | 83 |
| 634 | 3300009147 | Ga0114129_11274551 | Ga0114129_112745512 | 83 |
| 635 | 3300009148 | Ga0105243_10061151 | Ga0105243_100611513 | 83 |
| 636 | 3300009148 | Ga0105243_10702909 | Ga0105243_107029092 | 83 |
| 637 | 3300009148 | Ga0105243_11253727 | Ga0105243_112537272 | 83 |
| 638 | 3300009148 | Ga0105243_12460235 | Ga0105243_124602352 | 83 |
| 639 | 3300009174 | Ga0105241_10144017 | Ga0105241_101440173 | 83 |
| 640 | 3300009174 | Ga0105241_10642196 | Ga0105241_106421962 | 83 |
| 641 | 3300009176 | Ga0105242_11236447 | Ga0105242_112364472 | 83 |
| 642 | 3300009176 | Ga0105242_11635349 | Ga0105242_116353491 | 83 |
| 643 | 3300009177 | Ga0105248_10016965 | Ga0105248_100169658 | 83 |
| 644 | 3300009177 | Ga0105248_10435177 | Ga0105248_104351773 | 83 |
| 645 | 3300009177 | Ga0105248_11747331 | Ga0105248_117473311 | 83 |
| 646 | 3300009545 | Ga0105237_10531086 | Ga0105237_105310861 | 83 |
| 647 | 3300009545 | Ga0105237_10543583 | Ga0105237_105435832 | 83 |
| 648 | 3300009551 | Ga0105238_10151678 | Ga0105238_101516782 | 83 |
| 649 | 3300009551 | Ga0105238_11141734 | Ga0105238_111417342 | 83 |
| 650 | 3300009553 | Ga0105249_10016789 | Ga0105249_100167896 | 83 |
| 651 | 3300009553 | Ga0105249_10579820 | Ga0105249_105798202 | 83 |
| 652 | 3300009553 | Ga0105249_10773039 | Ga0105249_107730392 | 83 |
| 653 | 3300010375 | Ga0105239_10676300 | Ga0105239_106763002 | 83 |
| 654 | 3300010375 | Ga0105239_10973580 | Ga0105239_109735802 | 83 |
| 655 | 3300010375 | Ga0105239_13492167 | Ga0105239_134921671 | 83 |
| 656 | 3300011119 | Ga0105246_10395339 | Ga0105246_103953392 | 83 |
| 657 | 3300011119 | Ga0105246_10482363 | Ga0105246_104823632 | 83 |
| 658 | 3300012475 | Ga0157317_1011268 | Ga0157317_10112681 | 83 |
| 659 | 3300012482 | Ga0157318_1004150 | Ga0157318_10041502 | 83 |
| 660 | 3300012483 | Ga0157337_1033049 | Ga0157337_10330491 | 83 |
| 661 | 3300012485 | Ga0157325_1011370 | Ga0157325_10113702 | 83 |
| 662 | 3300012488 | Ga0157343_1029663 | Ga0157343_10296632 | 83 |
| 663 | 3300012491 | Ga0157329_1010315 | Ga0157329_10103152 | 83 |
| 664 | 3300012498 | Ga0157345_1017245 | Ga0157345_10172451 | 83 |
| 665 | 3300012503 | Ga0157313_1031199 | Ga0157313_10311991 | 83 |
| 666 | 3300012506 | Ga0157324_1016458 | Ga0157324_10164581 | 83 |
| 667 | 3300012506 | Ga0157324_1033534 | Ga0157324_10335342 | 83 |
| 668 | 3300012512 | Ga0157327_1001313 | Ga0157327_10013134 | 83 |
| 669 | 3300012513 | Ga0157326_1056645 | Ga0157326_10566452 | 83 |
| 670 | 3300012515 | Ga0157338_1016355 | Ga0157338_10163552 | 83 |
| 671 | 3300013104 | Ga0157370_10022193 | Ga0157370_100221932 | 83 |
| 672 | 3300013104 | Ga0157370_11406289 | Ga0157370_114062891 | 83 |
| 673 | 3300013105 | Ga0157369_10202691 | Ga0157369_102026912 | 83 |
| 674 | 3300013297 | Ga0157378_10062716 | Ga0157378_100627164 | 83 |
| 675 | 3300013297 | Ga0157378_10461754 | Ga0157378_104617542 | 83 |
| 676 | 3300013306 | Ga0163162_10027802 | Ga0163162_100278026 | 83 |
| 677 | 3300013306 | Ga0163162_10079660 | Ga0163162_100796603 | 83 |
| 678 | 3300013306 | Ga0163162_10268689 | Ga0163162_102686893 | 83 |
| 679 | 3300013306 | Ga0163162_11257646 | Ga0163162_112576462 | 83 |
| 680 | 3300013306 | Ga0163162_11570973 | Ga0163162_115709732 | 83 |
| 681 | 3300013307 | Ga0157372_10810324 | Ga0157372_108103242 | 83 |
| 682 | 3300013308 | Ga0157375_10100139 | Ga0157375_101001393 | 83 |
| 683 | 3300013308 | Ga0157375_12526301 | Ga0157375_125263012 | 83 |
| 684 | 3300014325 | Ga0163163_10011107 | Ga0163163_100111072 | 83 |
| 685 | 3300014325 | Ga0163163_10183020 | Ga0163163_101830202 | 83 |
| 686 | 3300014326 | Ga0157380_10000094 | Ga0157380_100000949 | 83 |
| 687 | 3300014326 | Ga0157380_10000231 | Ga0157380_1000023130 | 83 |
| 688 | 3300014326 | Ga0157380_10006104 | Ga0157380_100061044 | 83 |
| 689 | 3300014326 | Ga0157380_10482747 | Ga0157380_104827472 | 83 |
| 690 | 3300014326 | Ga0157380_11043423 | Ga0157380_110434232 | 83 |
| 691 | 3300014326 | Ga0157380_13117482 | Ga0157380_131174822 | 83 |
| 692 | 3300014968 | Ga0157379_10148470 | Ga0157379_101484703 | 83 |
| 693 | 3300014968 | Ga0157379_12169131 | Ga0157379_121691312 | 83 |
| 694 | 3300014969 | Ga0157376_10004537 | Ga0157376_100045378 | 83 |
| 695 | 3300014969 | Ga0157376_10128485 | Ga0157376_101284852 | 83 |
| 696 | 3300014969 | Ga0157376_10625195 | Ga0157376_106251952 | 83 |
| 697 | 3300014969 | Ga0157376_11404345 | Ga0157376_114043451 | 83 |
| 698 | 3300014969 | Ga0157376_12456480 | Ga0157376_124564802 | 83 |
| 699 | 3300015261 | Ga0182006_1111727 | Ga0182006_11117272 | 83 |
| 700 | 3300015265 | Ga0182005_1005698 | Ga0182005_10056982 | 83 |
| 701 | 3300015690 | Ga0183363_1007 | Ga0183363_100729 | 83 |
| 702 | 3300016635 | Ga0183361_10068 | Ga0183361_100685 | 83 |
| 703 | 3300017792 | Ga0163161_10295590 | Ga0163161_102955902 | 83 |
| 704 | 3300017792 | Ga0163161_11623367 | Ga0163161_116233671 | 83 |
| 705 | 3300020080 | Ga0206350_10854057 | Ga0206350_108540571 | 83 |
| 706 | 3300020082 | Ga0206353_10274352 | Ga0206353_102743522 | 83 |
| 707 | 3300021358 | Ga0213873_10000021 | Ga0213873_1000002190 | 83 |
| 708 | 3300021384 | Ga0213876_10000050 | Ga0213876_1000005033 | 83 |
| 709 | 3300023309 | Ga0256744_123496 | Ga0256744_1234961 | 83 |
| 710 | 3300025208 | Ga0209436_105263 | Ga0209436_1052634 | 83 |
| 711 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005576 | 83 |
| 712 | 3300025258 | Ga0209129_1008702 | Ga0209129_10087024 | 83 |
| 713 | 3300025263 | Ga0209565_1000029 | Ga0209565_1000029310 | 83 |
| 714 | 3300025263 | Ga0209565_1000052 | Ga0209565_100005228 | 83 |
| 715 | 3300025263 | Ga0209565_1018477 | Ga0209565_10184772 | 83 |
| 716 | 3300025273 | Ga0209673_1000889 | Ga0209673_100088923 | 83 |
| 717 | 3300025273 | Ga0209673_1066750 | Ga0209673_10667501 | 83 |
| 718 | 3300025291 | Ga0209675_1015193 | Ga0209675_10151932 | 83 |
| 719 | 3300025292 | Ga0209676_1016986 | Ga0209676_10169864 | 83 |
| 720 | 3300025292 | Ga0209676_1018694 | Ga0209676_10186942 | 83 |
| 721 | 3300025294 | Ga0209025_1000128 | Ga0209025_10001286 | 83 |
| 722 | 3300025295 | Ga0209564_1005977 | Ga0209564_10059772 | 83 |
| 723 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002768 | 83 |
| 724 | 3300025297 | Ga0209758_1004078 | Ga0209758_10040789 | 83 |
| 725 | 3300025297 | Ga0209758_1042906 | Ga0209758_10429062 | 83 |
| 726 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001753 | 83 |
| 727 | 3300025298 | Ga0209050_1000071 | Ga0209050_1000071225 | 83 |
| 728 | 3300025298 | Ga0209050_1000166 | Ga0209050_100016684 | 83 |
| 729 | 3300025298 | Ga0209050_1007906 | Ga0209050_10079065 | 83 |
| 730 | 3300025298 | Ga0209050_1032398 | Ga0209050_10323983 | 83 |
| 731 | 3300025298 | Ga0209050_1053035 | Ga0209050_10530352 | 83 |
| 732 | 3300025298 | Ga0209050_1077000 | Ga0209050_10770001 | 83 |
| 733 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008918 | 83 |
| 734 | 3300025302 | Ga0207426_1011881 | Ga0207426_10118813 | 83 |
| 735 | 3300025303 | Ga0209051_1001966 | Ga0209051_10019666 | 83 |
| 736 | 3300025304 | Ga0209257_1000027 | Ga0209257_100002778 | 83 |
| 737 | 3300025304 | Ga0209257_1002317 | Ga0209257_10023172 | 83 |
| 738 | 3300025304 | Ga0209257_1005763 | Ga0209257_10057638 | 83 |
| 739 | 3300025304 | Ga0209257_1012431 | Ga0209257_10124314 | 83 |
| 740 | 3300025304 | Ga0209257_1032794 | Ga0209257_10327943 | 83 |
| 741 | 3300025735 | Ga0207713_1000170 | Ga0207713_100017051 | 83 |
| 742 | 3300025893 | Ga0207682_10363370 | Ga0207682_103633701 | 83 |
| 743 | 3300025898 | Ga0207692_10192324 | Ga0207692_101923242 | 83 |
| 744 | 3300025899 | Ga0207642_10224158 | Ga0207642_102241583 | 83 |
| 745 | 3300025899 | Ga0207642_10577309 | Ga0207642_105773092 | 83 |
| 746 | 3300025899 | Ga0207642_10723090 | Ga0207642_107230901 | 83 |
| 747 | 3300025899 | Ga0207642_10991912 | Ga0207642_109919122 | 83 |
| 748 | 3300025903 | Ga0207680_10826258 | Ga0207680_108262581 | 83 |
| 749 | 3300025905 | Ga0207685_10395253 | Ga0207685_103952532 | 83 |
| 750 | 3300025907 | Ga0207645_10111059 | Ga0207645_101110593 | 83 |
| 751 | 3300025908 | Ga0207643_10048516 | Ga0207643_100485164 | 83 |
| 752 | 3300025908 | Ga0207643_10220695 | Ga0207643_102206952 | 83 |
| 753 | 3300025908 | Ga0207643_10348096 | Ga0207643_103480962 | 83 |
| 754 | 3300025908 | Ga0207643_11136689 | Ga0207643_111366891 | 83 |
| 755 | 3300025909 | Ga0207705_10121191 | Ga0207705_101211912 | 83 |
| 756 | 3300025909 | Ga0207705_11064686 | Ga0207705_110646862 | 83 |
| 757 | 3300025910 | Ga0207684_10039770 | Ga0207684_100397701 | 83 |
| 758 | 3300025911 | Ga0207654_10285572 | Ga0207654_102855721 | 83 |
| 759 | 3300025912 | Ga0207707_10350915 | Ga0207707_103509153 | 83 |
| 760 | 3300025913 | Ga0207695_10126174 | Ga0207695_101261742 | 83 |
| 761 | 3300025913 | Ga0207695_11085915 | Ga0207695_110859152 | 83 |
| 762 | 3300025914 | Ga0207671_10008759 | Ga0207671_100087597 | 83 |
| 763 | 3300025914 | Ga0207671_10566191 | Ga0207671_105661912 | 83 |
| 764 | 3300025917 | Ga0207660_10066673 | Ga0207660_100666735 | 83 |
| 765 | 3300025918 | Ga0207662_10187893 | Ga0207662_101878932 | 83 |
| 766 | 3300025918 | Ga0207662_10601706 | Ga0207662_106017061 | 83 |
| 767 | 3300025919 | Ga0207657_10267108 | Ga0207657_102671082 | 83 |
| 768 | 3300025920 | Ga0207649_10580142 | Ga0207649_105801422 | 83 |
| 769 | 3300025922 | Ga0207646_10585954 | Ga0207646_105859542 | 83 |
| 770 | 3300025922 | Ga0207646_11222917 | Ga0207646_112229172 | 83 |
| 771 | 3300025923 | Ga0207681_10010695 | Ga0207681_100106957 | 83 |
| 772 | 3300025923 | Ga0207681_10081198 | Ga0207681_100811982 | 83 |
| 773 | 3300025923 | Ga0207681_10484851 | Ga0207681_104848513 | 83 |
| 774 | 3300025923 | Ga0207681_11871868 | Ga0207681_118718681 | 83 |
| 775 | 3300025924 | Ga0207694_10316876 | Ga0207694_103168763 | 83 |
| 776 | 3300025924 | Ga0207694_10795760 | Ga0207694_107957602 | 83 |
| 777 | 3300025925 | Ga0207650_10000609 | Ga0207650_1000060922 | 83 |
| 778 | 3300025925 | Ga0207650_10127839 | Ga0207650_101278394 | 83 |
| 779 | 3300025925 | Ga0207650_10734858 | Ga0207650_107348581 | 83 |
| 780 | 3300025925 | Ga0207650_11049786 | Ga0207650_110497862 | 83 |
| 781 | 3300025926 | Ga0207659_10070632 | Ga0207659_100706324 | 83 |
| 782 | 3300025926 | Ga0207659_11267932 | Ga0207659_112679321 | 83 |
| 783 | 3300025932 | Ga0207690_10263195 | Ga0207690_102631952 | 83 |
| 784 | 3300025932 | Ga0207690_10472198 | Ga0207690_104721982 | 83 |
| 785 | 3300025932 | Ga0207690_10554120 | Ga0207690_105541201 | 83 |
| 786 | 3300025933 | Ga0207706_10004192 | Ga0207706_1000419210 | 83 |
| 787 | 3300025933 | Ga0207706_10579662 | Ga0207706_105796622 | 83 |
| 788 | 3300025933 | Ga0207706_10685804 | Ga0207706_106858042 | 83 |
| 789 | 3300025933 | Ga0207706_11409165 | Ga0207706_114091652 | 83 |
| 790 | 3300025935 | Ga0207709_10033646 | Ga0207709_100336464 | 83 |
| 791 | 3300025935 | Ga0207709_10098211 | Ga0207709_100982111 | 83 |
| 792 | 3300025935 | Ga0207709_10347470 | Ga0207709_103474702 | 83 |
| 793 | 3300025935 | Ga0207709_10623351 | Ga0207709_106233511 | 83 |
| 794 | 3300025936 | Ga0207670_10392327 | Ga0207670_103923272 | 83 |
| 795 | 3300025936 | Ga0207670_10909281 | Ga0207670_109092811 | 83 |
| 796 | 3300025937 | Ga0207669_10178645 | Ga0207669_101786452 | 83 |
| 797 | 3300025937 | Ga0207669_10627153 | Ga0207669_106271531 | 83 |
| 798 | 3300025937 | Ga0207669_11251853 | Ga0207669_112518532 | 83 |
| 799 | 3300025938 | Ga0207704_10763913 | Ga0207704_107639132 | 83 |
| 800 | 3300025938 | Ga0207704_11088079 | Ga0207704_110880792 | 83 |
| 801 | 3300025938 | Ga0207704_11397064 | Ga0207704_113970641 | 83 |
| 802 | 3300025939 | Ga0207665_10653358 | Ga0207665_106533581 | 83 |
| 803 | 3300025940 | Ga0207691_10017008 | Ga0207691_100170089 | 83 |
| 804 | 3300025940 | Ga0207691_10294334 | Ga0207691_102943343 | 83 |
| 805 | 3300025940 | Ga0207691_10678455 | Ga0207691_106784552 | 83 |
| 806 | 3300025941 | Ga0207711_10527097 | Ga0207711_105270971 | 83 |
| 807 | 3300025941 | Ga0207711_11751188 | Ga0207711_117511881 | 83 |
| 808 | 3300025942 | Ga0207689_10075163 | Ga0207689_100751633 | 83 |
| 809 | 3300025942 | Ga0207689_10281180 | Ga0207689_102811803 | 83 |
| 810 | 3300025942 | Ga0207689_10479198 | Ga0207689_104791982 | 83 |
| 811 | 3300025944 | Ga0207661_10945605 | Ga0207661_109456051 | 83 |
| 812 | 3300025944 | Ga0207661_11032044 | Ga0207661_110320441 | 83 |
| 813 | 3300025945 | Ga0207679_10523520 | Ga0207679_105235201 | 83 |
| 814 | 3300025945 | Ga0207679_10805260 | Ga0207679_108052602 | 83 |
| 815 | 3300025945 | Ga0207679_10963551 | Ga0207679_109635512 | 83 |
| 816 | 3300025949 | Ga0207667_10005788 | Ga0207667_100057882 | 83 |
| 817 | 3300025960 | Ga0207651_10856766 | Ga0207651_108567661 | 83 |
| 818 | 3300025961 | Ga0207712_10687640 | Ga0207712_106876401 | 83 |
| 819 | 3300025961 | Ga0207712_11347131 | Ga0207712_113471312 | 83 |
| 820 | 3300025961 | Ga0207712_11853353 | Ga0207712_118533532 | 83 |
| 821 | 3300025972 | Ga0207668_10025250 | Ga0207668_100252505 | 83 |
| 822 | 3300025972 | Ga0207668_10178791 | Ga0207668_101787912 | 83 |
| 823 | 3300025972 | Ga0207668_11327794 | Ga0207668_113277942 | 83 |
| 824 | 3300025972 | Ga0207668_12003485 | Ga0207668_120034851 | 83 |
| 825 | 3300025981 | Ga0207640_10009603 | Ga0207640_100096034 | 83 |
| 826 | 3300025981 | Ga0207640_11774739 | Ga0207640_117747391 | 83 |
| 827 | 3300025986 | Ga0207658_10001048 | Ga0207658_100010482 | 83 |
| 828 | 3300026023 | Ga0207677_10167615 | Ga0207677_101676151 | 83 |
| 829 | 3300026023 | Ga0207677_10757731 | Ga0207677_107577311 | 83 |
| 830 | 3300026035 | Ga0207703_10071564 | Ga0207703_100715641 | 83 |
| 831 | 3300026035 | Ga0207703_10778785 | Ga0207703_107787851 | 83 |
| 832 | 3300026035 | Ga0207703_10887307 | Ga0207703_108873071 | 83 |
| 833 | 3300026035 | Ga0207703_11455888 | Ga0207703_114558881 | 83 |
| 834 | 3300026035 | Ga0207703_11496307 | Ga0207703_114963072 | 83 |
| 835 | 3300026035 | Ga0207703_12250445 | Ga0207703_122504452 | 83 |
| 836 | 3300026041 | Ga0207639_11226195 | Ga0207639_112261951 | 83 |
| 837 | 3300026041 | Ga0207639_11575440 | Ga0207639_115754402 | 83 |
| 838 | 3300026067 | Ga0207678_10836914 | Ga0207678_108369141 | 83 |
| 839 | 3300026075 | Ga0207708_10072421 | Ga0207708_100724212 | 83 |
| 840 | 3300026075 | Ga0207708_10073525 | Ga0207708_100735252 | 83 |
| 841 | 3300026075 | Ga0207708_10203973 | Ga0207708_102039731 | 83 |
| 842 | 3300026075 | Ga0207708_10741462 | Ga0207708_107414622 | 83 |
| 843 | 3300026078 | Ga0207702_10142870 | Ga0207702_101428702 | 83 |
| 844 | 3300026088 | Ga0207641_10006798 | Ga0207641_100067985 | 83 |
| 845 | 3300026088 | Ga0207641_10684046 | Ga0207641_106840461 | 83 |
| 846 | 3300026088 | Ga0207641_11158621 | Ga0207641_111586211 | 83 |
| 847 | 3300026088 | Ga0207641_11615309 | Ga0207641_116153092 | 83 |
| 848 | 3300026089 | Ga0207648_10012302 | Ga0207648_100123028 | 83 |
| 849 | 3300026089 | Ga0207648_10438395 | Ga0207648_104383952 | 83 |
| 850 | 3300026095 | Ga0207676_10109232 | Ga0207676_101092322 | 83 |
| 851 | 3300026095 | Ga0207676_10382461 | Ga0207676_103824612 | 83 |
| 852 | 3300026095 | Ga0207676_10935398 | Ga0207676_109353982 | 83 |
| 853 | 3300026116 | Ga0207674_10043654 | Ga0207674_100436547 | 83 |
| 854 | 3300026116 | Ga0207674_10151794 | Ga0207674_101517944 | 83 |
| 855 | 3300026116 | Ga0207674_10246151 | Ga0207674_102461512 | 83 |
| 856 | 3300026116 | Ga0207674_10354086 | Ga0207674_103540862 | 83 |
| 857 | 3300026116 | Ga0207674_10890504 | Ga0207674_108905042 | 83 |
| 858 | 3300026116 | Ga0207674_11391114 | Ga0207674_113911141 | 83 |
| 859 | 3300026118 | Ga0207675_100000471 | Ga0207675_10000047139 | 83 |
| 860 | 3300026118 | Ga0207675_100000520 | Ga0207675_10000052030 | 83 |
| 861 | 3300026118 | Ga0207675_100140913 | Ga0207675_1001409132 | 83 |
| 862 | 3300026118 | Ga0207675_100403404 | Ga0207675_1004034042 | 83 |
| 863 | 3300026118 | Ga0207675_100854669 | Ga0207675_1008546692 | 83 |
| 864 | 3300026118 | Ga0207675_102203382 | Ga0207675_1022033821 | 83 |
| 865 | 3300026118 | Ga0207675_102275401 | Ga0207675_1022754011 | 83 |
| 866 | 3300026121 | Ga0207683_11963639 | Ga0207683_119636392 | 83 |
| 867 | 3300026142 | Ga0207698_10071771 | Ga0207698_100717714 | 83 |
| 868 | 3300026142 | Ga0207698_11655560 | Ga0207698_116555601 | 83 |
| 869 | 3300026142 | Ga0207698_11994847 | Ga0207698_119948471 | 83 |
| 870 | 3300027312 | Ga0209371_1000235 | Ga0209371_100023550 | 83 |
| 871 | 3300027866 | Ga0209813_10269161 | Ga0209813_102691611 | 83 |
| 872 | 3300027907 | Ga0207428_10026662 | Ga0207428_100266627 | 83 |
| 873 | 3300027907 | Ga0207428_10042112 | Ga0207428_100421124 | 83 |
| 874 | 3300027907 | Ga0207428_10093739 | Ga0207428_100937394 | 83 |
| 875 | 3300027907 | Ga0207428_10760017 | Ga0207428_107600171 | 83 |
| 876 | 3300027907 | Ga0207428_11275043 | Ga0207428_112750431 | 83 |
| 877 | 3300028379 | Ga0268266_10433855 | Ga0268266_104338552 | 83 |
| 878 | 3300028379 | Ga0268266_10860980 | Ga0268266_108609802 | 83 |
| 879 | 3300028379 | Ga0268266_10872419 | Ga0268266_108724192 | 83 |
| 880 | 3300028380 | Ga0268265_10011098 | Ga0268265_100110984 | 83 |
| 881 | 3300028380 | Ga0268265_10011632 | Ga0268265_100116323 | 83 |
| 882 | 3300028380 | Ga0268265_10320918 | Ga0268265_103209182 | 83 |
| 883 | 3300028380 | Ga0268265_10807366 | Ga0268265_108073662 | 83 |
| 884 | 3300028380 | Ga0268265_11955963 | Ga0268265_119559631 | 83 |
| 885 | 3300028380 | Ga0268265_12030754 | Ga0268265_120307541 | 83 |
| 886 | 3300028381 | Ga0268264_10000204 | Ga0268264_1000020488 | 83 |
| 887 | 3300028381 | Ga0268264_10001562 | Ga0268264_1000156210 | 83 |
| 888 | 3300028381 | Ga0268264_10263909 | Ga0268264_102639093 | 83 |
| 889 | 3300028381 | Ga0268264_10547266 | Ga0268264_105472662 | 83 |
| 890 | 3300028794 | Ga0307515_10496291 | Ga0307515_104962912 | 83 |
| 891 | 3300030500 | Ga0268256_1000196 | Ga0268256_100019613 | 83 |
| 892 | 3300030733 | Ga0314311_1176710 | Ga0314311_11767102 | 83 |
| 893 | 3300031507 | Ga0307509_10097611 | Ga0307509_100976114 | 83 |
| 894 | 3300031548 | Ga0307408_100451402 | Ga0307408_1004514023 | 83 |
| 895 | 3300031548 | Ga0307408_100675059 | Ga0307408_1006750593 | 83 |
| 896 | 3300031548 | Ga0307408_102033639 | Ga0307408_1020336391 | 83 |
| 897 | 3300031730 | Ga0307516_10420231 | Ga0307516_104202312 | 83 |
| 898 | 3300031731 | Ga0307405_10353778 | Ga0307405_103537782 | 83 |
| 899 | 3300031731 | Ga0307405_11740176 | Ga0307405_117401762 | 83 |
| 900 | 3300031824 | Ga0307413_10204123 | Ga0307413_102041233 | 83 |
| 901 | 3300031824 | Ga0307413_11915542 | Ga0307413_119155421 | 83 |
| 902 | 3300031852 | Ga0307410_10181207 | Ga0307410_101812072 | 83 |
| 903 | 3300031852 | Ga0307410_10589664 | Ga0307410_105896642 | 83 |
| 904 | 3300031901 | Ga0307406_10310916 | Ga0307406_103109163 | 83 |
| 905 | 3300031901 | Ga0307406_10502639 | Ga0307406_105026391 | 83 |
| 906 | 3300031901 | Ga0307406_10622376 | Ga0307406_106223762 | 83 |
| 907 | 3300031901 | Ga0307406_11185421 | Ga0307406_111854212 | 83 |
| 908 | 3300031903 | Ga0307407_10322962 | Ga0307407_103229623 | 83 |
| 909 | 3300031911 | Ga0307412_10000206 | Ga0307412_100002065 | 83 |
| 910 | 3300031911 | Ga0307412_10053739 | Ga0307412_100537392 | 83 |
| 911 | 3300031911 | Ga0307412_10160568 | Ga0307412_101605682 | 83 |
| 912 | 3300031911 | Ga0307412_11206085 | Ga0307412_112060852 | 83 |
| 913 | 3300031911 | Ga0307412_11352440 | Ga0307412_113524401 | 83 |
| 914 | 3300031911 | Ga0307412_11580058 | Ga0307412_115800581 | 83 |
| 915 | 3300031911 | Ga0307412_11739551 | Ga0307412_117395512 | 83 |
| 916 | 3300031995 | Ga0307409_100154737 | Ga0307409_1001547374 | 83 |
| 917 | 3300031995 | Ga0307409_100493890 | Ga0307409_1004938902 | 83 |
| 918 | 3300031995 | Ga0307409_100868530 | Ga0307409_1008685302 | 83 |
| 919 | 3300031995 | Ga0307409_100969487 | Ga0307409_1009694871 | 83 |
| 920 | 3300032002 | Ga0307416_100120782 | Ga0307416_1001207822 | 83 |
| 921 | 3300032002 | Ga0307416_100241034 | Ga0307416_1002410343 | 83 |
| 922 | 3300032002 | Ga0307416_100384873 | Ga0307416_1003848732 | 83 |
| 923 | 3300032002 | Ga0307416_100864069 | Ga0307416_1008640692 | 83 |
| 924 | 3300032002 | Ga0307416_101318337 | Ga0307416_1013183372 | 83 |
| 925 | 3300032002 | Ga0307416_102145746 | Ga0307416_1021457462 | 83 |
| 926 | 3300032004 | Ga0307414_10000090 | Ga0307414_1000009059 | 83 |
| 927 | 3300032004 | Ga0307414_10001067 | Ga0307414_100010674 | 83 |
| 928 | 3300032004 | Ga0307414_10024139 | Ga0307414_100241393 | 83 |
| 929 | 3300032004 | Ga0307414_10083257 | Ga0307414_100832573 | 83 |
| 930 | 3300032004 | Ga0307414_10314754 | Ga0307414_103147542 | 83 |
| 931 | 3300032005 | Ga0307411_10031870 | Ga0307411_100318702 | 83 |
| 932 | 3300032005 | Ga0307411_10177756 | Ga0307411_101777562 | 83 |
| 933 | 3300032005 | Ga0307411_11530548 | Ga0307411_115305482 | 83 |
| 934 | 3300032005 | Ga0307411_12320456 | Ga0307411_123204561 | 83 |
| 935 | 3300032126 | Ga0307415_100510698 | Ga0307415_1005106982 | 83 |
| 936 | 3300032126 | Ga0307415_101189908 | Ga0307415_1011899082 | 83 |
| 937 | 3300035083 | Ga0373926_0230201 | Ga0373926_0230201_38_307 | 83 |
| 938 | 3300035089 | Ga0373944_0213989 | Ga0373944_0213989_324_593 | 83 |
| 939 | 3300035114 | Ga0373939_0109239 | Ga0373939_0109239_573_842 | 83 |
| 940 | 3300035121 | Ga0373960_0205143 | Ga0373960_0205143_14_280 | 83 |
| 941 | 3300035171 | Ga0373946_0420660 | Ga0373946_0420660_245_514 | 83 |
| 942 | 3300035242 | Ga0373962_0236129 | Ga0373962_0236129_260_529 | 83 |
| 943 | 3300035691 | Ga0373931_0023028 | Ga0373931_0023028_1785_2054 | 83 |
| 944 | 3300035692 | Ga0373935_1428122 | Ga0373935_1428122_25_294 | 83 |
| 945 | 3300035695 | Ga0373927_0051355 | Ga0373927_0051355_1695_1964 | 83 |
| 946 | 3300036647 | Ga0316582_0523956 | Ga0316582_0523956_433_702 | 83 |
| 947 | 3300037068 | Ga0373925_0361313 | Ga0373925_0361313_781_1050 | 83 |
| 948 | 3300038443 | Ga0395901_1791740 | Ga0395901_1791740_35_301 | 83 |
| 949 | 3300039437 | Ga0436365_0480912 | Ga0436365_0480912_15214_15468 | 83 |
| 950 | 3300039450 | Ga0436363_0048982 | Ga0436363_0048982_126_395 | 83 |
| 951 | 3300039450 | Ga0436363_0493190 | Ga0436363_0493190_292_561 | 83 |
| 952 | 3300039453 | Ga0436362_0553111 | Ga0436362_0553111_33291_33545 | 83 |
| 953 | 3300041404 | Ga0439436_0065284 | Ga0439436_0065284_389_646 | 83 |
| 954 | 3300041404 | Ga0439436_0170291 | Ga0439436_0170291_271_528 | 83 |
| 955 | 3300041406 | Ga0439439_0010294 | Ga0439439_0010294_63_320 | 83 |
| 956 | 3300041410 | Ga0439461_0000394 | Ga0439461_0000394_503_760 | 83 |
| 957 | 3300041410 | Ga0439461_0023156 | Ga0439461_0023156_833_1090 | 83 |
| 958 | 3300041411 | Ga0439466_0199721 | Ga0439466_0199721_167_424 | 83 |
| 959 | 3300041413 | Ga0439465_0000283 | Ga0439465_0000283_1905_2162 | 83 |
| 960 | 3300041413 | Ga0439465_0001505 | Ga0439465_0001505_1592_1849 | 83 |
| 961 | 3300041443 | Ga0451789_0782680 | Ga0451789_0782680_102_368 | 83 |
| 962 | 3300041452 | Ga0451793_0033680 | Ga0451793_0033680_308_559 | 83 |
| 963 | 3300041452 | Ga0451793_0957128 | Ga0451793_0957128_278_547 | 83 |
| 964 | 3300041459 | Ga0451800_0427065 | Ga0451800_0427065_295_546 | 83 |
| 965 | 3300041459 | Ga0451800_0504361 | Ga0451800_0504361_298_564 | 83 |
| 966 | 3300041459 | Ga0451800_1486363 | Ga0451800_1486363_1261_1521 | 83 |
| 967 | 3300041460 | Ga0451802_0398890 | Ga0451802_0398890_492_752 | 83 |
| 968 | 3300041460 | Ga0451802_1054188 | Ga0451802_1054188_110_367 | 83 |
| 969 | 3300041462 | Ga0451806_242067 | Ga0451806_242067_1509_1760 | 83 |
| 970 | 3300041462 | Ga0451806_513296 | Ga0451806_513296_665_925 | 83 |
| 971 | 3300041463 | Ga0451804_0395309 | Ga0451804_0395309_1540_1791 | 83 |
| 972 | 3300041463 | Ga0451804_1112201 | Ga0451804_1112201_162_419 | 83 |
| 973 | 3300041486 | Ga0451807_0115728 | Ga0451807_0115728_44_304 | 83 |
| 974 | 3300041486 | Ga0451807_0343639 | Ga0451807_0343639_210_479 | 83 |
| 975 | 3300041486 | Ga0451807_0451373 | Ga0451807_0451373_299_571 | 83 |
| 976 | 3300041486 | Ga0451807_0556227 | Ga0451807_0556227_198_449 | 83 |
| 977 | 3300041486 | Ga0451807_1077379 | Ga0451807_1077379_371_640 | 83 |
| 978 | 3300041486 | Ga0451807_2058733 | Ga0451807_2058733_795_1064 | 83 |
| 979 | 3300041491 | Ga0451833_1248443 | Ga0451833_1248443_389_658 | 83 |
| 980 | 3300041494 | Ga0451837_0561980 | Ga0451837_0561980_131_400 | 83 |
| 981 | 3300041505 | Ga0451849_0025924 | Ga0451849_0025924_351_620 | 83 |
| 982 | 3300041507 | Ga0451851_0206228 | Ga0451851_0206228_21_290 | 83 |
| 983 | 3300041512 | Ga0451853_1265896 | Ga0451853_1265896_350_619 | 83 |
| 984 | 3300041512 | Ga0451853_2186315 | Ga0451853_2186315_69_332 | 83 |
| 985 | 3300041512 | Ga0451853_2340752 | Ga0451853_2340752_1113_1373 | 83 |
| 986 | 3300041997 | Ga0439431_0000388 | Ga0439431_0000388_4271_4528 | 83 |
| 987 | 3300041999 | Ga0439433_0082408 | Ga0439433_0082408_234_491 | 83 |
| 988 | 3300042002 | Ga0439442_000975 | Ga0439442_000975_4885_5142 | 83 |
| 989 | 3300042002 | Ga0439442_009486 | Ga0439442_009486_1652_1909 | 83 |
| 990 | 3300042003 | Ga0439443_080578 | Ga0439443_080578_14_283 | 83 |
| 991 | 3300042004 | Ga0439445_0006131 | Ga0439445_0006131_1036_1293 | 83 |
| 992 | 3300042004 | Ga0439445_0010370 | Ga0439445_0010370_537_794 | 83 |
| 993 | 3300042004 | Ga0439445_0236798 | Ga0439445_0236798_133_399 | 83 |
| 994 | 3300042006 | Ga0439432_000054 | Ga0439432_000054_14786_15043 | 83 |
| 995 | 3300042006 | Ga0439432_042859 | Ga0439432_042859_28_285 | 83 |
| 996 | 3300042010 | Ga0439452_021914 | Ga0439452_021914_640_897 | 83 |
| 997 | 3300042012 | Ga0439455_0145411 | Ga0439455_0145411_180_446 | 83 |
| 998 | 3300042014 | Ga0439457_139090 | Ga0439457_139090_149_406 | 83 |
| 999 | 3300042015 | Ga0439462_0000462 | Ga0439462_0000462_4993_5250 | 83 |
| 1000 | 3300042015 | Ga0439462_0004275 | Ga0439462_0004275_2809_3066 | 83 |
| 1001 | 3300042132 | Ga0450895_017865 | Ga0450895_017865_359_634 | 83 |
| 1002 | 3300042133 | Ga0450896_013094 | Ga0450896_013094_444_719 | 83 |
| 1003 | 3300042145 | Ga0450906_047077 | Ga0450906_047077_159_425 | 83 |
| 1004 | 3300042146 | Ga0450907_010656 | Ga0450907_010656_206_481 | 83 |
| 1005 | 3300042156 | Ga0439446_0023557 | Ga0439446_0023557_67_324 | 83 |
| 1006 | 3300042435 | Ga0439434_0000569 | Ga0439434_0000569_5504_5761 | 83 |
| 1007 | 3300042436 | Ga0439435_0219865 | Ga0439435_0219865_195_461 | 83 |
| 1008 | 3300042438 | Ga0439459_0094784 | Ga0439459_0094784_16_285 | 83 |
| 1009 | 3300042439 | Ga0439464_0171838 | Ga0439464_0171838_212_478 | 83 |
| 1010 | 3300042461 | Ga0439460_0094061 | Ga0439460_0094061_396_665 | 83 |
| 1011 | 3300042876 | Ga0451577_1011431 | Ga0451577_1011431_52_321 | 83 |
| 1012 | 3300042876 | Ga0451577_1076966 | Ga0451577_1076966_319_585 | 83 |
| 1013 | 3300044693 | Ga0466961_0103542 | Ga0466961_0103542_872_1129 | 83 |
| 1014 | 3300044694 | Ga0466963_0052452 | Ga0466963_0052452_1092_1349 | 83 |
| 1015 | 3300044719 | Ga0466971_0013113 | Ga0466971_0013113_2231_2488 | 83 |
| 1016 | 3300044765 | Ga0466970_0335562 | Ga0466970_0335562_136_393 | 83 |
| 1017 | 3300045051 | Ga0451576_0176225 | Ga0451576_0176225_938_1204 | 83 |
| 1018 | 3300045836 | Ga0466958_0091687 | Ga0466958_0091687_1612_1869 | 83 |
| 1019 | 3300045976 | Ga0466967_0030518 | Ga0466967_0030518_2995_3252 | 83 |
| 1020 | 3300046453 | Ga0495627_050209 | Ga0495627_050209_71_328 | 83 |
| 1021 | 3300046460 | Ga0495638_0000774 | Ga0495638_0000774_2327_2593 | 83 |
| 1022 | 3300046460 | Ga0495638_0090851 | Ga0495638_0090851_1215_1481 | 83 |
| 1023 | 3300046512 | Ga0495610_0131516 | Ga0495610_0131516_485_754 | 83 |
| 1024 | 3300046522 | Ga0495643_0141295 | Ga0495643_0141295_481_750 | 83 |
| 1025 | 3300046530 | Ga0495654_0133690 | Ga0495654_0133690_262_531 | 83 |
| 1026 | 3300046530 | Ga0495654_0378745 | Ga0495654_0378745_151_417 | 83 |
| 1027 | 3300046535 | Ga0495586_0413754 | Ga0495586_0413754_181_450 | 83 |
| 1028 | 3300046537 | Ga0495598_0185764 | Ga0495598_0185764_377_643 | 83 |
| 1029 | 3300046537 | Ga0495598_0358018 | Ga0495598_0358018_68_376 | 83 |
| 1030 | 3300046542 | Ga0495597_0240213 | Ga0495597_0240213_361_630 | 83 |
| 1031 | 3300046558 | Ga0495633_0316071 | Ga0495633_0316071_39_308 | 83 |
| 1032 | 3300046616 | Ga0495668_0000031 | Ga0495668_0000031_137523_137792 | 83 |
| 1033 | 3300046616 | Ga0495668_0037509 | Ga0495668_0037509_1004_1273 | 83 |
| 1034 | 3300046616 | Ga0495668_0162838 | Ga0495668_0162838_940_1209 | 83 |
| 1035 | 3300046616 | Ga0495668_0553833 | Ga0495668_0553833_142_411 | 83 |
| 1036 | 3300046660 | Ga0495625_0000083 | Ga0495625_0000083_147005_147274 | 83 |
| 1037 | 3300046660 | Ga0495625_0000115 | Ga0495625_0000115_106692_106961 | 83 |
| 1038 | 3300046660 | Ga0495625_0155072 | Ga0495625_0155072_649_915 | 83 |
| 1039 | 3300046660 | Ga0495625_0222491 | Ga0495625_0222491_37_306 | 83 |
| 1040 | 3300046691 | Ga0495670_0000047 | Ga0495670_0000047_51312_51569 | 83 |
| 1041 | 3300046694 | Ga0495649_0298965 | Ga0495649_0298965_486_743 | 83 |
| 1042 | 3300047318 | Ga0495636_0527102 | Ga0495636_0527102_11_277 | 83 |
| 1043 | 3300047470 | Ga0495681_0033786 | Ga0495681_0033786_153_410 | 83 |
| 1044 | 3300047472 | Ga0495686_0001048 | Ga0495686_0001048_11561_11818 | 83 |
| 1045 | 3300047472 | Ga0495686_0001884 | Ga0495686_0001884_10643_10912 | 83 |
| 1046 | 3300047472 | Ga0495686_0447359 | Ga0495686_0447359_308_577 | 83 |
| 1047 | 3300047472 | Ga0495686_0520613 | Ga0495686_0520613_341_598 | 83 |
| 1048 | 3300048091 | Ga0495626_0130762 | Ga0495626_0130762_192_458 | 83 |
| 1049 | 3300048905 | Ga0496102_0231762 | Ga0496102_0231762_28_285 | 83 |
| 1050 | 3300048905 | Ga0496102_1467062 | Ga0496102_1467062_79_339 | 83 |
| 1051 | 3300048907 | Ga0496104_0225962 | Ga0496104_0225962_86_355 | 83 |
| 1052 | 3300048914 | Ga0496111_0262321 | Ga0496111_0262321_873_1142 | 83 |
| 1053 | 3300048915 | Ga0496112_0055039 | Ga0496112_0055039_3490_3759 | 83 |
| 1054 | 3300048916 | Ga0496113_0371607 | Ga0496113_0371607_245_514 | 83 |
| 1055 | 3300048917 | Ga0496114_1496123 | Ga0496114_1496123_95_364 | 83 |
| 1056 | 3300048918 | Ga0496115_0000333 | Ga0496115_0000333_8859_9119 | 83 |
| 1057 | 3300048920 | Ga0496117_0002512 | Ga0496117_0002512_7370_7621 | 83 |
| 1058 | 3300048920 | Ga0496117_0027156 | Ga0496117_0027156_3239_3496 | 83 |
| 1059 | 3300048921 | Ga0496118_0032030 | Ga0496118_0032030_767_1018 | 83 |
| 1060 | 3300048921 | Ga0496118_0188008 | Ga0496118_0188008_250_516 | 83 |
| 1061 | 3300048921 | Ga0496118_0340787 | Ga0496118_0340787_189_440 | 83 |
| 1062 | 3300048922 | Ga0496119_0004541 | Ga0496119_0004541_3426_3677 | 83 |
| 1063 | 3300048922 | Ga0496119_0216175 | Ga0496119_0216175_659_916 | 83 |
| 1064 | 3300048923 | Ga0496120_0001660 | Ga0496120_0001660_15362_15613 | 83 |
| 1065 | 3300048923 | Ga0496120_0091448 | Ga0496120_0091448_517_774 | 83 |
| 1066 | 3300048923 | Ga0496120_0110315 | Ga0496120_0110315_921_1178 | 83 |
| 1067 | 3300048924 | Ga0496121_0183126 | Ga0496121_0183126_38_295 | 83 |
| 1068 | 3300048925 | Ga0496122_0000361 | Ga0496122_0000361_15558_15809 | 83 |
| 1069 | 3300048925 | Ga0496122_0096833 | Ga0496122_0096833_1463_1720 | 83 |
| 1070 | 3300048925 | Ga0496122_0344323 | Ga0496122_0344323_405_662 | 83 |
| 1071 | 3300048926 | Ga0496123_0002053 | Ga0496123_0002053_10114_10365 | 83 |
| 1072 | 3300048926 | Ga0496123_0008346 | Ga0496123_0008346_7922_8179 | 83 |
| 1073 | 3300048926 | Ga0496123_0119750 | Ga0496123_0119750_277_531 | 83 |
| 1074 | 3300048926 | Ga0496123_0158908 | Ga0496123_0158908_879_1136 | 83 |
| 1075 | 3300048926 | Ga0496123_0215755 | Ga0496123_0215755_355_612 | 83 |
| 1076 | 3300048927 | Ga0496124_0000116 | Ga0496124_0000116_131511_131768 | 83 |
| 1077 | 3300048927 | Ga0496124_0002453 | Ga0496124_0002453_13920_14171 | 83 |
| 1078 | 3300048927 | Ga0496124_0021657 | Ga0496124_0021657_11_268 | 83 |
| 1079 | 3300048927 | Ga0496124_0633391 | Ga0496124_0633391_69_326 | 83 |
| 1080 | 3300048928 | Ga0496125_0340902 | Ga0496125_0340902_303_560 | 83 |
| 1081 | 3300048928 | Ga0496125_0430948 | Ga0496125_0430948_400_657 | 83 |
| 1082 | 3300048929 | Ga0496126_0033359 | Ga0496126_0033359_1932_2189 | 83 |
| 1083 | 3300048929 | Ga0496126_0054433 | Ga0496126_0054433_1866_2135 | 83 |
| 1084 | 3300048929 | Ga0496126_0248981 | Ga0496126_0248981_729_980 | 83 |
| 1085 | 3300048929 | Ga0496126_1021124 | Ga0496126_1021124_176_445 | 83 |
| 1086 | 3300049513 | Ga0501290_000535 | Ga0501290_000535_4419_4685 | 83 |
| 1087 | 3300049522 | Ga0501299_131159 | Ga0501299_131159_193_459 | 83 |
| 1088 | 3300049523 | Ga0501300_000775 | Ga0501300_000775_1701_1967 | 83 |
| 1089 | 3300049572 | Ga0501036_0814721 | Ga0501036_0814721_215_484 | 83 |
| 1090 | 3300049573 | Ga0501037_0965925 | Ga0501037_0965925_51_323 | 83 |
| 1091 | 3300049575 | Ga0501039_0396712 | Ga0501039_0396712_589_861 | 83 |
| 1092 | 3300049575 | Ga0501039_0575172 | Ga0501039_0575172_184_453 | 83 |
| 1093 | 3300049582 | Ga0501048_1133089 | Ga0501048_1133089_121_387 | 83 |
| 1094 | 3300049592 | Ga0501076_0901884 | Ga0501076_0901884_276_545 | 83 |
| 1095 | 3300049655 | Ga0501208_058782 | Ga0501208_058782_446_712 | 83 |
| 1096 | 3300049690 | Ga0501261_069797 | Ga0501261_069797_122_388 | 83 |
| 1097 | 3300049744 | Ga0501083_0022042 | Ga0501083_0022042_722_991 | 83 |
| 1098 | 3300049772 | Ga0501275_000288 | Ga0501275_000288_63_329 | 83 |
| 1099 | 3300049772 | Ga0501275_090043 | Ga0501275_090043_242_496 | 83 |
| 1100 | 3300049823 | Ga0501044_1374425 | Ga0501044_1374425_105_374 | 83 |
| 1101 | 3300050489 | nmdc:mga03683_13_c1 | nmdc:mga03683_13_c1_77870_78139 | 83 |
| 1102 | 3300050490 | nmdc:mga03n38_1530_c1 | nmdc:mga03n38_1530_c1_891_1160 | 83 |
| 1103 | 3300050492 | nmdc:mga0yw44_1049937_c1 | nmdc:mga0yw44_1049937_c1_13_273 | 83 |
| 1104 | 3300050493 | nmdc:mga0k408_229344_c1 | nmdc:mga0k408_229344_c1_636_905 | 83 |
| 1105 | 3300050493 | nmdc:mga0k408_35281_c1 | nmdc:mga0k408_35281_c1_641_910 | 83 |
| 1106 | 3300050493 | nmdc:mga0k408_554573_c1 | nmdc:mga0k408_554573_c1_182_451 | 83 |
| 1107 | 3300050493 | nmdc:mga0k408_8_c1 | nmdc:mga0k408_8_c1_88203_88472 | 83 |
| 1108 | 3300050496 | nmdc:mga07m45_20_c1 | nmdc:mga07m45_20_c1_46206_46475 | 83 |
| 1109 | 3300050496 | nmdc:mga07m45_401758_c1 | nmdc:mga07m45_401758_c1_452_721 | 83 |
| 1110 | 3300050507 | nmdc:mga05p37_114129_c1 | nmdc:mga05p37_114129_c1_930_1196 | 83 |
| 1111 | 3300050507 | nmdc:mga05p37_1966634_c1 | nmdc:mga05p37_1966634_c1_221_487 | 83 |
| 1112 | 3300050507 | nmdc:mga05p37_214267_c1 | nmdc:mga05p37_214267_c1_326_592 | 83 |
| 1113 | 3300050507 | nmdc:mga05p37_418677_c1 | nmdc:mga05p37_418677_c1_150_416 | 83 |
| 1114 | 3300050507 | nmdc:mga05p37_520230_c1 | nmdc:mga05p37_520230_c1_63_329 | 83 |
| 1115 | 3300050508 | nmdc:mga09592_131176_c1 | nmdc:mga09592_131176_c1_862_1128 | 83 |
| 1116 | 3300050508 | nmdc:mga09592_183494_c1 | nmdc:mga09592_183494_c1_1396_1662 | 83 |
| 1117 | 3300050508 | nmdc:mga09592_300173_c1 | nmdc:mga09592_300173_c1_308_574 | 83 |
| 1118 | 3300050508 | nmdc:mga09592_49001_c1 | nmdc:mga09592_49001_c1_1561_1827 | 83 |
| 1119 | 3300050509 | nmdc:mga0qj67_116770_c1 | nmdc:mga0qj67_116770_c1_1189_1455 | 83 |
| 1120 | 3300050509 | nmdc:mga0qj67_222894_c1 | nmdc:mga0qj67_222894_c1_325_591 | 83 |
| 1121 | 3300050509 | nmdc:mga0qj67_274763_c1 | nmdc:mga0qj67_274763_c1_212_481 | 83 |
| 1122 | 3300050509 | nmdc:mga0qj67_30550_c1 | nmdc:mga0qj67_30550_c1_1073_1339 | 83 |
| 1123 | 3300050509 | nmdc:mga0qj67_58178_c1 | nmdc:mga0qj67_58178_c1_2472_2738 | 83 |
| 1124 | 3300050509 | nmdc:mga0qj67_601297_c1 | nmdc:mga0qj67_601297_c1_547_813 | 83 |
| 1125 | 3300050510 | nmdc:mga06r32_1278980_c1 | nmdc:mga06r32_1278980_c1_101_367 | 83 |
| 1126 | 3300050510 | nmdc:mga06r32_317791_c1 | nmdc:mga06r32_317791_c1_966_1232 | 83 |
| 1127 | 3300050510 | nmdc:mga06r32_337_c1 | nmdc:mga06r32_337_c1_24243_24509 | 83 |
| 1128 | 3300050510 | nmdc:mga06r32_404430_c1 | nmdc:mga06r32_404430_c1_517_783 | 83 |
| 1129 | 3300050510 | nmdc:mga06r32_436025_c1 | nmdc:mga06r32_436025_c1_26_295 | 83 |
| 1130 | 3300050510 | nmdc:mga06r32_45225_c1 | nmdc:mga06r32_45225_c1_2858_3124 | 83 |
| 1131 | 3300050510 | nmdc:mga06r32_497681_c1 | nmdc:mga06r32_497681_c1_642_908 | 83 |
| 1132 | 3300050511 | nmdc:mga08y16_143511_c1 | nmdc:mga08y16_143511_c1_1974_2240 | 83 |
| 1133 | 3300050511 | nmdc:mga08y16_153661_c1 | nmdc:mga08y16_153661_c1_623_889 | 83 |
| 1134 | 3300050511 | nmdc:mga08y16_278848_c1 | nmdc:mga08y16_278848_c1_47_316 | 83 |
| 1135 | 3300050511 | nmdc:mga08y16_465818_c1 | nmdc:mga08y16_465818_c1_124_390 | 83 |
| 1136 | 3300050511 | nmdc:mga08y16_589470_c1 | nmdc:mga08y16_589470_c1_816_1082 | 83 |
| 1137 | 3300050511 | nmdc:mga08y16_61630_c1 | nmdc:mga08y16_61630_c1_1459_1725 | 83 |
| 1138 | 3300050511 | nmdc:mga08y16_877419_c1 | nmdc:mga08y16_877419_c1_296_565 | 83 |
| 1139 | 3300050512 | nmdc:mga0n895_191741_c1 | nmdc:mga0n895_191741_c1_100_369 | 83 |
| 1140 | 3300050512 | nmdc:mga0n895_39742_c1 | nmdc:mga0n895_39742_c1_3790_4059 | 83 |
| 1141 | 3300050513 | nmdc:mga0rr50_1496350_c1 | nmdc:mga0rr50_1496350_c1_179_448 | 83 |
| 1142 | 3300050513 | nmdc:mga0rr50_210770_c1 | nmdc:mga0rr50_210770_c1_1303_1572 | 83 |
| 1143 | 3300050513 | nmdc:mga0rr50_531604_c1 | nmdc:mga0rr50_531604_c1_13_282 | 83 |
| 1144 | 3300050515 | nmdc:mga0a205_1176468_c1 | nmdc:mga0a205_1176468_c1_120_386 | 83 |
| 1145 | 3300050515 | nmdc:mga0a205_1207496_c1 | nmdc:mga0a205_1207496_c1_297_566 | 83 |
| 1146 | 3300050515 | nmdc:mga0a205_14992_c1 | nmdc:mga0a205_14992_c1_3101_3370 | 83 |
| 1147 | 3300050516 | nmdc:mga0sz30_2719_c1 | nmdc:mga0sz30_2719_c1_1163_1432 | 83 |
| 1148 | 3300053078 | Ga0495612_0182441 | Ga0495612_0182441_223_480 | 83 |
| 1149 | 3300053087 | Ga0500643_001338 | Ga0500643_001338_144_401 | 83 |
| 1150 | 3300053090 | Ga0500646_0126025 | Ga0500646_0126025_512_781 | 83 |
| 1151 | 3300053092 | Ga0500583_0541334 | Ga0500583_0541334_225_491 | 83 |
| 1152 | 3300053094 | Ga0500566_0008244 | Ga0500566_0008244_1421_1693 | 83 |
| 1153 | 3300053094 | Ga0500566_0383088 | Ga0500566_0383088_358_618 | 83 |
| 1154 | 3300053108 | Ga0500562_122410 | Ga0500562_122410_424_681 | 83 |
| 1155 | 3300053108 | Ga0500562_225602 | Ga0500562_225602_159_428 | 83 |
| 1156 | 3300053116 | Ga0500592_005468 | Ga0500592_005468_1583_1852 | 83 |
| 1157 | 3300053116 | Ga0500592_012998 | Ga0500592_012998_516_785 | 83 |
| 1158 | 3300053131 | Ga0500652_174553 | Ga0500652_174553_557_814 | 83 |
| 1159 | 3300053134 | Ga0500658_0123970 | Ga0500658_0123970_476_733 | 83 |
| 1160 | 3300053139 | Ga0500568_0013638 | Ga0500568_0013638_526_795 | 83 |
| 1161 | 3300053139 | Ga0500568_0034532 | Ga0500568_0034532_513_770 | 83 |
| 1162 | 3300053153 | Ga0500616_0111302 | Ga0500616_0111302_27_284 | 83 |
| 1163 | 3300053158 | Ga0500627_0000003 | Ga0500627_0000003_80233_80502 | 83 |
| 1164 | 3300053158 | Ga0500627_0121223 | Ga0500627_0121223_590_859 | 83 |
| 1165 | 3300054114 | Ga0501084_1142384 | Ga0501084_1142384_373_642 | 83 |
| 1166 | 3300059421 | Ga0590071_005027 | Ga0590071_005027_1040_1309 | 83 |
| 1167 | 3300059421 | Ga0590071_172255 | Ga0590071_172255_70_336 | 83 |
| 1168 | 3300059423 | Ga0590074_021120 | Ga0590074_021120_112_381 | 83 |
| 1169 | 3300059477 | Ga0587084_031580 | Ga0587084_031580_20_292 | 83 |
| 1170 | 3300059478 | Ga0587093_093274 | Ga0587093_093274_214_483 | 83 |
| 1171 | 3300059493 | Ga0587077_199839 | Ga0587077_199839_21_293 | 83 |
| 1172 | 3300059504 | Ga0587082_057045 | Ga0587082_057045_18_290 | 83 |
| 1173 | 3300059506 | Ga0587085_033063 | Ga0587085_033063_573_845 | 83 |
| 1174 | 3300059510 | Ga0587090_036077 | Ga0587090_036077_561_833 | 83 |
| 1175 | 3300059511 | Ga0587091_018621 | Ga0587091_018621_21_293 | 83 |
| 1176 | 3300059604 | Ga0587098_019198 | Ga0587098_019198_18_290 | 83 |
| 1177 | 3300059608 | Ga0587129_015400 | Ga0587129_015400_324_593 | 83 |
| 1178 | 3300059623 | Ga0587101_109295 | Ga0587101_109295_271_543 | 83 |
| 1179 | 3300059623 | Ga0587101_139287 | Ga0587101_139287_67_336 | 83 |
| 1180 | 3300059624 | Ga0587109_051344 | Ga0587109_051344_558_830 | 83 |
| 1181 | 3300059627 | Ga0587117_042859 | Ga0587117_042859_142_411 | 83 |
| 1182 | 3300059630 | Ga0587128_014085 | Ga0587128_014085_489_758 | 83 |
| 1183 | 3300059639 | Ga0587062_027045 | Ga0587062_027045_568_840 | 83 |
| 1184 | 3300059653 | Ga0587108_011948 | Ga0587108_011948_13_285 | 83 |
| 1185 | 3300060346 | Ga0587111_0049805 | Ga0587111_0049805_213_482 | 83 |
| 1186 | 3300060353 | Ga0501082_0481586 | Ga0501082_0481586_547_816 | 83 |
| 1187 | 3300061719 | Ga0466962_0007169 | Ga0466962_0007169_3598_3855 | 83 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar